BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23582_g4_i8 len=2233 path=[8733:0-998 6319:999-1052
@7576@!:1053-1508 8032:1509-1689 8213:1690-2232]

Length=2233
                                                                      Score     E

ref|XP_009598181.1|  PREDICTED: (6-4)DNA photolyase isoform X1          932   0.0      
ref|XP_009764105.1|  PREDICTED: (6-4)DNA photolyase isoform X2          912   0.0      
ref|XP_009764097.1|  PREDICTED: (6-4)DNA photolyase isoform X1          912   0.0      
ref|XP_009764113.1|  PREDICTED: (6-4)DNA photolyase isoform X3          910   0.0      
ref|XP_006346589.1|  PREDICTED: (6-4)DNA photolyase-like isoform X1     908   0.0      
ref|XP_004252323.1|  PREDICTED: (6-4)DNA photolyase                     908   0.0      
emb|CDO98113.1|  unnamed protein product                                887   0.0      
ref|XP_002285327.2|  PREDICTED: (6-4)DNA photolyase isoform X1          885   0.0      Vitis vinifera
ref|XP_011072252.1|  PREDICTED: (6-4)DNA photolyase                     884   0.0      
emb|CBI36257.3|  unnamed protein product                                882   0.0      
gb|KGN45302.1|  hypothetical protein Csa_7G433310                       881   0.0      
ref|XP_004158807.1|  PREDICTED: (6-4)DNA photolyase-like                881   0.0      
ref|XP_007023941.1|  DNA photolyase family protein isoform 3            880   0.0      
ref|XP_007023940.1|  DNA photolyase family protein isoform 2            880   0.0      
dbj|BAJ53248.1|  JHL25H03.11                                            879   0.0      
ref|XP_008228641.1|  PREDICTED: (6-4)DNA photolyase                     875   0.0      
ref|XP_010088262.1|  (6-4)DNA photolyase                                875   0.0      
ref|XP_002517574.1|  DNA photolyase, putative                           874   0.0      Ricinus communis
ref|XP_006427183.1|  hypothetical protein CICLE_v10025319mg             873   0.0      
ref|XP_006465388.1|  PREDICTED: (6-4)DNA photolyase-like                871   0.0      
ref|XP_002304163.2|  hypothetical protein POPTR_0003s05870g             870   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007215676.1|  hypothetical protein PRUPE_ppa003967mg             870   0.0      
ref|XP_004136080.1|  PREDICTED: (6-4)DNA photolyase-like                869   0.0      
ref|XP_008461072.1|  PREDICTED: (6-4)DNA photolyase isoform X1          868   0.0      
ref|XP_011040009.1|  PREDICTED: (6-4)DNA photolyase isoform X2          868   0.0      
ref|XP_004302937.1|  PREDICTED: (6-4)DNA photolyase-like                867   0.0      
ref|XP_008377613.1|  PREDICTED: (6-4)DNA photolyase                     867   0.0      
ref|XP_011040008.1|  PREDICTED: (6-4)DNA photolyase isoform X1          855   0.0      
ref|XP_006406944.1|  hypothetical protein EUTSA_v10020425mg             855   0.0      
ref|XP_010691197.1|  PREDICTED: (6-4)DNA photolyase isoform X1          855   0.0      
ref|XP_010691198.1|  PREDICTED: (6-4)DNA photolyase isoform X2          851   0.0      
ref|XP_006346590.1|  PREDICTED: (6-4)DNA photolyase-like isoform X2     849   0.0      
ref|XP_007135727.1|  hypothetical protein PHAVU_010G153200g             847   0.0      
ref|NP_566520.1|  (6-4)DNA photolyase                                   846   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299359.1|  hypothetical protein CARUB_v10015516mg             846   0.0      
ref|XP_009115379.1|  PREDICTED: (6-4)DNA photolyase isoform X1          846   0.0      
gb|KFK38908.1|  hypothetical protein AALP_AA3G176500                    845   0.0      
ref|XP_010249985.1|  PREDICTED: (6-4)DNA photolyase                     845   0.0      
ref|XP_010465536.1|  PREDICTED: (6-4)DNA photolyase                     843   0.0      
pdb|3FY4|A  Chain A, (6-4) Photolyase Crystal Structure                 841   0.0      
ref|XP_010487391.1|  PREDICTED: (6-4)DNA photolyase-like                842   0.0      
ref|XP_010503229.1|  PREDICTED: (6-4)DNA photolyase-like isoform X1     842   0.0      
ref|XP_004506890.1|  PREDICTED: (6-4)DNA photolyase-like                840   0.0      
ref|XP_010033920.1|  PREDICTED: (6-4)DNA photolyase                     839   0.0      
ref|XP_010545788.1|  PREDICTED: (6-4)DNA photolyase isoform X1          838   0.0      
gb|KHN47785.1|  (6-4)DNA photolyase                                     835   0.0      
ref|XP_003531700.2|  PREDICTED: (6-4)DNA photolyase-like isoform X1     836   0.0      
gb|KEH28723.1|  UVR3 AtUVR3-like 6-4 DNA photolyase                     833   0.0      
emb|CDY21853.1|  BnaC01g35950D                                          832   0.0      
ref|XP_006585645.1|  PREDICTED: (6-4)DNA photolyase-like isoform X2     829   0.0      
emb|CDY20139.1|  BnaA01g28630D                                          828   0.0      
ref|XP_008461073.1|  PREDICTED: (6-4)DNA photolyase isoform X2          812   0.0      
ref|XP_002885099.1|  6-4 photolyase                                     812   0.0      
ref|XP_007023939.1|  DNA photolyase family protein isoform 1            803   0.0      
gb|EYU21604.1|  hypothetical protein MIMGU_mgv1a019589mg                800   0.0      
ref|XP_009115387.1|  PREDICTED: (6-4)DNA photolyase isoform X2          788   0.0      
ref|XP_010545789.1|  PREDICTED: (6-4)DNA photolyase isoform X2          785   0.0      
gb|KEH28724.1|  UVR3 AtUVR3-like 6-4 DNA photolyase                     768   0.0      
gb|KEH28725.1|  UVR3 AtUVR3-like 6-4 DNA photolyase                     768   0.0      
ref|XP_010914923.1|  PREDICTED: (6-4)DNA photolyase isoform X1          758   0.0      
emb|CAN80978.1|  hypothetical protein VITISV_029095                     761   0.0      Vitis vinifera
ref|XP_008792094.1|  PREDICTED: (6-4)DNA photolyase                     756   0.0      
ref|XP_006841901.1|  hypothetical protein AMTR_s00042p00115230          755   0.0      
dbj|BAJ92104.1|  predicted protein                                      753   0.0      
ref|XP_009415361.1|  PREDICTED: (6-4)DNA photolyase                     752   0.0      
ref|XP_003571518.1|  PREDICTED: (6-4)DNA photolyase                     749   0.0      
ref|XP_004951515.1|  PREDICTED: (6-4)DNA photolyase-like isoform X3     748   0.0      
ref|XP_002451747.1|  hypothetical protein SORBIDRAFT_04g007140          747   0.0      Sorghum bicolor [broomcorn]
ref|XP_004976947.1|  PREDICTED: (6-4)DNA photolyase-like isoform X5     745   0.0      
ref|XP_006385491.1|  hypothetical protein POPTR_0003s05870g             743   0.0      
ref|XP_004951514.1|  PREDICTED: (6-4)DNA photolyase-like isoform X2     740   0.0      
ref|XP_004976946.1|  PREDICTED: (6-4)DNA photolyase-like isoform X4     736   0.0      
ref|XP_009598183.1|  PREDICTED: (6-4)DNA photolyase isoform X2          731   0.0      
ref|XP_008643513.1|  PREDICTED: uncharacterized protein LOC100280...    731   0.0      
gb|EEE56527.1|  hypothetical protein OsJ_05816                          731   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004951513.1|  PREDICTED: (6-4)DNA photolyase-like isoform X1     729   0.0      
ref|XP_004976944.1|  PREDICTED: (6-4)DNA photolyase-like isoform X2     728   0.0      
ref|XP_004976945.1|  PREDICTED: (6-4)DNA photolyase-like isoform X3     726   0.0      
ref|NP_001046243.2|  Os02g0204400                                       725   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC72708.1|  hypothetical protein OsI_06300                          724   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010914927.1|  PREDICTED: (6-4)DNA photolyase isoform X5          719   0.0      
ref|XP_010503237.1|  PREDICTED: (6-4)DNA photolyase-like isoform X2     719   0.0      
dbj|BAD16007.1|  putative 6-4 photolyase (UVR3)                         717   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010914924.1|  PREDICTED: (6-4)DNA photolyase isoform X2          712   0.0      
ref|XP_004976943.1|  PREDICTED: (6-4)DNA photolyase-like isoform X1     711   0.0      
ref|XP_010654743.1|  PREDICTED: (6-4)DNA photolyase isoform X2          702   0.0      
ref|XP_010914925.1|  PREDICTED: (6-4)DNA photolyase isoform X3          691   0.0      
gb|EPS64244.1|  hypothetical protein M569_10537                         686   0.0      
ref|XP_001754074.1|  UVR3 AtUVR3-like 6-4 DNA photolyase protein        682   0.0      
ref|XP_006385492.1|  hypothetical protein POPTR_0003s05870g             673   0.0      
ref|NP_001030703.1|  (6-4)DNA photolyase                                672   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO52905.1|  hypothetical protein CISIN_1g014577mg                   671   0.0      
ref|XP_006647054.1|  PREDICTED: LOW QUALITY PROTEIN: (6-4)DNA pho...    672   0.0      
ref|XP_002979633.1|  hypothetical protein SELMODRAFT_233387             669   0.0      
ref|XP_010914926.1|  PREDICTED: (6-4)DNA photolyase isoform X4          648   0.0      
ref|XP_010545790.1|  PREDICTED: (6-4)DNA photolyase isoform X3          648   0.0      
gb|ABR16130.1|  unknown                                                 579   0.0      Picea sitchensis
gb|KHG04636.1|  (6-4)DNA photolyase -like protein                       573   0.0      
ref|XP_005646798.1|  UVR3 AtUVR3-like 6-4 DNA photolyase protein        571   0.0      
ref|XP_002977641.1|  hypothetical protein SELMODRAFT_417535             566   0.0      
gb|AAX56342.1|  6-4 photolyase                                          571   0.0      Dunaliella salina
ref|XP_001698054.1|  cryptochrome photoreceptor                         570   0.0      Chlamydomonas reinhardtii
ref|XP_002945926.1|  DNA photolyase                                     551   0.0      
ref|XP_005843478.1|  hypothetical protein CHLNCDRAFT_7260               543   0.0      
ref|WP_023172734.1|  deoxyribodipyrimidine photo-lyase                  543   0.0      
ref|XP_002508785.1|  predicted protein                                  539   4e-180   Micromonas commoda
gb|AAU14280.1|  cryptochrome-like protein 1                             535   1e-178   Ostreococcus tauri
ref|XP_003061228.1|  predicted protein                                  530   8e-177   
gb|EKC39908.1|  Cryptochrome-1                                          523   1e-174   
ref|XP_007244778.1|  PREDICTED: cryptochrome-1-like isoform X1          523   2e-174   
ref|WP_011141747.1|  photolyase                                         520   8e-174   
ref|XP_004995002.1|  DNA photolyase                                     517   4e-172   
ref|XP_002595074.1|  hypothetical protein BRAFLDRAFT_60127              513   7e-171   Branchiostoma floridae
gb|AAH44204.1|  Cry5 protein                                            513   2e-170   Danio rerio [leopard danio]
ref|XP_009045182.1|  hypothetical protein LOTGIDRAFT_180057             511   7e-170   
ref|XP_003079123.1|  cryptochrome-like protein 1 (ISS)                  542   1e-169   
ref|NP_571863.1|  cryptochrome 5                                        509   3e-169   Danio rerio [leopard danio]
ref|XP_001417651.1|  predicted protein                                  511   3e-169   Ostreococcus lucimarinus CCE9901
ref|XP_005091065.1|  PREDICTED: cryptochrome-1-like                     509   5e-169   
ref|XP_005155462.1|  PREDICTED: cryptochrome 5 isoform X1               508   8e-169   
ref|XP_004067451.1|  PREDICTED: cryptochrome-1-like                     508   8e-169   
ref|XP_001747506.1|  hypothetical protein                               507   9e-169   Monosiga brevicollis MX1
ref|XP_008276779.1|  PREDICTED: cryptochrome-1-like                     505   1e-167   
ref|XP_004539639.1|  PREDICTED: cryptochrome-1-like                     505   2e-167   
ref|XP_005934599.1|  PREDICTED: cryptochrome-1-like isoform X1          504   2e-167   
ref|XP_003437646.1|  PREDICTED: cryptochrome-1-like                     504   2e-167   
ref|XP_001636303.1|  predicted protein                                  505   3e-167   Nematostella vectensis
ref|NP_001017311.2|  cryptochrome 1 (photolyase-like)                   508   3e-167   Xenopus tropicalis [western clawed frog]
pdb|4CT0|A  Chain A, Crystal Structure Of Mouse Cryptochrome1 In ...    503   4e-167   
ref|XP_006779921.1|  PREDICTED: cryptochrome-1-like isoform X1          504   4e-167   
gb|EDM17107.1|  cryptochrome 1 (photolyase-like)                        505   4e-167   
dbj|BAI82611.1|  cryptochrome 1                                         507   5e-167   Xenopus tropicalis [western clawed frog]
ref|XP_005039907.1|  PREDICTED: cryptochrome-1-like isoform X4          506   5e-167   
gb|AAK94665.1|  cryptochrome 1                                          507   6e-167   Xenopus laevis [clawed frog]
ref|NP_001081129.1|  cryptochrome circadian clock 1                     507   6e-167   Xenopus laevis [clawed frog]
ref|XP_007614122.1|  PREDICTED: cryptochrome-1                          506   6e-167   
ref|XP_005989314.1|  PREDICTED: cryptochrome-1                          508   8e-167   
gb|ABH03083.1|  cryptochrome 1b                                         505   9e-167   Sylvia borin
ref|XP_005039906.1|  PREDICTED: cryptochrome-1-like isoform X3          505   9e-167   
ref|XP_005733435.1|  PREDICTED: cryptochrome-1-like                     503   1e-166   
ref|XP_005150476.1|  PREDICTED: cryptochrome-1-like                     506   1e-166   
sp|Q6ZZY0.1|CRY1_SYLBO  RecName: Full=Cryptochrome-1                    506   1e-166   Sylvia borin
ref|XP_005358310.1|  PREDICTED: cryptochrome-1                          505   1e-166   
ref|NP_989576.1|  cryptochrome-1                                        506   1e-166   Gallus gallus [bantam]
ref|XP_005491227.1|  PREDICTED: cryptochrome-1-like                     506   1e-166   
ref|XP_006987024.1|  PREDICTED: cryptochrome-1                          505   1e-166   
ref|XP_005527592.1|  PREDICTED: cryptochrome-1-like                     506   1e-166   
ref|NP_942045.2|  cryptochrome-1                                        505   2e-166   Rattus norvegicus [brown rat]
ref|XP_009555905.1|  PREDICTED: cryptochrome-1                          506   2e-166   
ref|XP_005039904.1|  PREDICTED: cryptochrome-1-like isoform X1          506   2e-166   
ref|XP_005861714.1|  PREDICTED: cryptochrome-1-like isoform X2          504   2e-166   
ref|XP_006769397.1|  PREDICTED: cryptochrome-1 isoform X5               504   2e-166   
ref|XP_005237400.1|  PREDICTED: cryptochrome-1-like                     506   2e-166   
ref|XP_006769393.1|  PREDICTED: cryptochrome-1 isoform X1               504   2e-166   
ref|XP_005861717.1|  PREDICTED: cryptochrome-1-like isoform X5          504   2e-166   
ref|XP_007432429.1|  PREDICTED: cryptochrome-1-like isoform X1          506   2e-166   
ref|XP_007432431.1|  PREDICTED: cryptochrome-1-like isoform X3          506   2e-166   
ref|XP_003405361.1|  PREDICTED: cryptochrome-1                          504   2e-166   
sp|Q8WP19.1|CRY1_MACFA  RecName: Full=Cryptochrome-1                    504   3e-166   Macaca fascicularis [crab eating macaque]
gb|AAQ11980.1|  cryptochrome 1                                          504   3e-166   Rattus norvegicus [brown rat]
pdb|4K0R|A  Chain A, Crystal Structure Of Mouse Cryptochrome 1          505   3e-166   
ref|XP_007101410.1|  PREDICTED: cryptochrome-1                          502   4e-166   
ref|XP_007885950.1|  PREDICTED: cryptochrome-2                          503   4e-166   
ref|XP_002823736.1|  PREDICTED: cryptochrome-1                          504   4e-166   
ref|NP_031797.1|  cryptochrome-1                                        504   5e-166   Mus musculus [mouse]
gb|AHW46848.1|  cryptochrome-1                                          504   5e-166   
ref|XP_007066204.1|  PREDICTED: cryptochrome-1-like isoform X2          503   6e-166   
ref|XP_006092785.1|  PREDICTED: cryptochrome-1                          503   6e-166   
ref|XP_007066205.1|  PREDICTED: cryptochrome-1-like isoform X3          503   6e-166   
ref|XP_008108808.1|  PREDICTED: cryptochrome-1 isoform X2               504   6e-166   
ref|XP_007946421.1|  PREDICTED: cryptochrome-1                          503   6e-166   
ref|XP_005655590.1|  PREDICTED: cryptochrome-1 isoform X3               502   6e-166   
ref|XP_004053891.1|  PREDICTED: cryptochrome-1                          503   6e-166   
ref|XP_008703869.1|  PREDICTED: cryptochrome-1 isoform X2               502   7e-166   
ref|XP_010379691.1|  PREDICTED: cryptochrome-1                          503   7e-166   
ref|XP_002752992.1|  PREDICTED: cryptochrome-1                          503   7e-166   Callithrix jacchus [common marmoset]
ref|XP_005322380.1|  PREDICTED: cryptochrome-1                          503   7e-166   
ref|XP_010755355.1|  PREDICTED: cryptochrome-1-like isoform X1          501   7e-166   
ref|XP_005300861.1|  PREDICTED: cryptochrome-1                          504   7e-166   
ref|XP_006024339.1|  PREDICTED: cryptochrome-1-like isoform X1          504   8e-166   
ref|XP_004675775.1|  PREDICTED: cryptochrome-1                          503   8e-166   
ref|NP_001181088.1|  cryptochrome-1                                     503   8e-166   
ref|XP_006865309.1|  PREDICTED: cryptochrome-1 isoform X1               503   8e-166   
ref|XP_006865310.1|  PREDICTED: cryptochrome-1 isoform X2               503   8e-166   
ref|XP_006271722.1|  PREDICTED: cryptochrome-1-like isoform X1          504   9e-166   
ref|XP_004269459.1|  PREDICTED: cryptochrome-1                          503   9e-166   
ref|XP_007165787.1|  PREDICTED: cryptochrome-1 isoform X1               503   9e-166   
ref|XP_007165788.1|  PREDICTED: cryptochrome-1 isoform X2               502   9e-166   
ref|XP_008002745.1|  PREDICTED: cryptochrome-1                          503   1e-165   
ref|XP_006205926.1|  PREDICTED: cryptochrome-1 isoform X1               503   1e-165   
ref|XP_007066203.1|  PREDICTED: cryptochrome-1-like isoform X1          504   1e-165   
ref|XP_004650303.1|  PREDICTED: cryptochrome-1                          503   1e-165   
ref|XP_006069628.1|  PREDICTED: cryptochrome-1 isoform X1               503   1e-165   
ref|XP_004743134.1|  PREDICTED: cryptochrome-1                          503   1e-165   
ref|XP_005958591.1|  PREDICTED: cryptochrome-1                          503   1e-165   
ref|XP_003929699.1|  PREDICTED: cryptochrome-1                          503   1e-165   
ref|XP_008841338.1|  PREDICTED: cryptochrome-1                          503   1e-165   
ref|XP_010788556.1|  PREDICTED: cryptochrome-1-like                     500   1e-165   
ref|XP_862753.1|  PREDICTED: mTERF domain-containing protein 3, m...    503   1e-165   Canis lupus familiaris [dogs]
ref|XP_003126127.1|  PREDICTED: cryptochrome-1 isoform X1               503   1e-165   
ref|NP_001123207.1|  cryptochrome-1                                     502   1e-165   Ovis aries [domestic sheep]
ref|NP_001098885.1|  cryptochrome-1                                     502   1e-165   Bos taurus [bovine]
ref|XP_008542303.1|  PREDICTED: cryptochrome-1 isoform X2               500   1e-165   
tpg|DAA29534.1|  TPA: cryptochrome 1 (photolyase-like)                  501   1e-165   
ref|XP_004418125.1|  PREDICTED: cryptochrome-1                          502   2e-165   
ref|XP_003989258.1|  PREDICTED: cryptochrome-1                          502   2e-165   
ref|XP_509339.2|  PREDICTED: cryptochrome-1 isoform X1                  502   2e-165   Pan troglodytes
ref|XP_004473360.1|  PREDICTED: cryptochrome-1                          502   2e-165   
gb|AHA91700.1|  cryptochrome 1a                                         503   2e-165   
ref|NP_004066.1|  cryptochrome-1                                        502   2e-165   Homo sapiens [man]
ref|XP_006731113.1|  PREDICTED: cryptochrome-1                          502   2e-165   
ref|XP_008703868.1|  PREDICTED: cryptochrome-1 isoform X1               502   2e-165   
ref|XP_002927704.1|  PREDICTED: cryptochrome-1-like                     502   2e-165   
ref|XP_003220970.1|  PREDICTED: cryptochrome-1 isoform X1               503   2e-165   
ref|XP_002711467.1|  PREDICTED: cryptochrome-1                          502   2e-165   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004589630.1|  PREDICTED: cryptochrome-1                          502   2e-165   
ref|XP_010851672.1|  PREDICTED: cryptochrome-1                          502   2e-165   
ref|XP_005801946.1|  PREDICTED: cryptochrome-1-like                     504   3e-165   
ref|XP_006175506.1|  PREDICTED: cryptochrome-1 isoform X1               501   3e-165   
ref|XP_010968776.1|  PREDICTED: cryptochrome-1 isoform X1               501   3e-165   
ref|XP_008313617.1|  PREDICTED: cryptochrome-1-like                     503   3e-165   
ref|XP_006170414.1|  PREDICTED: cryptochrome-1 isoform X1               501   3e-165   
ref|XP_007462929.1|  PREDICTED: cryptochrome-1                          501   3e-165   
gb|ADL62679.1|  cryptochrome 1a                                         503   4e-165   
ref|XP_007566915.1|  PREDICTED: cryptochrome-1-like isoform X1          504   4e-165   
gb|AHF70975.1|  cryptochrome 1a                                         503   4e-165   
ref|XP_004567670.1|  PREDICTED: cryptochrome-1-like isoform X4          502   4e-165   
ref|XP_006175507.1|  PREDICTED: cryptochrome-1 isoform X2               501   4e-165   
ref|XP_005606624.1|  PREDICTED: cryptochrome-1 isoform X2               500   4e-165   
ref|XP_003783322.1|  PREDICTED: cryptochrome-1                          501   4e-165   
ref|XP_001499263.1|  PREDICTED: cryptochrome-1 isoform X1               501   4e-165   Equus caballus [domestic horse]
ref|XP_010968777.1|  PREDICTED: cryptochrome-1 isoform X2               499   4e-165   
ref|XP_008542302.1|  PREDICTED: cryptochrome-1 isoform X1               499   5e-165   
ref|XP_004700384.1|  PREDICTED: cryptochrome-1                          501   5e-165   
ref|NP_571861.2|  cryptochrome-2                                        501   5e-165   Danio rerio [leopard danio]
ref|XP_004623988.1|  PREDICTED: cryptochrome-1                          501   5e-165   
ref|XP_005750863.1|  PREDICTED: cryptochrome-1-like                     503   5e-165   
ref|XP_004844852.1|  PREDICTED: cryptochrome-1 isoform X2               501   6e-165   
dbj|BAA96850.1|  cryptochrome3                                          501   6e-165   Danio rerio [leopard danio]
ref|XP_004567668.1|  PREDICTED: cryptochrome-1-like isoform X2          503   7e-165   
ref|XP_004373851.1|  PREDICTED: cryptochrome-1                          501   7e-165   
ref|XP_006633149.1|  PREDICTED: cryptochrome-1-like isoform X3          501   7e-165   
ref|XP_005374693.1|  PREDICTED: cryptochrome-1                          500   8e-165   
ref|XP_008142937.1|  PREDICTED: cryptochrome-1                          500   1e-164   
ref|XP_004844851.1|  PREDICTED: cryptochrome-1 isoform X1               501   1e-164   
ref|XP_004567667.1|  PREDICTED: cryptochrome-1-like isoform X1          503   1e-164   
ref|XP_010780397.1|  PREDICTED: cryptochrome-1-like                     503   1e-164   
ref|XP_008317159.1|  PREDICTED: cryptochrome-1-like                     502   1e-164   
ref|XP_006633148.1|  PREDICTED: cryptochrome-1-like isoform X2          501   1e-164   
ref|XP_006633147.1|  PREDICTED: cryptochrome-1-like isoform X1          501   1e-164   
ref|XP_003462370.2|  PREDICTED: cryptochrome-1                          500   2e-164   
sp|Q5IZC5.2|CRY1_ERIRU  RecName: Full=Cryptochrome-1                    501   2e-164   Erithacus rubecula [robin]
gb|AAW48291.1|  cryptochrome-1b                                         499   2e-164   Erithacus rubecula [robin]
ref|XP_006807480.1|  PREDICTED: cryptochrome-1-like                     501   2e-164   
ref|XP_006628576.1|  PREDICTED: cryptochrome-1-like                     501   3e-164   
ref|NP_001278191.1|  cryptochrome-1-like                                500   4e-164   
ref|XP_004083252.1|  PREDICTED: cryptochrome-1-like                     499   5e-164   
dbj|BAA96846.1|  cryptochrome 1a                                        497   5e-164   Danio rerio [leopard danio]
gb|AII78495.1|  cryptochrome 1-like 3                                   496   5e-164   
ref|XP_005477802.1|  PREDICTED: cryptochrome-1-like                     501   6e-164   
ref|XP_008281376.1|  PREDICTED: cryptochrome-1-like                     501   6e-164   
ref|XP_005852637.1|  cryptochrome                                       497   7e-164   
ref|XP_008398691.1|  PREDICTED: cryptochrome-1-like                     499   7e-164   
ref|XP_007555375.1|  PREDICTED: cryptochrome-1-like                     499   7e-164   
ref|XP_007436637.1|  PREDICTED: cryptochrome-2 isoform X2               497   7e-164   
gb|EWM23893.1|  6-4 photolyase                                          498   8e-164   
sp|Q70AD6.1|CRY1_SPAJD  RecName: Full=Cryptochrome-1                    498   9e-164   Nannospalax judaei
ref|XP_002064736.1|  GK15094                                            496   9e-164   Drosophila willistoni
gb|AII78246.1|  cryptochrome 1                                          499   1e-163   
ref|XP_005800018.1|  PREDICTED: cryptochrome-1-like                     499   1e-163   
ref|XP_004905908.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1     498   1e-163   
ref|XP_004086356.1|  PREDICTED: cryptochrome-1-like                     500   1e-163   
ref|NP_001070765.2|  cryptochrome 1a                                    499   1e-163   Danio rerio [leopard danio]
gb|AAI24763.1|  Cryptochrome 1a                                         498   1e-163   Danio rerio [leopard danio]
ref|XP_001974136.1|  GG21562                                            496   1e-163   Drosophila erecta
gb|AHF70976.1|  cryptochrome 1b                                         497   2e-163   
ref|XP_001962202.1|  GF14557                                            495   2e-163   Drosophila ananassae
gb|AGV28718.1|  6-4 photolyase                                          494   2e-163   
ref|XP_002080051.1|  GD21692                                            495   2e-163   Drosophila simulans
dbj|BAL72539.1|  cryptochrome3                                          494   2e-163   
ref|XP_788938.2|  PREDICTED: cryptochrome-2-like                        494   2e-163   
ref|XP_006780939.1|  PREDICTED: cryptochrome-1-like isoform X2          497   3e-163   
ref|XP_005747322.1|  PREDICTED: cryptochrome-1-like isoform X2          497   3e-163   
emb|CDQ73814.1|  unnamed protein product                                496   3e-163   
ref|XP_004627070.1|  PREDICTED: cryptochrome-2                          496   3e-163   
ref|XP_010748281.1|  PREDICTED: cryptochrome-1-like                     498   4e-163   
ref|NP_571866.1|  cryptochrome-1                                        498   4e-163   
ref|NP_001120012.1|  uncharacterized protein LOC100144974               494   4e-163   
ref|XP_008643515.1|  PREDICTED: uncharacterized protein LOC100280...    488   4e-163   
ref|XP_002090823.1|  GE12583                                            494   5e-163   
ref|XP_004548499.1|  PREDICTED: cryptochrome-1-like isoform X2          496   5e-163   
ref|XP_003214689.1|  PREDICTED: cryptochrome-2                          496   6e-163   
ref|XP_008403715.1|  PREDICTED: cryptochrome-1-like isoform X2          494   6e-163   
ref|XP_004879669.1|  PREDICTED: cryptochrome-2                          496   6e-163   
ref|XP_006780938.1|  PREDICTED: cryptochrome-1-like isoform X1          497   6e-163   
ref|XP_005166950.1|  PREDICTED: cryptochrome-1 isoform X2               498   6e-163   
ref|XP_005166949.1|  PREDICTED: cryptochrome-1 isoform X1               498   6e-163   
ref|XP_005747321.1|  PREDICTED: cryptochrome-1-like isoform X1          497   6e-163   
ref|XP_007436636.1|  PREDICTED: cryptochrome-2 isoform X1               496   7e-163   
ref|XP_008403713.1|  PREDICTED: cryptochrome-1-like isoform X1          494   8e-163   
ref|XP_008643514.1|  PREDICTED: uncharacterized protein LOC100280...    488   8e-163   
ref|XP_008403716.1|  PREDICTED: cryptochrome-1-like isoform X3          493   8e-163   
gb|AFP33463.1|  cryptochrome 2                                          498   9e-163   
ref|XP_005456675.1|  PREDICTED: cryptochrome-1-like                     497   9e-163   
ref|XP_004548498.1|  PREDICTED: cryptochrome-1-like isoform X1          496   9e-163   
ref|XP_002042448.1|  GM23319                                            493   1e-162   
ref|XP_008279107.1|  PREDICTED: cryptochrome-1-like                     496   1e-162   
ref|XP_007569299.1|  PREDICTED: cryptochrome-1-like                     493   1e-162   
ref|XP_007561417.1|  PREDICTED: cryptochrome-1-like isoform X1          496   2e-162   
dbj|BAD32272.1|  mKIAA0658 protein                                      494   2e-162   
ref|XP_001356872.1|  GA15376                                            493   2e-162   
ref|XP_008544824.1|  PREDICTED: cryptochrome-1 isoform X1               495   2e-162   
gb|AFW70619.1|  hypothetical protein ZEAMMB73_082662                    487   2e-162   
gb|AAI66277.1|  LOC100144974 protein                                    492   2e-162   
ref|XP_003447120.1|  PREDICTED: cryptochrome-1-like isoform X1          494   2e-162   
ref|XP_010779097.1|  PREDICTED: cryptochrome-1                          493   2e-162   
ref|XP_005471126.1|  PREDICTED: cryptochrome-1-like isoform X2          493   2e-162   
ref|XP_008289212.1|  PREDICTED: cryptochrome-1-like                     493   3e-162   
ref|XP_007893621.1|  PREDICTED: cryptochrome-1                          495   3e-162   
ref|XP_003449297.1|  PREDICTED: cryptochrome-2-like isoform X1          497   3e-162   
ref|XP_003465189.1|  PREDICTED: cryptochrome-2                          494   3e-162   
ref|XP_010881675.1|  PREDICTED: cryptochrome-1 isoform X1               493   3e-162   
ref|XP_005384123.1|  PREDICTED: cryptochrome-2                          494   4e-162   
ref|XP_006042503.1|  PREDICTED: cryptochrome-2                          495   4e-162   
ref|NP_477188.1|  (6-4)-photolyase, isoform B                           492   4e-162   
pdb|3CVU|A  Chain A, Drosophila Melanogaster (6-4) Photolyase Bou...    492   5e-162   
gb|AAL90322.1|  RE11660p                                                491   5e-162   
ref|NP_001123208.1|  cryptochrome-2                                     493   6e-162   
ref|XP_007608052.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome...    493   7e-162   
ref|NP_001146620.1|  uncharacterized protein LOC100280217               486   9e-162   
ref|XP_004399632.1|  PREDICTED: cryptochrome-2                          493   1e-161   
pdb|4I6E|A  Chain A, A Vertebrate Cryptochrome                          489   1e-161   
pdb|4I6J|A  Chain A, A Ubiquitin Ligase-substrate Complex               491   1e-161   
ref|XP_005870921.1|  PREDICTED: cryptochrome-2                          493   1e-161   
ref|XP_006275665.1|  PREDICTED: cryptochrome-1-like                     490   1e-161   
ref|XP_004570851.1|  PREDICTED: cryptochrome-1-like isoform X1          491   1e-161   
ref|XP_003781307.1|  PREDICTED: cryptochrome-2                          493   1e-161   
ref|XP_005930358.1|  PREDICTED: cryptochrome-1-like isoform X1          491   2e-161   
ref|XP_006865104.1|  PREDICTED: cryptochrome-2                          492   2e-161   
gb|EMT24900.1|  Cryptochrome-1                                          489   2e-161   
ref|XP_540761.2|  PREDICTED: cryptochrome-2 isoform X2                  492   2e-161   
dbj|BAI82612.1|  cryptochrome 2                                         491   2e-161   
ref|NP_034093.1|  cryptochrome-2                                        492   2e-161   
ref|XP_005815705.1|  PREDICTED: cryptochrome-1-like                     491   2e-161   
ref|XP_002922356.1|  PREDICTED: cryptochrome-2-like                     491   2e-161   
ref|XP_005796259.1|  PREDICTED: cryptochrome-1-like                     489   2e-161   
ref|XP_010895469.1|  PREDICTED: cryptochrome-1-like                     494   2e-161   
gb|EFB24357.1|  hypothetical protein PANDA_011308                       491   3e-161   
ref|XP_010731762.1|  PREDICTED: cryptochrome-2-like                     496   3e-161   
ref|XP_008544827.1|  PREDICTED: cryptochrome-1 isoform X2               491   3e-161   
ref|XP_007561418.1|  PREDICTED: cryptochrome-1-like isoform X2          490   3e-161   
ref|XP_007455859.1|  PREDICTED: cryptochrome-2                          491   3e-161   
ref|XP_005064953.1|  PREDICTED: cryptochrome-2                          491   3e-161   
ref|XP_008832371.1|  PREDICTED: cryptochrome-2                          491   4e-161   
ref|XP_007181185.1|  PREDICTED: cryptochrome-2 isoform X2               491   4e-161   
ref|XP_010881867.1|  PREDICTED: cryptochrome-2-like isoform X1          491   4e-161   
gb|EFX85418.1|  DNA photolyase 1                                        489   4e-161   
ref|XP_006795810.1|  PREDICTED: cryptochrome-1-like                     490   4e-161   
ref|XP_008409847.1|  PREDICTED: cryptochrome-1-like isoform X1          492   4e-161   
ref|XP_004311885.1|  PREDICTED: cryptochrome-2 isoform 1                491   4e-161   
ref|XP_005047216.1|  PREDICTED: cryptochrome-2                          491   4e-161   
ref|XP_006896803.1|  PREDICTED: cryptochrome-2                          491   4e-161   
ref|XP_007632599.1|  PREDICTED: cryptochrome-2 isoform X2               490   4e-161   
gb|ERE69633.1|  cryptochrome-1-like protein                             491   5e-161   
pdb|3CVW|A  Chain A, Drosophila Melanogaster (6-4) Photolyase H36...    489   5e-161   
ref|NP_596896.2|  cryptochrome-2                                        491   5e-161   
ref|XP_004790486.1|  PREDICTED: cryptochrome-2 isoform X1               491   5e-161   
ref|XP_006021416.1|  PREDICTED: cryptochrome-1-like                     488   6e-161   
gb|ABD36589.1|  cryptochrome 1                                          491   6e-161   
ref|XP_006274133.1|  PREDICTED: cryptochrome-2                          491   6e-161   
ref|XP_003993331.2|  PREDICTED: cryptochrome-2                          490   6e-161   
ref|XP_007125038.1|  PREDICTED: cryptochrome-2                          490   8e-161   
ref|XP_006995217.1|  PREDICTED: cryptochrome-2                          490   9e-161   
ref|NP_989575.1|  cryptochrome-2                                        490   9e-161   
ref|XP_003412157.1|  PREDICTED: cryptochrome-2                          490   9e-161   
dbj|BAA12067.1|  photolyase                                             488   9e-161   
ref|XP_003505340.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1     490   9e-161   
pdb|3CVX|A  Chain A, Drosophila Melanogaster (6-4) Photolyase H36...    488   1e-160   
ref|XP_005522527.1|  PREDICTED: cryptochrome-2                          489   1e-160   
ref|XP_003707085.1|  PREDICTED: cryptochrome-1-like                     490   1e-160   
emb|CDQ68035.1|  unnamed protein product                                488   1e-160   
ref|XP_008544828.1|  PREDICTED: cryptochrome-1 isoform X3               488   1e-160   
ref|XP_008268424.1|  PREDICTED: cryptochrome-2                          490   1e-160   
ref|XP_004264088.1|  PREDICTED: cryptochrome-2 isoform 1                490   1e-160   
ref|XP_001113162.1|  PREDICTED: cryptochrome-2-like                     489   1e-160   
gb|AGJ94015.1|  cryptochrome-2                                          488   2e-160   
ref|XP_008409848.1|  PREDICTED: cryptochrome-1-like isoform X2          489   2e-160   
dbj|BAA96847.1|  cryptochrome 1b                                        490   2e-160   
ref|NP_571865.4|  cryptochrome-1                                        490   2e-160   
ref|XP_004531295.1|  PREDICTED: cryptochrome-1-like                     487   2e-160   
ref|XP_006092078.1|  PREDICTED: cryptochrome-2                          489   2e-160   
ref|XP_006908215.1|  PREDICTED: cryptochrome-2                          489   2e-160   
emb|CAK05311.1|  cryptochrome 1b                                        490   2e-160   
ref|XP_010369348.1|  PREDICTED: cryptochrome-2                          489   2e-160   
ref|NP_001082139.1|  cryptochrome 2a                                    488   2e-160   
ref|XP_001987903.1|  GH10854                                            487   3e-160   
sp|Q923I8.1|CRY2_RAT  RecName: Full=Cryptochrome-2                      489   3e-160   
ref|XP_007998737.1|  PREDICTED: cryptochrome-2                          489   3e-160   
ref|XP_004708484.1|  PREDICTED: cryptochrome-2                          489   3e-160   
sp|Q8QG60.2|CRY2_CHICK  RecName: Full=Cryptochrome-2                    488   3e-160   
ref|XP_010113633.1|  PREDICTED: cryptochrome-2                          488   4e-160   
gb|ETN57794.1|  DNA photolyase                                          487   4e-160   
ref|XP_008144996.1|  PREDICTED: cryptochrome-2                          488   4e-160   
ref|XP_002755255.1|  PREDICTED: cryptochrome-2                          488   4e-160   
ref|XP_010578512.1|  PREDICTED: cryptochrome-2                          488   5e-160   
ref|XP_314748.3|  AGAP008651-PA                                         487   5e-160   
ref|XP_009568372.1|  PREDICTED: cryptochrome-2                          488   5e-160   
dbj|BAA19864.1|  photolyase/blue-light receptor homolog2                487   5e-160   
ref|XP_006643183.1|  PREDICTED: cryptochrome-2-like                     487   6e-160   
ref|XP_010332071.1|  PREDICTED: cryptochrome-2                          488   6e-160   
gb|AAK94667.1|  cryptochrome 2b                                         487   6e-160   
ref|XP_005330087.1|  PREDICTED: cryptochrome-2                          488   7e-160   
ref|XP_004387710.1|  PREDICTED: cryptochrome-2                          488   8e-160   
ref|XP_006914574.1|  PREDICTED: cryptochrome-1                          488   8e-160   
ref|XP_010749380.1|  PREDICTED: cryptochrome-1-like                     487   8e-160   
ref|XP_004051044.1|  PREDICTED: cryptochrome-2 isoform 1                488   8e-160   
ref|XP_001160595.2|  PREDICTED: cryptochrome-2                          488   8e-160   
gb|AII78499.1|  cryptochrome 1-like 1                                   490   9e-160   
gb|ACN10565.1|  Cryptochrome-1                                          485   9e-160   
dbj|BAA31633.1|  KIAA0658 protein                                       488   9e-160   
ref|XP_007519157.1|  PREDICTED: cryptochrome-2                          488   9e-160   
sp|Q49AN0.2|CRY2_HUMAN  RecName: Full=Cryptochrome-2                    488   1e-159   
emb|CDQ57056.1|  unnamed protein product                                485   1e-159   
ref|XP_007944720.1|  PREDICTED: cryptochrome-2                          488   1e-159   
ref|XP_002821877.1|  PREDICTED: cryptochrome-2                          488   1e-159   
ref|XP_004437042.1|  PREDICTED: cryptochrome-2                          488   1e-159   
ref|NP_001083936.1|  cryptochrome circadian clock 2                     486   1e-159   
dbj|BAF83949.1|  unnamed protein product                                487   1e-159   
gb|AII78496.1|  cryptochrome 1-like 4                                   486   1e-159   
ref|XP_009472060.1|  PREDICTED: cryptochrome-2                          486   1e-159   
gb|AGX93012.1|  tr-cry                                                  487   2e-159   
ref|XP_004682938.1|  PREDICTED: cryptochrome-2                          487   2e-159   
ref|NP_066940.2|  cryptochrome-2 isoform 1                              488   2e-159   
ref|XP_008568740.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome-2     488   2e-159   
ref|XP_005364188.1|  PREDICTED: cryptochrome-2 isoform X1               487   2e-159   
gb|AGX93008.1|  tr-cry op                                               486   2e-159   
ref|XP_005302290.1|  PREDICTED: cryptochrome-2                          486   2e-159   
ref|XP_004069915.1|  PREDICTED: cryptochrome-1-like                     486   2e-159   
ref|XP_004585434.1|  PREDICTED: cryptochrome-2                          486   2e-159   
ref|XP_010868606.1|  PREDICTED: cryptochrome-1-like isoform X1          484   2e-159   
gb|AFP33464.1|  cryptochrome 1                                          485   3e-159   
ref|XP_004657243.1|  PREDICTED: cryptochrome-2                          486   4e-159   
ref|XP_008309446.1|  PREDICTED: cryptochrome-2-like                     489   4e-159   
gb|KFB40969.1|  AGAP008651-PA-like protein                              484   5e-159   
gb|ETE65617.1|  Cryptochrome-1                                          485   7e-159   
ref|XP_005706285.1|  deoxyribodipyrimidine photo-lyase                  484   7e-159   
gb|AAP13561.1|  cryptochrome 2                                          483   8e-159   
ref|XP_003122883.1|  PREDICTED: cryptochrome-2 isoform 1                485   9e-159   
ref|XP_007497436.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome-2     486   1e-158   
ref|XP_003398531.1|  PREDICTED: cryptochrome-1-like                     484   1e-158   
ref|XP_008169296.1|  PREDICTED: cryptochrome-1-like                     483   1e-158   
ref|XP_004070204.1|  PREDICTED: cryptochrome-2-like                     487   1e-158   
ref|XP_005182773.1|  PREDICTED: cryptochrome-1-like                     483   1e-158   
ref|NP_001267051.1|  cryptochrome 2                                     484   2e-158   
emb|CAE54427.1|  sCRY2L protein                                         484   2e-158   
gb|EKC20054.1|  Cleavage stimulation factor 77 kDa subunit              503   4e-158   
ref|XP_005951247.1|  PREDICTED: cryptochrome-2-like isoform X2          483   4e-158   
emb|CAE54426.1|  sCRY2S protein                                         483   5e-158   
ref|XP_005987747.1|  PREDICTED: cryptochrome-1-like                     484   5e-158   
emb|CAG04151.1|  unnamed protein product                                484   6e-158   
ref|XP_005747941.1|  PREDICTED: cryptochrome-2-like isoform X2          483   6e-158   
ref|XP_004556263.1|  PREDICTED: cryptochrome-2-like isoform X3          482   9e-158   
ref|NP_001081421.1|  6-4 photolyase                                     480   1e-157   
ref|XP_005507667.1|  PREDICTED: cryptochrome-1-like                     483   1e-157   
ref|XP_010894199.1|  PREDICTED: cryptochrome-2-like isoform X1          481   2e-157   
ref|XP_002609501.1|  hypothetical protein BRAFLDRAFT_230263             478   3e-157   
ref|XP_005747940.1|  PREDICTED: cryptochrome-2-like isoform X1          483   8e-157   
ref|XP_005951246.1|  PREDICTED: cryptochrome-2-like isoform X1          483   8e-157   
ref|NP_001077099.1|  cryptochrome 2                                     479   9e-157   
ref|XP_006620498.1|  PREDICTED: cryptochrome-1-like isoform X2          479   1e-156   
gb|ELU04573.1|  hypothetical protein CAPTEDRAFT_178510                  480   1e-156   
ref|XP_004556261.1|  PREDICTED: cryptochrome-2-like isoform X1          483   1e-156   
ref|XP_005537706.1|  6-4 photolyase                                     477   1e-156   
ref|XP_006566012.1|  PREDICTED: cryptochrome 2 isoform X1               479   2e-156   
ref|XP_006566014.1|  PREDICTED: cryptochrome 2 isoform X3               478   2e-156   
ref|XP_006566015.1|  PREDICTED: cryptochrome 2 isoform X4               477   2e-156   
ref|XP_009640446.1|  PREDICTED: cryptochrome-2-like                     476   2e-156   
ref|NP_001076794.1|  cryptochrome 2                                     477   2e-156   
ref|XP_010879200.1|  PREDICTED: cryptochrome-1-like                     481   2e-156   
ref|XP_006620499.1|  PREDICTED: cryptochrome-1-like isoform X3          477   2e-156   
dbj|BAG07408.1|  cryptochrome-m                                         477   3e-156   
ref|XP_007567615.1|  PREDICTED: cryptochrome-2-like                     481   4e-156   
ref|XP_006620497.1|  PREDICTED: cryptochrome-1-like isoform X1          478   4e-156   
ref|XP_001946012.1|  PREDICTED: cryptochrome-2                          476   5e-156   
ref|XP_002004062.1|  GI19664                                            476   5e-156   
ref|XP_002052207.1|  GJ17431                                            476   6e-156   
ref|XP_010840633.1|  PREDICTED: cryptochrome-2                          478   8e-156   
gb|ACN10538.1|  Cryptochrome-1                                          479   9e-156   
gb|EFN85258.1|  Cryptochrome-1                                          476   9e-156   
gb|ELR47705.1|  Cryptochrome-2                                          476   1e-155   
ref|XP_003692819.1|  PREDICTED: cryptochrome-1-like                     476   1e-155   
ref|XP_005795951.1|  PREDICTED: cryptochrome-2-like                     478   3e-155   
ref|XP_007668306.1|  PREDICTED: cryptochrome-1                          476   3e-155   
ref|XP_009294040.1|  PREDICTED: cryptochrome 4 isoform X2               475   5e-155   
ref|XP_005168334.1|  PREDICTED: cryptochrome 4 isoform X3               475   5e-155   
ref|XP_003225762.1|  PREDICTED: cryptochrome-1-like                     473   6e-155   
ref|XP_009064438.1|  hypothetical protein LOTGIDRAFT_131547             472   6e-155   
ref|XP_010579672.1|  PREDICTED: cryptochrome-2-like                     474   6e-155   
gb|AGH88839.1|  cryptochrome                                            474   8e-155   
gb|AGD94517.1|  cryptochrome                                            474   9e-155   



>ref|XP_009598181.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Nicotiana tomentosiformis]
Length=554

 Score =   932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/541 (81%), Positives = 501/541 (93%), Gaps = 0/541 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + MAS S SL+WFRKGLR+HDNPAL++AA  S   +P+FVIDPHYMEPDPTAFSPGS+RA
Sbjct  14    STMASGSNSLIWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMEPDPTAFSPGSSRA  73

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             GLNRI+FLLE+LVDLD SL  LGSRLLVL+G+PS+VLIRCLKEWSI KLCFEYDTEPYYQ
Sbjct  74    GLNRIQFLLESLVDLDLSLKKLGSRLLVLKGEPSEVLIRCLKEWSIGKLCFEYDTEPYYQ  133

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD KVKN+ASVAG+E F+PVSHTL++PADII+KNGG+PPLTYQSFLKLAG PSWAS+PL
Sbjct  134   ALDVKVKNHASVAGVEIFSPVSHTLYNPADIINKNGGSPPLTYQSFLKLAGQPSWASTPL  193

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
             ST++SSLPPIGN G+  VS VPT++ELGY D +EDERT F+GGESEAL+RLRESIANKEW
Sbjct  194   STTISSLPPIGNTGNFAVSEVPTVKELGYEDLNEDERTPFKGGESEALKRLRESIANKEW  253

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA FEKPKG+PSAF++PATTVLSPYLKFGCLSSRYFYQC+Q++ +SVK+HTSPPVSLLGQ
Sbjct  254   VANFEKPKGDPSAFMKPATTVLSPYLKFGCLSSRYFYQCIQDIQKSVKKHTSPPVSLLGQ  313

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWRDFFYTV+FGTP+FD+M+GNRICKQIPWK  DELLAAWRD+RTGFPWIDAIM QLRK
Sbjct  314   LLWRDFFYTVSFGTPNFDQMKGNRICKQIPWKNDDELLAAWRDARTGFPWIDAIMTQLRK  373

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
             WGWMHHLARHSVACFLTRGDLF+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY
Sbjct  374   WGWMHHLARHSVACFLTRGDLFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQY  433

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
             HRIYSP +FGKKYDP GNYIRHFLPVLKDMPKEYIYEPWTAPLS+QRKA+CIIG+DYPKP
Sbjct  434   HRIYSPTSFGKKYDPAGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQRKARCIIGLDYPKP  493

Query  1693  VVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             VVSHDSASKECR RLGEAYELNKKL G+V +E LN+L+R+ +++   ++  ++R+KQ LI
Sbjct  494   VVSHDSASKECRMRLGEAYELNKKLNGLVSEEHLNKLRRKNDDESTILDSISRRKKQKLI  553

Query  1873  G  1875
             G
Sbjct  554   G  554



>ref|XP_009764105.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Nicotiana sylvestris]
Length=564

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/540 (80%), Positives = 493/540 (91%), Gaps = 0/540 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + MAS S SLMWFRKGLR+HDNPAL++AA  S   +P+FVIDPHYME DPTAFSPGS++A
Sbjct  24    STMASGSNSLMWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMELDPTAFSPGSSKA  83

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             GLNRI+FLLE LVDLD SL+ LGSRLLVL+GDP +VL RC KEWSI KLCFEYDTEPYYQ
Sbjct  84    GLNRIQFLLECLVDLDLSLSKLGSRLLVLKGDPGEVLTRCWKEWSIGKLCFEYDTEPYYQ  143

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD KVKN+ASVAG+E F+PVSHTL++PADII+KNGG+PPLTYQSFLKLAG PSWAS+PL
Sbjct  144   ALDVKVKNHASVAGVEIFSPVSHTLYNPADIINKNGGSPPLTYQSFLKLAGQPSWASTPL  203

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
             ST++SSLPPIGN G+  VS VPT++ELGY D +EDERT F+GGESEAL+RLRESIANKEW
Sbjct  204   STTISSLPPIGNTGNFAVSGVPTVKELGYEDLNEDERTPFKGGESEALKRLRESIANKEW  263

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA FEKPKG+PSAF++PATTVLSPYLKFGCLSSRYFYQC+Q++ +SVK+HTSPPVSLLGQ
Sbjct  264   VANFEKPKGDPSAFMKPATTVLSPYLKFGCLSSRYFYQCIQDIQKSVKKHTSPPVSLLGQ  323

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWRDFFYTV+FGTP+FD+M+GNRICKQIPWK  DELLAAWRDSRTGFPWIDAIM QLRK
Sbjct  324   LLWRDFFYTVSFGTPNFDQMKGNRICKQIPWKNDDELLAAWRDSRTGFPWIDAIMAQLRK  383

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GWMHHLARHSVACFLTRGDLF+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY
Sbjct  384   CGWMHHLARHSVACFLTRGDLFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQY  443

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
             HRIYSP +FGKKYDP GNYIRHFLPVLKDMPKEYIYEPWTAPLS+QRKA+CIIG+DYP P
Sbjct  444   HRIYSPTSFGKKYDPAGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQRKARCIIGLDYPNP  503

Query  1693  VVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             VVSHDSASKECR RLGEAYELNKKL G V +E+LN+L+R+ + +   ++  ++++KQ LI
Sbjct  504   VVSHDSASKECRMRLGEAYELNKKLNGRVSEEDLNKLRRKNDNESAIVDSISRKKKQKLI  563



>ref|XP_009764097.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Nicotiana sylvestris]
Length=566

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/540 (80%), Positives = 493/540 (91%), Gaps = 0/540 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + MAS S SLMWFRKGLR+HDNPAL++AA  S   +P+FVIDPHYME DPTAFSPGS++A
Sbjct  26    STMASGSNSLMWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMELDPTAFSPGSSKA  85

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             GLNRI+FLLE LVDLD SL+ LGSRLLVL+GDP +VL RC KEWSI KLCFEYDTEPYYQ
Sbjct  86    GLNRIQFLLECLVDLDLSLSKLGSRLLVLKGDPGEVLTRCWKEWSIGKLCFEYDTEPYYQ  145

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD KVKN+ASVAG+E F+PVSHTL++PADII+KNGG+PPLTYQSFLKLAG PSWAS+PL
Sbjct  146   ALDVKVKNHASVAGVEIFSPVSHTLYNPADIINKNGGSPPLTYQSFLKLAGQPSWASTPL  205

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
             ST++SSLPPIGN G+  VS VPT++ELGY D +EDERT F+GGESEAL+RLRESIANKEW
Sbjct  206   STTISSLPPIGNTGNFAVSGVPTVKELGYEDLNEDERTPFKGGESEALKRLRESIANKEW  265

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA FEKPKG+PSAF++PATTVLSPYLKFGCLSSRYFYQC+Q++ +SVK+HTSPPVSLLGQ
Sbjct  266   VANFEKPKGDPSAFMKPATTVLSPYLKFGCLSSRYFYQCIQDIQKSVKKHTSPPVSLLGQ  325

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWRDFFYTV+FGTP+FD+M+GNRICKQIPWK  DELLAAWRDSRTGFPWIDAIM QLRK
Sbjct  326   LLWRDFFYTVSFGTPNFDQMKGNRICKQIPWKNDDELLAAWRDSRTGFPWIDAIMAQLRK  385

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GWMHHLARHSVACFLTRGDLF+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY
Sbjct  386   CGWMHHLARHSVACFLTRGDLFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQY  445

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
             HRIYSP +FGKKYDP GNYIRHFLPVLKDMPKEYIYEPWTAPLS+QRKA+CIIG+DYP P
Sbjct  446   HRIYSPTSFGKKYDPAGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQRKARCIIGLDYPNP  505

Query  1693  VVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             VVSHDSASKECR RLGEAYELNKKL G V +E+LN+L+R+ + +   ++  ++++KQ LI
Sbjct  506   VVSHDSASKECRMRLGEAYELNKKLNGRVSEEDLNKLRRKNDNESAIVDSISRKKKQKLI  565



>ref|XP_009764113.1| PREDICTED: (6-4)DNA photolyase isoform X3 [Nicotiana sylvestris]
Length=560

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/540 (80%), Positives = 493/540 (91%), Gaps = 0/540 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + MAS S SLMWFRKGLR+HDNPAL++AA  S   +P+FVIDPHYME DPTAFSPGS++A
Sbjct  20    STMASGSNSLMWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMELDPTAFSPGSSKA  79

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             GLNRI+FLLE LVDLD SL+ LGSRLLVL+GDP +VL RC KEWSI KLCFEYDTEPYYQ
Sbjct  80    GLNRIQFLLECLVDLDLSLSKLGSRLLVLKGDPGEVLTRCWKEWSIGKLCFEYDTEPYYQ  139

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD KVKN+ASVAG+E F+PVSHTL++PADII+KNGG+PPLTYQSFLKLAG PSWAS+PL
Sbjct  140   ALDVKVKNHASVAGVEIFSPVSHTLYNPADIINKNGGSPPLTYQSFLKLAGQPSWASTPL  199

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
             ST++SSLPPIGN G+  VS VPT++ELGY D +EDERT F+GGESEAL+RLRESIANKEW
Sbjct  200   STTISSLPPIGNTGNFAVSGVPTVKELGYEDLNEDERTPFKGGESEALKRLRESIANKEW  259

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA FEKPKG+PSAF++PATTVLSPYLKFGCLSSRYFYQC+Q++ +SVK+HTSPPVSLLGQ
Sbjct  260   VANFEKPKGDPSAFMKPATTVLSPYLKFGCLSSRYFYQCIQDIQKSVKKHTSPPVSLLGQ  319

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWRDFFYTV+FGTP+FD+M+GNRICKQIPWK  DELLAAWRDSRTGFPWIDAIM QLRK
Sbjct  320   LLWRDFFYTVSFGTPNFDQMKGNRICKQIPWKNDDELLAAWRDSRTGFPWIDAIMAQLRK  379

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GWMHHLARHSVACFLTRGDLF+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY
Sbjct  380   CGWMHHLARHSVACFLTRGDLFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQY  439

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
             HRIYSP +FGKKYDP GNYIRHFLPVLKDMPKEYIYEPWTAPLS+QRKA+CIIG+DYP P
Sbjct  440   HRIYSPTSFGKKYDPAGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQRKARCIIGLDYPNP  499

Query  1693  VVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             VVSHDSASKECR RLGEAYELNKKL G V +E+LN+L+R+ + +   ++  ++++KQ LI
Sbjct  500   VVSHDSASKECRMRLGEAYELNKKLNGRVSEEDLNKLRRKNDNESAIVDSISRKKKQKLI  559



>ref|XP_006346589.1| PREDICTED: (6-4)DNA photolyase-like isoform X1 [Solanum tuberosum]
Length=539

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/538 (80%), Positives = 488/538 (91%), Gaps = 0/538 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS + SLMWFRKGLR+HDNPAL++AA  S   +P+FVIDPHYMEPDPTAFS GS++AGL
Sbjct  1     MASGANSLMWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMEPDPTAFSLGSSKAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+LVDLD SL  +GSRLLVL+GDP +VLIRCLKEWSI KLCFEYDTEPYYQAL
Sbjct  61    NRIQFLLESLVDLDLSLKKVGSRLLVLKGDPGEVLIRCLKEWSIGKLCFEYDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK Y S  G+E F+PVSHTL++PADII KNGG+PPL+YQSFLKLAG PSWA++PL T
Sbjct  121   DEKVKGYVSGTGVEIFSPVSHTLYNPADIIRKNGGSPPLSYQSFLKLAGQPSWATTPLLT  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPPIGN GS  VS VPT+ ELGY D +EDERT F+GGESEAL+RLRESIANKEWVA
Sbjct  181   TISSLPPIGNTGSFAVSEVPTVRELGYEDLAEDERTPFKGGESEALKRLRESIANKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q++L+  K+HTSPPVSLLGQLL
Sbjct  241   NFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQDILKCSKKHTSPPVSLLGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYT AFGTP+F++M+GNRICKQIPWK  DELLAAWRDSRTGFPWIDAIMVQLRKWG
Sbjct  301   WRDFFYTAAFGTPNFNQMKGNRICKQIPWKNDDELLAAWRDSRTGFPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARHSVACFLTRGDLF+HWE+GR VFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WIHHLARHSVACFLTRGDLFVHWERGRHVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYD  GNYIRHFLPVLKDMPKEYIYEPWTAP+S+QRKAKCIIGIDYPKPVV
Sbjct  421   IYSPISFGKKYDSAGNYIRHFLPVLKDMPKEYIYEPWTAPISVQRKAKCIIGIDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             SHDSASKEC+ RLGEAY LNKKL G+V DE+LNEL+R+ + +  +++  ++++KQ LI
Sbjct  481   SHDSASKECKMRLGEAYALNKKLNGLVSDEDLNELRRKADNESTTLDSVSRKKKQKLI  538



>ref|XP_004252323.1| PREDICTED: (6-4)DNA photolyase [Solanum lycopersicum]
Length=539

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/538 (79%), Positives = 488/538 (91%), Gaps = 0/538 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS + SLMWFRKGLR+HDNPAL++AA  S   +P+FVIDPHYM+PDPTAFS GS++AGL
Sbjct  1     MASGANSLMWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMDPDPTAFSLGSSKAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+L DLD SL  +GSRLLVL+GDP ++LIRCLKEWSI KLCFEYDTEPYYQAL
Sbjct  61    NRIQFLLESLADLDLSLKKVGSRLLVLKGDPGELLIRCLKEWSIGKLCFEYDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK Y S  G+E F+PVSHTL++PADIIHKNGG+PPL+YQSFLKLAG PSWA++PLST
Sbjct  121   DEKVKGYVSGTGVEIFSPVSHTLYNPADIIHKNGGSPPLSYQSFLKLAGQPSWAATPLST  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLP IGN GS  VS VPT+ ELGY D  EDE+T F+GGESEAL+RLRESIANKEWVA
Sbjct  181   TISSLPRIGNTGSFAVSEVPTVRELGYEDLPEDEKTPFKGGESEALKRLRESIANKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKGNPSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q++L+  K+HTSPPVSLLGQLL
Sbjct  241   NFEKPKGNPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQDILKCSKKHTSPPVSLLGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYT AFGTP+FD+M+GNRICKQIPWK  D+LLAAWRDS+TGFPWIDAIMVQLRKWG
Sbjct  301   WRDFFYTAAFGTPNFDQMKGNRICKQIPWKNDDKLLAAWRDSKTGFPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARHSVACFLTRGDLF+HWE+GR VFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WIHHLARHSVACFLTRGDLFVHWERGRHVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP GNYIRHFLPVLKDMPKEYIYEPWTAP+S+QRKAKCIIG+DYPKPVV
Sbjct  421   IYSPISFGKKYDPAGNYIRHFLPVLKDMPKEYIYEPWTAPISVQRKAKCIIGVDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             SHDSASKEC+ RLGEAY LNKKL G+V +E+LNEL+R+ + +  +++  ++++KQ LI
Sbjct  481   SHDSASKECKMRLGEAYALNKKLNGLVSEEDLNELRRKADNESTTLDSVSRKKKQKLI  538



>emb|CDO98113.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/539 (80%), Positives = 481/539 (89%), Gaps = 1/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M   S SLMWFRKGLRIHDNPAL++AA  S   +P+FVIDP YMEPDPTAFSPGS RAGL
Sbjct  1     MDPGSNSLMWFRKGLRIHDNPALEYAAKDSKHVYPVFVIDPRYMEPDPTAFSPGSARAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLD SL NLGSRLLVL+G+PS+++I CLKEW+ISKLCFE+DTEPYYQAL
Sbjct  61    NRIRFLLESLTDLDKSLKNLGSRLLVLKGEPSEMVIHCLKEWNISKLCFEFDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS+ GIE F+PVSHTLF+PA+II KNGGTPPL+YQSF+K+AG P W+SS LST
Sbjct  121   DDKVKSYASLVGIEIFSPVSHTLFNPAEIIQKNGGTPPLSYQSFIKVAGQPFWSSSCLST  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             SLS LPP  NLGS  +S VP+L +LGY +  EDERT  RGGESEALRRL ESIA+K+WVA
Sbjct  181   SLSCLPPPVNLGSCTISEVPSLNDLGYKESEEDERTPIRGGESEALRRLSESIADKDWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLS RYFYQC+QEV ++VKRHTSPPVSLLGQLL
Sbjct  241   NFEKPKGDPSAFLKPATTVLSPYLKFGCLSPRYFYQCIQEVQKNVKRHTSPPVSLLGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+FD+M GNRICKQIPW  +DELLAAWRD+RTGFPWIDAIMVQLRKWG
Sbjct  301   WRDFFYTVAFGTPNFDKMHGNRICKQIPWDSNDELLAAWRDARTGFPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDL++HWEKGRDVFERLL+DSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLYVHWEKGRDVFERLLVDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPW APLSIQ KAKCIIG DYPKPVV
Sbjct  421   IYSPISFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWCAPLSIQTKAKCIIGKDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             SHDSASKECR+RL EAYELNKKL G V +E+L +L+R++EE D   E K+KR KQ  IG
Sbjct  481   SHDSASKECRRRLAEAYELNKKLNGTVSEEDLKKLRRKLEE-DTIQESKSKRLKQKSIG  538



>ref|XP_002285327.2| PREDICTED: (6-4)DNA photolyase isoform X1 [Vitis vinifera]
Length=564

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/543 (78%), Positives = 485/543 (89%), Gaps = 1/543 (0%)
 Frame = +1

Query  247   PATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGST  426
             P  +MAS S SLMWFRKGLRIHDNPALQHAA  S   +P+FVIDP++MEPDP AFSPGS+
Sbjct  23    PNPSMASGSSSLMWFRKGLRIHDNPALQHAAKESNCVYPVFVIDPYFMEPDPNAFSPGSS  82

Query  427   RAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPY  606
             RAGLNRIRFLLE+LVDLDSSL  LGSRLLVL+GDP +V+IRCLKEW + +LCFEYDT+PY
Sbjct  83    RAGLNRIRFLLESLVDLDSSLRQLGSRLLVLKGDPGEVIIRCLKEWEVKRLCFEYDTDPY  142

Query  607   YQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAss  786
             YQALD KVKNYAS AGIE F+PVSHTLFD A+II KNGG PPL+YQSFLKLAG PSWASS
Sbjct  143   YQALDIKVKNYASAAGIEVFSPVSHTLFDSAEIIQKNGGRPPLSYQSFLKLAGQPSWASS  202

Query  787   plstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANK  966
             PL T+LS LPP+G++G+ ++S VPT++ELGY +  +DE T F+GGESEAL+RLRESI +K
Sbjct  203   PLLTTLSWLPPVGDVGTCEISNVPTVKELGYEEIGQDESTPFKGGESEALKRLRESIRDK  262

Query  967   EWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLL  1146
             EWVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+ +V +++K HTSPPVSL+
Sbjct  263   EWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLTDVYKNMKWHTSPPVSLV  322

Query  1147  GQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQL  1326
             GQLLWRDFFYTV FGTP+FDRM+GNRICKQIPW + DELLAAWR++RTG+PWIDAIMVQL
Sbjct  323   GQLLWRDFFYTVGFGTPNFDRMKGNRICKQIPWNDDDELLAAWREARTGYPWIDAIMVQL  382

Query  1327  RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  1506
             RKWGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFY
Sbjct  383   RKWGWMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFY  442

Query  1507  QYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYP  1686
             QY+RIYSPI+FGKKYDP+GNYIRHFLP+LKDMPKEYIYEPWTAP SIQ KAKCIIG DYP
Sbjct  443   QYNRIYSPISFGKKYDPNGNYIRHFLPILKDMPKEYIYEPWTAPPSIQAKAKCIIGKDYP  502

Query  1687  KPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQT  1866
             KPVV HDSA KEC+++L EAY LNK+L G V +E+L +L+R++EE D++ E  T R +Q 
Sbjct  503   KPVVCHDSAIKECKRKLAEAYALNKRLDGSVTEEDLKKLRRKLEE-DENPESNTSRTRQK  561

Query  1867  LIG  1875
             LIG
Sbjct  562   LIG  564



>ref|XP_011072252.1| PREDICTED: (6-4)DNA photolyase [Sesamum indicum]
Length=547

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/537 (79%), Positives = 478/537 (89%), Gaps = 1/537 (0%)
 Frame = +1

Query  256   AMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAG  435
              MAS S SLMWFRKGLRIHDNPAL++AA  S   +P+FVIDPHYMEPDP AFSPGS RA 
Sbjct  12    TMASGSNSLMWFRKGLRIHDNPALEYAARGSDNLYPVFVIDPHYMEPDPNAFSPGSKRAS  71

Query  436   LNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQA  615
             LNRIRFLLE+LVDLD +L  LGSRLLVL G+PS+VL RCLKEWSI KLCFE+DTEPYYQA
Sbjct  72    LNRIRFLLESLVDLDLNLQKLGSRLLVLNGEPSEVLFRCLKEWSIKKLCFEFDTEPYYQA  131

Query  616   LDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspls  795
             LD KV+ YA+ AGIE F+PVSHTLF+PADII KNGG PPL+YQSF+KLAG PSWASSP+S
Sbjct  132   LDNKVRKYATAAGIEIFSPVSHTLFNPADIIQKNGGKPPLSYQSFVKLAGEPSWASSPIS  191

Query  796   tslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
             T L+ LPP+G+ GS   + VPT++ LGY D +ED+RT F+GGESEALRR+RES++NKEWV
Sbjct  192   TELTLLPPVGSFGSCPTTEVPTIKNLGYEDTAEDDRTPFKGGESEALRRMRESMSNKEWV  251

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FEKPKG+PS+F +PATTVLSPYLKFGCLSSRYFYQC+QEV R+VKRHTSPPVSLLGQL
Sbjct  252   ANFEKPKGDPSSFAKPATTVLSPYLKFGCLSSRYFYQCIQEVQRNVKRHTSPPVSLLGQL  311

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWRDFFYTVAFGTP+FD+M+ NRICKQIPWK  D+LL AWRD+RTGFPWIDAIMVQL+KW
Sbjct  312   LWRDFFYTVAFGTPNFDQMKDNRICKQIPWKNDDKLLCAWRDARTGFPWIDAIMVQLQKW  371

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDW+INN NW+WLSCSSFFYQY+
Sbjct  372   GWMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWSINNANWLWLSCSSFFYQYN  431

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
             RIYSPI+FGKKYDP+GN+IRHFLP+LKDMPKEYIYEPWTAPLSIQ KAKCIIG DYPKPV
Sbjct  432   RIYSPISFGKKYDPNGNFIRHFLPILKDMPKEYIYEPWTAPLSIQVKAKCIIGKDYPKPV  491

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQT  1866
             V HD ASKEC+Q L EAYELNK+L G V +E+L +L+R+VEE D+  E K+KR KQT
Sbjct  492   VDHDLASKECKQILYEAYELNKRLNGKVTEEDLKKLRRKVEE-DQRQEPKSKRLKQT  547



>emb|CBI36257.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/539 (78%), Positives = 483/539 (90%), Gaps = 1/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS S SLMWFRKGLRIHDNPALQHAA  S   +P+FVIDP++MEPDP AFSPGS+RAGL
Sbjct  1     MASGSSSLMWFRKGLRIHDNPALQHAAKESNCVYPVFVIDPYFMEPDPNAFSPGSSRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLDSSL  LGSRLLVL+GDP +V+IRCLKEW + +LCFEYDT+PYYQAL
Sbjct  61    NRIRFLLESLVDLDSSLRQLGSRLLVLKGDPGEVIIRCLKEWEVKRLCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVKNYAS AGIE F+PVSHTLFD A+II KNGG PPL+YQSFLKLAG PSWASSPL T
Sbjct  121   DIKVKNYASAAGIEVFSPVSHTLFDSAEIIQKNGGRPPLSYQSFLKLAGQPSWASSPLLT  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             +LS LPP+G++G+ ++S VPT++ELGY +  +DE T F+GGESEAL+RLRESI +KEWVA
Sbjct  181   TLSWLPPVGDVGTCEISNVPTVKELGYEEIGQDESTPFKGGESEALKRLRESIRDKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+ +V +++K HTSPPVSL+GQLL
Sbjct  241   NFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLTDVYKNMKWHTSPPVSLVGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTV FGTP+FDRM+GNRICKQIPW + DELLAAWR++RTG+PWIDAIMVQLRKWG
Sbjct  301   WRDFFYTVGFGTPNFDRMKGNRICKQIPWNDDDELLAAWREARTGYPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP+GNYIRHFLP+LKDMPKEYIYEPWTAP SIQ KAKCIIG DYPKPVV
Sbjct  421   IYSPISFGKKYDPNGNYIRHFLPILKDMPKEYIYEPWTAPPSIQAKAKCIIGKDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
              HDSA KEC+++L EAY LNK+L G V +E+L +L+R++EE D++ E  T R +Q LIG
Sbjct  481   CHDSAIKECKRKLAEAYALNKRLDGSVTEEDLKKLRRKLEE-DENPESNTSRTRQKLIG  538



>gb|KGN45302.1| hypothetical protein Csa_7G433310 [Cucumis sativus]
Length=562

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/538 (76%), Positives = 487/538 (91%), Gaps = 0/538 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA  S SLMWFRKG+RIHDNPAL++AA  +   +P+FVIDPHYMEPDP+AFS GS+RAGL
Sbjct  19    MAPSSNSLMWFRKGIRIHDNPALEYAAKGAKFLYPVFVIDPHYMEPDPSAFSLGSSRAGL  78

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD +L  LGSRLLVL G+P +VLIRCLKEW++ KLCFEYDT+PYYQAL
Sbjct  79    NRIRFLLESLVDLDLNLKKLGSRLLVLHGEPGEVLIRCLKEWNVKKLCFEYDTDPYYQAL  138

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D +V+N+AS AGIE F+PVSHTLF+PADII KNGG+PPL+YQSFLKLAG PSWA +PLST
Sbjct  139   DIRVQNHASAAGIEVFSPVSHTLFNPADIIQKNGGSPPLSYQSFLKLAGEPSWACAPLST  198

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPP+G+ G  ++S VPT+++LGY D ++D+ T FRGGE+EAL+RL+ES++NK+WVA
Sbjct  199   TVSSLPPVGDTGRSEISDVPTIKDLGYEDMAKDDWTPFRGGETEALKRLKESMSNKDWVA  258

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+QE+ ++VK HTSPPVSL+GQLL
Sbjct  259   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQEIYKNVKGHTSPPVSLVGQLL  318

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FDRM+ N+ICKQIPW + +ELLAAWRD+RTGFPWIDAIMVQLRKWG
Sbjct  319   WREFFYTAAFGTPNFDRMKDNKICKQIPWNDDNELLAAWRDARTGFPWIDAIMVQLRKWG  378

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINN NW+WLSCSSFFYQY+R
Sbjct  379   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNANWLWLSCSSFFYQYNR  438

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPITFGKKYDP+G++IRHFLPVLKDMPK+YIYEPWTAPLSIQ+KAKCIIG DYPKPVV
Sbjct  439   VYSPITFGKKYDPNGDFIRHFLPVLKDMPKQYIYEPWTAPLSIQKKAKCIIGEDYPKPVV  498

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             SHD A KECR+++GEAYELNK+L G++ DE+L  LK+R  E+D+    +TKR++QTLI
Sbjct  499   SHDIAIKECRKKMGEAYELNKRLKGLISDEDLENLKKRNSEEDQRQNAQTKRKRQTLI  556



>ref|XP_004158807.1| PREDICTED: (6-4)DNA photolyase-like [Cucumis sativus]
Length=544

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/538 (76%), Positives = 487/538 (91%), Gaps = 0/538 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA  S SLMWFRKG+RIHDNPAL++AA  +   +P+FVIDPHYMEPDP+AFS GS+RAGL
Sbjct  1     MAPSSNSLMWFRKGIRIHDNPALEYAAKGAKFLYPVFVIDPHYMEPDPSAFSLGSSRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD +L  LGSRLLVL G+P +VLIRCLKEW++ KLCFEYDT+PYYQAL
Sbjct  61    NRIRFLLESLVDLDLNLKKLGSRLLVLHGEPGEVLIRCLKEWNVKKLCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D +V+N+AS AGIE F+PVSHTLF+PADII KNGG+PPL+YQSFLKLAG PSWA +PLST
Sbjct  121   DIRVQNHASAAGIEVFSPVSHTLFNPADIIQKNGGSPPLSYQSFLKLAGEPSWACAPLST  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPP+G+ G  ++S VPT+++LGY D ++D+ T FRGGE+EAL+RL+ES++NK+WVA
Sbjct  181   TVSSLPPVGDTGRSEISDVPTIKDLGYEDMAKDDWTPFRGGETEALKRLKESMSNKDWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+QE+ ++VK HTSPPVSL+GQLL
Sbjct  241   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQEIYKNVKGHTSPPVSLVGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FDRM+ N+ICKQIPW + +ELLAAWRD+RTGFPWIDAIMVQLRKWG
Sbjct  301   WREFFYTAAFGTPNFDRMKDNKICKQIPWNDDNELLAAWRDARTGFPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINN NW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNANWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPITFGKKYDP+G++IRHFLPVLKDMPK+YIYEPWTAPLSIQ+KAKCIIG DYPKPVV
Sbjct  421   VYSPITFGKKYDPNGDFIRHFLPVLKDMPKQYIYEPWTAPLSIQKKAKCIIGEDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             SHD A KECR+++GEAYELNK+L G++ DE+L  LK+R  E+D+    +TKR++QTLI
Sbjct  481   SHDIAIKECRKKMGEAYELNKRLKGLISDEDLENLKKRNSEEDQRQNAQTKRKRQTLI  538



>ref|XP_007023941.1| DNA photolyase family protein isoform 3 [Theobroma cacao]
 gb|EOY26563.1| DNA photolyase family protein isoform 3 [Theobroma cacao]
Length=550

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/541 (77%), Positives = 488/541 (90%), Gaps = 2/541 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + M S S SL+WFRKGLRIHDNPAL++A+ AS   +PLFVIDPHYMEPDP AFSPGSTRA
Sbjct  10    SNMPSGSASLIWFRKGLRIHDNPALEYASRASAFVYPLFVIDPHYMEPDPKAFSPGSTRA  69

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             G++RIRFLLE+L DLD SL  LGSRLLVL+G+PS+VLIRCLKEW + K+CFEYDT+PYYQ
Sbjct  70    GISRIRFLLESLADLDLSLKKLGSRLLVLKGEPSEVLIRCLKEWDVKKICFEYDTDPYYQ  129

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD K+KNYAS+AGIE F+PVSHTLF+PADII KNGG PPL+YQSFLKLAG PSWASSPL
Sbjct  130   ALDNKIKNYASLAGIEVFSPVSHTLFNPADIIEKNGGRPPLSYQSFLKLAGEPSWASSPL  189

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYV-DCSEDERTSFRGGESEALRRLRESIANKE  969
                LSS+PP+G++ S ++S VPTL+ELGYV +  ++E T FRGGESEALRRLRES+++KE
Sbjct  190   LVELSSVPPVGDVASFEISQVPTLKELGYVQNDQQEELTPFRGGESEALRRLRESLSDKE  249

Query  970   WVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             WVA FEKPKG+PSA+++PATTVLSPYLKFGCLSSRYFYQC+++V ++VKRHTSPPVSL+G
Sbjct  250   WVANFEKPKGDPSAYIKPATTVLSPYLKFGCLSSRYFYQCLKDVYKNVKRHTSPPVSLVG  309

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWR+FFYTVAFGTP+FD+M GN+ICKQIPW + DELLAAWR++RTG+PWIDAIMVQLR
Sbjct  310   QLLWREFFYTVAFGTPNFDKMNGNKICKQIPWNDDDELLAAWREARTGYPWIDAIMVQLR  369

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             +WGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQ
Sbjct  370   EWGWMHHLARHCVACFLTRGDLFLHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQ  429

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y+RIYSP +FGKKYDP G+YIRHFLP+LKDMPKEYIYEPWTAPLS+Q KAKCIIG DYPK
Sbjct  430   YNRIYSPTSFGKKYDPHGDYIRHFLPILKDMPKEYIYEPWTAPLSVQNKAKCIIGRDYPK  489

Query  1690  PVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             PVVSHDSASKECR+++GEAY LNKKL G+V ++++  L+RR++E D   E + +RQ+Q L
Sbjct  490   PVVSHDSASKECRRKMGEAYALNKKLNGVVSEDDVKSLRRRLDE-DGGQEARGRRQRQKL  548

Query  1870  I  1872
             I
Sbjct  549   I  549



>ref|XP_007023940.1| DNA photolyase family protein isoform 2 [Theobroma cacao]
 gb|EOY26562.1| DNA photolyase family protein isoform 2 [Theobroma cacao]
Length=550

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/541 (77%), Positives = 487/541 (90%), Gaps = 2/541 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + M S S SL+WFRKGLRIHDNPAL++A+ AS   +PLFVIDPHYMEPDP AFSPGSTRA
Sbjct  10    SNMPSGSASLIWFRKGLRIHDNPALEYASRASAFVYPLFVIDPHYMEPDPKAFSPGSTRA  69

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             G++RIRFLLE+L DLD SL  LGSRLLVL+G+PS+VLIRCLKEW + K+CFEYDT+PYYQ
Sbjct  70    GISRIRFLLESLADLDLSLKKLGSRLLVLKGEPSEVLIRCLKEWDVKKICFEYDTDPYYQ  129

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD K+KNYAS+AGIE F+PVSHTLF+PADII KNGG PPL+YQSFLKLAG PSWASSPL
Sbjct  130   ALDNKIKNYASLAGIEVFSPVSHTLFNPADIIEKNGGRPPLSYQSFLKLAGEPSWASSPL  189

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                LSS+PP+G++ S ++S VPTL+ELGYV   ++E T FRGGESEALRRLRES+++KEW
Sbjct  190   LVELSSVPPVGDVASFEISQVPTLKELGYVQNDQEELTPFRGGESEALRRLRESLSDKEW  249

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLK-FGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             VA FEKPKG+PSA+++PATTVLSPYLK FGCLSSRYFYQC+++V ++VKRHTSPPVSL+G
Sbjct  250   VANFEKPKGDPSAYIKPATTVLSPYLKQFGCLSSRYFYQCLKDVYKNVKRHTSPPVSLVG  309

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWR+FFYTVAFGTP+FD+M GN+ICKQIPW + DELLAAWR++RTG+PWIDAIMVQLR
Sbjct  310   QLLWREFFYTVAFGTPNFDKMNGNKICKQIPWNDDDELLAAWREARTGYPWIDAIMVQLR  369

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             +WGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQ
Sbjct  370   EWGWMHHLARHCVACFLTRGDLFLHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQ  429

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y+RIYSP +FGKKYDP G+YIRHFLP+LKDMPKEYIYEPWTAPLS+Q KAKCIIG DYPK
Sbjct  430   YNRIYSPTSFGKKYDPHGDYIRHFLPILKDMPKEYIYEPWTAPLSVQNKAKCIIGRDYPK  489

Query  1690  PVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             PVVSHDSASKECR+++GEAY LNKKL G+V ++++  L+RR++E D   E + +RQ+Q L
Sbjct  490   PVVSHDSASKECRRKMGEAYALNKKLNGVVSEDDVKSLRRRLDE-DGGQEARGRRQRQKL  548

Query  1870  I  1872
             I
Sbjct  549   I  549



>dbj|BAJ53248.1| JHL25H03.11 [Jatropha curcas]
 gb|KDP37133.1| hypothetical protein JCGZ_06189 [Jatropha curcas]
Length=536

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/535 (78%), Positives = 480/535 (90%), Gaps = 1/535 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M S S +LMWFRKGLRIHDNPAL++A+  S   +P+FVIDPHYM+PDP AFSPGSTRAGL
Sbjct  1     MPSGSSTLMWFRKGLRIHDNPALEYASKGSNFVYPVFVIDPHYMKPDPNAFSPGSTRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+L DLD SL  LGS+LLVL+G+PSQVLI CLKEW + ++CFEYDT+PYYQAL
Sbjct  61    NRIKFLLESLADLDLSLKKLGSKLLVLKGEPSQVLISCLKEWDVKRVCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK++AS  GIE F+PVSHTLF+PADII KNGG PPLTYQSFLK+AG PSWASSPLS 
Sbjct  121   DVKVKDFASSVGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKVAGEPSWASSPLSI  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             S+SSLPP+G++GS ++S VPT+EELGY D  +DE T FRGGESEAL+ LRESI +KEW+A
Sbjct  181   SISSLPPVGDVGSCEISEVPTVEELGYGDVEQDEWTPFRGGESEALKSLRESIKDKEWIA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAF++PATTVLSPYLKFGCLSSRYF+QC+Q+V R+VK+HTSPPVSL+GQLL
Sbjct  241   NFEKPKGDPSAFVKPATTVLSPYLKFGCLSSRYFFQCLQDVYRNVKKHTSPPVSLVGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+FD+M+ NRICKQIPW E  ELLAAWRD+RTG+PWIDAIMVQLRKWG
Sbjct  301   WRDFFYTVAFGTPNFDQMKDNRICKQIPWNEDTELLAAWRDARTGYPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP+GNYIRHFLPVLKDMPKE+IYEPWTAPLS+Q KAKCIIG DYPKPVV
Sbjct  421   IYSPISFGKKYDPNGNYIRHFLPVLKDMPKEFIYEPWTAPLSVQTKAKCIIGRDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQ  1863
             SHDSASKEC+++L EAY LN+KL G + +E+L  LKR++ +QD+  E K  RQKQ
Sbjct  481   SHDSASKECKRKLAEAYALNQKLNGQLTEEDLGNLKRKL-QQDQDQERKITRQKQ  534



>ref|XP_008228641.1| PREDICTED: (6-4)DNA photolyase [Prunus mume]
Length=537

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/539 (77%), Positives = 481/539 (89%), Gaps = 2/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+S S SLMWFRKGLRIHDNPAL++A+  S   +P+FVIDPHYM+PDP AFSPGS++AGL
Sbjct  1     MSSGSGSLMWFRKGLRIHDNPALEYASKGSNFLYPVFVIDPHYMKPDPEAFSPGSSKAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+L DLD +L  LGSRLLVL+G+PS+VLIRCLKEW + KLCFEYDTEPYYQAL
Sbjct  61    NRIQFLLESLRDLDLNLKRLGSRLLVLKGEPSEVLIRCLKEWDVKKLCFEYDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS AGIE ++PVSHTLF+PADII KNGG PPL+YQSFLKLAG PSWASSPLS 
Sbjct  121   DVKVKSYASTAGIEIYSPVSHTLFNPADIIRKNGGKPPLSYQSFLKLAGEPSWASSPLSI  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             +LSSLP +GN G+  +S VPT+EELGY +  +DE + FRGGE+EAL+RLRESI NKEWVA
Sbjct  181   TLSSLPLVGNTGNCNISEVPTVEELGYEETQQDELSPFRGGETEALKRLRESIENKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C++++ ++VK HT PPVSL GQLL
Sbjct  241   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYICLKDLYKNVKTHTVPPVSLAGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTPSFDRMRGN+ICKQIPW + DELL AWR++RTGFPWIDAIM QLRKWG
Sbjct  301   WRDFFYTVAFGTPSFDRMRGNKICKQIPWNDDDELLVAWREARTGFPWIDAIMTQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP+G+YIRHFLPVL+DMPKEYIYEPWTAPLSIQ KAKCIIG DYPKPVV
Sbjct  421   IYSPISFGKKYDPNGDYIRHFLPVLRDMPKEYIYEPWTAPLSIQNKAKCIIGRDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             +HDSASK+CR+R+ EAY LN+K+ GMV  E+L  L+R++EE D+  E + KRQ++ LIG
Sbjct  481   AHDSASKDCRRRMAEAYALNQKMSGMVSAEDLRNLRRKLEE-DQKPEVENKRQRK-LIG  537



>ref|XP_010088262.1| (6-4)DNA photolyase [Morus notabilis]
 gb|EXB33246.1| (6-4)DNA photolyase [Morus notabilis]
Length=535

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/536 (77%), Positives = 483/536 (90%), Gaps = 2/536 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS S SLMWFRKGLRIHDNPAL +A+  S   +PLFVIDPHYM+PDPT FSPGS+RAGL
Sbjct  1     MASGSGSLMWFRKGLRIHDNPALDYASKGSALLYPLFVIDPHYMKPDPTEFSPGSSRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLDS+L  LGSRLLVL+G+P ++LIRCLK+W + +LCFEYD+EPYYQA+
Sbjct  61    NRIRFLLESLVDLDSNLKELGSRLLVLKGEPGEILIRCLKQWDVKRLCFEYDSEPYYQAM  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHK-NGGTPPLTYQSFLKLAGIPSWAsspls  795
             D KVK YA+  GIE F+PVSHTLFDPADII K NGG PPL+YQSFLKLAG P+WASS L 
Sbjct  121   DVKVKEYAAANGIEVFSPVSHTLFDPADIIQKKNGGKPPLSYQSFLKLAGKPAWASSQLI  180

Query  796   tslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
             T+LSSLPP+G  G+ ++  VPT+EELGY D  +DE T FRGGESEAL+RL++SI++KEWV
Sbjct  181   TTLSSLPPVGEFGNCEIFEVPTVEELGYEDPGQDEFTPFRGGESEALKRLKDSISDKEWV  240

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q+V ++VK+HTSPPVSL+GQL
Sbjct  241   ANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQDVYKNVKKHTSPPVSLVGQL  300

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWRDFFYTVAFGTP+FD+M+ NRICKQIPW +++ELL AWRD++TG+PWIDAIMVQLRKW
Sbjct  301   LWRDFFYTVAFGTPNFDQMKINRICKQIPWNDNEELLTAWRDAKTGYPWIDAIMVQLRKW  360

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GWMHHLARH VACFLTRGDLF+HWEKGR VFERLLIDSDWAINNGNW+WLSCSSFFYQY+
Sbjct  361   GWMHHLARHCVACFLTRGDLFVHWEKGRHVFERLLIDSDWAINNGNWLWLSCSSFFYQYN  420

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
             RIYSPI+FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPWTAPLS+Q KAKCIIG DYP+PV
Sbjct  421   RIYSPISFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQTKAKCIIGKDYPRPV  480

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQ  1863
             VSHDSASKEC++R+GEAY LN++L G V D++LN L+RR+EE D++ E K KR+++
Sbjct  481   VSHDSASKECKRRMGEAYALNQRLNGKVSDDDLNSLRRRLEE-DQNQEVKAKRKRK  535



>ref|XP_002517574.1| DNA photolyase, putative [Ricinus communis]
 gb|EEF44738.1| DNA photolyase, putative [Ricinus communis]
Length=537

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/532 (78%), Positives = 478/532 (90%), Gaps = 1/532 (0%)
 Frame = +1

Query  265   SESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             S S SLMWFRKGLR+HDNPAL +A+  S   +P+FVIDPHYMEPDP AFSPGS+RAG+NR
Sbjct  4     SGSSSLMWFRKGLRVHDNPALDYASKGSKFVYPVFVIDPHYMEPDPNAFSPGSSRAGINR  63

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDA  624
             IRFLLE+LVDLD SL  LGS+LLVLRG+PSQVLIRCLK W + KLCFEYDT+ YYQALDA
Sbjct  64    IRFLLESLVDLDLSLKKLGSKLLVLRGEPSQVLIRCLKIWDVEKLCFEYDTDSYYQALDA  123

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsl  804
             KVK YAS A IE F+PVSHTLF+PADII KNGG PPL+YQSFLK+AG PSWASSPL T++
Sbjct  124   KVKEYASSARIEVFSPVSHTLFNPADIIQKNGGKPPLSYQSFLKVAGQPSWASSPLPTTI  183

Query  805   sslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
             SSLPP+G++GS ++S VPTLEELGY D  +DE   FRGGESEAL+RLRE I NKEWVA F
Sbjct  184   SSLPPVGDVGSCEISEVPTLEELGYGDVEQDEWAPFRGGESEALKRLREKITNKEWVANF  243

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             EKPKG+PSAF++PATTVLSPYLKFGCLSSRYFYQC+Q+V ++V +HTSPPVSLLGQLLWR
Sbjct  244   EKPKGDPSAFMKPATTVLSPYLKFGCLSSRYFYQCLQDVYKNVGKHTSPPVSLLGQLLWR  303

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             DFFYTVAFGTP+FD+M+ NRICKQIPW E DELL+AWR++RTG+PWIDAIMVQLRKWGWM
Sbjct  304   DFFYTVAFGTPNFDQMKENRICKQIPWNEDDELLSAWREARTGYPWIDAIMVQLRKWGWM  363

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH VACFLTRGDLF+HWEKGR+VFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIY
Sbjct  364   HHLARHCVACFLTRGDLFVHWEKGRNVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIY  423

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
             SPI+FGKKYDP+GNYI+HFLPVLKDMPKEYIYEPWTAPLS+Q KAKCIIG DYPKPVV+H
Sbjct  424   SPISFGKKYDPNGNYIKHFLPVLKDMPKEYIYEPWTAPLSVQTKAKCIIGRDYPKPVVAH  483

Query  1705  DSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQK  1860
             DSASKEC+++L E+Y LN+KL G + +E+L  L+R++ EQD+  E+K KRQ+
Sbjct  484   DSASKECKKKLAESYALNQKLNGKLGEEDLRNLRRKL-EQDQDQEHKGKRQR  534



>ref|XP_006427183.1| hypothetical protein CICLE_v10025319mg [Citrus clementina]
 gb|ESR40423.1| hypothetical protein CICLE_v10025319mg [Citrus clementina]
Length=543

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/535 (76%), Positives = 481/535 (90%), Gaps = 0/535 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+S S SLMWFRKGLRIHDNPAL++A+  +   +P+FVIDPHYMEPDPTAFSPGS+RAG+
Sbjct  1     MSSGSASLMWFRKGLRIHDNPALEYASKGAKFVYPVFVIDPHYMEPDPTAFSPGSSRAGM  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD SL  LGSRLLV +G+PS++LIRCL+EW ++KLCFEYDT+PYYQAL
Sbjct  61    NRIRFLLESLVDLDLSLKKLGSRLLVFKGEPSEILIRCLQEWDVNKLCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS AGIE F+PVSHTLF+PADII KNGG PPLTYQSFLKLAG P WASSPL  
Sbjct  121   DMKVKDYASTAGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKLAGQPLWASSPLPV  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             SLSSLPP+G++G  ++S VPT+EELGY    ++E + FRGGESEAL++LRESI++KEWVA
Sbjct  181   SLSSLPPVGDVGYFEISEVPTVEELGYKGYGQEELSPFRGGESEALKKLRESISDKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSA+L+PATTVLSPYLKFGCLSSRYFYQC+ +V ++VK+HTSPPVSL+GQLL
Sbjct  241   NFEKPKGDPSAYLKPATTVLSPYLKFGCLSSRYFYQCLTDVYQNVKKHTSPPVSLVGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+FDRM+GNRICKQIPW   DELLAAWR++RTG+PWIDAIMVQLRKWG
Sbjct  301   WRDFFYTVAFGTPNFDRMKGNRICKQIPWSNDDELLAAWREARTGYPWIDAIMVQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGD+F+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDMFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSP++FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPWTAPL+IQ +AKCIIG DYP PVV
Sbjct  421   IYSPVSFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLTIQTRAKCIIGRDYPAPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQ  1863
             SHDSASKEC+++LGEAY LN+KL G V +++L  L+R+ E ++     + ++QK+
Sbjct  481   SHDSASKECKRKLGEAYALNQKLNGQVSEDDLKNLRRKFEGEENQESGRRQKQKR  535



>ref|XP_006465388.1| PREDICTED: (6-4)DNA photolyase-like [Citrus sinensis]
Length=559

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/539 (76%), Positives = 481/539 (89%), Gaps = 1/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+S S SLMWFRKGLRIHDNPAL++A+  +   +P+FV+DPHYMEPDPTAFSPGS+RAGL
Sbjct  17    MSSGSASLMWFRKGLRIHDNPALEYASKGAKFVYPVFVVDPHYMEPDPTAFSPGSSRAGL  76

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD SL  LGSRLLV +G+PS++LIRCL+EW ++KLCFEYDT+PYYQAL
Sbjct  77    NRIRFLLESLVDLDLSLKKLGSRLLVFKGEPSEILIRCLQEWDVNKLCFEYDTDPYYQAL  136

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS AGIE F+PVSHTLF+PADII KNGG PPLTYQSFLKLAG PSWASSPL  
Sbjct  137   DMKVKDYASTAGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKLAGQPSWASSPLPV  196

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             SLSSLPP+G++G+ ++S VPT+EELGY    ++E + FRGGESEAL++LRESI +KEWVA
Sbjct  197   SLSSLPPVGDVGNFEISEVPTVEELGYKGYGQEELSPFRGGESEALKKLRESINDKEWVA  256

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSA+L PATTVLSPYLKFGCLSSRYFYQC+ +V  +VK+HT+PPVSL+GQLL
Sbjct  257   NFEKPKGDPSAYLTPATTVLSPYLKFGCLSSRYFYQCLTDVYNNVKKHTAPPVSLVGQLL  316

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+FDRM+GNRICKQIPW   DELLAAWR++RTG+PWIDAIMVQLRKWG
Sbjct  317   WRDFFYTVAFGTPNFDRMKGNRICKQIPWSNDDELLAAWREARTGYPWIDAIMVQLRKWG  376

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGD+F+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  377   WMHHLARHCVACFLTRGDMFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQYNR  436

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSP++FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPWTAPL+IQ +AKCIIG DYP PVV
Sbjct  437   IYSPVSFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLTIQTRAKCIIGRDYPAPVV  496

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             SHDSASKEC+++LGEAY LN+KL G V ++ L  L+R+ E ++     + ++QK TL G
Sbjct  497   SHDSASKECKRKLGEAYALNQKLNGQVSEDGLKNLRRKFEGEENQESGRRQKQK-TLTG  554



>ref|XP_002304163.2| hypothetical protein POPTR_0003s05870g [Populus trichocarpa]
 gb|EEE79142.2| hypothetical protein POPTR_0003s05870g [Populus trichocarpa]
Length=613

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/554 (75%), Positives = 487/554 (88%), Gaps = 4/554 (1%)
 Frame = +1

Query  214   ISLSARRTSMHPATAM--ASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHY  387
             +SL   + + H    +  AS S S++WFRKGLRIHDNPAL++A+  S   +P+FVIDPHY
Sbjct  58    LSLCLSKPAQHLKNPLMAASGSGSIIWFRKGLRIHDNPALEYASKGSDFVYPVFVIDPHY  117

Query  388   MEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWS  567
             MEPDP AFSPGS  AGLNRIRFLLE+LVDLD+SL  LGSRLL+LRG+P QVL RCLKEW 
Sbjct  118   MEPDPKAFSPGSRLAGLNRIRFLLESLVDLDTSLKKLGSRLLILRGEPGQVLTRCLKEWG  177

Query  568   ISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQS  747
             + KLCFEYDT+P+YQALD +VK YAS AGIE F+PVSHTLF+PADII +NGG PPLTYQS
Sbjct  178   VKKLCFEYDTDPHYQALDIRVKEYASAAGIEVFSPVSHTLFNPADIIQRNGGKPPLTYQS  237

Query  748   FLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGES  927
             FLKLAG PSWASSPL TS+SSLPP+G++GS ++S VPT+++LGY D  E E   FRGGES
Sbjct  238   FLKLAGQPSWASSPLLTSISSLPPVGDVGSCEISEVPTIKDLGYGDI-EQEWIPFRGGES  296

Query  928   EALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLR  1107
             EAL+RL+ESI++KEWVA FEKPKGNPSAF++PATTVLSPYLKFGCLSSRYFYQC+Q+V +
Sbjct  297   EALKRLKESISDKEWVANFEKPKGNPSAFVKPATTVLSPYLKFGCLSSRYFYQCLQDVYK  356

Query  1108  SVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSR  1287
             +V++HTSPPVSL GQLLWRDFFYTVAFGTP+FDRM GN++CKQIPW + DELLAAWR++R
Sbjct  357   NVQKHTSPPVSLAGQLLWRDFFYTVAFGTPNFDRMEGNKLCKQIPWNDDDELLAAWREAR  416

Query  1288  TGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINN  1467
             TG+PWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLF+HWE+GRDVFERLLIDSDWAINN
Sbjct  417   TGYPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFLHWERGRDVFERLLIDSDWAINN  476

Query  1468  GNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSI  1647
             GNW+WLSCSSFFYQY+RIYSPI+FGKKYDP+G+YIRHFLPVLKDMPKEYIYEPWTAP  I
Sbjct  477   GNWLWLSCSSFFYQYNRIYSPISFGKKYDPNGDYIRHFLPVLKDMPKEYIYEPWTAPPGI  536

Query  1648  QRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQD  1827
             QRKAKCIIG DYPKPVV HDSASKEC+++L EAY LNKKL G +  E+L+ L+R++ EQD
Sbjct  537   QRKAKCIIGRDYPKPVVYHDSASKECKRKLAEAYALNKKLNGQLSQEDLDNLRRKL-EQD  595

Query  1828  KSMEYKTKRQKQTL  1869
             +  E K +RQ+Q +
Sbjct  596   EDQEPKIRRQRQKV  609



>ref|XP_007215676.1| hypothetical protein PRUPE_ppa003967mg [Prunus persica]
 gb|EMJ16875.1| hypothetical protein PRUPE_ppa003967mg [Prunus persica]
Length=537

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/539 (77%), Positives = 481/539 (89%), Gaps = 2/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+S S SLMWFRKGLRIHDNPAL++A+  S   +P+FVIDPHYM+PDP AFSPGS++AGL
Sbjct  1     MSSGSGSLMWFRKGLRIHDNPALEYASKGSKFLYPVFVIDPHYMKPDPEAFSPGSSKAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+L DLD +L  LGSRLLVL+G+PS+VLIRCLKEW + KLCFEYDTEPYYQAL
Sbjct  61    NRIQFLLESLRDLDLNLKRLGSRLLVLKGEPSEVLIRCLKEWDVKKLCFEYDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS AGIE ++PVSHTLF+PADII KNGG PPL+YQSFLKLAG PSW SSPLS 
Sbjct  121   DVKVKSYASTAGIEIYSPVSHTLFNPADIIRKNGGKPPLSYQSFLKLAGEPSWVSSPLSI  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             +LSSLPP+GN G+  +S VPT+EELGY +  +DE   FRGGE+EAL+RLRESI NKEWVA
Sbjct  181   TLSSLPPVGNTGNCNISEVPTVEELGYEETQQDELCPFRGGETEALKRLRESIENKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C++++ ++VK HT PPVSL GQLL
Sbjct  241   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYICLKDLYKNVKMHTVPPVSLAGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTPSFD+MRGN+ICKQIPW + +ELL AWR++RTGFPWIDAIM+QLRKWG
Sbjct  301   WRDFFYTVAFGTPSFDQMRGNKICKQIPWNDDEELLVAWREARTGFPWIDAIMIQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP+G+YIRHFLPVLKDMPKEYIYEPWTAPLSIQ KAKCIIG DYPKPVV
Sbjct  421   IYSPISFGKKYDPNGDYIRHFLPVLKDMPKEYIYEPWTAPLSIQNKAKCIIGRDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             +HDSA+K+CR+R+ EAY LN+K+ GMV  E+L  L+R++EE D+  E + KRQ++ LIG
Sbjct  481   AHDSANKDCRRRMAEAYALNQKMSGMVSAEDLRNLRRKLEE-DQKPEVENKRQRK-LIG  537



>ref|XP_004136080.1| PREDICTED: (6-4)DNA photolyase-like [Cucumis sativus]
Length=549

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/543 (75%), Positives = 486/543 (90%), Gaps = 5/543 (1%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA  S SLMWFRKG+RIHDNPAL++AA  +   +P+FVIDPHYMEPDP+AFS GS+RAGL
Sbjct  1     MAPSSNSLMWFRKGIRIHDNPALEYAAKGAKFLYPVFVIDPHYMEPDPSAFSLGSSRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD +L  LGSRLLVL G+P +VLIRCLKEW++ KLCFEYDT+PYYQAL
Sbjct  61    NRIRFLLESLVDLDLNLKKLGSRLLVLHGEPGEVLIRCLKEWNVKKLCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D +V+N+AS AGIE F+PVSHTLF+PADII KNGG+PPL+YQSFLKLAG PSWA +PLST
Sbjct  121   DIRVQNHASAAGIEVFSPVSHTLFNPADIIQKNGGSPPLSYQSFLKLAGEPSWACAPLST  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIAN-----  963
             ++SSLPP+G+ G  ++S VPT+++LGY D ++D+ T FRGGE+EAL+RL+ES++      
Sbjct  181   TVSSLPPVGDTGRSEISDVPTIKDLGYEDMAKDDWTPFRGGETEALKRLKESMSFLIGSL  240

Query  964   KEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSL  1143
             ++WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+QE+ ++VK HTSPPVSL
Sbjct  241   QDWVAKFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQEIYKNVKGHTSPPVSL  300

Query  1144  LGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQ  1323
             +GQLLWR+FFYT AFGTP+FDRM+ N+ICKQIPW + +ELLAAWRD+RTGFPWIDAIMVQ
Sbjct  301   VGQLLWREFFYTAAFGTPNFDRMKDNKICKQIPWNDDNELLAAWRDARTGFPWIDAIMVQ  360

Query  1324  LRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFF  1503
             LRKWGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINN NW+WLSCSSFF
Sbjct  361   LRKWGWMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNANWLWLSCSSFF  420

Query  1504  YQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDY  1683
             YQY+R+YSPITFGKKYDP+G++IRHFLPVLKDMPK+YIYEPWTAPLSIQ+KAKCIIG DY
Sbjct  421   YQYNRVYSPITFGKKYDPNGDFIRHFLPVLKDMPKQYIYEPWTAPLSIQKKAKCIIGEDY  480

Query  1684  PKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQ  1863
             PKPVVSHD A KECR+++GEAYELNK+L G++ DE+L  LK+R  E+D+    +TKR++Q
Sbjct  481   PKPVVSHDIAIKECRKKMGEAYELNKRLKGLISDEDLENLKKRNSEEDQRQNAQTKRKRQ  540

Query  1864  TLI  1872
             TLI
Sbjct  541   TLI  543



>ref|XP_008461072.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Cucumis melo]
Length=562

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/537 (75%), Positives = 483/537 (90%), Gaps = 0/537 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS S SLMWFRKG+RIHDNPAL++AA  +   +P+FVIDPHYMEPDP+AFSPGS+RAGL
Sbjct  19    MASSSNSLMWFRKGIRIHDNPALEYAAKGANFLYPVFVIDPHYMEPDPSAFSPGSSRAGL  78

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD +L  LGSRLLVL G+P +VLIRCL+EW++ KLCFEYDT+PYYQAL
Sbjct  79    NRIRFLLESLVDLDLNLKKLGSRLLVLHGEPGEVLIRCLEEWNVKKLCFEYDTDPYYQAL  138

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             DA+V+N AS AGIE F+PVSHTLF+PADII KNGG+PPL+YQSFLKLAG PSWA +PLST
Sbjct  139   DARVQNLASAAGIEVFSPVSHTLFNPADIIQKNGGSPPLSYQSFLKLAGEPSWACAPLST  198

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPP+G+ G   +S VPT+++LGY D ++D+ T FRGGE+EAL+RL ES++NK+WVA
Sbjct  199   TVSSLPPVGDTGRSDISDVPTIKDLGYEDMAKDDWTPFRGGETEALKRLEESMSNKDWVA  258

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQ +QE+  +V+ HTSPPVSL+GQLL
Sbjct  259   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQRIQEIYNNVEGHTSPPVSLVGQLL  318

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FD M+ N+ICKQIPW + +ELLAAWRD+RTGFPWIDAIMVQLRKWG
Sbjct  319   WREFFYTAAFGTPNFDCMKDNKICKQIPWNDDNELLAAWRDARTGFPWIDAIMVQLRKWG  378

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINN NW+WLSCSSFFYQY+R
Sbjct  379   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNANWLWLSCSSFFYQYNR  438

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPITFGKKYDP+G++IRHFLPVLKDMPK+YIYEPWTAPLSIQ+KAKCIIG DYPKPV+
Sbjct  439   VYSPITFGKKYDPNGDFIRHFLPVLKDMPKQYIYEPWTAPLSIQKKAKCIIGEDYPKPVL  498

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             SHD A KECR+++GEAYELNK+L G++ +E+L  LK++  E+D+    +TKR++QTL
Sbjct  499   SHDIAIKECRKKMGEAYELNKRLKGLISEEDLENLKKQNSEEDQRQNAQTKRKRQTL  555



>ref|XP_011040009.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Populus euphratica]
Length=558

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/554 (75%), Positives = 487/554 (88%), Gaps = 4/554 (1%)
 Frame = +1

Query  214   ISLSARRTSMHPATAM--ASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHY  387
             +SL   + + H    +  AS S S+MWFRK LRIHDNPAL++A+  S   +P+FVIDPHY
Sbjct  3     LSLCLSKPTQHLKNPLMAASGSGSIMWFRKALRIHDNPALEYASKGSDFVYPVFVIDPHY  62

Query  388   MEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWS  567
             MEPDP AFSPGS  AGLNRIRFLLE+LVDLD+SL  LGSRLL+LRG+P QVLIRCLKEW 
Sbjct  63    MEPDPKAFSPGSRLAGLNRIRFLLESLVDLDTSLKKLGSRLLILRGEPGQVLIRCLKEWG  122

Query  568   ISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQS  747
             + KLCFEYDT+P+YQALD +VK YAS AGIE F+PVSHTLF+PADII +NGG PPLTYQS
Sbjct  123   VKKLCFEYDTDPHYQALDIRVKEYASAAGIEVFSPVSHTLFNPADIIQRNGGKPPLTYQS  182

Query  748   FLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGES  927
             FLKL+G PSWASSPL TS+SSLPP+G++GS ++S VPT+++LGY D  E E   FRGGES
Sbjct  183   FLKLSGQPSWASSPLLTSISSLPPVGDVGSCEISEVPTIKDLGYGDI-EQEWIPFRGGES  241

Query  928   EALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLR  1107
             EAL+RL+ESI++KEWVA FEKPKGNPSAF++PATTVLSPYLKFGCLSSRYFYQC+Q+V +
Sbjct  242   EALKRLKESISDKEWVANFEKPKGNPSAFVKPATTVLSPYLKFGCLSSRYFYQCLQDVYK  301

Query  1108  SVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSR  1287
             +V++HTSPPVSL GQLLWRDFFYTVAFGTP+FDRM GN++CKQIPW + DELLAAWR++R
Sbjct  302   NVQKHTSPPVSLAGQLLWRDFFYTVAFGTPNFDRMEGNKLCKQIPWNDDDELLAAWREAR  361

Query  1288  TGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINN  1467
             TG+PWIDAIMVQL KWGWMHHLARHSVACFLTRGDLF+HWE+GRDVFERLLIDSDWAINN
Sbjct  362   TGYPWIDAIMVQLHKWGWMHHLARHSVACFLTRGDLFLHWERGRDVFERLLIDSDWAINN  421

Query  1468  GNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSI  1647
             GNW+WLSCSSFFYQY+RIYSPI+FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPWTAP  I
Sbjct  422   GNWLWLSCSSFFYQYNRIYSPISFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPPGI  481

Query  1648  QRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQD  1827
             QRKAKCIIG DYPKPVV HDSASKEC+++L EAY LN+KL G +  E+L+ L+R++ EQD
Sbjct  482   QRKAKCIIGRDYPKPVVYHDSASKECKRKLAEAYALNQKLNGQLSQEDLDNLRRKL-EQD  540

Query  1828  KSMEYKTKRQKQTL  1869
             + +E K +RQ+Q +
Sbjct  541   EDLEPKIRRQRQKV  554



>ref|XP_004302937.1| PREDICTED: (6-4)DNA photolyase-like [Fragaria vesca subsp. vesca]
Length=548

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/539 (76%), Positives = 477/539 (88%), Gaps = 1/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M++ S SLMWFRKGLRIHDNPAL+HA+ AS   +P+FVIDPHYM+PDPTA SPGS+RAGL
Sbjct  1     MSTGSGSLMWFRKGLRIHDNPALEHASKASNFLYPVFVIDPHYMKPDPTAPSPGSSRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLL++LVDLD SL  LGS LLVL+GDP +V++RCLKEW + KLCFEYDTEPYYQAL
Sbjct  61    NRIRFLLQSLVDLDLSLKKLGSGLLVLKGDPGEVIVRCLKEWDVKKLCFEYDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK +AS AGIE ++PVSH LF+PA+II KNGG PPL+YQSFLKLAG P W SS LS 
Sbjct  121   DGKVKGFASAAGIEVYSPVSHMLFNPAEIIQKNGGRPPLSYQSFLKLAGEPLWMSSSLSM  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPP+GN+ + +VS VPT+EELGY +  +DE + F+GGESEAL+RLRESI  KEWVA
Sbjct  181   TVSSLPPVGNVANFEVSEVPTVEELGYEEAQQDEFSPFKGGESEALQRLRESIEKKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q+V ++VKRHT PPVSL+GQLL
Sbjct  241   NFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYTCLQDVQKNVKRHTLPPVSLVGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+FD+MRGN+ICKQIPW + D LLAAWR++RTG+PWIDAIM QLRKWG
Sbjct  301   WRDFFYTVAFGTPNFDQMRGNKICKQIPWNDDDNLLAAWREARTGYPWIDAIMTQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSS FYQY+R
Sbjct  361   WMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSLFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDP+G+YIRHFLPVLKDMPKEYIYEPWTAPLSIQ KAKCIIG DYPKPVV
Sbjct  421   IYSPISFGKKYDPNGDYIRHFLPVLKDMPKEYIYEPWTAPLSIQNKAKCIIGRDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
              HDSASKEC++++ EAY LN+KL G+V +E+L  L+R++EE D+  E K KRQ++   G
Sbjct  481   YHDSASKECKKKMAEAYALNQKLTGLVSEEDLINLRRKLEE-DQKPEVKNKRQRKLTDG  538



>ref|XP_008377613.1| PREDICTED: (6-4)DNA photolyase [Malus domestica]
Length=537

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/539 (77%), Positives = 480/539 (89%), Gaps = 2/539 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+S S SLMWFRKGLRIHDNPAL++A+  S   +P+FVIDPHYM+PD  AFSPGS++AGL
Sbjct  1     MSSGSSSLMWFRKGLRIHDNPALEYASKGSDFLYPVFVIDPHYMKPDADAFSPGSSKAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLDS+L  LGSRLLVL+G+PS+VL RCLKEW + +LCFEYDTEPYYQAL
Sbjct  61    NRIRFLLESLSDLDSNLKKLGSRLLVLKGEPSEVLNRCLKEWDVKRLCFEYDTEPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK YAS AGIE F+PVSHTLF+PADII +NGG PPLTYQSF+KL G PSWASSPLS 
Sbjct  121   DVKVKGYASAAGIEVFSPVSHTLFNPADIIRRNGGRPPLTYQSFVKLVGDPSWASSPLSI  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             +LSSLPPIG+ G  ++S VPT+EELGY +  +DE + F+GGESEAL++LRESI  KEWVA
Sbjct  181   TLSSLPPIGSFGRCEISEVPTVEELGYEETQQDEHSPFKGGESEALKKLRESIEKKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL PATTVLSPYLKFGCLSSRYFY C+Q++ ++VK HTSPPVSL GQLL
Sbjct  241   NFEKPKGDPSAFLTPATTVLSPYLKFGCLSSRYFYICLQDLYKNVKSHTSPPVSLAGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+FDRMRGN+ICKQIPW + DELL AWR++RTGFPWIDAIM+QLRKWG
Sbjct  301   WRDFFYTVAFGTPNFDRMRGNKICKQIPWNDDDELLQAWREARTGFPWIDAIMIQLRKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  361   WMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSP +FGKKYDP+G+YIRHFLPVLK+MPKEYIYEPWTAP SIQ+KAKCIIG DYPKPVV
Sbjct  421   IYSPTSFGKKYDPNGDYIRHFLPVLKEMPKEYIYEPWTAPESIQKKAKCIIGRDYPKPVV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             +HDSASKEC++R+ EAY LN+KL G+V +E+L  L+R++E+ +K  E K KRQ++ LIG
Sbjct  481   AHDSASKECKRRMAEAYALNQKLTGLVSEEDLRNLRRKLEKDEKP-EVKNKRQRK-LIG  537



>ref|XP_011040008.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Populus euphratica]
Length=580

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/576 (72%), Positives = 487/576 (85%), Gaps = 26/576 (5%)
 Frame = +1

Query  214   ISLSARRTSMHPATAM--ASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHY  387
             +SL   + + H    +  AS S S+MWFRK LRIHDNPAL++A+  S   +P+FVIDPHY
Sbjct  3     LSLCLSKPTQHLKNPLMAASGSGSIMWFRKALRIHDNPALEYASKGSDFVYPVFVIDPHY  62

Query  388   MEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWS  567
             MEPDP AFSPGS  AGLNRIRFLLE+LVDLD+SL  LGSRLL+LRG+P QVLIRCLKEW 
Sbjct  63    MEPDPKAFSPGSRLAGLNRIRFLLESLVDLDTSLKKLGSRLLILRGEPGQVLIRCLKEWG  122

Query  568   ISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQS  747
             + KLCFEYDT+P+YQALD +VK YAS AGIE F+PVSHTLF+PADII +NGG PPLTYQS
Sbjct  123   VKKLCFEYDTDPHYQALDIRVKEYASAAGIEVFSPVSHTLFNPADIIQRNGGKPPLTYQS  182

Query  748   FLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGES  927
             FLKL+G PSWASSPL TS+SSLPP+G++GS ++S VPT+++LGY D  E E   FRGGES
Sbjct  183   FLKLSGQPSWASSPLLTSISSLPPVGDVGSCEISEVPTIKDLGYGDI-EQEWIPFRGGES  241

Query  928   EALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLR  1107
             EAL+RL+ESI++KEWVA FEKPKGNPSAF++PATTVLSPYLKFGCLSSRYFYQC+Q+V +
Sbjct  242   EALKRLKESISDKEWVANFEKPKGNPSAFVKPATTVLSPYLKFGCLSSRYFYQCLQDVYK  301

Query  1108  SVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSR  1287
             +V++HTSPPVSL GQLLWRDFFYTVAFGTP+FDRM GN++CKQIPW + DELLAAWR++R
Sbjct  302   NVQKHTSPPVSLAGQLLWRDFFYTVAFGTPNFDRMEGNKLCKQIPWNDDDELLAAWREAR  361

Query  1288  TGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINN  1467
             TG+PWIDAIMVQL KWGWMHHLARHSVACFLTRGDLF+HWE+GRDVFERLLIDSDWAINN
Sbjct  362   TGYPWIDAIMVQLHKWGWMHHLARHSVACFLTRGDLFLHWERGRDVFERLLIDSDWAINN  421

Query  1468  GNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSI  1647
             GNW+WLSCSSFFYQY+RIYSPI+FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPWTAP  I
Sbjct  422   GNWLWLSCSSFFYQYNRIYSPISFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPPGI  481

Query  1648  QRKAKCIIGIDYPKP----------------------VVSHDSASKECRQRLGEAYELNK  1761
             QRKAKCIIG DYPKP                      VV HDSASKEC+++L EAY LN+
Sbjct  482   QRKAKCIIGRDYPKPVDLPCICMQMGVILIFTLMLVSVVYHDSASKECKRKLAEAYALNQ  541

Query  1762  KLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             KL G +  E+L+ L+R++ EQD+ +E K +RQ+Q +
Sbjct  542   KLNGQLSQEDLDNLRRKL-EQDEDLEPKIRRQRQKV  576



>ref|XP_006406944.1| hypothetical protein EUTSA_v10020425mg [Eutrema salsugineum]
 gb|ESQ48397.1| hypothetical protein EUTSA_v10020425mg [Eutrema salsugineum]
Length=557

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/555 (72%), Positives = 480/555 (86%), Gaps = 2/555 (0%)
 Frame = +1

Query  205   LSAISLSARRTSMHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPH  384
              S  S S+ R S  P T+MA+ S SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPH
Sbjct  4     FSVCSPSSYRLS--PITSMATGSGSLIWFRKGLRVHDNPALEYASKGSQFLYPVFVIDPH  61

Query  385   YMEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEW  564
             YME DP+AFSPGS+RAG+NRIRFLLE+L DLDSSL  LGSRLLVL+G+P ++L+RCL+EW
Sbjct  62    YMESDPSAFSPGSSRAGVNRIRFLLESLRDLDSSLKKLGSRLLVLKGEPGEILVRCLQEW  121

Query  565   SISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQ  744
              + +LCFEYDT+PYYQALD KVK+YAS  G+E F+PVSHTLF+P+DII KNGG PPL+YQ
Sbjct  122   KVKRLCFEYDTDPYYQALDFKVKDYASSTGVEVFSPVSHTLFNPSDIIAKNGGKPPLSYQ  181

Query  745   SFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGE  924
             SFLK+AG PS   S L  S SSLPPIG++G L +S VPTLEELGY +  + E T FRGGE
Sbjct  182   SFLKIAGEPSCVESELVMSYSSLPPIGDVGKLGISEVPTLEELGYREDEQAEWTPFRGGE  241

Query  925   SEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVL  1104
             SEAL+RL +SI++K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q + 
Sbjct  242   SEALKRLTKSISDKVWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQRIY  301

Query  1105  RSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDS  1284
             + +K+HTSPPVSLLGQLLWR+FFYT AFGTP+FD+M+GNRICKQIPWKE  ++LAAWRDS
Sbjct  302   KDMKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWKEDPDMLAAWRDS  361

Query  1285  RTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAIN  1464
             +TG+PWIDAIMVQLRKWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWA+N
Sbjct  362   KTGYPWIDAIMVQLRKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAVN  421

Query  1465  NGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS  1644
             NGNWMWLSCSSFFYQY+RIYSP++FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAP+S
Sbjct  422   NGNWMWLSCSSFFYQYNRIYSPVSFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPIS  481

Query  1645  IQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQ  1824
             +Q KAKCI+G DYPKP+V HD ASKEC++++GE Y LNKK+ G V DE+L +L+R++++ 
Sbjct  482   VQAKAKCIVGKDYPKPMVLHDLASKECKRKMGETYALNKKMNGKVGDEDLRDLRRKLQKD  541

Query  1825  DKSMEYKTKRQKQTL  1869
             D+  E K + Q+  L
Sbjct  542   DEHDESKIRNQRPKL  556



>ref|XP_010691197.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/568 (71%), Positives = 480/568 (85%), Gaps = 5/568 (1%)
 Frame = +1

Query  181   VFLSLQTTLSAISLSAR----RTSMHPATAMASESCSLMWFRKGLRIHDNPALQHAANAS  348
             +F+  +T+ +  S S R     T    +T+  +   SLMWFRKGLRIHDNPAL+HAA  S
Sbjct  13    IFIPAKTSTAKNSPSTRFKMTGTGAGTSTSADNSKSSLMWFRKGLRIHDNPALEHAAMGS  72

Query  349   TKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGD  528
                +P+FVIDPHYM+PDP +FSPGSTRAG+NRI+FLLE+L+DLD++L  +GS+LLVL+G+
Sbjct  73    NFVYPIFVIDPHYMDPDPDSFSPGSTRAGVNRIKFLLESLLDLDTNLRKIGSKLLVLKGE  132

Query  529   PSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADII  708
             P  VLI CLK+W+I KLCFEYDT+PYYQALDA+++ Y S+AGIE F+PVSHTLFDP  +I
Sbjct  133   PGDVLIHCLKQWNIKKLCFEYDTDPYYQALDARIEKYTSLAGIEVFSPVSHTLFDPRAVI  192

Query  709   HKNGGTPPLTYQSFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDC  888
              KNGG PPLTYQSF K++G PSW SSPLS    S+P  G++  LQ+S VPTLEELGYV+ 
Sbjct  193   DKNGGKPPLTYQSFRKVSGQPSWLSSPLSNGPLSIPSPGDIEDLQISNVPTLEELGYVNV  252

Query  889   SEDERTSFRGGESEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLS  1068
              + E + ++GGESEAL+RL++S+ +KEWVA FEKPKG+PS+FL+PATTVLSPYLKFGCLS
Sbjct  253   GQQEFSPYKGGESEALKRLKQSLDDKEWVAKFEKPKGDPSSFLKPATTVLSPYLKFGCLS  312

Query  1069  SRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWK  1248
             SRYFYQC+QE  ++VK HTSPPVSLLGQLLWRDFFYT AFGTP+FDRM GNRICKQIPW 
Sbjct  313   SRYFYQCIQESYKNVKHHTSPPVSLLGQLLWRDFFYTAAFGTPNFDRMTGNRICKQIPWN  372

Query  1249  ESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVF  1428
             E  +LLAAWRD RTG+PWIDAIMVQL KWGWMHHLARH VACFLTRGDLFIHWEKGRDVF
Sbjct  373   EDSQLLAAWRDGRTGYPWIDAIMVQLHKWGWMHHLARHCVACFLTRGDLFIHWEKGRDVF  432

Query  1429  ERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPK  1608
             ERLLIDSDWAINNGNW+WLSCSSFFY+YHRIYSPITFGKKYDP+GN+IRHFLPVLKDMPK
Sbjct  433   ERLLIDSDWAINNGNWLWLSCSSFFYEYHRIYSPITFGKKYDPNGNFIRHFLPVLKDMPK  492

Query  1609  EYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDE  1788
             EYIYEPWTAP SIQ KAKC+IG DYP PV+SHDSASKEC+++L EAY LN++  G V ++
Sbjct  493   EYIYEPWTAPKSIQVKAKCVIGKDYPSPVISHDSASKECKRKLAEAYALNRQSNGSVSED  552

Query  1789  ELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             +L++LKR+ +E D++ E   K+ KQ LI
Sbjct  553   DLSKLKRKFDE-DQTQEPNVKKLKQKLI  579



>ref|XP_010691198.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=580

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/568 (71%), Positives = 480/568 (85%), Gaps = 6/568 (1%)
 Frame = +1

Query  181   VFLSLQTTLSAISLSAR----RTSMHPATAMASESCSLMWFRKGLRIHDNPALQHAANAS  348
             +F+  +T+ +  S S R     T    +T+  +   SLMWFRKGLRIHDNPAL+HAA  S
Sbjct  13    IFIPAKTSTAKNSPSTRFKMTGTGAGTSTSADNSKSSLMWFRKGLRIHDNPALEHAAMGS  72

Query  349   TKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGD  528
                +P+FVIDPHYM+PDP +FSPGSTRAG+NRI+FLLE+L+DLD++L  +GS+LLVL+G+
Sbjct  73    NFVYPIFVIDPHYMDPDPDSFSPGSTRAGVNRIKFLLESLLDLDTNLRKIGSKLLVLKGE  132

Query  529   PSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADII  708
             P  VLI CLK+W+I KLCFEYDT+PYYQALDA+++ Y S+AGIE F+PVSHTLFDP  +I
Sbjct  133   PGDVLIHCLKQWNIKKLCFEYDTDPYYQALDARIEKYTSLAGIEVFSPVSHTLFDPRAVI  192

Query  709   HKNGGTPPLTYQSFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDC  888
              KNGG PPLTYQSF K++G PSW SSPLS    S+P  G++  LQ+S VPTLEELGYV+ 
Sbjct  193   DKNGGKPPLTYQSFRKVSGQPSWLSSPLSNGPLSIPSPGDIEDLQISNVPTLEELGYVNV  252

Query  889   SEDERTSFRGGESEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLS  1068
              + E + ++GGESEAL+RL++S+ +KEWVA FEKPKG+PS+FL+PATTVLSPYLKFGCLS
Sbjct  253   GQ-EFSPYKGGESEALKRLKQSLDDKEWVAKFEKPKGDPSSFLKPATTVLSPYLKFGCLS  311

Query  1069  SRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWK  1248
             SRYFYQC+QE  ++VK HTSPPVSLLGQLLWRDFFYT AFGTP+FDRM GNRICKQIPW 
Sbjct  312   SRYFYQCIQESYKNVKHHTSPPVSLLGQLLWRDFFYTAAFGTPNFDRMTGNRICKQIPWN  371

Query  1249  ESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVF  1428
             E  +LLAAWRD RTG+PWIDAIMVQL KWGWMHHLARH VACFLTRGDLFIHWEKGRDVF
Sbjct  372   EDSQLLAAWRDGRTGYPWIDAIMVQLHKWGWMHHLARHCVACFLTRGDLFIHWEKGRDVF  431

Query  1429  ERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPK  1608
             ERLLIDSDWAINNGNW+WLSCSSFFY+YHRIYSPITFGKKYDP+GN+IRHFLPVLKDMPK
Sbjct  432   ERLLIDSDWAINNGNWLWLSCSSFFYEYHRIYSPITFGKKYDPNGNFIRHFLPVLKDMPK  491

Query  1609  EYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDE  1788
             EYIYEPWTAP SIQ KAKC+IG DYP PV+SHDSASKEC+++L EAY LN++  G V ++
Sbjct  492   EYIYEPWTAPKSIQVKAKCVIGKDYPSPVISHDSASKECKRKLAEAYALNRQSNGSVSED  551

Query  1789  ELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             +L++LKR+ +E D++ E   K+ KQ LI
Sbjct  552   DLSKLKRKFDE-DQTQEPNVKKLKQKLI  578



>ref|XP_006346590.1| PREDICTED: (6-4)DNA photolyase-like isoform X2 [Solanum tuberosum]
Length=515

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/538 (75%), Positives = 466/538 (87%), Gaps = 24/538 (4%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS + SLMWFRKGLR+HDNPAL++AA  S   +P+FVIDPHYMEPDPTAFS GS++AGL
Sbjct  1     MASGANSLMWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMEPDPTAFSLGSSKAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+LVDLD SL  +GSRLLVL+GDP +VLIRCLKE                   
Sbjct  61    NRIQFLLESLVDLDLSLKKVGSRLLVLKGDPGEVLIRCLKE-------------------  101

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
                   Y S  G+E F+PVSHTL++PADII KNGG+PPL+YQSFLKLAG PSWA++PL T
Sbjct  102   -----GYVSGTGVEIFSPVSHTLYNPADIIRKNGGSPPLSYQSFLKLAGQPSWATTPLLT  156

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPPIGN GS  VS VPT+ ELGY D +EDERT F+GGESEAL+RLRESIANKEWVA
Sbjct  157   TISSLPPIGNTGSFAVSEVPTVRELGYEDLAEDERTPFKGGESEALKRLRESIANKEWVA  216

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q++L+  K+HTSPPVSLLGQLL
Sbjct  217   NFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQDILKCSKKHTSPPVSLLGQLL  276

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYT AFGTP+F++M+GNRICKQIPWK  DELLAAWRDSRTGFPWIDAIMVQLRKWG
Sbjct  277   WRDFFYTAAFGTPNFNQMKGNRICKQIPWKNDDELLAAWRDSRTGFPWIDAIMVQLRKWG  336

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARHSVACFLTRGDLF+HWE+GR VFERLLIDSDWAINNGNW+WLSCSSFFYQY+R
Sbjct  337   WIHHLARHSVACFLTRGDLFVHWERGRHVFERLLIDSDWAINNGNWLWLSCSSFFYQYNR  396

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYD  GNYIRHFLPVLKDMPKEYIYEPWTAP+S+QRKAKCIIGIDYPKPVV
Sbjct  397   IYSPISFGKKYDSAGNYIRHFLPVLKDMPKEYIYEPWTAPISVQRKAKCIIGIDYPKPVV  456

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             SHDSASKEC+ RLGEAY LNKKL G+V DE+LNEL+R+ + +  +++  ++++KQ LI
Sbjct  457   SHDSASKECKMRLGEAYALNKKLNGLVSDEDLNELRRKADNESTTLDSVSRKKKQKLI  514



>ref|XP_007135727.1| hypothetical protein PHAVU_010G153200g [Phaseolus vulgaris]
 gb|ESW07721.1| hypothetical protein PHAVU_010G153200g [Phaseolus vulgaris]
Length=536

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/538 (73%), Positives = 470/538 (87%), Gaps = 4/538 (1%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M S S SL+WFRKG+RIHDNPAL+ A+ +++  +P+FVIDPHYM+PDP A SPGS+RAGL
Sbjct  2     MGSGSGSLVWFRKGIRIHDNPALEFASRSASHLYPVFVIDPHYMKPDPNAPSPGSSRAGL  61

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRI+FLLE+LVDLD +L NLGSRLL+L+GDP++V+I+CLKEW+++KLCFEYDT+PYYQAL
Sbjct  62    NRIKFLLESLVDLDLNLKNLGSRLLILKGDPAEVVIQCLKEWNVNKLCFEYDTDPYYQAL  121

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVKN+A  AGIE F+PVSHTLF+P DIIHKNGG PPL+YQSF+KLAG P +  + + +
Sbjct  122   DVKVKNFALGAGIEVFSPVSHTLFNPTDIIHKNGGKPPLSYQSFVKLAGEPPFPLTTMYS  181

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             SL     +G+LGS  +S VPT+ +LGY D  +DE + F+GGESEALRRL E + NK WVA
Sbjct  182   SLPP---VGHLGSCVISEVPTITDLGYGDAEQDEFSPFKGGESEALRRLDECMKNKGWVA  238

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKGNPSAFL+PATTVLSPYLKFGCLSSRYFY+ +Q++ +S+ +HTSPPVSL GQLL
Sbjct  239   NFEKPKGNPSAFLKPATTVLSPYLKFGCLSSRYFYRQIQDIYKSMPKHTSPPVSLAGQLL  298

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FDRM+GNRICKQIPWK+ D+LL AWR++RTGFPWIDAIM+QLRKWG
Sbjct  299   WREFFYTAAFGTPNFDRMKGNRICKQIPWKDDDKLLEAWREARTGFPWIDAIMIQLRKWG  358

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY+R
Sbjct  359   WMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNR  418

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSP TFGKKYDP+G+YIRHFLPVLKDMP+EYIYEPWTAP SIQ KA CIIG DYP PVV
Sbjct  419   IYSPTTFGKKYDPNGDYIRHFLPVLKDMPREYIYEPWTAPKSIQTKANCIIGKDYPMPVV  478

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             SHDSASKECR ++GEAY LNKKL G+V +++L  L+R+++E ++  E + KR KQ L+
Sbjct  479   SHDSASKECRGKMGEAYALNKKLNGLVSEDDLKNLRRKLDESERQ-EPQAKRSKQQLL  535



>ref|NP_566520.1| (6-4)DNA photolyase [Arabidopsis thaliana]
 sp|O48652.2|UVR3_ARATH RecName: Full=(6-4)DNA photolyase; AltName: Full=Protein UV repair 
defective 3 [Arabidopsis thaliana]
 gb|AEE75703.1| (6-4)DNA photolyase [Arabidopsis thaliana]
Length=556

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/543 (73%), Positives = 472/543 (87%), Gaps = 1/543 (0%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPG  420
             ++P T+MA+ S SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME DP+AFSPG
Sbjct  14    LNPITSMATGSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPG  73

Query  421   STRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTE  600
             S+RAG+NRIRFLLE+L DLDSSL  LGSRLLV +G+P +VL+RCL+EW + +LCFEYDT+
Sbjct  74    SSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTD  133

Query  601   PYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWA  780
             PYYQALD KVK+YAS  G+E F+PVSHTLF+PA II KNGG PPL+YQSFLK+AG PS A
Sbjct  134   PYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCA  193

Query  781   ssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIA  960
              S L  S SSLPPIG++G+L +S VP+LEELGY D  + + T FRGGESEAL+RL +SI+
Sbjct  194   KSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSIS  253

Query  961   NKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVS  1140
             +K WVA FEKPKG+PSAFL+PATTV+SPYLKFGCLSSRYFYQC+Q + + VK+HTSPPVS
Sbjct  254   DKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVS  313

Query  1141  LLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMV  1320
             LLGQLLWR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMV
Sbjct  314   LLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMV  373

Query  1321  QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSF  1500
             QL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSF
Sbjct  374   QLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSF  433

Query  1501  FYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGID  1680
             FYQ++RIYSPI+FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KA CI+G D
Sbjct  434   FYQFNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKD  493

Query  1681  YPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQK  1860
             YPKP+V HDSASKEC++++GEAY LNKK+ G V +E L +L+R++ ++D+  E K + Q+
Sbjct  494   YPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKL-QKDEHEESKIRNQR  552

Query  1861  QTL  1869
               L
Sbjct  553   PKL  555



>ref|XP_006299359.1| hypothetical protein CARUB_v10015516mg [Capsella rubella]
 gb|EOA32257.1| hypothetical protein CARUB_v10015516mg [Capsella rubella]
Length=558

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/555 (72%), Positives = 471/555 (85%), Gaps = 1/555 (0%)
 Frame = +1

Query  205   LSAISLSARRTSMHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPH  384
              S  S S+ R +  P + MA+ S SL+WFRKGLRIHDNPAL++A+  S   +P+FVIDPH
Sbjct  4     FSVCSPSSYRLN-RPISTMATGSGSLVWFRKGLRIHDNPALEYASKGSQFLYPVFVIDPH  62

Query  385   YMEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEW  564
             YME DP+AFSPGS+RAG+NRIRFLLE+L DLDSSL  LGSRLLVL+G+P +VL+RCL+EW
Sbjct  63    YMESDPSAFSPGSSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVLKGEPGEVLVRCLQEW  122

Query  565   SISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQ  744
              + +LCFEYDT+PYYQALD +VK+YAS  G+E F+PVSHTLF+P+DII KNGG  PL+YQ
Sbjct  123   KVKRLCFEYDTDPYYQALDVRVKDYASSTGVEVFSPVSHTLFNPSDIIEKNGGKTPLSYQ  182

Query  745   SFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGE  924
             SFLK+AG PS A S L  S SSLPPIG +GSL +S VP LEELGY D  + E T FRGGE
Sbjct  183   SFLKIAGEPSCAKSELVMSYSSLPPIGAVGSLGISEVPILEELGYTDDEQAEWTPFRGGE  242

Query  925   SEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVL  1104
             SEAL+RL +S+++K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q + 
Sbjct  243   SEALKRLTKSVSDKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQNLY  302

Query  1105  RSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDS  1284
             + VK+HTSPPVSLLGQLLWR+FFYT AFGTP+FD+M+GN ICKQIPW E   +LAAWRD 
Sbjct  303   KDVKKHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMKGNPICKQIPWNEDHAMLAAWRDG  362

Query  1285  RTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAIN  1464
             +TG+PWIDAIM+QL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAIN
Sbjct  363   KTGYPWIDAIMIQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAIN  422

Query  1465  NGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS  1644
             NGNWMWLSCSSFFYQY+RIYSPI+FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS
Sbjct  423   NGNWMWLSCSSFFYQYNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLS  482

Query  1645  IQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQ  1824
             +Q KA CI+G DYPKP+V HDSASKEC++++GE Y LNKK+GG V DE+L  L+R+++E 
Sbjct  483   VQTKANCIVGKDYPKPMVLHDSASKECKRKMGETYALNKKMGGKVDDEDLRGLRRKLQED  542

Query  1825  DKSMEYKTKRQKQTL  1869
                   K + Q++ L
Sbjct  543   GHEESTKIRNQRRKL  557



>ref|XP_009115379.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Brassica rapa]
Length=572

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/545 (73%), Positives = 471/545 (86%), Gaps = 3/545 (1%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAAN--ASTKCFPLFVIDPHYMEPDPTAFS  414
             ++P T+M++ S SL+WFRKGLR+HDNPAL+HA +  +S   +P+FVIDP YMEPDP+AFS
Sbjct  15    LNPVTSMSTGSNSLIWFRKGLRVHDNPALEHACSKASSGSMYPVFVIDPRYMEPDPSAFS  74

Query  415   PGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYD  594
             PGS+RAG+NRIRFLLE+L DLDS L  LGSRLLVLRG+P  VL+RCL+EW + +LCFEYD
Sbjct  75    PGSSRAGVNRIRFLLESLKDLDSGLKKLGSRLLVLRGEPGDVLVRCLQEWKVKRLCFEYD  134

Query  595   TEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPS  774
             T+PYYQALD KVK YAS  G+E F+PVSHTLF+P DII KNGG  PL+YQSFLK+AG PS
Sbjct  135   TDPYYQALDFKVKEYASSVGVEVFSPVSHTLFNPTDIIQKNGGKAPLSYQSFLKIAGEPS  194

Query  775   WAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
              A S L  S SSLPPIG++GSL VS VPTLEELGY D  + E T FRGGESEAL+RL +S
Sbjct  195   CAESELVMSYSSLPPIGDVGSLGVSEVPTLEELGYRDDEQAEWTPFRGGESEALKRLHKS  254

Query  955   IANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPP  1134
             I++K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q V + VK+HTSPP
Sbjct  255   ISDKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQRVYKDVKKHTSPP  314

Query  1135  VSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAI  1314
             VSLLGQLLWR+FFYT AFGT +FD+M+GN ICKQIPWKE  ++LAAWRD +TG+PWIDAI
Sbjct  315   VSLLGQLLWREFFYTTAFGTRNFDKMKGNPICKQIPWKEDHDMLAAWRDGKTGYPWIDAI  374

Query  1315  MVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  1494
             MVQL KWGWMHHLARHSVACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCS
Sbjct  375   MVQLLKWGWMHHLARHSVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCS  434

Query  1495  SFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIG  1674
             SFFYQY+RIYSP++FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KAKCI+G
Sbjct  435   SFFYQYNRIYSPVSFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKAKCIVG  494

Query  1675  IDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKR  1854
              DYPKP+V HD+ASKEC++++GEAY LNKK+ G + D++L +L+R++E   +S   + +R
Sbjct  495   KDYPKPMVMHDAASKECKRKMGEAYALNKKMNGNIGDDDLKDLRRKLETDGES-NIRNQR  553

Query  1855  QKQTL  1869
              K  L
Sbjct  554   PKTQL  558



>gb|KFK38908.1| hypothetical protein AALP_AA3G176500 [Arabis alpina]
Length=535

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/537 (73%), Positives = 468/537 (87%), Gaps = 3/537 (1%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA+ S S++WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME DP AFSPGS+R+G+
Sbjct  1     MATGSGSVIWFRKGLRVHDNPALEYASKGSEFLYPVFVIDPHYMESDPYAFSPGSSRSGV  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLDS+L  LGSRLLVL+G+P +V++RCL+EW + +LCFEYDT+PYYQAL
Sbjct  61    NRIRFLLESLKDLDSNLKKLGSRLLVLKGEPGEVMVRCLQEWKVKRLCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS +G+E F+PVSHTLF+P+ II KNGG PPL+YQSFLK+AG PS A S L  
Sbjct  121   DFKVKDYASSSGVEIFSPVSHTLFNPSYIIEKNGGKPPLSYQSFLKIAGEPSCAKSELVM  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             S +SLPPIGN+G+L VS VPTLEELGY+D  + E T FRGGESEAL+RL +SI++K WVA
Sbjct  181   SYTSLPPIGNVGNLGVSEVPTLEELGYIDDEQAESTPFRGGESEALKRLNKSISDKAWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q + +  K+HTSPPVSLLGQLL
Sbjct  241   NFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQTIYKDAKKHTSPPVSLLGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMVQL KWG
Sbjct  301   WREFFYTTAFGTPNFDKMKGNRICKQIPWNEDQVMLAAWRDGKTGYPWIDAIMVQLLKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWE+GRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY+R
Sbjct  361   WMHHLARHCVACFLTRGDLFVHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KAKCI+G DYPKP+V
Sbjct  421   IYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKAKCIVGKDYPKPMV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
              HDSASKEC++++GE Y +NKK+ G V DE+L +L+R+++  D+S   K + Q+  L
Sbjct  481   LHDSASKECKRKMGETYAMNKKMNGYVGDEDLRDLRRKLQNDDES---KIRNQRPKL  534



>ref|XP_010249985.1| PREDICTED: (6-4)DNA photolyase [Nelumbo nucifera]
Length=558

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/561 (71%), Positives = 480/561 (86%), Gaps = 5/561 (1%)
 Frame = +1

Query  193   LQTTLSAISLSARRTSMHPATAMASE-SCSLMWFRKGLRIHDNPALQHAANASTKCFPLF  369
             ++ + S   L   R  +H A ++    S SL+WFRKGLRIHDNPAL+HA   +T  +P+F
Sbjct  1     MRASSSLYQLPGSRLFVHHAASIPPMVSNSLLWFRKGLRIHDNPALEHARKDATHLYPVF  60

Query  370   VIDPHYMEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIR  549
             ++DPH++EPDPT FSPGS RAGLNRI+FLLE+LVDLDSSL  LGSRLLV RG+P +VL R
Sbjct  61    ILDPHFLEPDPTDFSPGSARAGLNRIQFLLESLVDLDSSLRKLGSRLLVFRGEPVEVLFR  120

Query  550   CLKEWSISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTP  729
              LKEW + KLCFEYDTEPYYQA+D +VK++AS  G+E F+PVSHTLF+P  II KNGG P
Sbjct  121   LLKEWGVKKLCFEYDTEPYYQAMDDRVKDHASALGMEVFSPVSHTLFNPVKIIEKNGGAP  180

Query  730   PLTYQSFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTS  909
             PL+YQSFLK+AG PS    PLST++S LPPIGN+  L++  +PT++ELGY D  +DE + 
Sbjct  181   PLSYQSFLKIAGKPS---PPLSTTISWLPPIGNVEDLEILGIPTIKELGYGDIRQDEFSP  237

Query  910   FRGGESEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQC  1089
             FRGGESEAL+RLRE++ ++EWVA FEKPKGNPS FL+PATTVLSPYLKFGCLSSRYFYQC
Sbjct  238   FRGGESEALKRLREALNDEEWVASFEKPKGNPSLFLKPATTVLSPYLKFGCLSSRYFYQC  297

Query  1090  VQEVLRSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLA  1269
             +Q+V + VKRHT PPVSL GQLLWR+FFYTVA+GTP+FD+M+GNRICKQIPW + DELLA
Sbjct  298   LQDVYKKVKRHTLPPVSLAGQLLWREFFYTVAYGTPNFDKMKGNRICKQIPWNDDDELLA  357

Query  1270  AWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDS  1449
             AWR++RTG+PWIDAIMVQL++WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDS
Sbjct  358   AWREARTGYPWIDAIMVQLQRWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDS  417

Query  1450  DWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPW  1629
             DWAINNGNW+WLSCSSFFYQY+RIYSPI+FGKKYDP+GNYIRHF+PVLKDMPKEYIYEPW
Sbjct  418   DWAINNGNWLWLSCSSFFYQYNRIYSPISFGKKYDPNGNYIRHFVPVLKDMPKEYIYEPW  477

Query  1630  TAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKR  1809
             TAPL++Q KA CIIG DYP PVV+HDSASKEC+ ++ EAYELN+K+ G+V +E+L  L+R
Sbjct  478   TAPLTVQTKANCIIGRDYPHPVVAHDSASKECKMKIAEAYELNRKMNGLVSEEDLKGLRR  537

Query  1810  RVEEQDKSMEYKTKRQKQTLI  1872
             + EE D+    K++RQKQ LI
Sbjct  538   KFEE-DQHQVSKSRRQKQKLI  557



>ref|XP_010465536.1| PREDICTED: (6-4)DNA photolyase [Camelina sativa]
Length=579

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/543 (72%), Positives = 465/543 (86%), Gaps = 0/543 (0%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPG  420
             ++P   MA+ S SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME DP+AFSPG
Sbjct  36    LNPIVTMATGSGSLVWFRKGLRVHDNPALEYASKGSQFLYPVFVIDPHYMESDPSAFSPG  95

Query  421   STRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTE  600
             S+R+G+NRIRFLLE+L DLDSSL  LGSRLLVL+G+P +VL+RCL+EW + +LCFEYDT+
Sbjct  96    SSRSGVNRIRFLLESLKDLDSSLKKLGSRLLVLKGEPGEVLVRCLQEWKVKRLCFEYDTD  155

Query  601   PYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWA  780
             PYYQALD +VK+YAS  G+E F+PVSHTLF+P DII KNGG PPL+YQSF+K+AG PS A
Sbjct  156   PYYQALDVRVKDYASSTGVEIFSPVSHTLFNPVDIIEKNGGKPPLSYQSFVKIAGEPSCA  215

Query  781   ssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIA  960
             +S L  S SS+PP+G +G+L +S VPT EELGY +    E T FRGGESEAL RL +SI+
Sbjct  216   TSELVMSYSSIPPMGEVGNLGISEVPTPEELGYREDENAEWTPFRGGESEALLRLTKSIS  275

Query  961   NKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVS  1140
             +K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC++ + + VK+HTSPPVS
Sbjct  276   DKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLKNIYKDVKKHTSPPVS  335

Query  1141  LLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMV  1320
             LLGQLLWR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMV
Sbjct  336   LLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMV  395

Query  1321  QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSF  1500
             QL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSF
Sbjct  396   QLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSF  455

Query  1501  FYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGID  1680
             FYQY+RIYSPI+FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KAKCI+G D
Sbjct  456   FYQYNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKAKCIVGKD  515

Query  1681  YPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQK  1860
             YPKP+V HD+ASKEC++++GE Y LNKK  G V DE+L  L+R++EE       K + Q+
Sbjct  516   YPKPMVLHDTASKECKRKMGETYALNKKKEGKVDDEDLKNLRRKLEEDGHEESTKIRNQR  575

Query  1861  QTL  1869
             Q L
Sbjct  576   QKL  578



>pdb|3FY4|A Chain A, (6-4) Photolyase Crystal Structure
 pdb|3FY4|B Chain B, (6-4) Photolyase Crystal Structure
 pdb|3FY4|C Chain C, (6-4) Photolyase Crystal Structure
 dbj|BAA24449.1| 6-4 photolyase [Arabidopsis thaliana]
 dbj|BAA34711.1| 6-4 photolyase [Arabidopsis thaliana]
 dbj|BAB02293.1| 6-4 photolyase [Arabidopsis thaliana]
Length=537

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/537 (73%), Positives = 467/537 (87%), Gaps = 1/537 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA+ S SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME DP+AFSPGS+RAG+
Sbjct  1     MATGSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPGSSRAGV  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLDSSL  LGSRLLV +G+P +VL+RCL+EW + +LCFEYDT+PYYQAL
Sbjct  61    NRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS  G+E F+PVSHTLF+PA II KNGG PPL+YQSFLK+AG PS A S L  
Sbjct  121   DVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCAKSELVM  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             S SSLPPIG++G+L +S VP+LEELGY D  + + T FRGGESEAL+RL +SI++K WVA
Sbjct  181   SYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSISDKAWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTV+SPYLKFGCLSSRYFYQC+Q + + VK+HTSPPVSLLGQLL
Sbjct  241   NFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMVQL KWG
Sbjct  301   WREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ++R
Sbjct  361   WMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQFNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPI+FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KA CI+G DYPKP+V
Sbjct  421   IYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIVGKDYPKPMV  480

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
              HDSASKEC++++GEAY LNKK+ G V +E L +L+R++ ++D+  E K + Q+  L
Sbjct  481   LHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKL-QKDEHEESKIRNQRPKL  536



>ref|XP_010487391.1| PREDICTED: (6-4)DNA photolyase-like [Camelina sativa]
Length=579

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/543 (73%), Positives = 466/543 (86%), Gaps = 0/543 (0%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPG  420
             ++P   MA+ S SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME DP+AFSPG
Sbjct  36    LNPIVTMATGSGSLVWFRKGLRVHDNPALEYASKGSQFLYPVFVIDPHYMELDPSAFSPG  95

Query  421   STRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTE  600
             S+R+G+NRIRFLLE+L DLDSSL  LGSRLLVL+G+P +VL+RCL+EW + +LCFEYDT+
Sbjct  96    SSRSGVNRIRFLLESLKDLDSSLKKLGSRLLVLKGEPGEVLVRCLQEWKVKRLCFEYDTD  155

Query  601   PYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWA  780
             PYYQALD +VK YAS  G+E F+PVSHTLF+PADII KNGG PPL+YQSF+K+AG PS A
Sbjct  156   PYYQALDVRVKEYASSTGVEVFSPVSHTLFNPADIIEKNGGKPPLSYQSFVKIAGEPSCA  215

Query  781   ssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIA  960
             +S L  S SSLPPIG +G+L +S V TLEELGY +    E T FRGGESEAL+RL +SI+
Sbjct  216   TSELVMSYSSLPPIGEVGNLGISEVQTLEELGYREDEIAEWTPFRGGESEALQRLTKSIS  275

Query  961   NKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVS  1140
             +K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC++ + + VK+HTSPPVS
Sbjct  276   DKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLKNIYKDVKKHTSPPVS  335

Query  1141  LLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMV  1320
             LLGQLLWR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMV
Sbjct  336   LLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMV  395

Query  1321  QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSF  1500
             QL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSF
Sbjct  396   QLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSF  455

Query  1501  FYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGID  1680
             FYQY+RIYSPI+FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KAKCI+G D
Sbjct  456   FYQYNRIYSPISFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKAKCIVGKD  515

Query  1681  YPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQK  1860
             YPKP+V HD+ASKEC++++GE Y LNKK  G V DE+L  L+R+++E       K + Q+
Sbjct  516   YPKPMVLHDTASKECKRKMGETYALNKKKEGKVDDEDLKNLRRKLQEDGHEEPTKIRNQR  575

Query  1861  QTL  1869
             Q L
Sbjct  576   QKL  578



>ref|XP_010503229.1| PREDICTED: (6-4)DNA photolyase-like isoform X1 [Camelina sativa]
Length=584

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/551 (72%), Positives = 469/551 (85%), Gaps = 2/551 (0%)
 Frame = +1

Query  223   SARRTSMHPATAMASESC--SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEP  396
             S+     +P   MAS S   SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME 
Sbjct  33    SSSSYCFNPIATMASASGFGSLVWFRKGLRVHDNPALEYASKGSQFLYPVFVIDPHYMEL  92

Query  397   DPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISK  576
             DP+AFSPGS+R+G+NRIRFLLE+L DLDSSL  LGSRLLVL+G+P +VL+RCL+EW ++ 
Sbjct  93    DPSAFSPGSSRSGVNRIRFLLESLKDLDSSLKKLGSRLLVLKGEPGEVLVRCLQEWKVNM  152

Query  577   LCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLK  756
             LCFEYDT+PYYQALD +VK+YAS  G+E F+PVSHTLF+PADII KNGG PPL+YQSF+K
Sbjct  153   LCFEYDTDPYYQALDVRVKDYASSTGVEVFSPVSHTLFNPADIIEKNGGKPPLSYQSFVK  212

Query  757   LAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEAL  936
             +AG PS A+S L  S SSLPPIG +G+L +S VPTLEELGY +    E T FRGGESEAL
Sbjct  213   IAGEPSCATSELVMSYSSLPPIGEVGNLGISEVPTLEELGYREDEIAEWTPFRGGESEAL  272

Query  937   RRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVK  1116
             +RL +SI++K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC++ + + VK
Sbjct  273   QRLTKSISDKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLKNIYKDVK  332

Query  1117  RHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGF  1296
             +HTSPPVSLLGQLLWR+FFYT AFGTP+FD+MRGNRICKQIPW E   +LAAWRD +TG+
Sbjct  333   KHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMRGNRICKQIPWNEDHAMLAAWRDGKTGY  392

Query  1297  PWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW  1476
             PWIDAIMVQL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNW
Sbjct  393   PWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNW  452

Query  1477  MWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRK  1656
             MWLSCSSFFYQY+RIYSPI+FGKKYDPDG +IRHFLPVLKDMPK+YIYEPWTAPLS+Q K
Sbjct  453   MWLSCSSFFYQYNRIYSPISFGKKYDPDGKFIRHFLPVLKDMPKQYIYEPWTAPLSVQTK  512

Query  1657  AKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSM  1836
             AKCI+G DYPKP+V HD+ASKEC++++GE Y LNKK  G V DE+L  L+R++EE     
Sbjct  513   AKCIVGKDYPKPMVLHDTASKECKRKMGETYALNKKKEGKVDDEDLKNLRRKLEEDGHEE  572

Query  1837  EYKTKRQKQTL  1869
               K + Q+Q L
Sbjct  573   STKIRNQRQKL  583



>ref|XP_004506890.1| PREDICTED: (6-4)DNA photolyase-like [Cicer arietinum]
Length=543

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/547 (72%), Positives = 467/547 (85%), Gaps = 6/547 (1%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPG  420
             M   ++M   S SLMWFRKG+RIHDNPAL+ A+  S+  +PLF+IDPHYMEPDP AFSPG
Sbjct  1     MRLTSSMGFGSGSLMWFRKGIRIHDNPALEFASRGSSHLYPLFIIDPHYMEPDPNAFSPG  60

Query  421   STRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTE  600
             S+RAGLNRI FLL++LVDLD  L  LGSRLL+L GDP++VL+RCLKEW+I KLCFEYDT+
Sbjct  61    SSRAGLNRINFLLQSLVDLDVKLKKLGSRLLILHGDPNEVLVRCLKEWNIGKLCFEYDTD  120

Query  601   PYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWA  780
             PYYQA+D K+K++A  +GIE F+PVSHTLF+P +II KNGG PPL+YQSF+KLAG P   
Sbjct  121   PYYQAMDIKIKDFALASGIEVFSPVSHTLFNPMEIIQKNGGKPPLSYQSFVKLAGDPP--  178

Query  781   ssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERT--SFRGGESEALRRLRES  954
              SPL T  SSLP +G+LGS  +S VPT+++LGY D   +E +   F+GGESEAL++L   
Sbjct  179   -SPLLTKYSSLPAVGHLGSCDISEVPTIKDLGYEDAKLEEFSFSPFKGGESEALKQLEAC  237

Query  955   IANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPP  1134
             + +K WVA FEKPKGNPSAF +PATT+LSPYLKFGCLSSRYFY C+Q+V +S+ +HTSPP
Sbjct  238   MKDKMWVANFEKPKGNPSAFFKPATTILSPYLKFGCLSSRYFYHCIQDVYKSLPKHTSPP  297

Query  1135  VSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAI  1314
             VSLLGQLLWRDFFYT AFGTP+FDRM+GNRICKQIPWK+ D+L  AWRD++TGFPWIDAI
Sbjct  298   VSLLGQLLWRDFFYTAAFGTPNFDRMKGNRICKQIPWKDDDKLFEAWRDAKTGFPWIDAI  357

Query  1315  MVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  1494
             MVQLR+WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS
Sbjct  358   MVQLRQWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  417

Query  1495  SFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIG  1674
             SFFYQYHRIYSP TFGKKYDP+G+YIRHFLPVLKD+PKEYIYEPWTAPLSIQ KA CIIG
Sbjct  418   SFFYQYHRIYSPTTFGKKYDPNGDYIRHFLPVLKDIPKEYIYEPWTAPLSIQTKANCIIG  477

Query  1675  IDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKR  1854
              DYP PVVSHDSASKECR+++GEAY LNK L G+V +++L  L+R+++E ++    K K+
Sbjct  478   KDYPMPVVSHDSASKECRRKMGEAYALNKALNGLVSEDDLKNLRRKLDESEEQGT-KAKK  536

Query  1855  QKQTLIG  1875
              +Q LIG
Sbjct  537   SRQLLIG  543



>ref|XP_010033920.1| PREDICTED: (6-4)DNA photolyase [Eucalyptus grandis]
 gb|KCW53790.1| hypothetical protein EUGRSUZ_J03037 [Eucalyptus grandis]
Length=542

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/528 (75%), Positives = 467/528 (88%), Gaps = 2/528 (0%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAA-NASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             LMWFRKGLRIHDNPALQHAA  A    +P+FVIDP YMEPD  A SPGS+RAG+NRIRFL
Sbjct  15    LMWFRKGLRIHDNPALQHAAARACGPLYPVFVIDPRYMEPDRAAPSPGSSRAGVNRIRFL  74

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DLDS L  LGSRLLVL+G+P +VLIRCL+EW++ +LCFE+DTEPYYQALD +VK+
Sbjct  75    LESLADLDSGLRRLGSRLLVLKGEPGEVLIRCLEEWNVGRLCFEHDTEPYYQALDKRVKD  134

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
             +AS AGIETF+PVSHTL+DPADII +NGG PPL+YQSFLKLAG PSWA+SPLST+L+S+P
Sbjct  135   FASAAGIETFSPVSHTLYDPADIIARNGGKPPLSYQSFLKLAGKPSWAASPLSTTLASVP  194

Query  817   pIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKPK  996
             P+G++G  ++  VPTL ELGY +  +DE   FRGGE+ AL R++E+++NK WVA FEKPK
Sbjct  195   PVGDVGRCEIFEVPTLIELGYNETEQDEGAPFRGGETAALTRMKEALSNKAWVADFEKPK  254

Query  997   GNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFY  1176
             G+PSAF +PATTVLSPYLKFGCLSSRYFYQC+Q++ + VK+HTSPPVSLLGQLLWRDFFY
Sbjct  255   GDPSAFYKPATTVLSPYLKFGCLSSRYFYQCIQDIYKDVKKHTSPPVSLLGQLLWRDFFY  314

Query  1177  TVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLA  1356
             T AFGTP+FD+M+GNRICKQIPW + ++LLAAWR++RTG+PWIDAIMVQL KWGWMHHLA
Sbjct  315   TAAFGTPNFDKMKGNRICKQIPWSDDEQLLAAWREARTGYPWIDAIMVQLHKWGWMHHLA  374

Query  1357  RHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPIT  1536
             RH VACFLTRGDLF+HWEKGRDVFERLLIDSDWA+NNGNW+WLSCSSFFYQY+RIYSPIT
Sbjct  375   RHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAVNNGNWLWLSCSSFFYQYNRIYSPIT  434

Query  1537  FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSAS  1716
             FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPW APLSIQ KAKC+IG DYP PVVSHD AS
Sbjct  435   FGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWKAPLSIQTKAKCVIGRDYPNPVVSHDMAS  494

Query  1717  KECRQRLGEAYELNKKLGGMVRDEELNELKRRVEE-QDKSMEYKTKRQ  1857
             KECR++L EAY +N++L G V DE+L  L+R++EE Q+K + +  +R+
Sbjct  495   KECRRKLAEAYAVNQRLNGTVSDEDLKSLRRKLEEDQEKELRHTKQRR  542



>ref|XP_010545788.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Tarenaya hassleriana]
Length=556

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/539 (74%), Positives = 463/539 (86%), Gaps = 5/539 (1%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M++    L+WFRKGLRIHDNPAL+ A+  S   +P+FV+DPHYMEPDP+AFSPGSTRAGL
Sbjct  20    MSNGLSYLVWFRKGLRIHDNPALEFASKGSEFMYPVFVVDPHYMEPDPSAFSPGSTRAGL  79

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLD SL  LGSRLLVL+GDP +VL+RCLKEW I KLCFE+DT+ YY+AL
Sbjct  80    NRIRFLLESLEDLDCSLKRLGSRLLVLKGDPGEVLVRCLKEWKIKKLCFEFDTDSYYRAL  139

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             DAKVK+YAS  GIE F+PVSHTLF+P+DII +NGG PPL+YQSFLK+AG PS   S L  
Sbjct  140   DAKVKDYASSVGIEVFSPVSHTLFNPSDIIRENGGRPPLSYQSFLKIAGEPSCERSELVM  199

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             S SSLPP+G+ G+L +SAVP +EELGY D  +DERT F GGE+EAL+RL ES+ ++ WVA
Sbjct  200   SYSSLPPVGDTGNLDISAVPNIEELGYRDDEQDERTPFIGGETEALKRLDESMRDEAWVA  259

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQ +Q + +SVK+HTSPPVSLLGQLL
Sbjct  260   DFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQRIQSIYKSVKKHTSPPVSLLGQLL  319

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FD+M+GNRIC+QIPW +  E+L AWRD +TG+PWIDAIMVQLRKWG
Sbjct  320   WREFFYTAAFGTPNFDKMKGNRICRQIPWNDDHEMLVAWRDGKTGYPWIDAIMVQLRKWG  379

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLFIHWE GRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY+R
Sbjct  380   WMHHLARHCVACFLTRGDLFIHWENGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNR  439

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPITFGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KA CIIG DYPKPVV
Sbjct  440   IYSPITFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIIGKDYPKPVV  499

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVE--EQDKSMEYKTKRQKQTL  1869
              HDSA KECR+++ EAY LN+K  G V DE+L  L+R++E  E D+SM   T++Q+  L
Sbjct  500   CHDSAGKECRRKMSEAYALNQKKNGQVGDEDLRNLRRKLEKDEHDESM---TRKQRSKL  555



>gb|KHN47785.1| (6-4)DNA photolyase [Glycine soja]
Length=546

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/530 (75%), Positives = 461/530 (87%), Gaps = 4/530 (1%)
 Frame = +1

Query  286   WFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLLET  465
             WFRKGLRIHDNPAL+ A+  ++  +P+FVIDPH+MEPDP + +PGS+RAGLNRI+FLLE 
Sbjct  21    WFRKGLRIHDNPALEVASRGASHLYPVFVIDPHFMEPDPNSSAPGSSRAGLNRIKFLLEC  80

Query  466   LVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNYAS  645
             LVDLD +L NLGSRLL+L+GDP++V+IRCLKE  + KLCFEYDTEPYYQALD KVKN+A 
Sbjct  81    LVDLDLNLKNLGSRLLILKGDPAEVVIRCLKELHVKKLCFEYDTEPYYQALDVKVKNFAL  140

Query  646   VAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslppIG  825
              AGIE F+PVSHTLF+P DII KNGG PPL+YQSF+KLAG P    S LST  SSLPP+G
Sbjct  141   AAGIEVFSPVSHTLFNPTDIIEKNGGKPPLSYQSFVKLAGEPP---SSLSTVYSSLPPVG  197

Query  826   NLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKPKGNP  1005
             NLGS  +S VPT+ +LGY D  +DE + F+GGESEAL+RL E + +K+WVA FEKPKGNP
Sbjct  198   NLGSCDISEVPTIRDLGYGDAEQDEFSPFKGGESEALKRLDECMKDKKWVANFEKPKGNP  257

Query  1006  SAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFYTVA  1185
             SAFL+PATTVLSPYLKFGCLS RYFYQ +Q+V +S+ +HT PPVSL+GQLLWR+FFYT A
Sbjct  258   SAFLKPATTVLSPYLKFGCLSPRYFYQSIQDVYKSMPKHTLPPVSLIGQLLWREFFYTAA  317

Query  1186  FGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHS  1365
             FGTP+FDRM+GNRICKQIPWK+ D+LL AWR++RTGFPWIDAIMVQLRKWGWMHHLARHS
Sbjct  318   FGTPNFDRMKGNRICKQIPWKDDDKLLEAWREARTGFPWIDAIMVQLRKWGWMHHLARHS  377

Query  1366  VACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGK  1545
             VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY+RIYSP TFGK
Sbjct  378   VACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNRIYSPTTFGK  437

Query  1546  KYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKEC  1725
             KYDP+G+YIRHFLPVLKDMP+EYIYEPWTAP SIQ KA CIIG DYP PVVSHDSASKEC
Sbjct  438   KYDPNGDYIRHFLPVLKDMPREYIYEPWTAPKSIQTKANCIIGKDYPMPVVSHDSASKEC  497

Query  1726  RQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             R+++GEAY LNK+L G+V +++L  L+R+++E +   E   KR KQ LIG
Sbjct  498   RRKMGEAYALNKELNGLVSEDDLKNLRRKLDESE-GQEAGAKRYKQQLIG  546



>ref|XP_003531700.2| PREDICTED: (6-4)DNA photolyase-like isoform X1 [Glycine max]
Length=563

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/554 (72%), Positives = 470/554 (85%), Gaps = 15/554 (3%)
 Frame = +1

Query  247   PATAMASESCS-----------LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYME  393
             P++AM    C+           L+WFRKGLRIHDNPAL+ A+  ++  +P+FVIDPH+ME
Sbjct  14    PSSAMRLSPCANTTSMSSGSGSLLWFRKGLRIHDNPALEVASRGASHLYPVFVIDPHFME  73

Query  394   PDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSIS  573
             PDP + +PGS+RAGLNRI+FLLE LVDLD +L NLGSRLL+L+GDP++V+IRCLKE  + 
Sbjct  74    PDPNSSAPGSSRAGLNRIKFLLECLVDLDLNLKNLGSRLLILKGDPAEVVIRCLKELHVK  133

Query  574   KLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFL  753
             KLCFEYDTEPYYQALD KVKN+A  AGIE F+PVSHTLF+P DII KNGG PPL+YQSF+
Sbjct  134   KLCFEYDTEPYYQALDVKVKNFALAAGIEVFSPVSHTLFNPTDIIEKNGGKPPLSYQSFV  193

Query  754   KLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEA  933
             KLAG P    S LST  SSLPP+GNLGS  +S VPT+ +LGY D  +DE + F+GGESEA
Sbjct  194   KLAGEPP---SSLSTVYSSLPPVGNLGSCDISEVPTIRDLGYGDAEQDEFSPFKGGESEA  250

Query  934   LRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSV  1113
             L+RL E + +K+WVA FEKPKGNPSAFL+PATTVLSPYLKFGCLS RYFYQ +Q+V +S+
Sbjct  251   LKRLDECMKDKKWVANFEKPKGNPSAFLKPATTVLSPYLKFGCLSPRYFYQSIQDVYKSM  310

Query  1114  KRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTG  1293
              +HT PPVSL+GQLLWR+FFYT AFGTP+FDRM+GNRICKQIPWK+ D+LL AWR++RTG
Sbjct  311   PKHTLPPVSLIGQLLWREFFYTAAFGTPNFDRMKGNRICKQIPWKDDDKLLEAWREARTG  370

Query  1294  FPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGN  1473
             FPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGN
Sbjct  371   FPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGN  430

Query  1474  WMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQR  1653
             WMWLSCSSFFYQY+RIYSP TFGKKYDP+G+YIRHFLPVLKDMP+EYIYEPWTAP SIQ 
Sbjct  431   WMWLSCSSFFYQYNRIYSPTTFGKKYDPNGDYIRHFLPVLKDMPREYIYEPWTAPKSIQT  490

Query  1654  KAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             KA CIIG DYP PVVSHDSASKECR+++GEAY LNK+L G+V +++L  L+R+++E +  
Sbjct  491   KANCIIGKDYPMPVVSHDSASKECRRKMGEAYALNKELNGLVSEDDLKNLRRKLDESE-G  549

Query  1834  MEYKTKRQKQTLIG  1875
              E   KR KQ LIG
Sbjct  550   QEAGAKRYKQQLIG  563



>gb|KEH28723.1| UVR3 AtUVR3-like 6-4 DNA photolyase [Medicago truncatula]
Length=542

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/542 (73%), Positives = 468/542 (86%), Gaps = 5/542 (1%)
 Frame = +1

Query  250   ATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTR  429
             +++M   S S++WFRKG+RIHDNPAL++A    +  +PLFVIDPHYM+PDP AFSPGS+R
Sbjct  6     SSSMTLGSGSMIWFRKGIRIHDNPALEYATRGCSNLYPLFVIDPHYMKPDPNAFSPGSSR  65

Query  430   AGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYY  609
             AGLNRI FLLE+L DLD +L  +GSRLLVL+GDPS+VLIRCLK+W+I KLCFEYDT+PYY
Sbjct  66    AGLNRISFLLESLGDLDVNLKKIGSRLLVLKGDPSEVLIRCLKQWNIGKLCFEYDTDPYY  125

Query  610   QALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssp  789
             QALD KVK+YA  AGIE F+PVSHTLF+P DII KNGG PPL+YQSF+ LAG P    SP
Sbjct  126   QALDIKVKDYALKAGIEVFSPVSHTLFNPTDIIQKNGGKPPLSYQSFVNLAGEPP---SP  182

Query  790   lstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKE  969
             L+T  SSLPP+G LGS  +S VPT+++LGY D  + E + F+GGESEALRRL E + +K 
Sbjct  183   LATKYSSLPPVGPLGSCDISEVPTIKDLGYED-DQLEFSPFKGGESEALRRLEECMKDKT  241

Query  970   WVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             WVA FEKPKGNPSAFL+PATT+LSPYLKFGCLSSRYFYQC+Q+V +S+ +HTSPPVSLLG
Sbjct  242   WVANFEKPKGNPSAFLKPATTILSPYLKFGCLSSRYFYQCIQDVYKSLPKHTSPPVSLLG  301

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWRDFFYT AFGTP+FD M+ NRICKQIPWK+ D+LL AWRD++TGFPWIDAIMVQLR
Sbjct  302   QLLWRDFFYTAAFGTPNFDSMKDNRICKQIPWKDDDKLLEAWRDAKTGFPWIDAIMVQLR  361

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             +WGWMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ
Sbjct  362   QWGWMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  421

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y+RIYSP TFGKKYDPDG+YIRHFLPVLKDMPK YIYEPWTAP SIQ KA CIIG DYP 
Sbjct  422   YNRIYSPTTFGKKYDPDGDYIRHFLPVLKDMPKAYIYEPWTAPPSIQTKANCIIGKDYPM  481

Query  1690  PVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             PVVSHDSASKEC++++GEAY L+K L G+V +++L  L+R++++ ++    K+KR +Q L
Sbjct  482   PVVSHDSASKECKRKMGEAYALSKALNGLVSEDDLKNLRRKLDKGEEQGT-KSKRSRQLL  540

Query  1870  IG  1875
             IG
Sbjct  541   IG  542



>emb|CDY21853.1| BnaC01g35950D [Brassica napus]
Length=564

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/550 (72%), Positives = 472/550 (86%), Gaps = 10/550 (2%)
 Frame = +1

Query  208   SAISLSARRTSMHPATAMASESCSLMWFRKGLRIHDNPALQHAANAST-KCFPLFVIDPH  384
             S  S S+ R  ++P T+MA+ S SL+WFRKGLR+HDNPAL+HA+ AS+   +P+FVIDP 
Sbjct  7     SVCSPSSHR--LNPVTSMATGSNSLIWFRKGLRVHDNPALEHASKASSGSMYPVFVIDPR  64

Query  385   YMEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEW  564
             YMEPDP+AFSPGS+RAG+NRIRFLLE+L DLDS L  LGSRLLVLRG+P +VL+RCL+EW
Sbjct  65    YMEPDPSAFSPGSSRAGVNRIRFLLESLKDLDSGLKKLGSRLLVLRGEPGEVLVRCLREW  124

Query  565   SISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQ  744
              + +LCFEYDT+PYYQALD KVK YAS  G+E F+PVSHTLF+P DII KNGG  PL+YQ
Sbjct  125   KVKRLCFEYDTDPYYQALDFKVKEYASSVGVEVFSPVSHTLFNPTDIIQKNGGKAPLSYQ  184

Query  745   SFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGE  924
             SFLK+AG PS A S L  S SSLPPIG++GS+ VS VP LEELGY +  +DE T FRGGE
Sbjct  185   SFLKIAGEPSCAESELLMSYSSLPPIGDVGSIGVSEVPKLEELGYREDEQDEWTPFRGGE  244

Query  925   SEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYL-KFGCLSSRYFYQCVQEV  1101
             SEAL RL +SI++K WVA FEKPKG+PSA L+PATTVLSPYL KFGCLSSRYFYQC+Q V
Sbjct  245   SEALERLTKSISDKAWVANFEKPKGDPSALLKPATTVLSPYLKKFGCLSSRYFYQCLQRV  304

Query  1102  LRSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRD  1281
              + +K+HTSPPVSLLGQLLWR+FFYT AFGT +FD+M+GN ICKQIPWKE  ++LAAWRD
Sbjct  305   YKDMKKHTSPPVSLLGQLLWREFFYTTAFGTRNFDKMKGNPICKQIPWKEDHDMLAAWRD  364

Query  1282  SRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAI  1461
              +TG+PWIDAIMVQL KWGWMHHLARHSVACFLTRGDLFIHWE+GRDVFERLLIDSDWAI
Sbjct  365   GKTGYPWIDAIMVQLLKWGWMHHLARHSVACFLTRGDLFIHWEQGRDVFERLLIDSDWAI  424

Query  1462  NNGNWMWLSCSSFFYQ------YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYE  1623
             NNGNWMWLSCSSFFYQ      Y+RIYSP++FGKKYDP+G YIRHFLPVLKDMPK+YIYE
Sbjct  425   NNGNWMWLSCSSFFYQALPPPFYNRIYSPVSFGKKYDPEGKYIRHFLPVLKDMPKQYIYE  484

Query  1624  PWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNEL  1803
             PWTAPLS+Q KAKCI+G DYPKP+V HD+ASKEC++++GEAY LNKK+ G + D++L +L
Sbjct  485   PWTAPLSVQTKAKCIVGKDYPKPMVMHDAASKECKRKMGEAYALNKKMNGNIGDDDLKDL  544

Query  1804  KRRVEEQDKS  1833
             +R++E  ++S
Sbjct  545   RRKLETDEES  554



>ref|XP_006585645.1| PREDICTED: (6-4)DNA photolyase-like isoform X2 [Glycine max]
Length=558

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/554 (72%), Positives = 468/554 (84%), Gaps = 20/554 (4%)
 Frame = +1

Query  247   PATAMASESCS-----------LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYME  393
             P++AM    C+           L+WFRKGLRIHDNPAL+ A+  ++  +P+FVIDPH+ME
Sbjct  14    PSSAMRLSPCANTTSMSSGSGSLLWFRKGLRIHDNPALEVASRGASHLYPVFVIDPHFME  73

Query  394   PDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSIS  573
             PDP + +PGS+RAGLNRI+FLLE LVDLD +L NLGSRLL+L+GDP++V+IRCLKE    
Sbjct  74    PDPNSSAPGSSRAGLNRIKFLLECLVDLDLNLKNLGSRLLILKGDPAEVVIRCLKE----  129

Query  574   KLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFL  753
              LCFEYDTEPYYQALD KVKN+A  AGIE F+PVSHTLF+P DII KNGG PPL+YQSF+
Sbjct  130   -LCFEYDTEPYYQALDVKVKNFALAAGIEVFSPVSHTLFNPTDIIEKNGGKPPLSYQSFV  188

Query  754   KLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEA  933
             KLAG P    S LST  SSLPP+GNLGS  +S VPT+ +LGY D  +DE + F+GGESEA
Sbjct  189   KLAGEPP---SSLSTVYSSLPPVGNLGSCDISEVPTIRDLGYGDAEQDEFSPFKGGESEA  245

Query  934   LRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSV  1113
             L+RL E + +K+WVA FEKPKGNPSAFL+PATTVLSPYLKFGCLS RYFYQ +Q+V +S+
Sbjct  246   LKRLDECMKDKKWVANFEKPKGNPSAFLKPATTVLSPYLKFGCLSPRYFYQSIQDVYKSM  305

Query  1114  KRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTG  1293
              +HT PPVSL+GQLLWR+FFYT AFGTP+FDRM+GNRICKQIPWK+ D+LL AWR++RTG
Sbjct  306   PKHTLPPVSLIGQLLWREFFYTAAFGTPNFDRMKGNRICKQIPWKDDDKLLEAWREARTG  365

Query  1294  FPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGN  1473
             FPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGN
Sbjct  366   FPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGN  425

Query  1474  WMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQR  1653
             WMWLSCSSFFYQY+RIYSP TFGKKYDP+G+YIRHFLPVLKDMP+EYIYEPWTAP SIQ 
Sbjct  426   WMWLSCSSFFYQYNRIYSPTTFGKKYDPNGDYIRHFLPVLKDMPREYIYEPWTAPKSIQT  485

Query  1654  KAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             KA CIIG DYP PVVSHDSASKECR+++GEAY LNK+L G+V +++L  L+R+++E +  
Sbjct  486   KANCIIGKDYPMPVVSHDSASKECRRKMGEAYALNKELNGLVSEDDLKNLRRKLDESE-G  544

Query  1834  MEYKTKRQKQTLIG  1875
              E   KR KQ LIG
Sbjct  545   QEAGAKRYKQQLIG  558



>emb|CDY20139.1| BnaA01g28630D [Brassica napus]
Length=561

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/548 (72%), Positives = 467/548 (85%), Gaps = 12/548 (2%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAAN--ASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             M++ S SL+WFRKGLR+HDNPAL+HA +  +S   +P+FVIDP YM+PDP+AFSPGS+RA
Sbjct  1     MSTGSNSLIWFRKGLRVHDNPALEHACSKASSGSMYPVFVIDPRYMDPDPSAFSPGSSRA  60

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             G+NRIRFLLE+L DLDS L  LGSRLLVLRG+P +VL+RCL+EW + +LCFEYDT+PYYQ
Sbjct  61    GVNRIRFLLESLKDLDSGLKKLGSRLLVLRGEPGEVLVRCLQEWKVKRLCFEYDTDPYYQ  120

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD KVK YAS  G+E F+PVSHTLF+P DII KNGG  PL+YQSFLK+AG PS A S L
Sbjct  121   ALDFKVKEYASSVGVEVFSPVSHTLFNPTDIIQKNGGKAPLSYQSFLKIAGEPSCAESEL  180

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
               S SSLPPIG++GSL VS VPTLEELGY +  +DE T FRGGESEAL+RL +SI++K W
Sbjct  181   VMSYSSLPPIGDVGSLGVSEVPTLEELGYREDEQDEWTPFRGGESEALKRLHKSISDKAW  240

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYL-KFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             VA FEKPKG+PSAFL+PATTVLSPYL KFGCLSSRYFYQC+Q V + VK+HTSPPVSLLG
Sbjct  241   VANFEKPKGDPSAFLKPATTVLSPYLKKFGCLSSRYFYQCLQRVYKDVKKHTSPPVSLLG  300

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWR+FFYT AFGT +FD+M+GN ICKQIPWKE  ++LAAWRD +TG+PWIDAIMVQL 
Sbjct  301   QLLWREFFYTTAFGTRNFDKMKGNPICKQIPWKEDHDMLAAWRDGKTGYPWIDAIMVQLL  360

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             KWGWMHHLARHSVACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ
Sbjct  361   KWGWMHHLARHSVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  420

Query  1510  --------YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKC  1665
                     Y+RIYSP++FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KAKC
Sbjct  421   ALPPSPTIYNRIYSPVSFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKAKC  480

Query  1666  IIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYK  1845
             I+G DYPKP+V HD+ASKEC++++GEAY LNKK+ G + D++L +L+R++ E D     +
Sbjct  481   IVGKDYPKPMVMHDAASKECKRKMGEAYALNKKMNGNIGDDDLKDLRRKL-ETDGESNIR  539

Query  1846  TKRQKQTL  1869
              +R K  L
Sbjct  540   NQRPKTQL  547



>ref|XP_008461073.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Cucumis melo]
Length=538

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/537 (72%), Positives = 460/537 (86%), Gaps = 24/537 (4%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS S SLMWFRKG+RIHDNPAL++AA  +   +P+FVIDPHYMEPDP+AFSPGS+RAGL
Sbjct  19    MASSSNSLMWFRKGIRIHDNPALEYAAKGANFLYPVFVIDPHYMEPDPSAFSPGSSRAGL  78

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLD +L  LGSRLLVL G+P +VLIRCL+E                   
Sbjct  79    NRIRFLLESLVDLDLNLKKLGSRLLVLHGEPGEVLIRCLEE-------------------  119

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
                  N AS AGIE F+PVSHTLF+PADII KNGG+PPL+YQSFLKLAG PSWA +PLST
Sbjct  120   -----NLASAAGIEVFSPVSHTLFNPADIIQKNGGSPPLSYQSFLKLAGEPSWACAPLST  174

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             ++SSLPP+G+ G   +S VPT+++LGY D ++D+ T FRGGE+EAL+RL ES++NK+WVA
Sbjct  175   TVSSLPPVGDTGRSDISDVPTIKDLGYEDMAKDDWTPFRGGETEALKRLEESMSNKDWVA  234

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQ +QE+  +V+ HTSPPVSL+GQLL
Sbjct  235   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQRIQEIYNNVEGHTSPPVSLVGQLL  294

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FD M+ N+ICKQIPW + +ELLAAWRD+RTGFPWIDAIMVQLRKWG
Sbjct  295   WREFFYTAAFGTPNFDCMKDNKICKQIPWNDDNELLAAWRDARTGFPWIDAIMVQLRKWG  354

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINN NW+WLSCSSFFYQY+R
Sbjct  355   WMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNANWLWLSCSSFFYQYNR  414

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPITFGKKYDP+G++IRHFLPVLKDMPK+YIYEPWTAPLSIQ+KAKCIIG DYPKPV+
Sbjct  415   VYSPITFGKKYDPNGDFIRHFLPVLKDMPKQYIYEPWTAPLSIQKKAKCIIGEDYPKPVL  474

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             SHD A KECR+++GEAYELNK+L G++ +E+L  LK++  E+D+    +TKR++QTL
Sbjct  475   SHDIAIKECRKKMGEAYELNKRLKGLISEEDLENLKKQNSEEDQRQNAQTKRKRQTL  531



>ref|XP_002885099.1| 6-4 photolyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61358.1| 6-4 photolyase [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/546 (71%), Positives = 458/546 (84%), Gaps = 10/546 (2%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA+ S SL+WFRKGLR+HDNPAL+ A+  S   FP+FVIDPHYME DP+AFSPGS+RAG+
Sbjct  1     MATRSGSLIWFRKGLRVHDNPALEFASKGSEFMFPVFVIDPHYMESDPSAFSPGSSRAGV  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLDSSL  LGSRLLVL+G+P +VL RCL+EW + +LCFEYDT+PYY+AL
Sbjct  61    NRIRFLLESLKDLDSSLKKLGSRLLVLKGEPGEVLFRCLQEWKVKRLCFEYDTDPYYKAL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK+YAS  G+E F+PVSHTLF+PAD+I KNGG PPL+YQSFLK+AG PS A S L  
Sbjct  121   DVKVKDYASSTGVEVFSPVSHTLFNPADVIEKNGGKPPLSYQSFLKIAGEPSCAKSELVM  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSED-ERTSFRGGESEALRRLRESIANKEWV  975
             S SSLPP+G++G+L +S VP+LEELGY D  E  + T FRGGESEAL+RL +SI++K WV
Sbjct  181   SYSSLPPVGDVGNLGISEVPSLEELGYRDDDEQADWTPFRGGESEALKRLTKSISDKAWV  240

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FEKPKG+PSAFL+PATTV+SPYLKFGCLSSRYFYQC+Q + + VK+HTSPPVSLLGQL
Sbjct  241   ANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVSLLGQL  300

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMVQL KW
Sbjct  301   LWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMVQLLKW  360

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  
Sbjct  361   GWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQAI  420

Query  1516  R--------IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCII  1671
             +        +   I    KYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KA CI+
Sbjct  421   KATFVMLTLVSQCIVMVSKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIV  480

Query  1672  GIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTK  1851
             G DYPKP+V HDSASKEC++++GEAY LNKK+ G V +E L +L+R++ E+D+  E K +
Sbjct  481   GKDYPKPMVLHDSASKECKRKMGEAYALNKKMDGKVDEENLRDLRRKL-EKDEHEESKIR  539

Query  1852  RQKQTL  1869
              Q+  L
Sbjct  540   NQRPKL  545



>ref|XP_007023939.1| DNA photolyase family protein isoform 1 [Theobroma cacao]
 gb|EOY26561.1| DNA photolyase family protein isoform 1 [Theobroma cacao]
Length=517

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/540 (71%), Positives = 457/540 (85%), Gaps = 33/540 (6%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + M S S SL+WFRKGLRIHDNPAL++A+ AS   +PLFVIDPHYMEPDP AFSPGSTRA
Sbjct  10    SNMPSGSASLIWFRKGLRIHDNPALEYASRASAFVYPLFVIDPHYMEPDPKAFSPGSTRA  69

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             G++RIRFLLE+L DLD SL  LGSRLLVL+G+PS+VLIRCLKEW + K+CFEYDT+PYYQ
Sbjct  70    GISRIRFLLESLADLDLSLKKLGSRLLVLKGEPSEVLIRCLKEWDVKKICFEYDTDPYYQ  129

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD K+KNYAS+AGIE F+PVSHTLF+PADII KNGG PPL+YQSFLKLAG PSWASSPL
Sbjct  130   ALDNKIKNYASLAGIEVFSPVSHTLFNPADIIEKNGGRPPLSYQSFLKLAGEPSWASSPL  189

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                LSS+PP+G++ S ++S VPTL+ELGYV   ++E T FRGGESEALRRLRES+++KEW
Sbjct  190   LVELSSVPPVGDVASFEISQVPTLKELGYVQNDQEELTPFRGGESEALRRLRESLSDKEW  249

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA FEKPKG+PSA+++PATTVLSPYLKFGCLSSRYFYQC+++V ++VKRHTSPPVSL+GQ
Sbjct  250   VANFEKPKGDPSAYIKPATTVLSPYLKFGCLSSRYFYQCLKDVYKNVKRHTSPPVSLVGQ  309

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWR+FFYTVAFGTP+FD+M GN+ICKQIPW + DELLAAWR++RTG+PWIDAIMVQLR+
Sbjct  310   LLWREFFYTVAFGTPNFDKMNGNKICKQIPWNDDDELLAAWREARTGYPWIDAIMVQLRE  369

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
             WGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY
Sbjct  370   WGWMHHLARHCVACFLTRGDLFLHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQY  429

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
             +RIYSP +FGKKYDP G+YIRHFLP+LK                                
Sbjct  430   NRIYSPTSFGKKYDPHGDYIRHFLPILK--------------------------------  457

Query  1693  VVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             VVSHDSASKECR+++GEAY LNKKL G+V ++++  L+RR++E D   E + +RQ+Q LI
Sbjct  458   VVSHDSASKECRRKMGEAYALNKKLNGVVSEDDVKSLRRRLDE-DGGQEARGRRQRQKLI  516



>gb|EYU21604.1| hypothetical protein MIMGU_mgv1a019589mg, partial [Erythranthe 
guttata]
Length=478

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/478 (80%), Positives = 430/478 (90%), Gaps = 0/478 (0%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MAS S SLMWFRKGLRIHDNPAL+ AA  +   +P+FVIDPHYMEPDP  FS GS RAGL
Sbjct  1     MASGSNSLMWFRKGLRIHDNPALECAARRAEFLYPVFVIDPHYMEPDPNEFSTGSKRAGL  60

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+LVDLDSSL  LGSRLLVLRG+PS+VL RCLKEWSI KLCFE+DT+PYY++L
Sbjct  61    NRIRFLLESLVDLDSSLRKLGSRLLVLRGEPSEVLFRCLKEWSIKKLCFEFDTDPYYRSL  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVK YA+ A +E F+PVSHTLFDPADIIHKNGG PPLTYQSF+K AG PSWASSPL+T
Sbjct  121   DDKVKRYATGASVEIFSPVSHTLFDPADIIHKNGGRPPLTYQSFVKCAGEPSWASSPLAT  180

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              L+SLPP+G+L +  V  VP++EELGY +  EDERT F+GGESEAL RLRESI+NKEWVA
Sbjct  181   ELTSLPPVGSLKNCPVVEVPSIEELGYEEAHEDERTPFKGGESEALTRLRESISNKEWVA  240

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+QEV R V RHTSPPVSLLGQLL
Sbjct  241   KFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCIQEVQRDVGRHTSPPVSLLGQLL  300

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTVAFGTP+F +M+ N+ICKQIPWK  DELLAAWRD++TGFPWIDAIM+QL+KWG
Sbjct  301   WRDFFYTVAFGTPNFGQMKDNKICKQIPWKNDDELLAAWRDAKTGFPWIDAIMMQLKKWG  360

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINN NW+WLSCSSFFYQY+R
Sbjct  361   WIHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNANWLWLSCSSFFYQYNR  420

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
             IYSPI+FGKKYDP+GNYIRHFLP+LKDMPKEYIYEPWTAP S+Q KAKC++G DYPKP
Sbjct  421   IYSPISFGKKYDPNGNYIRHFLPILKDMPKEYIYEPWTAPQSVQVKAKCVVGKDYPKP  478



>ref|XP_009115387.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Brassica rapa]
Length=519

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/486 (77%), Positives = 428/486 (88%), Gaps = 2/486 (0%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAAN--ASTKCFPLFVIDPHYMEPDPTAFS  414
             ++P T+M++ S SL+WFRKGLR+HDNPAL+HA +  +S   +P+FVIDP YMEPDP+AFS
Sbjct  15    LNPVTSMSTGSNSLIWFRKGLRVHDNPALEHACSKASSGSMYPVFVIDPRYMEPDPSAFS  74

Query  415   PGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYD  594
             PGS+RAG+NRIRFLLE+L DLDS L  LGSRLLVLRG+P  VL+RCL+EW + +LCFEYD
Sbjct  75    PGSSRAGVNRIRFLLESLKDLDSGLKKLGSRLLVLRGEPGDVLVRCLQEWKVKRLCFEYD  134

Query  595   TEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPS  774
             T+PYYQALD KVK YAS  G+E F+PVSHTLF+P DII KNGG  PL+YQSFLK+AG PS
Sbjct  135   TDPYYQALDFKVKEYASSVGVEVFSPVSHTLFNPTDIIQKNGGKAPLSYQSFLKIAGEPS  194

Query  775   WAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
              A S L  S SSLPPIG++GSL VS VPTLEELGY D  + E T FRGGESEAL+RL +S
Sbjct  195   CAESELVMSYSSLPPIGDVGSLGVSEVPTLEELGYRDDEQAEWTPFRGGESEALKRLHKS  254

Query  955   IANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPP  1134
             I++K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+Q V + VK+HTSPP
Sbjct  255   ISDKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLQRVYKDVKKHTSPP  314

Query  1135  VSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAI  1314
             VSLLGQLLWR+FFYT AFGT +FD+M+GN ICKQIPWKE  ++LAAWRD +TG+PWIDAI
Sbjct  315   VSLLGQLLWREFFYTTAFGTRNFDKMKGNPICKQIPWKEDHDMLAAWRDGKTGYPWIDAI  374

Query  1315  MVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  1494
             MVQL KWGWMHHLARHSVACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCS
Sbjct  375   MVQLLKWGWMHHLARHSVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCS  434

Query  1495  SFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIG  1674
             SFFYQY+RIYSP++FGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KAKCI+G
Sbjct  435   SFFYQYNRIYSPVSFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKAKCIVG  494

Query  1675  IDYPKP  1692
              DYPKP
Sbjct  495   KDYPKP  500



>ref|XP_010545789.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/539 (71%), Positives = 442/539 (82%), Gaps = 29/539 (5%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M++    L+WFRKGLRIHDNPAL+ A+  S   +P+FV+DPHYMEPDP+AFSPGSTRAGL
Sbjct  20    MSNGLSYLVWFRKGLRIHDNPALEFASKGSEFMYPVFVVDPHYMEPDPSAFSPGSTRAGL  79

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLD SL  LGSRLLVL+GDP +VL+RCLKE                   
Sbjct  80    NRIRFLLESLEDLDCSLKRLGSRLLVLKGDPGEVLVRCLKE-------------------  120

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
                  +YAS  GIE F+PVSHTLF+P+DII +NGG PPL+YQSFLK+AG PS   S L  
Sbjct  121   -----DYASSVGIEVFSPVSHTLFNPSDIIRENGGRPPLSYQSFLKIAGEPSCERSELVM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             S SSLPP+G+ G+L +SAVP +EELGY D  +DERT F GGE+EAL+RL ES+ ++ WVA
Sbjct  176   SYSSLPPVGDTGNLDISAVPNIEELGYRDDEQDERTPFIGGETEALKRLDESMRDEAWVA  235

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQ +Q + +SVK+HTSPPVSLLGQLL
Sbjct  236   DFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQRIQSIYKSVKKHTSPPVSLLGQLL  295

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT AFGTP+FD+M+GNRIC+QIPW +  E+L AWRD +TG+PWIDAIMVQLRKWG
Sbjct  296   WREFFYTAAFGTPNFDKMKGNRICRQIPWNDDHEMLVAWRDGKTGYPWIDAIMVQLRKWG  355

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH VACFLTRGDLFIHWE GRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY+R
Sbjct  356   WMHHLARHCVACFLTRGDLFIHWENGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNR  415

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPITFGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KA CIIG DYPKPVV
Sbjct  416   IYSPITFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIIGKDYPKPVV  475

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVE--EQDKSMEYKTKRQKQTL  1869
              HDSA KECR+++ EAY LN+K  G V DE+L  L+R++E  E D+SM   T++Q+  L
Sbjct  476   CHDSAGKECRRKMSEAYALNQKKNGQVGDEDLRNLRRKLEKDEHDESM---TRKQRSKL  531



>gb|KEH28724.1| UVR3 AtUVR3-like 6-4 DNA photolyase [Medicago truncatula]
Length=491

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/481 (76%), Positives = 420/481 (87%), Gaps = 4/481 (1%)
 Frame = +1

Query  250   ATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTR  429
             +++M   S S++WFRKG+RIHDNPAL++A    +  +PLFVIDPHYM+PDP AFSPGS+R
Sbjct  6     SSSMTLGSGSMIWFRKGIRIHDNPALEYATRGCSNLYPLFVIDPHYMKPDPNAFSPGSSR  65

Query  430   AGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYY  609
             AGLNRI FLLE+L DLD +L  +GSRLLVL+GDPS+VLIRCLK+W+I KLCFEYDT+PYY
Sbjct  66    AGLNRISFLLESLGDLDVNLKKIGSRLLVLKGDPSEVLIRCLKQWNIGKLCFEYDTDPYY  125

Query  610   QALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssp  789
             QALD KVK+YA  AGIE F+PVSHTLF+P DII KNGG PPL+YQSF+ LAG P    SP
Sbjct  126   QALDIKVKDYALKAGIEVFSPVSHTLFNPTDIIQKNGGKPPLSYQSFVNLAGEPP---SP  182

Query  790   lstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKE  969
             L+T  SSLPP+G LGS  +S VPT+++LGY D  + E + F+GGESEALRRL E + +K 
Sbjct  183   LATKYSSLPPVGPLGSCDISEVPTIKDLGYED-DQLEFSPFKGGESEALRRLEECMKDKT  241

Query  970   WVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             WVA FEKPKGNPSAFL+PATT+LSPYLKFGCLSSRYFYQC+Q+V +S+ +HTSPPVSLLG
Sbjct  242   WVANFEKPKGNPSAFLKPATTILSPYLKFGCLSSRYFYQCIQDVYKSLPKHTSPPVSLLG  301

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWRDFFYT AFGTP+FD M+ NRICKQIPWK+ D+LL AWRD++TGFPWIDAIMVQLR
Sbjct  302   QLLWRDFFYTAAFGTPNFDSMKDNRICKQIPWKDDDKLLEAWRDAKTGFPWIDAIMVQLR  361

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             +WGWMHHLARHSVACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ
Sbjct  362   QWGWMHHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  421

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y+RIYSP TFGKKYDPDG+YIRHFLPVLKDMPK YIYEPWTAP SIQ KA CIIG DYP 
Sbjct  422   YNRIYSPTTFGKKYDPDGDYIRHFLPVLKDMPKAYIYEPWTAPPSIQTKANCIIGKDYPM  481

Query  1690  P  1692
             P
Sbjct  482   P  482



>gb|KEH28725.1| UVR3 AtUVR3-like 6-4 DNA photolyase [Medicago truncatula]
Length=518

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/542 (69%), Positives = 444/542 (82%), Gaps = 29/542 (5%)
 Frame = +1

Query  250   ATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTR  429
             +++M   S S++WFRKG+RIHDNPAL++A    +  +PLFVIDPHYM+PDP AFSPGS+R
Sbjct  6     SSSMTLGSGSMIWFRKGIRIHDNPALEYATRGCSNLYPLFVIDPHYMKPDPNAFSPGSSR  65

Query  430   AGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYY  609
             AGLNRI FLLE+L DLD +L  +GSRLLVL+GDPS+VLIRCLK+W+I KLCFEYDT+PYY
Sbjct  66    AGLNRISFLLESLGDLDVNLKKIGSRLLVLKGDPSEVLIRCLKQWNIGKLCFEYDTDPYY  125

Query  610   QALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssp  789
             QALD KVK+YA  AGIE F+PVSHTLF+P DII KNGG PPL+YQSF+ LAG P    SP
Sbjct  126   QALDIKVKDYALKAGIEVFSPVSHTLFNPTDIIQKNGGKPPLSYQSFVNLAGEPP---SP  182

Query  790   lstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKE  969
             L+T  SSLPP+G LGS  +S VPT+++LGY D  + E + F+GGESEALRRL E + +K 
Sbjct  183   LATKYSSLPPVGPLGSCDISEVPTIKDLGYED-DQLEFSPFKGGESEALRRLEECMKDKT  241

Query  970   WVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             WVA FEKPKGNPSAFL+PATT+LSPYLKFGCLSSRYFYQC+Q+V +S+ +HTSPPVSLLG
Sbjct  242   WVANFEKPKGNPSAFLKPATTILSPYLKFGCLSSRYFYQCIQDVYKSLPKHTSPPVSLLG  301

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWRDFFYT AFGTP+FD M+ NRICKQIPWK+ D+LL AWRD++TGFPWIDAIMVQ  
Sbjct  302   QLLWRDFFYTAAFGTPNFDSMKDNRICKQIPWKDDDKLLEAWRDAKTGFPWIDAIMVQ--  359

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
                                   F+HWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ
Sbjct  360   ----------------------FVHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  397

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y+RIYSP TFGKKYDPDG+YIRHFLPVLKDMPK YIYEPWTAP SIQ KA CIIG DYP 
Sbjct  398   YNRIYSPTTFGKKYDPDGDYIRHFLPVLKDMPKAYIYEPWTAPPSIQTKANCIIGKDYPM  457

Query  1690  PVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             PVVSHDSASKEC++++GEAY L+K L G+V +++L  L+R++++ ++    K+KR +Q L
Sbjct  458   PVVSHDSASKECKRKMGEAYALSKALNGLVSEDDLKNLRRKLDKGEEQGT-KSKRSRQLL  516

Query  1870  IG  1875
             IG
Sbjct  517   IG  518



>ref|XP_010914923.1| PREDICTED: (6-4)DNA photolyase isoform X1 [Elaeis guineensis]
Length=533

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/522 (70%), Positives = 443/522 (85%), Gaps = 3/522 (1%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +L+WFRKGLRIHDNPAL HA   S   FP+FV+DP Y++PDP+AFSPGS R+ +NRI
Sbjct  2     ESNALIWFRKGLRIHDNPALDHARRGSKHLFPVFVLDPRYLDPDPSAFSPGSARSAINRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+ L DLD++L  LGSRLL+LRGDP  VL   LK+W+I KLC+E+DTEPY  A D +
Sbjct  62    RFLLDCLSDLDATLRTLGSRLLLLRGDPVPVLCTILKDWNIGKLCYEFDTEPYSLARDKQ  121

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             VK++AS++GIE F+PVSHTLF+PA +I KNGG PPLTYQSF+KLAG P    +PL+ + S
Sbjct  122   VKDFASISGIEVFSPVSHTLFNPAVVIEKNGGRPPLTYQSFVKLAGKPP---TPLTETYS  178

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              LPP+GN+   ++ +VP +EELGY D S++E + FRGGE+EAL+RL++++ +KEWVA FE
Sbjct  179   ELPPVGNVEGYELLSVPAIEELGYGDLSQEEFSPFRGGETEALKRLKKALEDKEWVATFE  238

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+  V ++V +HTSPPVSL+GQLLWR+
Sbjct  239   KPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLHNVYKTVGKHTSPPVSLVGQLLWRE  298

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYTVAFGTP FD+M GN+ICKQIPW++ +EL  AWR+ RTG+PWIDAIM+QL KWGWMH
Sbjct  299   FFYTVAFGTPHFDQMIGNKICKQIPWRDDEELFVAWREGRTGYPWIDAIMIQLTKWGWMH  358

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  359   HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  418

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             PI+FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS+Q+KA CIIG DYPK VV HD
Sbjct  419   PISFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQKKANCIIGKDYPKRVVVHD  478

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             +ASKECR+ + EAY L+     +   E  N L+R++++Q  S
Sbjct  479   TASKECRKAMAEAYALDHLGDNLASKEISNGLRRKLDDQKAS  520



>emb|CAN80978.1| hypothetical protein VITISV_029095 [Vitis vinifera]
Length=633

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/543 (70%), Positives = 437/543 (80%), Gaps = 53/543 (10%)
 Frame = +1

Query  247   PATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGST  426
             P  +MAS S SLMWFRKGLRIHDNPALQHAA  S   +P+FVIDP++MEPDP AFSPGS+
Sbjct  144   PNPSMASGSGSLMWFRKGLRIHDNPALQHAAMESNCVYPVFVIDPYFMEPDPNAFSPGSS  203

Query  427   RAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPY  606
             RAGLNRIRFLLE+LVDLDSSL  LGSRLLVL+GDP +V+I+CLK                
Sbjct  204   RAGLNRIRFLLESLVDLDSSLRQLGSRLLVLKGDPGEVIIQCLK----------------  247

Query  607   YQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAss  786
                     KNYAS AGIE F+PVSHTLFD ADII KNGG PPL+YQSFLKLAG PSWASS
Sbjct  248   --------KNYASAAGIEVFSPVSHTLFDSADIIQKNGGRPPLSYQSFLKLAGQPSWASS  299

Query  787   plstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANK  966
             PLST+LS LPP+G++G+ ++S VPT++ELGY +  +DE T F+GGESEAL+RLRESI +K
Sbjct  300   PLSTTLSWLPPVGDVGTCEISNVPTVKELGYEEIGQDELTPFKGGESEALKRLRESIRDK  359

Query  967   EWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLL  1146
             +WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+ +V ++VKRHTSPPVSL+
Sbjct  360   DWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLTDVYKNVKRHTSPPVSLV  419

Query  1147  GQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQL  1326
             GQLLWRDFFYTV FGTP+FDRM+GNRICKQIPW + DELLAAWR++RTG+PWIDAIMVQL
Sbjct  420   GQLLWRDFFYTVGFGTPNFDRMKGNRICKQIPWNDDDELLAAWREARTGYPWIDAIMVQL  479

Query  1327  RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  1506
             RKWGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFY
Sbjct  480   RKWGWMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFY  539

Query  1507  QYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYP  1686
             Q                             DMPKEYIYEPWTAP SIQ KAKCIIG DYP
Sbjct  540   Q----------------------------PDMPKEYIYEPWTAPPSIQXKAKCIIGKDYP  571

Query  1687  KPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQT  1866
             KPVV HDSA KEC+++L EAY LNK+L G V +E+L +L+R++EE D++ E  T R +Q 
Sbjct  572   KPVVCHDSAXKECKRKLAEAYALNKRLDGSVTEEDLKKLRRKLEE-DENXESNTSRTRQK  630

Query  1867  LIG  1875
             LIG
Sbjct  631   LIG  633



>ref|XP_008792094.1| PREDICTED: (6-4)DNA photolyase [Phoenix dactylifera]
Length=533

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/531 (69%), Positives = 446/531 (84%), Gaps = 3/531 (1%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +L+WFRKGLRIHDNPAL HA   S   FP+FV+DP Y++PDP+AFSPGS R+ LNRI
Sbjct  2     ESNALIWFRKGLRIHDNPALDHARRGSKHLFPVFVLDPRYLDPDPSAFSPGSARSALNRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+ L DLD++L  LGSRLL+LRGDP +VL   LK+W I KLC+E+DTEPY  A D +
Sbjct  62    RFLLDCLSDLDATLRTLGSRLLLLRGDPVRVLCAILKDWKIGKLCYEFDTEPYSFAQDKQ  121

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             VK++AS++GIE F+PVSHTLF+PA +I KNGG PPLTYQSF+KLAG P    +PL+ + S
Sbjct  122   VKDFASLSGIEVFSPVSHTLFNPAVVIEKNGGRPPLTYQSFVKLAGEPP---APLTETYS  178

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              LPP+GN+   ++ +VP++EELGY D S++E + F GGE+EAL+RL+E++ +KEWVA FE
Sbjct  179   ELPPVGNVEGYELLSVPSIEELGYGDLSQEEFSPFPGGETEALKRLKEALEDKEWVATFE  238

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPK +PSAFL+PATTVLSPYLKFGCLSSRYFYQC+  V  +V +HTSPPVSL+GQLLWR+
Sbjct  239   KPKSDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLHNVYTTVGKHTSPPVSLVGQLLWRE  298

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYTVAFGTP FD+M GN+ICKQIPW++ +EL  AWR+ RTG+PWIDAIM+QL+KWGWMH
Sbjct  299   FFYTVAFGTPHFDQMIGNKICKQIPWRDDEELFVAWREGRTGYPWIDAIMIQLKKWGWMH  358

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLFIHWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  359   HLARHSVACFLTRGDLFIHWEKGRDVFKRLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  418

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             PI+FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS+Q+KA CIIG DYPK VV HD
Sbjct  419   PISFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQKKANCIIGKDYPKRVVVHD  478

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQK  1860
             +ASKECR+++ EAY L+     +   E  N L+R++ ++  S     K++K
Sbjct  479   AASKECRKKMAEAYALDHLGDNLASKEISNGLRRKLGDEKASRSSSLKQRK  529



>ref|XP_006841901.1| hypothetical protein AMTR_s00042p00115230 [Amborella trichopoda]
 gb|ERN03576.1| hypothetical protein AMTR_s00042p00115230 [Amborella trichopoda]
Length=537

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/532 (66%), Positives = 431/532 (81%), Gaps = 4/532 (1%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             E  SLMWFRKGLRIHDNPAL +A   +   +P+FV+DP Y+ PD +AFSPGS ++ LNRI
Sbjct  2     EVNSLMWFRKGLRIHDNPALDYATKNAKHLYPVFVLDPLYLNPDTSAFSPGSKKSALNRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             +FLLE+L DLDSSL  LGSRLL+  GDP   + R L  W+I +LCFE+DTEPY    D +
Sbjct  62    QFLLESLSDLDSSLKALGSRLLLFNGDPVHTIKRLLNRWNIGRLCFEFDTEPYSLTRDGQ  121

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             V+++AS  GIE F+PVSHTLFDP ++I KNGG PPLTYQSFL++ GIPS    P + ++S
Sbjct  122   VQDFASHTGIEVFSPVSHTLFDPREVIKKNGGKPPLTYQSFLRIVGIPS---PPHANTIS  178

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
             SLPP+GN+   +VS VPT+EELGY D  ++E + FRGGESEAL+RL+ S+ +K+WVA FE
Sbjct  179   SLPPLGNIEDSEVSNVPTIEELGYADVKQEEYSPFRGGESEALKRLKASLMDKDWVANFE  238

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG P++F  PATTVLSPYLKFGCLSSR FYQ +Q+V + VK+HT PPVSL+GQLLWR+
Sbjct  239   KPKGKPTSFENPATTVLSPYLKFGCLSSRLFYQGLQDVFKEVKKHTLPPVSLVGQLLWRE  298

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFY VA GTP+FD+M+GN+ICKQIPW   D+L  AWR+++TG+PWIDA+MVQLRKWGWMH
Sbjct  299   FFYVVAIGTPNFDQMKGNKICKQIPWSGDDKLFIAWREAQTGYPWIDAVMVQLRKWGWMH  358

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH+VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  359   HLARHAVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  418

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             P +F KKYDP G YIRHF+PVLKDMP++YIYEPWTAPL +Q KA C+IG DYPKPVV HD
Sbjct  419   PTSFAKKYDPSGIYIRHFIPVLKDMPEDYIYEPWTAPLEVQIKANCVIGRDYPKPVVDHD  478

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQ  1863
               SK+CR+++G AY +N     +V  EEL  L R++E+Q   +   TK+QKQ
Sbjct  479   IVSKDCRRKMGAAYAMNSTASDVVTGEELGSLGRKLEKQPIQIS-DTKKQKQ  529



>dbj|BAJ92104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/532 (67%), Positives = 429/532 (81%), Gaps = 7/532 (1%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             L+WFRKGLR+HDNPAL  A  ++ + +P+FV+DP Y+ PDP A SPGS  AG+ R+RFLL
Sbjct  16    LVWFRKGLRVHDNPALDAARRSAARVYPVFVLDPRYLRPDPAAPSPGSAHAGVARVRFLL  75

Query  460   ETLVDLDSSLNNLGSRLLVLRG--DPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L+DLD+ L  LGSRLLVLR   D S  +   LK+W+I KLCFE DTEPY  A D +V 
Sbjct  76    ESLLDLDARLRCLGSRLLVLRARDDVSDAVCAALKDWNIGKLCFESDTEPYALARDKRVT  135

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A+ +GIE F+PVSHTLFDPA+II KNGG PPLTYQSF+  AG P     P+    S L
Sbjct  136   DFAAASGIEVFSPVSHTLFDPAEIIEKNGGRPPLTYQSFVATAGEPP---KPVMEEYSVL  192

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PPIG+ G  ++  VP LEELGY D S++    FRGGE+EAL+R+RES+ +KEWVA FEKP
Sbjct  193   PPIGDTGGYELLPVPKLEELGYGDLSQEYIPPFRGGETEALKRMRESLQDKEWVAKFEKP  252

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAF++PATTVLSPYLKFGCLS RYFY C+Q+V RS K HT PPVSL GQLLWRDFF
Sbjct  253   KGDPSAFVKPATTVLSPYLKFGCLSVRYFYHCIQDVYRSAKTHTKPPVSLAGQLLWRDFF  312

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+ GTP+FD M GN ICKQIPW+ES+EL  AWRD RTG+PWIDAIM+QLRKWGWMHHL
Sbjct  313   YTVSLGTPNFDHMEGNPICKQIPWRESEELFVAWRDGRTGYPWIDAIMIQLRKWGWMHHL  372

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPI  1533
             ARHSVACFLTRGDL+IHWE+GRDVFERLLIDSDWAINNGNW+WLSCSSFFYQYHRIYSPI
Sbjct  373   ARHSVACFLTRGDLYIHWEQGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYHRIYSPI  432

Query  1534  TFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSA  1713
             +FGKKYDP+G+YIRHF+PVLKDMPKEYIYEPWTAPLS+Q KA+CI+G DYPKPVV H++A
Sbjct  433   SFGKKYDPNGDYIRHFIPVLKDMPKEYIYEPWTAPLSVQEKARCIVGKDYPKPVVDHEAA  492

Query  1714  SKECRQRLGEAYELNKKLGGMVRDEELNELKRRV--EEQDKSMEYKTKRQKQ  1863
             SK CR+R+GEAY  N+  G  V+    N  +R++    QD     K+K+ ++
Sbjct  493   SKGCRRRMGEAYASNRLGGSTVKGNSSNSSRRKLCHGGQDVPDSSKSKQPRK  544



>ref|XP_009415361.1| PREDICTED: (6-4)DNA photolyase [Musa acuminata subsp. malaccensis]
Length=521

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/532 (70%), Positives = 447/532 (84%), Gaps = 15/532 (3%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +++WFRKGLRIHDNPAL +A   S+  FP+FV+DP Y+ PDP+AFS GS RAGLNRI
Sbjct  2     ESNAVVWFRKGLRIHDNPALDYACRGSSHIFPVFVLDPRYLHPDPSAFSLGSARAGLNRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRG--DPSQVLIRCLKEWSISKLCFEYDTEPYYQALD  621
             RFLL+ L+DLDSSL NLGSRLLVL+G  +P+ V+ + LK+W+I KLC+E+DTEPY QA D
Sbjct  62    RFLLDCLLDLDSSLRNLGSRLLVLKGHPEPASVICQILKDWNIRKLCYEFDTEPYGQARD  121

Query  622   AKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplsts  801
              +V ++AS  GIE F+PVSHTLFDPA++I KNGG PPLTYQSF+ LAG P     PL+ +
Sbjct  122   RQVTDFASQLGIEVFSPVSHTLFDPAEVIKKNGGRPPLTYQSFVALAGKPP---DPLAKT  178

Query  802   lsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAY  981
              S LPP+GN+G++++  +PT+EELGY D  ++E + F GGESEALRRL+E + +KEWVA 
Sbjct  179   YSELPPVGNVGNVELLNIPTIEELGYKDIEQEEFSPFGGGESEALRRLKEVLKDKEWVAN  238

Query  982   FEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLW  1161
             FEKPKG+PSAF +PATTVLSPYLKFGCLSSRYFY C+  V  +V +HTSPPVSL+GQLLW
Sbjct  239   FEKPKGDPSAFWKPATTVLSPYLKFGCLSSRYFYHCLHSVYLTVGKHTSPPVSLVGQLLW  298

Query  1162  RDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGW  1341
             R+FFYTVAFGTP+FD+MRGN+ICKQIPWK+ D+LL AWR+ RTG+PWIDAIM+QL+KWGW
Sbjct  299   REFFYTVAFGTPNFDQMRGNKICKQIPWKDDDKLLVAWREGRTGYPWIDAIMIQLKKWGW  358

Query  1342  MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  1521
             MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCS+FFYQYHRI
Sbjct  359   MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSAFFYQYHRI  418

Query  1522  YSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVS  1701
             YSPI+FG+KYDPDG YIRHFLPVLKDMP EYIYEPWTAPLSIQ+KA CIIG DYP+PVV 
Sbjct  419   YSPISFGRKYDPDGKYIRHFLPVLKDMPNEYIYEPWTAPLSIQKKANCIIGKDYPRPVVV  478

Query  1702  HDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQ  1857
             HD A+KECR+++GEAY    K+G +  +EE N     V   + + + K KR+
Sbjct  479   HDKANKECRKKMGEAY---GKVGSV--EEEDN-----VAASESTAKQKRKRR  520



>ref|XP_003571518.1| PREDICTED: (6-4)DNA photolyase [Brachypodium distachyon]
Length=547

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/533 (69%), Positives = 434/533 (81%), Gaps = 9/533 (2%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  17    MVWFRKGLRVHDNPALDAARRGAARVYPVFVLDPRYLRPDPAAHSPGSARAGVARVRFLL  76

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D    L   L++W+I KLCFE DTEPY  A D +V 
Sbjct  77    ESLSDLDAGLRRLGSRLLLLRARDDVPDALCAALRDWNIGKLCFEADTEPYALARDKRVT  136

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A+  GIE FTPVSHTLFDPA+II KNGG PPLTYQSFL +AG P     P+    S L
Sbjct  137   DFAAALGIEVFTPVSHTLFDPAEIIEKNGGRPPLTYQSFLAIAGEPP---KPVMAEYSEL  193

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             P IG+ G  ++  VP LEELGY D S++  + FRGGE+EAL+R+RES+ +KEWV+ FEKP
Sbjct  194   PLIGDTGEYELLPVPKLEELGYGDISQENISPFRGGETEALKRMRESLQDKEWVSMFEKP  253

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+QEV RS K+HT PPVSL GQLLWRDFF
Sbjct  254   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQEVYRSTKKHTKPPVSLTGQLLWRDFF  313

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FGT SFD M+GN+ICKQIPW++++EL  AWRD RTG+PWIDAIM+QLRKWGWMHHL
Sbjct  314   YTVSFGTLSFDHMKGNKICKQIPWRQNEELFVAWRDGRTGYPWIDAIMIQLRKWGWMHHL  373

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPI  1533
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQYHRIYSPI
Sbjct  374   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYHRIYSPI  433

Query  1534  TFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSA  1713
             +FGKKYDP+G+YIRHF+PVLKDMPKEYIYEPWTAPLS+Q KA+CI+G DYPKPVV H++A
Sbjct  434   SFGKKYDPNGDYIRHFIPVLKDMPKEYIYEPWTAPLSVQEKARCIVGRDYPKPVVDHEAA  493

Query  1714  SKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEE---QDKSMEYKTKRQKQ  1863
             SKECR+R+GEAY  N +LGG   + + +E  RR      QD S   K+K+ K+
Sbjct  494   SKECRKRMGEAYASN-RLGGNTVNGKTSESSRRKSSDGGQDASDLSKSKQPKR  545



>ref|XP_004951515.1| PREDICTED: (6-4)DNA photolyase-like isoform X3 [Setaria italica]
Length=544

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/520 (70%), Positives = 429/520 (83%), Gaps = 5/520 (1%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A  +GIE FTPVSHTLFDPA+II+KNGG PPLTYQSF+ +AG P     PL    S L
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKNGGRPPLTYQSFIAIAGEPP---EPLMEEYSEL  188

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ES+ NKEWVA FEKP
Sbjct  189   PPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESLENKEWVAKFEKP  248

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q+V RSV+ +T PPVSL GQLLWRDFF
Sbjct  249   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDVYRSVRNYTKPPVSLTGQLLWRDFF  308

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FGTP+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QLRKWGWMHHL
Sbjct  309   YTVSFGTPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQLRKWGWMHHL  368

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPI  1533
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQYHRIYSPI
Sbjct  369   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYHRIYSPI  428

Query  1534  TFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSA  1713
             TFGKKYDP+GNYIRHF+P LKDMP+EYIYEPWTAPLSIQ+KAKCIIG DYPKPVV H++A
Sbjct  429   TFGKKYDPNGNYIRHFIPALKDMPREYIYEPWTAPLSIQKKAKCIIGKDYPKPVVDHETA  488

Query  1714  SKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             SKECR+R+GEAY  ++      R +  N  +R+    D+ 
Sbjct  489   SKECRKRMGEAYASSRLDSNPSRGKPSNMSRRKKSHGDQG  528



>ref|XP_002451747.1| hypothetical protein SORBIDRAFT_04g007140 [Sorghum bicolor]
 gb|EES04723.1| hypothetical protein SORBIDRAFT_04g007140 [Sorghum bicolor]
Length=550

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/531 (68%), Positives = 434/531 (82%), Gaps = 11/531 (2%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAAN------ASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLN  441
             ++WFRKGLR+HDNPAL  A        ++ + +P+FV+DP Y+ PDP A SPGS RAG+ 
Sbjct  11    MVWFRKGLRVHDNPALDAARRYGAGAASARRLYPVFVLDPRYLRPDPAASSPGSARAGVA  70

Query  442   RIRFLLETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQA  615
             RIRFLLE+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY  A
Sbjct  71    RIRFLLESLSDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALA  130

Query  616   LDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspls  795
              D KV ++A  +GIE FTPVSHTLFDPA+II KNGG PPLTYQSF+ +AG P     P+ 
Sbjct  131   RDKKVTDFALASGIEVFTPVSHTLFDPAEIIKKNGGRPPLTYQSFVSIAGEPP---DPIM  187

Query  796   tslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
                S LPP+G+ G  ++  VPT+EELGYVD SE+E   FRGGE+EALRR++ES+ NKEWV
Sbjct  188   EEYSELPPLGDTGEYELLPVPTVEELGYVDISEEEIPPFRGGETEALRRMKESLQNKEWV  247

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FEKPKG+PSAFL+P+TTVLSPYLKFGCLSSRYFY C+Q+V +SV+ HT PPVSL+GQL
Sbjct  248   AKFEKPKGDPSAFLKPSTTVLSPYLKFGCLSSRYFYHCIQDVYKSVRNHTKPPVSLIGQL  307

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWRDFFYTV++GTP+FDRM+GN+ICKQIPW E++EL  AWRD +TG+PWIDAIM+QLRKW
Sbjct  308   LWRDFFYTVSYGTPNFDRMKGNKICKQIPWSENEELFVAWRDGQTGYPWIDAIMIQLRKW  367

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GWMHHLARHSVACFLTRGD+FIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH
Sbjct  368   GWMHHLARHSVACFLTRGDMFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  427

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
             RIYSPITFGKKYDP+GNYIRHF+PVLKDMP+EYIYEPWTAPLSIQ+KA CIIG DYPKPV
Sbjct  428   RIYSPITFGKKYDPNGNYIRHFIPVLKDMPREYIYEPWTAPLSIQKKANCIIGKDYPKPV  487

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKT  1848
             V H++ASKEC++R+GEAY  ++      + + LN  +R++   D+     T
Sbjct  488   VDHETASKECKKRMGEAYASSRLDANPTKGKTLNSSRRKMPHGDQDTSNST  538



>ref|XP_004976947.1| PREDICTED: (6-4)DNA photolyase-like isoform X5 [Setaria italica]
Length=544

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/520 (70%), Positives = 428/520 (82%), Gaps = 5/520 (1%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A  +GIE FTPVSHTLFDPA+II+KNGG PPLTYQSF+ +AG P     PL    S L
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKNGGRPPLTYQSFIAIAGEPP---EPLMEEYSEL  188

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ESI NKEWVA FEKP
Sbjct  189   PPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESIENKEWVAKFEKP  248

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+++V RSV+ +T PPVSL GQLLWRDFF
Sbjct  249   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIRDVYRSVRNYTKPPVSLTGQLLWRDFF  308

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FG P+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QLRKWGWMHHL
Sbjct  309   YTVSFGIPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQLRKWGWMHHL  368

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPI  1533
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQYHRIYSPI
Sbjct  369   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYHRIYSPI  428

Query  1534  TFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSA  1713
             TFGKKYDP+GNYIRHF+P LKDMP+EYIYEPWTAPLSIQ+KAKCIIG DYPKPVV H++A
Sbjct  429   TFGKKYDPNGNYIRHFIPALKDMPREYIYEPWTAPLSIQKKAKCIIGKDYPKPVVDHETA  488

Query  1714  SKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             SKECR+R+GEAY  ++      R +  N  +R+    D+ 
Sbjct  489   SKECRKRMGEAYASSRLDSNPSRGKPSNMSRRKKSHGDQG  528



>ref|XP_006385491.1| hypothetical protein POPTR_0003s05870g [Populus trichocarpa]
 gb|ERP63288.1| hypothetical protein POPTR_0003s05870g [Populus trichocarpa]
Length=533

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/463 (77%), Positives = 413/463 (89%), Gaps = 3/463 (1%)
 Frame = +1

Query  214   ISLSARRTSMHPATAM--ASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHY  387
             +SL   + + H    +  AS S S++WFRKGLRIHDNPAL++A+  S   +P+FVIDPHY
Sbjct  58    LSLCLSKPAQHLKNPLMAASGSGSIIWFRKGLRIHDNPALEYASKGSDFVYPVFVIDPHY  117

Query  388   MEPDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWS  567
             MEPDP AFSPGS  AGLNRIRFLLE+LVDLD+SL  LGSRLL+LRG+P QVL RCLKEW 
Sbjct  118   MEPDPKAFSPGSRLAGLNRIRFLLESLVDLDTSLKKLGSRLLILRGEPGQVLTRCLKEWG  177

Query  568   ISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQS  747
             + KLCFEYDT+P+YQALD +VK YAS AGIE F+PVSHTLF+PADII +NGG PPLTYQS
Sbjct  178   VKKLCFEYDTDPHYQALDIRVKEYASAAGIEVFSPVSHTLFNPADIIQRNGGKPPLTYQS  237

Query  748   FLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGES  927
             FLKLAG PSWASSPL TS+SSLPP+G++GS ++S VPT+++LGY D  E E   FRGGES
Sbjct  238   FLKLAGQPSWASSPLLTSISSLPPVGDVGSCEISEVPTIKDLGYGDI-EQEWIPFRGGES  296

Query  928   EALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLR  1107
             EAL+RL+ESI++KEWVA FEKPKGNPSAF++PATTVLSPYLKFGCLSSRYFYQC+Q+V +
Sbjct  297   EALKRLKESISDKEWVANFEKPKGNPSAFVKPATTVLSPYLKFGCLSSRYFYQCLQDVYK  356

Query  1108  SVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSR  1287
             +V++HTSPPVSL GQLLWRDFFYTVAFGTP+FDRM GN++CKQIPW + DELLAAWR++R
Sbjct  357   NVQKHTSPPVSLAGQLLWRDFFYTVAFGTPNFDRMEGNKLCKQIPWNDDDELLAAWREAR  416

Query  1288  TGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINN  1467
             TG+PWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLF+HWE+GRDVFERLLIDSDWAINN
Sbjct  417   TGYPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFLHWERGRDVFERLLIDSDWAINN  476

Query  1468  GNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLK  1596
             GNW+WLSCSSFFYQY+RIYSPI+FGKKYDP+G+YIRHFLPVLK
Sbjct  477   GNWLWLSCSSFFYQYNRIYSPISFGKKYDPNGDYIRHFLPVLK  519



>ref|XP_004951514.1| PREDICTED: (6-4)DNA photolyase-like isoform X2 [Setaria italica]
Length=553

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/529 (69%), Positives = 429/529 (81%), Gaps = 14/529 (3%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHK---------NGGTPPLTYQSFLKLAGIPSWAss  786
             ++A  +GIE FTPVSHTLFDPA+II+K         NGG PPLTYQSF+ +AG P     
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKVLFCFAHLQNGGRPPLTYQSFIAIAGEPP---E  188

Query  787   plstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANK  966
             PL    S LPP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ES+ NK
Sbjct  189   PLMEEYSELPPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESLENK  248

Query  967   EWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLL  1146
             EWVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q+V RSV+ +T PPVSL 
Sbjct  249   EWVAKFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDVYRSVRNYTKPPVSLT  308

Query  1147  GQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQL  1326
             GQLLWRDFFYTV+FGTP+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QL
Sbjct  309   GQLLWRDFFYTVSFGTPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQL  368

Query  1327  RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  1506
             RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFY
Sbjct  369   RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFY  428

Query  1507  QYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYP  1686
             QYHRIYSPITFGKKYDP+GNYIRHF+P LKDMP+EYIYEPWTAPLSIQ+KAKCIIG DYP
Sbjct  429   QYHRIYSPITFGKKYDPNGNYIRHFIPALKDMPREYIYEPWTAPLSIQKKAKCIIGKDYP  488

Query  1687  KPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             KPVV H++ASKECR+R+GEAY  ++      R +  N  +R+    D+ 
Sbjct  489   KPVVDHETASKECRKRMGEAYASSRLDSNPSRGKPSNMSRRKKSHGDQG  537



>ref|XP_004976946.1| PREDICTED: (6-4)DNA photolyase-like isoform X4 [Setaria italica]
Length=553

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/529 (68%), Positives = 428/529 (81%), Gaps = 14/529 (3%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHK---------NGGTPPLTYQSFLKLAGIPSWAss  786
             ++A  +GIE FTPVSHTLFDPA+II+K         NGG PPLTYQSF+ +AG P     
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKVLFCFAHLQNGGRPPLTYQSFIAIAGEPP---E  188

Query  787   plstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANK  966
             PL    S LPP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ESI NK
Sbjct  189   PLMEEYSELPPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESIENK  248

Query  967   EWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLL  1146
             EWVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+++V RSV+ +T PPVSL 
Sbjct  249   EWVAKFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIRDVYRSVRNYTKPPVSLT  308

Query  1147  GQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQL  1326
             GQLLWRDFFYTV+FG P+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QL
Sbjct  309   GQLLWRDFFYTVSFGIPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQL  368

Query  1327  RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  1506
             RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFY
Sbjct  369   RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFY  428

Query  1507  QYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYP  1686
             QYHRIYSPITFGKKYDP+GNYIRHF+P LKDMP+EYIYEPWTAPLSIQ+KAKCIIG DYP
Sbjct  429   QYHRIYSPITFGKKYDPNGNYIRHFIPALKDMPREYIYEPWTAPLSIQKKAKCIIGKDYP  488

Query  1687  KPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             KPVV H++ASKECR+R+GEAY  ++      R +  N  +R+    D+ 
Sbjct  489   KPVVDHETASKECRKRMGEAYASSRLDSNPSRGKPSNMSRRKKSHGDQG  537



>ref|XP_009598183.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Nicotiana tomentosiformis]
Length=463

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/427 (82%), Positives = 396/427 (93%), Gaps = 0/427 (0%)
 Frame = +1

Query  253   TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             + MAS S SL+WFRKGLR+HDNPAL++AA  S   +P+FVIDPHYMEPDPTAFSPGS+RA
Sbjct  14    STMASGSNSLIWFRKGLRLHDNPALEYAAKGSKFLYPVFVIDPHYMEPDPTAFSPGSSRA  73

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             GLNRI+FLLE+LVDLD SL  LGSRLLVL+G+PS+VLIRCLKEWSI KLCFEYDTEPYYQ
Sbjct  74    GLNRIQFLLESLVDLDLSLKKLGSRLLVLKGEPSEVLIRCLKEWSIGKLCFEYDTEPYYQ  133

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
             ALD KVKN+ASVAG+E F+PVSHTL++PADII+KNGG+PPLTYQSFLKLAG PSWAS+PL
Sbjct  134   ALDVKVKNHASVAGVEIFSPVSHTLYNPADIINKNGGSPPLTYQSFLKLAGQPSWASTPL  193

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
             ST++SSLPPIGN G+  VS VPT++ELGY D +EDERT F+GGESEAL+RLRESIANKEW
Sbjct  194   STTISSLPPIGNTGNFAVSEVPTVKELGYEDLNEDERTPFKGGESEALKRLRESIANKEW  253

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA FEKPKG+PSAF++PATTVLSPYLKFGCLSSRYFYQC+Q++ +SVK+HTSPPVSLLGQ
Sbjct  254   VANFEKPKGDPSAFMKPATTVLSPYLKFGCLSSRYFYQCIQDIQKSVKKHTSPPVSLLGQ  313

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWRDFFYTV+FGTP+FD+M+GNRICKQIPWK  DELLAAWRD+RTGFPWIDAIM QLRK
Sbjct  314   LLWRDFFYTVSFGTPNFDQMKGNRICKQIPWKNDDELLAAWRDARTGFPWIDAIMTQLRK  373

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
             WGWMHHLARHSVACFLTRGDLF+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQ+
Sbjct  374   WGWMHHLARHSVACFLTRGDLFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQF  433

Query  1513  HRIYSPI  1533
               + S I
Sbjct  434   SWMTSNI  440



>ref|XP_008643513.1| PREDICTED: uncharacterized protein LOC100280217 isoform X1 [Zea 
mays]
 gb|AFW70620.1| hypothetical protein ZEAMMB73_082662 [Zea mays]
Length=548

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/537 (67%), Positives = 430/537 (80%), Gaps = 11/537 (2%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANA-----STKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             +MWFRKGLR+HDNPAL  A        S + +P+FV+DP Y+ PD  A SPGS RAG+ R
Sbjct  11    MMWFRKGLRVHDNPALDAARRHGAGAASARLYPVFVLDPRYLRPDAVAASPGSARAGVAR  70

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             IRFLLE+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY  A 
Sbjct  71    IRFLLESLSDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALAR  130

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KV ++A  +GIE  TPVSHTLFDP +II KNGG PPLTYQSF+ +AG P    +P   
Sbjct  131   DKKVTDFALASGIEVLTPVSHTLFDPEEIIKKNGGRPPLTYQSFVSIAGEPP---APAME  187

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
               S LPP+G+ G  ++  VPT+EELGY D S++E   F GGE+EALRR++ES+ NKEWVA
Sbjct  188   EYSELPPLGDTGEYELLPVPTVEELGYGDISQEEIPPFHGGETEALRRMKESLQNKEWVA  247

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PSAF++P+TTVLSPYLKFGCLSSRYFY C+Q+V RSV+ HT PPVSL GQLL
Sbjct  248   KFEKPKGDPSAFVKPSTTVLSPYLKFGCLSSRYFYHCIQDVHRSVRNHTKPPVSLTGQLL  307

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WRDFFYTV++GTP+FDRM+GN+ICKQIPW E+++L  AWRD +TG+PWIDAIM+QLR WG
Sbjct  308   WRDFFYTVSYGTPNFDRMKGNKICKQIPWSENEDLFVAWRDGQTGYPWIDAIMIQLRNWG  367

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARHSVACFLTRGD+FIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQYHR
Sbjct  368   WMHHLARHSVACFLTRGDMFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYHR  427

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             IYSPITFGKKYDP+GNYIRHF+PVLKDMP+EYIYEPWTAP SIQ+KA CIIG DYPKPVV
Sbjct  428   IYSPITFGKKYDPNGNYIRHFIPVLKDMPREYIYEPWTAPTSIQKKANCIIGKDYPKPVV  487

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVE-EQDKSMEYKTKRQKQT  1866
              H++ASKECR+R+GEAY L++      + + LN  ++ +  ++D S     KR K+ 
Sbjct  488   DHETASKECRKRMGEAYALSRVDAKPSKGKTLNSRRKMLHGDRDTSNSTIAKRLKRN  544



>gb|EEE56527.1| hypothetical protein OsJ_05816 [Oryza sativa Japonica Group]
Length=551

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/500 (71%), Positives = 418/500 (84%), Gaps = 9/500 (2%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHA--ANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRF  453
             ++WFRKGLR+HDNPAL  A    A  + +P+FV+DP Y+ PD  A SPGS RAG+ R+RF
Sbjct  16    MVWFRKGLRVHDNPALDAARRGGAVARLYPVFVLDPRYLRPDQAAPSPGSARAGVARVRF  75

Query  454   LLETLVDLDSSLNNLGSRLLVLR----GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALD  621
             LLE+L DLD+ L  LGSRLL+LR    GD +  +   LK+W+I KLCFE DTEPY  A D
Sbjct  76    LLESLSDLDARLRRLGSRLLLLRARDDGDVAGTVCAALKDWNIGKLCFESDTEPYALARD  135

Query  622   AKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplsts  801
              KV ++A+ +GI+ F+PVSHTLFDPA+II KNGG PP+TYQSF+ +AG P     P+   
Sbjct  136   KKVMDFAAASGIDVFSPVSHTLFDPAEIIEKNGGRPPMTYQSFVAIAGEPP---EPIMEE  192

Query  802   lsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAY  981
              S LPP+G+ G  ++  VP +EELGY D S+++ + FRGGE+EAL+R+RES+ +KEWVA 
Sbjct  193   YSELPPVGDTGEYELLPVPRVEELGYGDISQEDLSLFRGGETEALKRMRESLHDKEWVAK  252

Query  982   FEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLW  1161
             FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q++ RS K+HT+PPVSL GQLLW
Sbjct  253   FEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDIYRSTKKHTNPPVSLTGQLLW  312

Query  1162  RDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGW  1341
             RDFFYTVAFGTP+FD+M+GN+ICKQIPW E++EL  AWRD RTG+PWIDAIM+QLRKWGW
Sbjct  313   RDFFYTVAFGTPNFDQMKGNKICKQIPWTENEELFPAWRDGRTGYPWIDAIMIQLRKWGW  372

Query  1342  MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  1521
             MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI
Sbjct  373   MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  432

Query  1522  YSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVS  1701
             YSP +FGKKYDP+GNYIRHF+PVLKDMPKEYIYEPWTAPLSIQ+KA CIIG DYPKPVV 
Sbjct  433   YSPTSFGKKYDPNGNYIRHFIPVLKDMPKEYIYEPWTAPLSIQKKANCIIGKDYPKPVVD  492

Query  1702  HDSASKECRQRLGEAYELNK  1761
             H  ASKEC++ +GEAY  N+
Sbjct  493   HAIASKECKKMMGEAYASNR  512



>ref|XP_004951513.1| PREDICTED: (6-4)DNA photolyase-like isoform X1 [Setaria italica]
Length=575

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/551 (66%), Positives = 429/551 (78%), Gaps = 36/551 (7%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A  +GIE FTPVSHTLFDPA+II+KNGG PPLTYQSF+ +AG P     PL    S L
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKNGGRPPLTYQSFIAIAGEPP---EPLMEEYSEL  188

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ES+ NKEWVA FEKP
Sbjct  189   PPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESLENKEWVAKFEKP  248

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q+V RSV+ +T PPVSL GQLLWRDFF
Sbjct  249   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDVYRSVRNYTKPPVSLTGQLLWRDFF  308

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FGTP+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QLRKWGWMHHL
Sbjct  309   YTVSFGTPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQLRKWGWMHHL  368

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ--------  1509
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQ        
Sbjct  369   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQVRQRISFR  428

Query  1510  -----------------------YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIY  1620
                                    YHRIYSPITFGKKYDP+GNYIRHF+P LKDMP+EYIY
Sbjct  429   WHWLWTFLFSLIVCLLYFNLIKQYHRIYSPITFGKKYDPNGNYIRHFIPALKDMPREYIY  488

Query  1621  EPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNE  1800
             EPWTAPLSIQ+KAKCIIG DYPKPVV H++ASKECR+R+GEAY  ++      R +  N 
Sbjct  489   EPWTAPLSIQKKAKCIIGKDYPKPVVDHETASKECRKRMGEAYASSRLDSNPSRGKPSNM  548

Query  1801  LKRRVEEQDKS  1833
              +R+    D+ 
Sbjct  549   SRRKKSHGDQG  559



>ref|XP_004976944.1| PREDICTED: (6-4)DNA photolyase-like isoform X2 [Setaria italica]
Length=576

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/551 (66%), Positives = 428/551 (78%), Gaps = 37/551 (7%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A  +GIE FTPVSHTLFDPA+II+KNGG PPLTYQSF+ +AG P     PL    S L
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKNGGRPPLTYQSFIAIAGEPP---EPLMEEYSEL  188

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ESI NKEWVA FEKP
Sbjct  189   PPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESIENKEWVAKFEKP  248

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+++V RSV+ +T PPVSL GQLLWRDFF
Sbjct  249   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIRDVYRSVRNYTKPPVSLTGQLLWRDFF  308

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FG P+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QLRKWGWMHHL
Sbjct  309   YTVSFGIPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQLRKWGWMHHL  368

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPI  1533
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQYHRIYSPI
Sbjct  369   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYHRIYSPI  428

Query  1534  TFGKKYDPDGNYIRHFLPVLK--------------------------------DMPKEYI  1617
             TFGKKYDP+GNYIRHF+P LK                                DMP+EYI
Sbjct  429   TFGKKYDPNGNYIRHFIPALKGTSEVRTRKKAFFLDKENETFFFCTMLYSINLDMPREYI  488

Query  1618  YEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELN  1797
             YEPWTAPLSIQ+KAKCIIG DYPKPVV H++ASKECR+R+GEAY  ++      R +  N
Sbjct  489   YEPWTAPLSIQKKAKCIIGKDYPKPVVDHETASKECRKRMGEAYASSRLDSNPSRGKPSN  548

Query  1798  ELKRRVEEQDK  1830
               +R+    D+
Sbjct  549   MSRRKKSHGDQ  559



>ref|XP_004976945.1| PREDICTED: (6-4)DNA photolyase-like isoform X3 [Setaria italica]
Length=575

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/551 (66%), Positives = 428/551 (78%), Gaps = 36/551 (7%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A  +GIE FTPVSHTLFDPA+II+KNGG PPLTYQSF+ +AG P     PL    S L
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKNGGRPPLTYQSFIAIAGEPP---EPLMEEYSEL  188

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ESI NKEWVA FEKP
Sbjct  189   PPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESIENKEWVAKFEKP  248

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+++V RSV+ +T PPVSL GQLLWRDFF
Sbjct  249   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIRDVYRSVRNYTKPPVSLTGQLLWRDFF  308

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FG P+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QLRKWGWMHHL
Sbjct  309   YTVSFGIPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQLRKWGWMHHL  368

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ--------  1509
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQ        
Sbjct  369   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQVRQRISFR  428

Query  1510  -----------------------YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIY  1620
                                    YHRIYSPITFGKKYDP+GNYIRHF+P LKDMP+EYIY
Sbjct  429   WHWLWTFLFSLIVCLLYFNLIKQYHRIYSPITFGKKYDPNGNYIRHFIPALKDMPREYIY  488

Query  1621  EPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNE  1800
             EPWTAPLSIQ+KAKCIIG DYPKPVV H++ASKECR+R+GEAY  ++      R +  N 
Sbjct  489   EPWTAPLSIQKKAKCIIGKDYPKPVVDHETASKECRKRMGEAYASSRLDSNPSRGKPSNM  548

Query  1801  LKRRVEEQDKS  1833
              +R+    D+ 
Sbjct  549   SRRKKSHGDQG  559



>ref|NP_001046243.2| Os02g0204400 [Oryza sativa Japonica Group]
 sp|Q0E2Y1.1|UVR3_ORYSJ RecName: Full=(6-4)DNA photolyase [Oryza sativa Japonica Group]
 dbj|BAF08157.2| Os02g0204400 [Oryza sativa Japonica Group]
Length=551

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/500 (70%), Positives = 416/500 (83%), Gaps = 9/500 (2%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTK--CFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRF  453
             ++WFRKGLR+HDNPAL  A         +P+FV+DP Y+ PD  A SPGS RAG+ R+RF
Sbjct  16    MVWFRKGLRVHDNPALDAARRGGAAARLYPVFVLDPRYLRPDQAAPSPGSARAGVARVRF  75

Query  454   LLETLVDLDSSLNNLGSRLLVLR----GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALD  621
             LLE+L DLD+ L  LGSRLL+LR    GD +  +   LK+W+I KLCFE DTEPY  A D
Sbjct  76    LLESLSDLDARLRRLGSRLLLLRARDDGDVAGTVCAALKDWNIGKLCFESDTEPYALARD  135

Query  622   AKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplsts  801
              KV ++A+ +GI+ F+PVSHTLFDPA+II KNGG PP+TYQSF+ +AG P     P+   
Sbjct  136   KKVMDFAAASGIDVFSPVSHTLFDPAEIIEKNGGRPPMTYQSFVAIAGEPP---EPIMEE  192

Query  802   lsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAY  981
              S LPP+G+ G  ++  VP +EELGY D S+++ + FRGGE+EAL+R+RES+ +KEWVA 
Sbjct  193   YSELPPVGDTGEYELLPVPRVEELGYGDISQEDLSLFRGGETEALKRMRESLHDKEWVAK  252

Query  982   FEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLW  1161
             FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q++ RS K+HT+PPVSL GQLLW
Sbjct  253   FEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDIYRSTKKHTNPPVSLTGQLLW  312

Query  1162  RDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGW  1341
             RDFFYTVAFGTP+FD+M+GN+ICKQIPW E++EL  AWRD RTG+PWIDAIM+QLRKWGW
Sbjct  313   RDFFYTVAFGTPNFDQMKGNKICKQIPWTENEELFPAWRDGRTGYPWIDAIMIQLRKWGW  372

Query  1342  MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  1521
             MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI
Sbjct  373   MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  432

Query  1522  YSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVS  1701
             YSP +FGKKYDP+GNYIRHF+PVLKDMPKEYIYEPWTAPLSIQ+KA CIIG DYPKPVV 
Sbjct  433   YSPTSFGKKYDPNGNYIRHFIPVLKDMPKEYIYEPWTAPLSIQKKANCIIGKDYPKPVVD  492

Query  1702  HDSASKECRQRLGEAYELNK  1761
             H  ASKEC++ +GEAY  N+
Sbjct  493   HAIASKECKKMMGEAYASNR  512



>gb|EEC72708.1| hypothetical protein OsI_06300 [Oryza sativa Indica Group]
Length=551

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/500 (70%), Positives = 416/500 (83%), Gaps = 9/500 (2%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTK--CFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRF  453
             ++WFRKGLR+HDNPAL  A         +P+FV+DP ++ PD  A SPGS RAG+ R+RF
Sbjct  16    MVWFRKGLRVHDNPALDAARRGGAAARLYPVFVLDPRFLLPDQAAPSPGSARAGVARVRF  75

Query  454   LLETLVDLDSSLNNLGSRLLVLR----GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALD  621
             LLE+L DLD+ L  LGSRLL+LR    GD +  +   LK+W+I KLCFE DTEPY  A D
Sbjct  76    LLESLSDLDARLRRLGSRLLLLRARDDGDVAGTVCAALKDWNIGKLCFESDTEPYALARD  135

Query  622   AKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplsts  801
              KV ++A+ +GI+ F+PVSHTLFDPA+II KNGG PP+TYQSF+ +AG P     P+   
Sbjct  136   KKVMDFAAASGIDVFSPVSHTLFDPAEIIEKNGGRPPMTYQSFVAIAGEPP---EPIMEE  192

Query  802   lsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAY  981
              S LPP+G+ G  ++  VP +EELGY D S+++ + FRGGE+EAL+R+RES+ +KEWVA 
Sbjct  193   YSELPPVGDTGEYELLPVPRVEELGYGDISQEDLSPFRGGETEALKRMRESLHDKEWVAK  252

Query  982   FEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLW  1161
             FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q+V RS K+HT+PPVSL GQLLW
Sbjct  253   FEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDVYRSTKKHTNPPVSLTGQLLW  312

Query  1162  RDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGW  1341
             RDFFYTVAFGTP+FD+M+GN+ICKQIPW E++EL  AWRD RTG+PWIDAIM+QLRKWGW
Sbjct  313   RDFFYTVAFGTPNFDQMKGNKICKQIPWTENEELFPAWRDGRTGYPWIDAIMIQLRKWGW  372

Query  1342  MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  1521
             MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI
Sbjct  373   MHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRI  432

Query  1522  YSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVS  1701
             YSP +FGKKYDP+GNYIRHF+PVLKDMPKEYIYEPWTAPLSIQ+KA CIIG DYPKPVV 
Sbjct  433   YSPTSFGKKYDPNGNYIRHFIPVLKDMPKEYIYEPWTAPLSIQKKANCIIGKDYPKPVVD  492

Query  1702  HDSASKECRQRLGEAYELNK  1761
             H  ASKEC++ +GEAY  N+
Sbjct  493   HAIASKECKKMMGEAYASNR  512



>ref|XP_010914927.1| PREDICTED: (6-4)DNA photolyase isoform X5 [Elaeis guineensis]
Length=476

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/474 (73%), Positives = 413/474 (87%), Gaps = 3/474 (1%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +L+WFRKGLRIHDNPAL HA   S   FP+FV+DP Y++PDP+AFSPGS R+ +NRI
Sbjct  2     ESNALIWFRKGLRIHDNPALDHARRGSKHLFPVFVLDPRYLDPDPSAFSPGSARSAINRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+ L DLD++L  LGSRLL+LRGDP  VL   LK+W+I KLC+E+DTEPY  A D +
Sbjct  62    RFLLDCLSDLDATLRTLGSRLLLLRGDPVPVLCTILKDWNIGKLCYEFDTEPYSLARDKQ  121

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             VK++AS++GIE F+PVSHTLF+PA +I KNGG PPLTYQSF+KLAG P    +PL+ + S
Sbjct  122   VKDFASISGIEVFSPVSHTLFNPAVVIEKNGGRPPLTYQSFVKLAGKPP---TPLTETYS  178

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              LPP+GN+   ++ +VP +EELGY D S++E + FRGGE+EAL+RL++++ +KEWVA FE
Sbjct  179   ELPPVGNVEGYELLSVPAIEELGYGDLSQEEFSPFRGGETEALKRLKKALEDKEWVATFE  238

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+  V ++V +HTSPPVSL+GQLLWR+
Sbjct  239   KPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLHNVYKTVGKHTSPPVSLVGQLLWRE  298

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYTVAFGTP FD+M GN+ICKQIPW++ +EL  AWR+ RTG+PWIDAIM+QL KWGWMH
Sbjct  299   FFYTVAFGTPHFDQMIGNKICKQIPWRDDEELFVAWREGRTGYPWIDAIMIQLTKWGWMH  358

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  359   HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  418

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             PI+FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS+Q+KA CIIG DYPK
Sbjct  419   PISFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQKKANCIIGKDYPK  472



>ref|XP_010503237.1| PREDICTED: (6-4)DNA photolyase-like isoform X2 [Camelina sativa]
Length=494

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/460 (75%), Positives = 399/460 (87%), Gaps = 2/460 (0%)
 Frame = +1

Query  223   SARRTSMHPATAMASESC--SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEP  396
             S+     +P   MAS S   SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME 
Sbjct  33    SSSSYCFNPIATMASASGFGSLVWFRKGLRVHDNPALEYASKGSQFLYPVFVIDPHYMEL  92

Query  397   DPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISK  576
             DP+AFSPGS+R+G+NRIRFLLE+L DLDSSL  LGSRLLVL+G+P +VL+RCL+EW ++ 
Sbjct  93    DPSAFSPGSSRSGVNRIRFLLESLKDLDSSLKKLGSRLLVLKGEPGEVLVRCLQEWKVNM  152

Query  577   LCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLK  756
             LCFEYDT+PYYQALD +VK+YAS  G+E F+PVSHTLF+PADII KNGG PPL+YQSF+K
Sbjct  153   LCFEYDTDPYYQALDVRVKDYASSTGVEVFSPVSHTLFNPADIIEKNGGKPPLSYQSFVK  212

Query  757   LAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEAL  936
             +AG PS A+S L  S SSLPPIG +G+L +S VPTLEELGY +    E T FRGGESEAL
Sbjct  213   IAGEPSCATSELVMSYSSLPPIGEVGNLGISEVPTLEELGYREDEIAEWTPFRGGESEAL  272

Query  937   RRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVK  1116
             +RL +SI++K WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC++ + + VK
Sbjct  273   QRLTKSISDKAWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLKNIYKDVK  332

Query  1117  RHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGF  1296
             +HTSPPVSLLGQLLWR+FFYT AFGTP+FD+MRGNRICKQIPW E   +LAAWRD +TG+
Sbjct  333   KHTSPPVSLLGQLLWREFFYTTAFGTPNFDKMRGNRICKQIPWNEDHAMLAAWRDGKTGY  392

Query  1297  PWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW  1476
             PWIDAIMVQL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNW
Sbjct  393   PWIDAIMVQLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNW  452

Query  1477  MWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLK  1596
             MWLSCSSFFYQY+RIYSPI+FGKKYDPDG +IRHFLPVLK
Sbjct  453   MWLSCSSFFYQYNRIYSPISFGKKYDPDGKFIRHFLPVLK  492



>dbj|BAD16007.1| putative 6-4 photolyase (UVR3) [Oryza sativa Japonica Group]
 dbj|BAD38427.1| putative 6-4 photolyase (UVR3) [Oryza sativa Japonica Group]
Length=560

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/509 (69%), Positives = 416/509 (82%), Gaps = 18/509 (4%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTK--CFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRF  453
             ++WFRKGLR+HDNPAL  A         +P+FV+DP Y+ PD  A SPGS RAG+ R+RF
Sbjct  16    MVWFRKGLRVHDNPALDAARRGGAAARLYPVFVLDPRYLRPDQAAPSPGSARAGVARVRF  75

Query  454   LLETLVDLDSSLNNLGSRLLVLR----GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALD  621
             LLE+L DLD+ L  LGSRLL+LR    GD +  +   LK+W+I KLCFE DTEPY  A D
Sbjct  76    LLESLSDLDARLRRLGSRLLLLRARDDGDVAGTVCAALKDWNIGKLCFESDTEPYALARD  135

Query  622   AKVKNYASVAGIETFTPVSHTLFDPADIIHK---------NGGTPPLTYQSFLKLAGIPS  774
              KV ++A+ +GI+ F+PVSHTLFDPA+II K         NGG PP+TYQSF+ +AG P 
Sbjct  136   KKVMDFAAASGIDVFSPVSHTLFDPAEIIEKFLFSFGKWKNGGRPPMTYQSFVAIAGEPP  195

Query  775   WAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
                 P+    S LPP+G+ G  ++  VP +EELGY D S+++ + FRGGE+EAL+R+RES
Sbjct  196   ---EPIMEEYSELPPVGDTGEYELLPVPRVEELGYGDISQEDLSLFRGGETEALKRMRES  252

Query  955   IANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPP  1134
             + +KEWVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q++ RS K+HT+PP
Sbjct  253   LHDKEWVAKFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDIYRSTKKHTNPP  312

Query  1135  VSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAI  1314
             VSL GQLLWRDFFYTVAFGTP+FD+M+GN+ICKQIPW E++EL  AWRD RTG+PWIDAI
Sbjct  313   VSLTGQLLWRDFFYTVAFGTPNFDQMKGNKICKQIPWTENEELFPAWRDGRTGYPWIDAI  372

Query  1315  MVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  1494
             M+QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS
Sbjct  373   MIQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  432

Query  1495  SFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIG  1674
             SFFYQYHRIYSP +FGKKYDP+GNYIRHF+PVLKDMPKEYIYEPWTAPLSIQ+KA CIIG
Sbjct  433   SFFYQYHRIYSPTSFGKKYDPNGNYIRHFIPVLKDMPKEYIYEPWTAPLSIQKKANCIIG  492

Query  1675  IDYPKPVVSHDSASKECRQRLGEAYELNK  1761
              DYPKPVV H  ASKEC++ +GEAY  N+
Sbjct  493   KDYPKPVVDHAIASKECKKMMGEAYASNR  521



>ref|XP_010914924.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Elaeis guineensis]
Length=509

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/522 (67%), Positives = 424/522 (81%), Gaps = 27/522 (5%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +L+WFRKGLRIHDNPAL HA   S   FP+FV+DP Y++PDP+AFSPGS R+ +NRI
Sbjct  2     ESNALIWFRKGLRIHDNPALDHARRGSKHLFPVFVLDPRYLDPDPSAFSPGSARSAINRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+ L DLD++L  LGSRLL+LRGDP  VL   LK+                      
Sbjct  62    RFLLDCLSDLDATLRTLGSRLLLLRGDPVPVLCTILKD----------------------  99

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
               ++AS++GIE F+PVSHTLF+PA +I KNGG PPLTYQSF+KLAG P    +PL+ + S
Sbjct  100   --DFASISGIEVFSPVSHTLFNPAVVIEKNGGRPPLTYQSFVKLAGKPP---TPLTETYS  154

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              LPP+GN+   ++ +VP +EELGY D S++E + FRGGE+EAL+RL++++ +KEWVA FE
Sbjct  155   ELPPVGNVEGYELLSVPAIEELGYGDLSQEEFSPFRGGETEALKRLKKALEDKEWVATFE  214

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+  V ++V +HTSPPVSL+GQLLWR+
Sbjct  215   KPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLHNVYKTVGKHTSPPVSLVGQLLWRE  274

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYTVAFGTP FD+M GN+ICKQIPW++ +EL  AWR+ RTG+PWIDAIM+QL KWGWMH
Sbjct  275   FFYTVAFGTPHFDQMIGNKICKQIPWRDDEELFVAWREGRTGYPWIDAIMIQLTKWGWMH  334

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  335   HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  394

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             PI+FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS+Q+KA CIIG DYPK VV HD
Sbjct  395   PISFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQKKANCIIGKDYPKRVVVHD  454

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             +ASKECR+ + EAY L+     +   E  N L+R++++Q  S
Sbjct  455   TASKECRKAMAEAYALDHLGDNLASKEISNGLRRKLDDQKAS  496



>ref|XP_004976943.1| PREDICTED: (6-4)DNA photolyase-like isoform X1 [Setaria italica]
Length=607

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/582 (62%), Positives = 428/582 (74%), Gaps = 68/582 (12%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             ++WFRKGLR+HDNPAL  A   + + +P+FV+DP Y+ PDP A SPGS RAG+ R+RFLL
Sbjct  12    MVWFRKGLRVHDNPALDAARRGAGRLYPVFVLDPRYLRPDPAAASPGSARAGVARVRFLL  71

Query  460   ETLVDLDSSLNNLGSRLLVLR--GDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVK  633
             E+L DLD+ L  LGSRLL+LR   D +  +   LK+W+I KLCFE DTEPY    D KV 
Sbjct  72    ESLGDLDARLRRLGSRLLLLRARDDVADAVCAALKDWNIGKLCFESDTEPYALVRDKKVT  131

Query  634   NYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslssl  813
             ++A  +GIE FTPVSHTLFDPA+II+KNGG PPLTYQSF+ +AG P     PL    S L
Sbjct  132   DFAMASGIEVFTPVSHTLFDPAEIINKNGGRPPLTYQSFIAIAGEPP---EPLMEEYSEL  188

Query  814   ppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKP  993
             PP+G+ G  ++  VPT+EELGY D S++E   FRGGE+EALRR++ESI NKEWVA FEKP
Sbjct  189   PPVGDTGEYELLPVPTVEELGYGDISQEEIPPFRGGETEALRRMKESIENKEWVAKFEKP  248

Query  994   KGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFF  1173
             KG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+++V RSV+ +T PPVSL GQLLWRDFF
Sbjct  249   KGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIRDVYRSVRNYTKPPVSLTGQLLWRDFF  308

Query  1174  YTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHL  1353
             YTV+FG P+FD+M+GN+ICKQIPW E++EL  AWRDSRTG+PWIDAIM+QLRKWGWMHHL
Sbjct  309   YTVSFGIPNFDQMKGNKICKQIPWSENEELFVAWRDSRTGYPWIDAIMIQLRKWGWMHHL  368

Query  1354  ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ--------  1509
             ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQ        
Sbjct  369   ARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQVRQRISFR  428

Query  1510  -----------------------YHRIYSPITFGKKYDPDGNYIRHFLPVLK--------  1596
                                    YHRIYSPITFGKKYDP+GNYIRHF+P LK        
Sbjct  429   WHWLWTFLFSLIVCLLYFNLIKQYHRIYSPITFGKKYDPNGNYIRHFIPALKGTSEVRTR  488

Query  1597  ------------------------DMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
                                     DMP+EYIYEPWTAPLSIQ+KAKCIIG DYPKPVV H
Sbjct  489   KKAFFLDKENETFFFCTMLYSINLDMPREYIYEPWTAPLSIQKKAKCIIGKDYPKPVVDH  548

Query  1705  DSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDK  1830
             ++ASKECR+R+GEAY  ++      R +  N  +R+    D+
Sbjct  549   ETASKECRKRMGEAYASSRLDSNPSRGKPSNMSRRKKSHGDQ  590



>ref|XP_010654743.1| PREDICTED: (6-4)DNA photolyase isoform X2 [Vitis vinifera]
Length=463

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/422 (79%), Positives = 382/422 (91%), Gaps = 0/422 (0%)
 Frame = +1

Query  247   PATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGST  426
             P  +MAS S SLMWFRKGLRIHDNPALQHAA  S   +P+FVIDP++MEPDP AFSPGS+
Sbjct  23    PNPSMASGSSSLMWFRKGLRIHDNPALQHAAKESNCVYPVFVIDPYFMEPDPNAFSPGSS  82

Query  427   RAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPY  606
             RAGLNRIRFLLE+LVDLDSSL  LGSRLLVL+GDP +V+IRCLKEW + +LCFEYDT+PY
Sbjct  83    RAGLNRIRFLLESLVDLDSSLRQLGSRLLVLKGDPGEVIIRCLKEWEVKRLCFEYDTDPY  142

Query  607   YQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAss  786
             YQALD KVKNYAS AGIE F+PVSHTLFD A+II KNGG PPL+YQSFLKLAG PSWASS
Sbjct  143   YQALDIKVKNYASAAGIEVFSPVSHTLFDSAEIIQKNGGRPPLSYQSFLKLAGQPSWASS  202

Query  787   plstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANK  966
             PL T+LS LPP+G++G+ ++S VPT++ELGY +  +DE T F+GGESEAL+RLRESI +K
Sbjct  203   PLLTTLSWLPPVGDVGTCEISNVPTVKELGYEEIGQDESTPFKGGESEALKRLRESIRDK  262

Query  967   EWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLL  1146
             EWVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+ +V +++K HTSPPVSL+
Sbjct  263   EWVANFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLTDVYKNMKWHTSPPVSLV  322

Query  1147  GQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQL  1326
             GQLLWRDFFYTV FGTP+FDRM+GNRICKQIPW + DELLAAWR++RTG+PWIDAIMVQL
Sbjct  323   GQLLWRDFFYTVGFGTPNFDRMKGNRICKQIPWNDDDELLAAWREARTGYPWIDAIMVQL  382

Query  1327  RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  1506
             RKWGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFY
Sbjct  383   RKWGWMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFY  442

Query  1507  QY  1512
             Q+
Sbjct  443   QW  444



>ref|XP_010914925.1| PREDICTED: (6-4)DNA photolyase isoform X3 [Elaeis guineensis]
Length=505

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/522 (66%), Positives = 417/522 (80%), Gaps = 31/522 (6%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +L+WFRKGLRIHDNPAL HA   S   FP+FV+DP Y++PDP+AFSPGS R+ +NRI
Sbjct  2     ESNALIWFRKGLRIHDNPALDHARRGSKHLFPVFVLDPRYLDPDPSAFSPGSARSAINRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+ L DLD++L  LGSRLL+LRGDP  VL   LK+W+I KLC+E+DTEPY  A D +
Sbjct  62    RFLLDCLSDLDATLRTLGSRLLLLRGDPVPVLCTILKDWNIGKLCYEFDTEPYSLARDKQ  121

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             VK++AS++GIE F+PVSHTLF+PA +I KNGG PPLTYQSF+KLAG P    +PL+ + S
Sbjct  122   VKDFASISGIEVFSPVSHTLFNPAVVIEKNGGRPPLTYQSFVKLAGKPP---TPLTETYS  178

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              LPP+GN+   ++ +VP +EELGY D S++E + FRGGE+EAL+RL++++ +KEWVA FE
Sbjct  179   ELPPVGNVEGYELLSVPAIEELGYGDLSQEEFSPFRGGETEALKRLKKALEDKEWVATFE  238

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+  V ++V +HTSPPVSL+G      
Sbjct  239   KPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLHNVYKTVGKHTSPPVSLVG------  292

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
                                   QIPW++ +EL  AWR+ RTG+PWIDAIM+QL KWGWMH
Sbjct  293   ----------------------QIPWRDDEELFVAWREGRTGYPWIDAIMIQLTKWGWMH  330

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  331   HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  390

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             PI+FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLS+Q+KA CIIG DYPK VV HD
Sbjct  391   PISFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSVQKKANCIIGKDYPKRVVVHD  450

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             +ASKECR+ + EAY L+     +   E  N L+R++++Q  S
Sbjct  451   TASKECRKAMAEAYALDHLGDNLASKEISNGLRRKLDDQKAS  492



>gb|EPS64244.1| hypothetical protein M569_10537, partial [Genlisea aurea]
Length=436

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/436 (73%), Positives = 379/436 (87%), Gaps = 3/436 (1%)
 Frame = +1

Query  562   WSISKLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY  741
             W++ KLCFE+D+EPYYQA+D KVK + +   +ETF+PVSHT++DPADII KNGG PPLTY
Sbjct  1     WNVRKLCFEFDSEPYYQAIDDKVKKFCASTSVETFSPVSHTIYDPADIIRKNGGKPPLTY  60

Query  742   QSFLKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGG  921
             QSF+KLAG PSWASS +ST ++ LP +GN+G   V  VP++EELGY +  EDE T F+GG
Sbjct  61    QSFVKLAGEPSWASSSVSTGVTWLPTVGNIGRCSVIDVPSIEELGYEELPEDETTPFKGG  120

Query  922   ESEALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEV  1101
             E+EAL+RLR S++++EWV+ FEKPKG+PSAFL PATTVLSPYLKFGCLSSRYFY+C+Q +
Sbjct  121   ETEALKRLRTSLSDQEWVSKFEKPKGDPSAFLSPATTVLSPYLKFGCLSSRYFYKCIQGI  180

Query  1102  LRSVKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRD  1281
              R+VKRHTSPPVSLLGQLLWRDFFYTVAFGTP+FDRM+ NRICKQIPW+  DELLAAWR+
Sbjct  181   QRNVKRHTSPPVSLLGQLLWRDFFYTVAFGTPNFDRMKENRICKQIPWRNDDELLAAWRE  240

Query  1282  SRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAI  1461
             +RTG+PWIDAIMVQLRKWGWMHHLARH VACFLTRGDLF+HWEKGRDVFERLLIDSDW+I
Sbjct  241   ARTGYPWIDAIMVQLRKWGWMHHLARHCVACFLTRGDLFVHWEKGRDVFERLLIDSDWSI  300

Query  1462  NNGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPL  1641
             NN NW+WLSCSSFFYQY+RIYSPI+FGKKYDP+GNYIRHFLPVLK +PKEYIYEPW AP+
Sbjct  301   NNANWLWLSCSSFFYQYNRIYSPISFGKKYDPNGNYIRHFLPVLKGIPKEYIYEPWRAPM  360

Query  1642  SIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEE  1821
             S+Q KAKCIIG DYPKPV+ HD ASKEC+Q L +AYELN++  G+V  EEL  L+RR+E+
Sbjct  361   SVQVKAKCIIGKDYPKPVIEHDVASKECKQMLHQAYELNRRSNGIVSVEELESLRRRMED  420

Query  1822  Q---DKSMEYKTKRQK  1860
             +   D+    K KR K
Sbjct  421   EEDADQQQCLKGKRLK  436



>ref|XP_001754074.1| UVR3 AtUVR3-like 6-4 DNA photolyase protein [Physcomitrella patens]
 gb|EDQ80975.1| UVR3 AtUVR3-like 6-4 DNA photolyase protein [Physcomitrella patens]
Length=526

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/526 (61%), Positives = 398/526 (76%), Gaps = 16/526 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             SLMWFRKGLR+HDNPAL  +   ++  +P+FV+DP ++ PDPTA SPGS   G+NRIRFL
Sbjct  5     SLMWFRKGLRLHDNPALLRSCEGASHVYPVFVLDPWFLAPDPTAPSPGSKLVGVNRIRFL  64

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L++L DLD +L   GSRLLVL G+P+ V+   L +W I++LCFE+DTEPY Q  DA +K 
Sbjct  65    LQSLEDLDENLRKHGSRLLVLHGNPTTVIPELLMKWQINELCFEFDTEPYAQDRDADIKK  124

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+  G+E F+PVSHTLF+P D I KNGG  PLTYQ+FLKL G P    +      S   
Sbjct  125   LATKYGVEVFSPVSHTLFNPIDTIRKNGGQTPLTYQAFLKLTGKPPLPVTAPLQIPSPPE  184

Query  817   pIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKPK  996
                +L  + V  VP LE+LGYV+  E E +   GGE+EALRRL +S+ N++WV  FEKPK
Sbjct  185   ---DLNDVHVVPVPKLEDLGYVNLDE-EFSPHPGGETEALRRLDKSLVNQKWVCDFEKPK  240

Query  997   GNPSAFLRPATTVLSPYLK------------FGCLSSRYFYQCVQEVLRSVKRHTSPPVS  1140
             GNP+AF+ PATTVLSPYLK            FGCLS R F+Q +  V    K+H+SPPVS
Sbjct  241   GNPTAFIEPATTVLSPYLKASNLGFLLKPMLFGCLSCRLFHQRLLAVYSQNKKHSSPPVS  300

Query  1141  LLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMV  1320
             L GQLLWR+FFYT  +GTP+FDRM GN ICKQIPWK+ D LLAAWRD +TG+PWIDA MV
Sbjct  301   LEGQLLWREFFYTAGYGTPNFDRMLGNPICKQIPWKDDDRLLAAWRDGQTGYPWIDAAMV  360

Query  1321  QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSF  1500
             QLRKWGWMHHLARH+VACFLTRGD+F++WEKGRDVF+RLLIDSDWAINNGNW+WLS S+F
Sbjct  361   QLRKWGWMHHLARHAVACFLTRGDMFVYWEKGRDVFDRLLIDSDWAINNGNWLWLSASAF  420

Query  1501  FYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGID  1680
             F+QYHRIYSP+TFGKKYDPDG Y++HFLPVLKDMPK YIYEPWTAPL++Q+KA CIIG+D
Sbjct  421   FHQYHRIYSPVTFGKKYDPDGLYVKHFLPVLKDMPKYYIYEPWTAPLAVQKKANCIIGVD  480

Query  1681  YPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVE  1818
             YP+P+V H  A+KECR+++G AY  N+          + + +R V+
Sbjct  481   YPRPIVDHSIANKECREKMGIAYSQNRSQAAPSVSSTMRKRRRGVD  526



>ref|XP_006385492.1| hypothetical protein POPTR_0003s05870g [Populus trichocarpa]
 gb|ERP63289.1| hypothetical protein POPTR_0003s05870g [Populus trichocarpa]
Length=418

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/414 (78%), Positives = 375/414 (91%), Gaps = 2/414 (0%)
 Frame = +1

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             ++ YAS AGIE F+PVSHTLF+PADII +NGG PPLTYQSFLKLAG PSWASSPL TS+S
Sbjct  3     LQEYASAAGIEVFSPVSHTLFNPADIIQRNGGKPPLTYQSFLKLAGQPSWASSPLLTSIS  62

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
             SLPP+G++GS ++S VPT+++LGY D  E E   FRGGESEAL+RL+ESI++KEWVA FE
Sbjct  63    SLPPVGDVGSCEISEVPTIKDLGYGDI-EQEWIPFRGGESEALKRLKESISDKEWVANFE  121

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKGNPSAF++PATTVLSPYLKFGCLSSRYFYQC+Q+V ++V++HTSPPVSL GQLLWRD
Sbjct  122   KPKGNPSAFVKPATTVLSPYLKFGCLSSRYFYQCLQDVYKNVQKHTSPPVSLAGQLLWRD  181

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYTVAFGTP+FDRM GN++CKQIPW + DELLAAWR++RTG+PWIDAIMVQLRKWGWMH
Sbjct  182   FFYTVAFGTPNFDRMEGNKLCKQIPWNDDDELLAAWREARTGYPWIDAIMVQLRKWGWMH  241

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLF+HWE+GRDVFERLLIDSDWAINNGNW+WLSCSSFFYQY+RIYS
Sbjct  242   HLARHSVACFLTRGDLFLHWERGRDVFERLLIDSDWAINNGNWLWLSCSSFFYQYNRIYS  301

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             PI+FGKKYDP+G+YIRHFLPVLKDMPKEYIYEPWTAP  IQRKAKCIIG DYPKPVV HD
Sbjct  302   PISFGKKYDPNGDYIRHFLPVLKDMPKEYIYEPWTAPPGIQRKAKCIIGRDYPKPVVYHD  361

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTL  1869
             SASKEC+++L EAY LNKKL G +  E+L+ L+R++ EQD+  E K +RQ+Q +
Sbjct  362   SASKECKRKLAEAYALNKKLNGQLSQEDLDNLRRKL-EQDEDQEPKIRRQRQKV  414



>ref|NP_001030703.1| (6-4)DNA photolyase [Arabidopsis thaliana]
 gb|AEE75704.1| (6-4)DNA photolyase [Arabidopsis thaliana]
Length=445

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/433 (74%), Positives = 374/433 (86%), Gaps = 3/433 (1%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPG  420
             ++P T+MA+ S SL+WFRKGLR+HDNPAL++A+  S   +P+FVIDPHYME DP+AFSPG
Sbjct  14    LNPITSMATGSGSLIWFRKGLRVHDNPALEYASKGSEFMYPVFVIDPHYMESDPSAFSPG  73

Query  421   STRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTE  600
             S+RAG+NRIRFLLE+L DLDSSL  LGSRLLV +G+P +VL+RCL+EW + +LCFEYDT+
Sbjct  74    SSRAGVNRIRFLLESLKDLDSSLKKLGSRLLVFKGEPGEVLVRCLQEWKVKRLCFEYDTD  133

Query  601   PYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWA  780
             PYYQALD KVK+YAS  G+E F+PVSHTLF+PA II KNGG PPL+YQSFLK+AG PS A
Sbjct  134   PYYQALDVKVKDYASSTGVEVFSPVSHTLFNPAHIIEKNGGKPPLSYQSFLKVAGEPSCA  193

Query  781   ssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIA  960
              S L  S SSLPPIG++G+L +S VP+LEELGY D  + + T FRGGESEAL+RL +SI+
Sbjct  194   KSELVMSYSSLPPIGDIGNLGISEVPSLEELGYKDDEQADWTPFRGGESEALKRLTKSIS  253

Query  961   NKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVS  1140
             +K WVA FEKPKG+PSAFL+PATTV+SPYLKFGCLSSRYFYQC+Q + + VK+HTSPPVS
Sbjct  254   DKAWVANFEKPKGDPSAFLKPATTVMSPYLKFGCLSSRYFYQCLQNIYKDVKKHTSPPVS  313

Query  1141  LLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMV  1320
             LLGQLLWR+FFYT AFGTP+FD+M+GNRICKQIPW E   +LAAWRD +TG+PWIDAIMV
Sbjct  314   LLGQLLWREFFYTTAFGTPNFDKMKGNRICKQIPWNEDHAMLAAWRDGKTGYPWIDAIMV  373

Query  1321  QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSF  1500
             QL KWGWMHHLARH VACFLTRGDLFIHWE+GRDVFERLLIDSDWAINNGNWMWLSCSSF
Sbjct  374   QLLKWGWMHHLARHCVACFLTRGDLFIHWEQGRDVFERLLIDSDWAINNGNWMWLSCSSF  433

Query  1501  FYQYHRIYSPITF  1539
             FYQ     SP  F
Sbjct  434   FYQ---ALSPFCF  443



>gb|KDO52905.1| hypothetical protein CISIN_1g014577mg [Citrus sinensis]
Length=422

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/417 (77%), Positives = 373/417 (89%), Gaps = 1/417 (0%)
 Frame = +1

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsl  804
             KVK+YAS AGIE F+PVSHTLF+PADII KNGG PPLTYQSFLKLAG P WASSPL  SL
Sbjct  2     KVKDYASTAGIEVFSPVSHTLFNPADIIQKNGGKPPLTYQSFLKLAGQPLWASSPLPVSL  61

Query  805   sslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
             SSLPP+G++G  ++S VPT+EELGY    ++E + FRGGESEAL++LRESI++KEWVA F
Sbjct  62    SSLPPVGDVGYFEISEVPTVEELGYKGYGQEELSPFRGGESEALKKLRESISDKEWVANF  121

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             EKPKG+PSA+L+PATTVLSPYLKFGCLSSRYFYQC+ +V ++VK+HTSPPVSL+GQLLWR
Sbjct  122   EKPKGDPSAYLKPATTVLSPYLKFGCLSSRYFYQCLTDVYQNVKKHTSPPVSLVGQLLWR  181

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             DFFYTVAFGTP+FDRM+GNRICKQIPW   DELLAAWR++RTG+PWIDAIMVQLRKWGWM
Sbjct  182   DFFYTVAFGTPNFDRMKGNRICKQIPWSNDDELLAAWREARTGYPWIDAIMVQLRKWGWM  241

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH VACFLTRGD+F+HWEKGRDVF+RLLIDSDWAINNGNW+WLSCSSFFYQY+RIY
Sbjct  242   HHLARHCVACFLTRGDMFVHWEKGRDVFDRLLIDSDWAINNGNWLWLSCSSFFYQYNRIY  301

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
             SP++FGKKYDP+GNYIRHFLPVLKDMPKEYIYEPWTAPL+IQ +AKCIIG DYP PVVSH
Sbjct  302   SPVSFGKKYDPNGNYIRHFLPVLKDMPKEYIYEPWTAPLTIQTRAKCIIGRDYPAPVVSH  361

Query  1705  DSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLIG  1875
             DSASKEC+++LGEAY LN+KL G V ++ L  L+R+ E ++     + ++QK TL G
Sbjct  362   DSASKECKRKLGEAYALNQKLNGQVSEDGLKNLRRKFEGEENQESGRRQKQK-TLTG  417



>ref|XP_006647054.1| PREDICTED: LOW QUALITY PROTEIN: (6-4)DNA photolyase-like, partial 
[Oryza brachyantha]
Length=490

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/492 (67%), Positives = 398/492 (81%), Gaps = 15/492 (3%)
 Frame = +1

Query  427   RAGLNRIRFLLETLVDLDSSLNNLGSRLLVLR------GDPSQVLIRCLKEWSISKLCFE  588
             RAG  R+RFLLE+L DLD+ L  LGSRLL+LR      GD +  +   LK+W+I KLCFE
Sbjct  1     RAGAARVRFLLESLSDLDARLCRLGSRLLLLRAPSDGDGDVAATVCAALKDWNIGKLCFE  60

Query  589   YDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY------QSF  750
              DTEPY  A D KV ++A+ +GI+ F+PVSHTLFDPA+II KNGG PP+TY      Q+F
Sbjct  61    SDTEPYALARDKKVMDFAAASGIDVFSPVSHTLFDPAEIIEKNGGRPPVTYRRSWPGQAF  120

Query  751   LKLAGIPSWAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESE  930
             + +AG P     P+    S LPP+G+ G  ++  VP +EELGY D S++E + FRGGE+E
Sbjct  121   VAVAGQPP---EPVMEEYSELPPVGDTGEYELLPVPKVEELGYGDISQEELSPFRGGETE  177

Query  931   ALRRLRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRS  1110
             AL+R+RES+ +KEWVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFY C+Q++ RS
Sbjct  178   ALKRMRESLHDKEWVAKFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYHCIQDIYRS  237

Query  1111  VKRHTSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRT  1290
              K+HT+PPVSL+GQLLWRDFFYTV+FGTP+FDRM+GNRICKQIPW E++EL  AWRD RT
Sbjct  238   TKKHTNPPVSLIGQLLWRDFFYTVSFGTPNFDRMKGNRICKQIPWTENEELFLAWRDGRT  297

Query  1291  GFPWIDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNG  1470
             G+PWIDAIM+QLR+WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNG
Sbjct  298   GYPWIDAIMIQLRRWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNG  357

Query  1471  NWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQ  1650
             NW+WLSCSSFFYQYHRIYSPI+FGKKYDP+GNYIRHF+PVLKDMPKEYIYEPWTAPLSIQ
Sbjct  358   NWLWLSCSSFFYQYHRIYSPISFGKKYDPNGNYIRHFIPVLKDMPKEYIYEPWTAPLSIQ  417

Query  1651  RKAKCIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDK  1830
             +KAKCIIG DYPKPVV H+ ASKEC++++GEAY          + +  N  +R++    +
Sbjct  418   KKAKCIIGKDYPKPVVDHEIASKECKKKMGEAYASKHLDDKPNKGKPSNSSRRKLSAGSQ  477

Query  1831  SMEYKTKRQKQT  1866
                 KTK+ K +
Sbjct  478   VTSSKTKQLKGS  489



>ref|XP_002979633.1| hypothetical protein SELMODRAFT_233387 [Selaginella moellendorffii]
 gb|EFJ19522.1| hypothetical protein SELMODRAFT_233387 [Selaginella moellendorffii]
Length=527

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/532 (61%), Positives = 406/532 (76%), Gaps = 11/532 (2%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             +L+WFRKGLR+HDNP+L+ A + S   +P+FV+DP ++ PDP A SPGS R G+NRI+FL
Sbjct  2     ALLWFRKGLRLHDNPSLEAACHGSRNVYPVFVLDPWFLAPDPRASSPGSARVGINRIQFL  61

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DLD +L++ GS+LL++ G+P QV+   L +W I KLCFE+DTEPY    DAK+K 
Sbjct  62    LESLQDLDRNLSSRGSKLLLVHGNPIQVIPELLDKWRIRKLCFEFDTEPYALDRDAKIKE  121

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
             +A   GIE   PVSHT+F+P  +I KNGG  PLT+QSF K   +P  A+ P+    S++P
Sbjct  122   HAKDKGIELHCPVSHTIFNPDLLIAKNGGKAPLTFQSFCKNL-VP--ATKPIGNGPSAIP  178

Query  817   pIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKPK  996
             P G+L  ++V  VPTLEELGY D  ED  + FRGGE+ AL RL +S+AN++WV  FEKPK
Sbjct  179   PTGDLHGIKVVPVPTLEELGYADFHED-FSPFRGGETVALTRLEDSLANEKWVCEFEKPK  237

Query  997   GNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFY  1176
             G+P+AF++PATTVLSPYLKFGCLSSR  Y  V+EV    K  TSPPVSL  QLLWR+FFY
Sbjct  238   GDPTAFIKPATTVLSPYLKFGCLSSRLVYSRVKEVYSRAKSFTSPPVSLEAQLLWREFFY  297

Query  1177  TVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLA  1356
             T A+ T +FD+M GN ICKQIPWK+ DELL+AWRD RTG+PWIDA M QLRKWGWMHHLA
Sbjct  298   TAAYATANFDKMVGNPICKQIPWKDDDELLSAWRDGRTGYPWIDAAMTQLRKWGWMHHLA  357

Query  1357  RHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPIT  1536
             RH+VACFLTRGD+F++WEKGRDVF+RLLID+DW+INNGNW+WLS S+FF QYHRIYSPIT
Sbjct  358   RHAVACFLTRGDMFVYWEKGRDVFDRLLIDADWSINNGNWLWLSASAFFNQYHRIYSPIT  417

Query  1537  FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSAS  1716
             F KKYD  GNYI+HFLP       E+IYEPW AP  IQRKAKCIIG DYP PV+ H +AS
Sbjct  418   FAKKYDRQGNYIKHFLP-------EFIYEPWKAPAEIQRKAKCIIGKDYPTPVLDHAAAS  470

Query  1717  KECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
             K CR+R+G AY L+K   G V  E+++EL+  + +   S   K KRQKQ+ I
Sbjct  471   KICRERMGAAYALSKSSHGNVSREQVDELQDTLTDVPTSSTSKNKRQKQSRI  522



>ref|XP_010914926.1| PREDICTED: (6-4)DNA photolyase isoform X4 [Elaeis guineensis]
Length=490

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/522 (63%), Positives = 400/522 (77%), Gaps = 46/522 (9%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ES +L+WFRKGLRIHDNPAL HA   S   FP+FV+DP Y++PDP+AFSPGS R+ +NRI
Sbjct  2     ESNALIWFRKGLRIHDNPALDHARRGSKHLFPVFVLDPRYLDPDPSAFSPGSARSAINRI  61

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+ L DLD++L  LGSRLL+LRGDP  VL   LK+W+I KLC+E+DTEPY  A D +
Sbjct  62    RFLLDCLSDLDATLRTLGSRLLLLRGDPVPVLCTILKDWNIGKLCYEFDTEPYSLARDKQ  121

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstsls  807
             VK++AS++GIE F+PVSHTLF+PA +I KNGG PPLTYQSF+KLAG P    +PL+ + S
Sbjct  122   VKDFASISGIEVFSPVSHTLFNPAVVIEKNGGRPPLTYQSFVKLAGKPP---TPLTETYS  178

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              LPP+GN+   ++ +VP +EELGY D S++E + FRGGE+EAL+RL++++ +KEWVA FE
Sbjct  179   ELPPVGNVEGYELLSVPAIEELGYGDLSQEEFSPFRGGETEALKRLKKALEDKEWVATFE  238

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQC+  V ++V +HTSPPVSL+GQLLWR+
Sbjct  239   KPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQCLHNVYKTVGKHTSPPVSLVGQLLWRE  298

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYTVAFGTP FD+M GN+ICKQIPW++ +EL  AWR+ RTG+PWIDAIM+QL KWGWMH
Sbjct  299   FFYTVAFGTPHFDQMIGNKICKQIPWRDDEELFVAWREGRTGYPWIDAIMIQLTKWGWMH  358

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINN                    
Sbjct  359   HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINN--------------------  398

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
                                    DMPKEYIYEPWTAPLS+Q+KA CIIG DYPK VV HD
Sbjct  399   -----------------------DMPKEYIYEPWTAPLSVQKKANCIIGKDYPKRVVVHD  435

Query  1708  SASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKS  1833
             +ASKECR+ + EAY L+     +   E  N L+R++++Q  S
Sbjct  436   TASKECRKAMAEAYALDHLGDNLASKEISNGLRRKLDDQKAS  477



>ref|XP_010545790.1| PREDICTED: (6-4)DNA photolyase isoform X3 [Tarenaya hassleriana]
Length=505

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/543 (61%), Positives = 396/543 (73%), Gaps = 64/543 (12%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M++    L+WFRKGLRIHDNPAL+ A+  S   +P+FV+DPHYMEPD     P +   G 
Sbjct  20    MSNGLSYLVWFRKGLRIHDNPALEFASKGSEFMYPVFVVDPHYMEPD-----PSAFSPGS  74

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
              R            + LN +            + L+  L++                  L
Sbjct  75    TR------------AGLNRI------------RFLLESLED------------------L  92

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADII----HKNGGTPPLTYQSFLKLAGIPSWAss  786
             D  +K   S   +           DP +++     +NGG PPL+YQSFLK+AG PS   S
Sbjct  93    DCSLKRLGSRLLV--------LKGDPGEVLVRCLKENGGRPPLSYQSFLKIAGEPSCERS  144

Query  787   plstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANK  966
              L  S SSLPP+G+ G+L +SAVP +EELGY D  +DERT F GGE+EAL+RL ES+ ++
Sbjct  145   ELVMSYSSLPPVGDTGNLDISAVPNIEELGYRDDEQDERTPFIGGETEALKRLDESMRDE  204

Query  967   EWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLL  1146
              WVA FEKPKG+PSAFL+PATTVLSPYLKFGCLSSRYFYQ +Q + +SVK+HTSPPVSLL
Sbjct  205   AWVADFEKPKGDPSAFLKPATTVLSPYLKFGCLSSRYFYQRIQSIYKSVKKHTSPPVSLL  264

Query  1147  GQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQL  1326
             GQLLWR+FFYT AFGTP+FD+M+GNRIC+QIPW +  E+L AWRD +TG+PWIDAIMVQL
Sbjct  265   GQLLWREFFYTAAFGTPNFDKMKGNRICRQIPWNDDHEMLVAWRDGKTGYPWIDAIMVQL  324

Query  1327  RKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  1506
             RKWGWMHHLARH VACFLTRGDLFIHWE GRDVFERLLIDSDWAINNGNWMWLSCSSFFY
Sbjct  325   RKWGWMHHLARHCVACFLTRGDLFIHWENGRDVFERLLIDSDWAINNGNWMWLSCSSFFY  384

Query  1507  QYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYP  1686
             QY+RIYSPITFGKKYDPDG YIRHFLPVLKDMPK+YIYEPWTAPLS+Q KA CIIG DYP
Sbjct  385   QYNRIYSPITFGKKYDPDGKYIRHFLPVLKDMPKQYIYEPWTAPLSVQTKANCIIGKDYP  444

Query  1687  KPVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVE--EQDKSMEYKTKRQK  1860
             KPVV HDSA KECR+++ EAY LN+K  G V DE+L  L+R++E  E D+SM   T++Q+
Sbjct  445   KPVVCHDSAGKECRRKMSEAYALNQKKNGQVGDEDLRNLRRKLEKDEHDESM---TRKQR  501

Query  1861  QTL  1869
               L
Sbjct  502   SKL  504



>gb|ABR16130.1| unknown [Picea sitchensis]
Length=431

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/400 (67%), Positives = 320/400 (80%), Gaps = 4/400 (1%)
 Frame = +1

Query  610   QALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssp  789
             Q  D  VK +A   G++ FTP+SHT+F P +II KNGG PPLTYQSF+KL G+P      
Sbjct  9     QKRDGFVKEFALKLGVDVFTPISHTIFSPEEIIKKNGGKPPLTYQSFIKLIGLPP-LPLG  67

Query  790   lstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKE  969
               +       I N   L    +PTL +LG+ D S++E   F GGE+EAL+R+  SI +++
Sbjct  68    NGSPSIPPVGIDNSNDL---PIPTLTDLGFGDVSQEECNPFIGGETEALKRMDASIQDQK  124

Query  970   WVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             WVA FEKPKG+P+AFL+PATTVLSPYLKFGCLSSR FYQ +QEV R VK+HT PPVSL G
Sbjct  125   WVAAFEKPKGDPTAFLKPATTVLSPYLKFGCLSSRLFYQRLQEVYRKVKKHTEPPVSLEG  184

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWR+FFYTVA+GTP FD+M GN ICKQIPW + D LL+AWRD +TG+PWIDA+MVQLR
Sbjct  185   QLLWREFFYTVAYGTPKFDQMEGNPICKQIPWNDDDSLLSAWRDGQTGYPWIDAVMVQLR  244

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             KWGWMHHLARH+VACFLTRGDLF+HWEKGRDVF+RLLIDSDWAINN NWMWLSCS+FF Q
Sbjct  245   KWGWMHHLARHAVACFLTRGDLFVHWEKGRDVFDRLLIDSDWAINNSNWMWLSCSAFFSQ  304

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             YHRIYSPI+FGKKYDPDG Y+R+FLPVLKDMPKEYIYEPWTAP+ +QRKAKCIIG DYP+
Sbjct  305   YHRIYSPISFGKKYDPDGKYVRYFLPVLKDMPKEYIYEPWTAPIDVQRKAKCIIGKDYPE  364

Query  1690  PVVSHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKR  1809
             P+VSH  ASK C++++  AY LNK++ G     +L  +K+
Sbjct  365   PLVSHLGASKNCKEKIAAAYALNKQIKGERNQVQLQGVKK  404



>gb|KHG04636.1| (6-4)DNA photolyase -like protein [Gossypium arboreum]
Length=393

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/427 (66%), Positives = 330/427 (77%), Gaps = 56/427 (13%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M S S SLMWFRKGLR+HDNPAL++A+  S+  +PLFVIDPHYME DP A+SPGSTRAG+
Sbjct  12    MPSGSGSLMWFRKGLRVHDNPALEYASRGSSCVYPLFVIDPHYMELDPDAYSPGSTRAGI  71

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NRIRFLLE+L DLDSSL  LGSRLLVL+G+PS        EW + KLCFEYDT+PYYQAL
Sbjct  72    NRIRFLLESLADLDSSLKKLGSRLLVLKGEPS--------EWDVRKLCFEYDTDPYYQAL  123

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             D KVKNYAS AGIE F+PVSHT+FDPADII K  G P  ++   ++L+  P         
Sbjct  124   DDKVKNYASAAGIEVFSPVSHTIFDPADIIEKLAGEP--SFSLSVELSWTPP--------  173

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                    +G++G  ++  VPTL+ELGYV+  +DE T FRGGESEALRRLRES+++KEWVA
Sbjct  174   -------VGDVGRCEILQVPTLKELGYVEKHQDEFTPFRGGESEALRRLRESLSDKEWVA  226

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPKG+PS +++PATTVLSPYLK                     RHTSPPVSL+GQLL
Sbjct  227   NFEKPKGDPSVYIKPATTVLSPYLK---------------------RHTSPPVSLVGQLL  265

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQ----------IPWKESDELLAAWRDSRTGFPWID  1308
             WR+FFYTVAFGTP+FD+M+GN+ICKQ          IPW + D+LLAAWR +RTG+PWID
Sbjct  266   WREFFYTVAFGTPNFDKMKGNKICKQVGASNVPNGTIPWNDDDKLLAAWRAARTGYPWID  325

Query  1309  AIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLS  1488
             AIMVQLRKWGWMHHLARHSVACFLTRGDLF+HWEKGRD+FERLLIDSDWAINNGNW+W S
Sbjct  326   AIMVQLRKWGWMHHLARHSVACFLTRGDLFVHWEKGRDIFERLLIDSDWAINNGNWLWQS  385

Query  1489  CSSFFYQ  1509
             CSSFFYQ
Sbjct  386   CSSFFYQ  392



>ref|XP_005646798.1| UVR3 AtUVR3-like 6-4 DNA photolyase protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22254.1| UVR3 AtUVR3-like 6-4 DNA photolyase protein [Coccomyxa subellipsoidea 
C-169]
Length=482

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 345/484 (71%), Gaps = 15/484 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S++WFRKGLR+HDNP+L  A   +T  +P+FV+DP +++PD           G+NR+ FL
Sbjct  10    SILWFRKGLRLHDNPSLLAAIKGATHLYPVFVLDPWFLKPD---------VVGVNRLNFL  60

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DL SSL   GS LLVLRG+P  VL R  K+W+I++LCFE DTE Y +  D K+  
Sbjct  61    LESLTDLRSSLQARGSNLLVLRGNPQDVLPRVWKDWNITRLCFEADTEDYAEERDTKITA  120

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLA---GIPSWAssplstsls  807
              A  AGIE  + VSHTL+D +D++ KNGG  PLTY+ F K     G P          L 
Sbjct  121   AAQEAGIEVISCVSHTLYDTSDVVAKNGGKAPLTYKGFEKAITALGPPPAPVEDPPAKLP  180

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
              L         + ++VP+L ELGY D   +  T  +GGE+EAL RL E +++K WVA FE
Sbjct  181   PLAADSKGTDSETTSVPSLRELGYPD---EASTDIKGGETEALARLAEQLSDKGWVAAFE  237

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KPKG+P+AF++PATTVLSP+LKFGCLS R FY+ +Q V +  K H+ PPVSLLGQLLWR+
Sbjct  238   KPKGDPTAFIKPATTVLSPHLKFGCLSPRLFYEALQRVYKEKKEHSKPPVSLLGQLLWRE  297

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             F+Y  A  TP++ RM GN ICKQIPW  + E   AW +SRTG+PWIDAIM QLR+ GWMH
Sbjct  298   FYYVAAAHTPNYHRMEGNPICKQIPWDNNAEFYRAWEESRTGYPWIDAIMAQLRRTGWMH  357

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH VACFLTRGDL++ WEKGRD F+RLLID D ++N+GNWMWLS SSFFYQY R+YS
Sbjct  358   HLARHCVACFLTRGDLYVSWEKGRDTFDRLLIDGDPSLNSGNWMWLSASSFFYQYFRVYS  417

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             PIT+GKKYDP+G Y++HFLP+LKD P +YI+EPW AP  +Q +A CIIG DYP P+V H 
Sbjct  418   PITYGKKYDPEGKYVKHFLPILKDYPPKYIWEPWKAPKEVQEQAGCIIGKDYPAPIVDHA  477

Query  1708  SASK  1719
               SK
Sbjct  478   EVSK  481



>ref|XP_002977641.1| hypothetical protein SELMODRAFT_417535 [Selaginella moellendorffii]
 gb|EFJ20979.1| hypothetical protein SELMODRAFT_417535 [Selaginella moellendorffii]
Length=433

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/440 (63%), Positives = 343/440 (78%), Gaps = 12/440 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             +L+WFRKGLR+HDNP+L+ A + S   +P+FV+DP ++ PDP+A SPGS R G+NRI+FL
Sbjct  2     ALLWFRKGLRLHDNPSLEAACHGSRNVYPVFVLDPWFLAPDPSAPSPGSARVGINRIQFL  61

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DLD +L++ GS+LL++ G+P Q        W I KLCFE+DTEPY    DAK+K 
Sbjct  62    LESLQDLDRNLSSRGSKLLLVHGNPIQ--------WRIRKLCFEFDTEPYALDRDAKIKE  113

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
             +A   GIE    VSHT+F+P  +I KNGG  PLT+QSF K   +P  A+ P+    SS+P
Sbjct  114   HAKDKGIELHCSVSHTIFNPDLLIAKNGGKAPLTFQSFCKNL-VP--ATKPIGNGPSSIP  170

Query  817   pIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKPK  996
             P G+L  ++V  VPTLEELGY D  ED  + FRGGE+  L RL +S+AN++WV  FEKPK
Sbjct  171   PTGDLHGIKVVPVPTLEELGYTDFHED-FSPFRGGETVGLTRLEDSLANEKWVCEFEKPK  229

Query  997   GNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFY  1176
             G+P+AF++PATTVLSPYLKFGCLSSR FY  V+EV    K  TSPPVSL  QLLWR+FFY
Sbjct  230   GDPTAFIKPATTVLSPYLKFGCLSSRLFYSRVKEVYSRAKSFTSPPVSLEAQLLWREFFY  289

Query  1177  TVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLA  1356
             T A+ T +FD+M GN  CKQIPWK+ DELL+AWRD RTG+PWIDA M QLRKWGWMHHLA
Sbjct  290   TAAYATANFDKMVGNPTCKQIPWKDDDELLSAWRDGRTGYPWIDAAMTQLRKWGWMHHLA  349

Query  1357  RHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPIT  1536
             RH+VACFLTRGD+F++WEKGRDVF+RLLID+DW+INNGNW+WLS S+FF QYHRIYSPIT
Sbjct  350   RHAVACFLTRGDMFVYWEKGRDVFDRLLIDADWSINNGNWLWLSASAFFNQYHRIYSPIT  409

Query  1537  FGKKYDPDGNYIRHFLPVLK  1596
             F KKYD  GNYI+HFLPV+K
Sbjct  410   FAKKYDRQGNYIKHFLPVIK  429



>gb|AAX56342.1| 6-4 photolyase [Dunaliella salina]
Length=600

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/516 (53%), Positives = 360/516 (70%), Gaps = 15/516 (3%)
 Frame = +1

Query  235   TSMHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFS  414
             TS   +T+   +  S++WFRKGLR+HDNPAL+ A   S   FP+F+IDP++++       
Sbjct  37    TSRMASTSSGQQGRSILWFRKGLRLHDNPALRDACTGSAAVFPIFIIDPYFLQKS-----  91

Query  415   PGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYD  594
               + + G+NR +FLLE+L DL+SSL +LGS+LLVLRG P +V+ R L++WSI KLC+E D
Sbjct  92    --NNKVGVNRYQFLLESLSDLNSSLTSLGSQLLVLRGTPEEVIPRVLRDWSIKKLCYEID  149

Query  595   TEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLA---G  765
             TEPY +A DA+V + A  AG+E     SHTL+D   ++ +N G  PLT Q+F KL    G
Sbjct  150   TEPYAKARDARVDDMAREAGVEVKKHWSHTLYDTDMLVRENKGKAPLTMQAFEKLVDRVG  209

Query  766   IPSWAssplstsls-slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRR  942
              P  A    +  L      +  +   +V  VPT +E+G+    E     F+GGE+EAL+R
Sbjct  210   HPLTALPAPTARLPPVDVSLPGIKDAEV-GVPTWQEMGF---KEAPTAIFKGGETEALKR  265

Query  943   LRESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRH  1122
             L   + + +W A FEKP  +PSAF  P+TT LSPYLKFGCLS+R+F+Q + +V R   +H
Sbjct  266   LEHYMKDTKWXASFEKPSTDPSAFTEPSTTALSPYLKFGCLSARFFHQRLLDVYRLHPKH  325

Query  1123  TSPPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPW  1302
             + PP+SL GQLLWR+FFYT+   TP+FDR+ GN IC+QI W  +  LL AWRD  TG+PW
Sbjct  326   SQPPMSLRGQLLWREFFYTLGSHTPNFDRIAGNPICRQITWDTNPALLKAWRDGATGYPW  385

Query  1303  IDAIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMW  1482
             IDA M QLR+WGWMHHLARHSVACFLTRGDL++ WE G++VFE LL+D+D+ IN  NWMW
Sbjct  386   IDAAMTQLREWGWMHHLARHSVACFLTRGDLYLSWESGKEVFEELLLDADYFINAANWMW  445

Query  1483  LSCSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAK  1662
             LS S+FF QY R+YSP+ FGKKYD +G YIR FLPVLKDMP +YIYEPWTAP  +Q++A 
Sbjct  446   LSASAFFAQYFRVYSPVVFGKKYDKEGAYIRKFLPVLKDMPAKYIYEPWTAPKEVQQRAN  505

Query  1663  CIIGIDYPKPVVSHDSASKECRQRLGEAYELNKKLG  1770
             CIIG DYP P+V H  ASKEC  R+G AY+     G
Sbjct  506   CIIGRDYPAPIVDHAVASKECIARMGAAYKATNTGG  541



>ref|XP_001698054.1| cryptochrome photoreceptor [Chlamydomonas reinhardtii]
 gb|EDO99639.1| cryptochrome photoreceptor [Chlamydomonas reinhardtii]
Length=595

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/504 (54%), Positives = 347/504 (69%), Gaps = 13/504 (3%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA    S++WFRKGLR+HDNPAL  A   +   +P+FV+DPH+++         S +  +
Sbjct  1     MAGVKNSIIWFRKGLRLHDNPALLEACKDAKHVYPVFVLDPHFLQQS-------SYKVSV  53

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NR  FLLE+L DL  S    GSRLLVLRG P +V  R  +EW +++LCFE+DTEPY +  
Sbjct  54    NRYNFLLESLEDLQRSFQARGSRLLVLRGKPEEVFPRVFREWGVTQLCFEHDTEPYAKVR  113

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLA---GIPSWAssp  789
             DA V+  A+ AG+E  TP+SHTL+D   ++ +NGG  PLT QSF KL    G P   +  
Sbjct  114   DAAVRRLAAEAGVEVVTPISHTLYDTDMLVARNGGAAPLTMQSFTKLVDRVGDPPAPAPD  173

Query  790   lstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKE  969
                ++          +   + VPT +E+G+    E   T F+GGE+EAL RL  +  + +
Sbjct  174   PPAAMPPPAEDMPSAAPAATGVPTWQEVGF---KEPPLTVFKGGETEALARLEAAFQDPK  230

Query  970   WVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLG  1149
             WVA F+KP  +PSA+ +PATTVLSPYLKFGCLS+R F+  + EV R    H+ PPVSL G
Sbjct  231   WVAGFQKPDTDPSAWEKPATTVLSPYLKFGCLSARLFHARLLEVYRRHPAHSQPPVSLRG  290

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWR+FFYTV   TP+F RM GN +CKQI W ++ E LAAWR++RTGFPWIDAIM QL 
Sbjct  291   QLLWREFFYTVGSTTPNFHRMAGNPVCKQIDWDDNPEFLAAWREARTGFPWIDAIMTQLV  350

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
              WGWMHHLARHSVACFLTRGDL++ WE+G +VFE  LID D  +N  NWMWLS S+FF Q
Sbjct  351   TWGWMHHLARHSVACFLTRGDLYVSWERGMEVFEEHLIDQDHYLNAANWMWLSASAFFSQ  410

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y R+YSP+ FGKKYDP+G +IR FLPVLKDMP +YIYEPWTAPL +QRKA C++G DYP 
Sbjct  411   YFRVYSPVVFGKKYDPEGRFIRKFLPVLKDMPAKYIYEPWTAPLEVQRKAGCVVGRDYPA  470

Query  1690  PVVSHDSASKECRQRLGEAYELNK  1761
             P+V H  ASK C  R+  AY  +K
Sbjct  471   PIVDHAVASKACIARMAAAYRRSK  494



>ref|XP_002945926.1| DNA photolyase [Volvox carteri f. nagariensis]
 gb|EFJ52921.1| DNA photolyase [Volvox carteri f. nagariensis]
Length=621

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/503 (54%), Positives = 344/503 (68%), Gaps = 19/503 (4%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             MA    S++WFRKGLR+HDNPAL  A   +   +P+F++DP +++         S + G+
Sbjct  1     MAGPKNSILWFRKGLRLHDNPALLEACRGAAHVYPVFILDPFFLQQS-------SYKVGV  53

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
             NR  FLLE+L DLD+S  + GSRLLVLRG P +V  R  +EW I++LCFE DTEPY +  
Sbjct  54    NRYNFLLESLRDLDASFRSRGSRLLVLRGKPEEVFPRVFREWRITQLCFEVDTEPYARVR  113

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             DA+++  A  AG+  +T VSHTL+         G   P+       L G   W     + 
Sbjct  114   DARIQGLADEAGVAVWTAVSHTLYVGLFCSCTAGRHGPV-------LGGCWLWKEKAPAP  166

Query  799   slsslppIGNLGSLQ--VSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                  P   N  S     +AVPT +E+G+   +E   T F+GGE+EAL+RL  S+A+ +W
Sbjct  167   GGRRGPACENAPSTDAATTAVPTWQEVGF---TEAPTTIFKGGETEALKRLSASLADSKW  223

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             VA F+KP  +P+AF RPATTVLSPY+KFGCLS R F+  + EV R  + H+ PPVSL GQ
Sbjct  224   VADFKKPDTDPAAFERPATTVLSPYVKFGCLSPRLFHARLLEVYRRHRGHSQPPVSLRGQ  283

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWR+FFYTV   TP+F RM GN +CKQI W + +ELLAAWR++RTGFPWIDAIM QLR+
Sbjct  284   LLWREFFYTVGAHTPNFHRMDGNPLCKQIDWDDDEELLAAWREARTGFPWIDAIMTQLRQ  343

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
             WGWMHHLARHSVACFLTRGDL++ WE+G  VFE LLID D  +N  NWMWLS S+FF QY
Sbjct  344   WGWMHHLARHSVACFLTRGDLYVSWERGMQVFEELLIDQDHYLNAANWMWLSASAFFSQY  403

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
              R+YSPI+FGKKYDP+G +IR FLPVLKDMP +YIYEPWTAP  +QR+A C+IG DYP P
Sbjct  404   FRVYSPISFGKKYDPEGKFIRKFLPVLKDMPSKYIYEPWTAPSEVQRRAGCVIGRDYPHP  463

Query  1693  VVSHDSASKECRQRLGEAYELNK  1761
             VV H   SK+   R+  AY  NK
Sbjct  464   VVDHALVSKQNIARMAAAYRSNK  486



>ref|XP_005843478.1| hypothetical protein CHLNCDRAFT_7260, partial [Chlorella variabilis]
 gb|EFN51376.1| hypothetical protein CHLNCDRAFT_7260, partial [Chlorella variabilis]
Length=491

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 346/504 (69%), Gaps = 22/504 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S++WFRKGLR+HDNPAL  AA  +    P+F++DP +++ D         + G+NRI+FL
Sbjct  1     SIIWFRKGLRLHDNPALLAAAAGADHLCPIFILDPWFLKSD---------KIGVNRIQFL  51

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQV--------LIRCLKEWSISKLCFEYDTEPYYQ  612
             LE+L DLD+S    GSRLLVLRG   +         L   L+EW +++LCFE+DTEPY +
Sbjct  52    LESLTDLDASFRARGSRLLVLRGRSEEAPSCQAAASLPGALQEWGVTRLCFEHDTEPYAK  111

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAsspl  792
               D  V+  A  AG+E   PVSHTL+DP  ++ +NGG  PLT QSF KL      A+   
Sbjct  112   RRDVAVRQLAEAAGVEVVAPVSHTLYDPQVLLQRNGGRAPLTMQSFTKLVDGGGCAAGYR  171

Query  793   stslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
               +  S P    L S  V AVP+L ++GY        T F+GGES AL R+ + +++K W
Sbjct  172   CIAAPSWPQAAALVSSSV-AVPSLTDIGYPPTGT---TPFKGGESAALARMADYLSDKGW  227

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVK-RHTSPPVSLLG  1149
             V  FEKPKGNP+AF+RP+TTVLSPYLKFGCLS R F+  +Q++       HT PPVSL G
Sbjct  228   VCAFEKPKGNPAAFVRPSTTVLSPYLKFGCLSPRLFHAKLQQIYAERNGMHTQPPVSLRG  287

Query  1150  QLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLR  1329
             QLLWR+FF       P+FDRM GN ICKQIPW +  E +AAW  SRTG+PWIDAIM QLR
Sbjct  288   QLLWREFFTLCGAAIPNFDRMAGNPICKQIPWVDDPERIAAWEHSRTGYPWIDAIMAQLR  347

Query  1330  KWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQ  1509
             + GWMHHLARHSVACFLTRGDL+  WE G+ VF++ LID+DW++N  NW WLS S+FF Q
Sbjct  348   QQGWMHHLARHSVACFLTRGDLWCSWEAGQAVFDKYLIDADWSLNAANWQWLSASAFFSQ  407

Query  1510  YHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPK  1689
             Y R+YSPI FGK+YD +G+YIR FLPVLKDMP  YIYEPWTAPLS+Q+ A C++G DYP+
Sbjct  408   YFRVYSPIAFGKQYDKNGDYIRRFLPVLKDMPVRYIYEPWTAPLSVQQAAGCVVGKDYPR  467

Query  1690  PVVSHDSASKECRQRLGEAYELNK  1761
             P+V H +A KE   R+  AY  +K
Sbjct  468   PIVDHQAAMKENMARMKAAYGASK  491



>ref|WP_023172734.1| deoxyribodipyrimidine photo-lyase [Gloeobacter kilaueensis]
 ref|YP_008711344.1| deoxyribodipyrimidine photo-lyase [Gloeobacter kilaueensis JS1]
 gb|AGY57637.1| deoxyribodipyrimidine photo-lyase [Gloeobacter kilaueensis JS1]
Length=493

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 337/491 (69%), Gaps = 10/491 (2%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             +L+WFRKGLR+HDNPALQ A   +T+  P+FV+DPH+++PD         R G+NR+ FL
Sbjct  4     TLLWFRKGLRLHDNPALQMAIQKATRLMPVFVLDPHFIDPD---------RVGINRMAFL  54

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+LVDLD  L  LGSRLLVLRG P +VL      W + +LCFE DTEPY +  D ++++
Sbjct  55    LESLVDLDRRLRTLGSRLLVLRGQPEEVLAHAFSTWQVGRLCFERDTEPYARNRDERLRS  114

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A   GIE  +P  HTLFDP  ++   GG  PLTY +FL++       + P  T     P
Sbjct  115   LAQKCGIEVVSPTGHTLFDPDAVLKAGGGRAPLTYSAFLRVISRLGTPAQPQPTPAHLPP  174

Query  817   pIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEKPK  996
             PI  +      A+PTL ELGY D  E     + GGE+  L RL + +A++  VA+F KP 
Sbjct  175   PIAEICESPDYAIPTLTELGYTDL-EAVNHRYPGGETAGLERLGDYLADRARVAHFAKPD  233

Query  997   GNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDFFY  1176
              +P+AF  PATTVL  +LKFGCLS+R FY  VQ + R  + HT PPVSLL Q+LWR+FFY
Sbjct  234   TDPTAFDPPATTVLGAHLKFGCLSARTFYYEVQAIYRQARSHTEPPVSLLAQILWREFFY  293

Query  1177  TVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLA  1356
              + + TP++DRM GN IC+QI W ++   LAAW + RTG+PWIDA M QL + GW+HHL+
Sbjct  294   VLGYATPNYDRMAGNPICRQIAWDDNPAYLAAWSEGRTGYPWIDAAMHQLEREGWLHHLS  353

Query  1357  RHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPIT  1536
             RH+VACFLTRGDL++ WE G+ VFERLL+D DW++N  NWMWLS S+FF+ YHR+YSPI+
Sbjct  354   RHAVACFLTRGDLWLSWEAGQAVFERLLVDQDWSLNASNWMWLSASAFFHAYHRVYSPIS  413

Query  1537  FGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSAS  1716
             F KKYDP G ++RH+LP L+  P  +IYEPW APLS+QR+A CI+G DYP+P+V H  A 
Sbjct  414   FAKKYDPAGRFVRHYLPALERYPDAFIYEPWKAPLSVQREAGCIVGRDYPEPIVDHTEAR  473

Query  1717  KECRQRLGEAY  1749
                 +R+  A+
Sbjct  474   TRNIERMRMAF  484



>ref|XP_002508785.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70043.1| predicted protein [Micromonas sp. RCC299]
Length=566

 Score =   539 bits (1389),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 269/550 (49%), Positives = 350/550 (64%), Gaps = 64/550 (12%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             +++WFRKGLR+HDNPAL  A   ++   P+FV+DP +++P+         R G NR+RFL
Sbjct  6     TILWFRKGLRVHDNPALVKACEGASAVQPVFVLDPWFIKPE---------RVGANRLRFL  56

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DLD+SL   GS LLVL GDP++V+   L+ W   +LC+E+DTEPY Q  DA V  
Sbjct  57    LESLTDLDASLRARGSSLLVLHGDPARVIPAALEAWRCDRLCYEFDTEPYAQKRDASVNE  116

Query  637   YASVAGIETFTPVSHTLFDPADIIHK-NGGTPPLTYQSFLKLA-GIPSWAssplstslss  810
              A   G+E   PVSHTL+D   ++ K   G PP  Y SFLK+A G+             +
Sbjct  117   AARALGVEVHAPVSHTLWDLDRLLAKCPRGEPPTAYASFLKIAHGVGPVPPVAPDVPSIT  176

Query  811   lppIGNLGS------------LQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
                 G+  S            +  S +P+LE LGY      E    RGGE+E L RLR+ 
Sbjct  177   PLSDGDALSDGKDLVDALRDVVTGSGIPSLERLGYEPIKAGEGFPARGGETEGLARLRKM  236

Query  955   IANKEWVAYFEKPKGNPS---------------------------------------AFL  1017
             +A   ++A F+KP+ NP+                                       AF+
Sbjct  237   LARTTYIAEFKKPQTNPTELWTPVLGKEGKVKGAPPANPFEAAKKSSKEPKSTQLAEAFM  296

Query  1018  RPATTVLSPYLKFGCLSSRYFYQCVQEVL--RSVKRHTSPPVSLLGQLLWRDFFYTVAFG  1191
              PATT LSPYLKFGC+S R F+  ++ VL      +H+ PP SL GQLLWR+F+Y   +G
Sbjct  297   APATTALSPYLKFGCVSPRTFWHELRAVLDVELGGKHSKPPESLEGQLLWREFYYLAGYG  356

Query  1192  TPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVA  1371
             TP++DRM GNRIC+QIPW   +E LAAW +SRTGFPWIDA M+QL++ GWMHHLARH+VA
Sbjct  357   TPNYDRMAGNRICRQIPWTWDEERLAAWEESRTGFPWIDACMMQLKQEGWMHHLARHAVA  416

Query  1372  CFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKY  1551
             CFLTRGDLF+HWE G  VF+R L+D+DWA+NNGNWMWLSCS FFYQY R+Y P++FGKKY
Sbjct  417   CFLTRGDLFVHWEAGAAVFDRELVDADWALNNGNWMWLSCSCFFYQYFRVYGPVSFGKKY  476

Query  1552  DPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQ  1731
             D +G YIR +LP LKDMP +YIYEPWTAP+ +QRKA C++G+DYP P+V H  ASKEC +
Sbjct  477   DKEGAYIRKYLPQLKDMPAKYIYEPWTAPIEVQRKAGCVVGVDYPAPIVDHAVASKECIE  536

Query  1732  RLGEAYELNK  1761
             ++  AY  +K
Sbjct  537   KIAAAYNAHK  546



>gb|AAU14280.1| cryptochrome-like protein 1 [Ostreococcus tauri]
 emb|CEF97817.1| DNA photolyase, FAD-binding/Cryptochrome, C-terminal [Ostreococcus 
tauri]
Length=559

 Score =   535 bits (1378),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 264/550 (48%), Positives = 348/550 (63%), Gaps = 55/550 (10%)
 Frame = +1

Query  250   ATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTR  429
             +T+ A++  +L+WFRK LR+HDNPAL      +T C P+FV+DP + +P         +R
Sbjct  5     STSAAAKGRTLVWFRKALRVHDNPALSRGTLHATACQPVFVLDPWFCQP---------SR  55

Query  430   AGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYY  609
              G NR+RFLL++L DLD+ L   GS LLVL G+P  VL R  K+W +  + +E+D EPY 
Sbjct  56    VGANRMRFLLQSLRDLDAQLRARGSSLLVLHGEPRVVLPRACKKWRVDSVTWEHDIEPYA  115

Query  610   QALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLA---GIPSWA  780
             +  DA V+     AG+E      HTL+D  +++ K  G PP TYQ F K+    G P+  
Sbjct  116   KIRDAAVRGALERAGVECHAASGHTLYDVDEMLEKCKGAPPTTYQGFFKIVDKMGAPNAP  175

Query  781   ssplstslsslppIGN------LGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRR  942
                +     S             G      +PTLE+LGY    +DE     GGE+E LRR
Sbjct  176   IDAMEKMPGSFASSDEETKALVQGVADAYGIPTLEDLGYEPLGDDEGFPGVGGETEGLRR  235

Query  943   LRESIANKEWVAYFEKPKGNPS------------------------------------AF  1014
             LR  +A KEW+  FEKP  NP+                                    A 
Sbjct  236   LRLMLARKEWIGQFEKPSTNPTTRFHGLSQSGKTKPKSPFEIAAGRSKDGDASTSGAEAL  295

Query  1015  LRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVK-RHTSPPVSLLGQLLWRDFFYTVAFG  1191
             + P+TT LSPY+KFGC+S R FY  +  V + ++ +H+ PP SL+GQL+WR+F+Y VA G
Sbjct  296   MIPSTTALSPYMKFGCVSPRVFYHELTAVYKELEGKHSKPPTSLMGQLMWREFYYLVAAG  355

Query  1192  TPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVA  1371
             T +FD+M GN IC+QIPWK+  EL AAW +++TGFPWIDA M QLR+ GW+HHLARH+VA
Sbjct  356   TKNFDKMEGNAICRQIPWKKDRELFAAWENAQTGFPWIDAAMTQLRREGWLHHLARHAVA  415

Query  1372  CFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKY  1551
             CFLTRGDLFIHWE GRD F+R L+D+DWA+NNGNWMWLSCS+FFYQY R+YSPI F KKY
Sbjct  416   CFLTRGDLFIHWEWGRDAFDRDLVDADWALNNGNWMWLSCSAFFYQYFRVYSPIAFAKKY  475

Query  1552  DPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQ  1731
             D DG Y+RH+LPVLK+MP +Y+YEPW APL +Q+KA C++G+DYP P+V H +ASK C  
Sbjct  476   DKDGQYVRHYLPVLKNMPSKYVYEPWLAPLDVQKKAGCVVGVDYPAPIVDHSAASKRCVD  535

Query  1732  RLGEAYELNK  1761
              +  AY  +K
Sbjct  536   DIATAYAAHK  545



>ref|XP_003061228.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54878.1| predicted protein [Micromonas pusilla CCMP1545]
Length=559

 Score =   530 bits (1366),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 274/544 (50%), Positives = 349/544 (64%), Gaps = 58/544 (11%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL  A   +T   P+FV+DP ++ P         +R G NR+RFL
Sbjct  10    SIHWFRKGLRVHDNPALVDACADATAVQPIFVLDPWFLTP---------SRVGANRVRFL  60

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L++L DLD+SL   GS LLVLRGDP  V+   L+ W   +L  E DTEPY  A DA V++
Sbjct  61    LQSLTDLDASLRARGSSLLVLRGDPKAVVPAALRAWGCDRLTHEVDTEPYASARDAAVRD  120

Query  637   YASVAGIETFTPVSHTLFDPADIIHK-NGGTPPLTYQSFLKLAG-------------IPS  774
              A   G E  T  SHTL+D   ++ K   G PP +Y SFLK+AG                
Sbjct  121   AAKRVGAEVKTFASHTLYDMERLLSKCPKGAPPTSYASFLKIAGSCGAVAKPAPPPPASM  180

Query  775   WAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
               S    + +  +  I ++ S     VPTLEELGY +  +DE    RGGE+E L RLR  
Sbjct  181   PGSPDGKSHVELVAMIEDVVSSAEVGVPTLEELGYPELPDDEGFPARGGETEGLDRLRRM  240

Query  955   IANKEWVAYFEKPKGNPS----------------------------------AFLRPATT  1032
             ++ K W+A F+KP  +P+                                  AFL P+TT
Sbjct  241   LSRKTWIAEFQKPMTSPTSLWAVVGADGKTQKPANPFEAASKASKSKTVGAEAFLAPSTT  300

Query  1033  VLSPYLKFGCLSSRYFYQCVQEVLRSVK-RHTSPPVSLLGQLLWRDFFYTVAFGTPSFDR  1209
              LSPYLKFGC+S R FY  +++VL   K +H++PPVSL GQLLWR+F+Y  AFGTP++ +
Sbjct  301   ALSPYLKFGCVSPRTFYHELKDVLNDAKGKHSAPPVSLEGQLLWREFYYLAAFGTPNYHK  360

Query  1210  MRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTRG  1389
             M GN IC+QIPW   +E LAAW + RTGFPWIDA M QLR+ GW+HHLARH+VACFLTRG
Sbjct  361   MEGNPICRQIPWTWDEERLAAWEEGRTGFPWIDACMHQLRQEGWLHHLARHAVACFLTRG  420

Query  1390  DLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGNY  1569
             DLF+HWE G  VF+R L+D+D A+N GNWMWLSCS FFYQY R+Y P++FGKKYD DG +
Sbjct  421   DLFVHWEAGAKVFDRDLVDADPALNYGNWMWLSCSCFFYQYFRVYGPVSFGKKYDKDGTF  480

Query  1570  IRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEAY  1749
             IR +LPVLKDMP +YIYEPWTAP  +Q+KA C+IG+DYP P+V H  ASKEC ++L  AY
Sbjct  481   IRKYLPVLKDMPAKYIYEPWTAPADVQKKAGCVIGVDYPPPIVDHAVASKECIEKLAVAY  540

Query  1750  ELNK  1761
             + +K
Sbjct  541   KAHK  544



>gb|EKC39908.1| Cryptochrome-1 [Crassostrea gigas]
Length=510

 Score =   523 bits (1346),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 259/505 (51%), Positives = 335/505 (66%), Gaps = 19/505 (4%)
 Frame = +1

Query  268   ESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRI  447
             ++C++ WFRKGLR+HDNPALQ A   +    P+F++DP +           +   G+NR 
Sbjct  2     KTCAIHWFRKGLRLHDNPALQAACKVADDVKPVFILDPWFA---------NNANVGVNRW  52

Query  448   RFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAK  627
             RFLL+TL +LD +L  + SRL +++G P+ V  +  K W +S L FE D EPY    D++
Sbjct  53    RFLLQTLQNLDENLKKINSRLYIIKGKPADVFPKLFKNWGVSHLTFEEDIEPYALTRDSE  112

Query  628   VKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQ---SFLKLAGIPSWAssplst  798
             +K  A    ++  + VSHTLFDP  II KNGG  PLTYQ   + L   G P       S 
Sbjct  113   IKKLADEHNVKVTSCVSHTLFDPQRIISKNGGKAPLTYQRLQTVLSSLGSPPKPVDSPSE  172

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
               +      +    +   VP+LE+LG  +  E     F GGE+EALRRL   +  K WV 
Sbjct  173   CKTKTESDHD----KKYGVPSLEDLGKSE-KECGPLLFPGGETEALRRLESMMGKKNWVC  227

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPK  P++ L P+TTVLSPYLKFGCLS R FY  +QEV    K HTSPPVSLLGQLL
Sbjct  228   TFEKPKTAPNS-LEPSTTVLSPYLKFGCLSPRMFYYKLQEVYNKAK-HTSPPVSLLGQLL  285

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+F+Y VA  TP+FD+M GN +CKQIPW  ++  L AW++ RTG+P+IDA+M QLR+ G
Sbjct  286   WREFYYCVAVDTPNFDKMEGNPVCKQIPWDTNESYLKAWKEGRTGYPFIDAVMTQLRQEG  345

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARHSVACFLTRGDL+I+WE+G  VFE  L+D+DW++N GNWMWLS S+FF+QY R
Sbjct  346   WIHHLARHSVACFLTRGDLWINWEEGMKVFEEYLLDADWSLNAGNWMWLSASAFFHQYFR  405

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPI FGKK D DG+ IR ++P L   P  YIYEPW APL +Q KA CI+G DYPKP+V
Sbjct  406   VYSPIEFGKKTDKDGDNIRKYVPQLSKYPTAYIYEPWKAPLKVQEKAGCIVGKDYPKPIV  465

Query  1699  SHDSASKECRQRLGEAYELNKKLGG  1773
              HD   K+  +R+ +AY  +K  GG
Sbjct  466   EHDKIRKKNIERMAQAYNASKTEGG  490



>ref|XP_007244778.1| PREDICTED: cryptochrome-1-like isoform X1 [Astyanax mexicanus]
 ref|XP_007244779.1| PREDICTED: cryptochrome-1-like isoform X2 [Astyanax mexicanus]
Length=521

 Score =   523 bits (1347),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 265/538 (49%), Positives = 355/538 (66%), Gaps = 34/538 (6%)
 Frame = +1

Query  271   SCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIR  450
             SC + WFRKGLR+HDNPAL++A +     +P+F++DP +         P + + G+NR R
Sbjct  4     SC-IHWFRKGLRLHDNPALKYALHDCKHMYPVFILDPWF---------PKNAQVGINRWR  53

Query  451   FLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKV  630
             FL+E L DLDSSL  L SRL V+RG P +V  R  +EW +++L FE D+EPY Q  D +V
Sbjct  54    FLIEALKDLDSSLRKLNSRLFVIRGVPREVFPRLFEEWKVTRLTFEVDSEPYSQKRDKEV  113

Query  631   KNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplsts  801
              + A   G+E  T +SHTL++   +I +N G  PLTY   Q+ L   G P       +  
Sbjct  114   MDLAKQHGVEIITKISHTLYNLERVIEENNGKAPLTYVRFQTVLNKIGPPKRPVPAPTRE  173

Query  802   lsslppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                     +  + + +  VPTL+ELG  D +      + GGE EALRRL E +    WV 
Sbjct  174   DMKGVSTPSSETDKENYGVPTLDELGQ-DSTTLGPVLYPGGEQEALRRLDEYMQRTNWVC  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKP+ +P+A L+P+TTVLSPY+KFGCLS+R F+  + EV    K+H++PPVSL GQLL
Sbjct  233   SFEKPQTSPNA-LKPSTTVLSPYVKFGCLSARTFWWRLAEVYHG-KKHSAPPVSLHGQLL  290

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A+G P+F++M GN IC Q+ W  + E LAAWR++RTGFP+IDAIM QLR+ G
Sbjct  291   WREFFYTAAYGIPNFNKMEGNTICVQVDWDSNPEHLAAWREARTGFPFIDAIMTQLRQEG  350

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G+ VFE LL+D+DWA+N GNW WLS S+FF+QY R
Sbjct  351   WIHHLARHAVACFLTRGDLWISWEEGQKVFEELLLDADWALNAGNWQWLSASAFFHQYFR  410

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPI FGKK D +G+YI+ +LP+LK  P +YIYEPW AP SIQ +A CI+G DYP+P+V
Sbjct  411   VYSPIAFGKKTDKNGDYIKKYLPILKKFPAQYIYEPWKAPKSIQEQAGCIVGKDYPRPIV  470

Query  1699  SHDSASKECRQRLGEAYELNKKLGGMVRDEELNELKRRVEEQDKSMEYKTKRQKQTLI  1872
              HD+ SK+  QR+  AY                  KR  +  D S E K +++K   I
Sbjct  471   DHDTISKKNIQRMKAAYA-----------------KRSPDSSDGSAERKGQKRKSASI  511



>ref|WP_011141747.1| photolyase [Gloeobacter violaceus]
 ref|NP_924695.1| photolyase [Gloeobacter violaceus PCC 7421]
 dbj|BAC89690.1| photolyase [Gloeobacter violaceus PCC 7421]
Length=490

 Score =   520 bits (1339),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 253/500 (51%), Positives = 341/500 (68%), Gaps = 15/500 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             SL+WFRKGLR+HDNPAL  AA  + + +PLF++DP ++ P+         R G+NR+RFL
Sbjct  4     SLVWFRKGLRLHDNPALLDAARDAARLYPLFIVDPWFVNPE---------RVGVNRMRFL  54

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L ++D +L  LGSRL+VL+G P +VL R L  W I +LCFE DTEPY +  D  +++
Sbjct  55    LESLGEIDGNLRRLGSRLIVLQGRPQEVLERVLSRWQIGRLCFERDTEPYARRRDEAIRS  114

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A   G+   +P +HTL+DP ++I    G  P TY +F +LA             ++S  
Sbjct  115   MAERVGVRVISPTAHTLYDPDELIELGRGKVPTTYGAFGRLAA----KLGEPDAPVASPS  170

Query  817   pIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFR-GGESEALRRLRESIANKEWVAYFEK  990
              +   G L     +PTL ELGY D     R     GGE E LRRL   +++++  A F K
Sbjct  171   HLPPPGELDADYGIPTLAELGYPDPECPSRGIIPPGGEGEGLRRLHVYLSDRQRSAGFAK  230

Query  991   PKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDF  1170
             P  +P+AF  P+TT L  +LKFGCLS+R FY  VQ+V R V  HT PP+SL+GQ+LWR+F
Sbjct  231   PDTDPTAFDPPSTTALGAHLKFGCLSARTFYAEVQKVYREVGEHTEPPMSLIGQILWREF  290

Query  1171  FYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHH  1350
             FYTV + TP++DR+ GN +C+QIPW ++ E LAAW ++RTGFPWIDA M QLR  GW+HH
Sbjct  291   FYTVGYATPNYDRIEGNPVCRQIPWDDNPEYLAAWSEARTGFPWIDAAMTQLRTEGWLHH  350

Query  1351  LARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSP  1530
             L+RH+VACFLTRGDL++ WEKG+ VFERLL+D DW++N  NWMWLS S+FF  Y+R+YSP
Sbjct  351   LSRHAVACFLTRGDLWVSWEKGQAVFERLLLDQDWSLNASNWMWLSASAFFNAYYRVYSP  410

Query  1531  ITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDS  1710
             I+F KKYDP+G Y+R +LP L  +P E+IYEPW APL +Q++A C++G DYP P+V H+ 
Sbjct  411   ISFAKKYDPEGRYVRRYLPKLARVPAEFIYEPWRAPLLVQKQAGCVVGRDYPDPIVDHEQ  470

Query  1711  ASKECRQRLGEAYELNKKLG  1770
             A     +R+  AYE N K G
Sbjct  471   AKACNLERMRLAYEQNAKGG  490



>ref|XP_004995002.1| DNA photolyase [Salpingoeca rosetta]
 gb|EGD83498.1| DNA photolyase [Salpingoeca rosetta]
Length=540

 Score =   517 bits (1332),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 329/510 (65%), Gaps = 18/510 (4%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+  + S+ WFRKGLR+HDN AL  A   + + +P+FV+DPH+ +P+           G+
Sbjct  1     MSGGAVSIHWFRKGLRLHDNAALLAALKGAKQVYPVFVLDPHFAKPE---------FVGV  51

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
              R  FLLE+L DLD SL  LGSRL VL+G P Q L    KEW +++L FE DTEPY +  
Sbjct  52    VRYNFLLESLRDLDKSLRTLGSRLYVLKGKPLQALEEKFKEWEVTRLTFERDTEPYAKLR  111

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTP--PLTYQSF----LKLAGIPSWA  780
             D + +  A   GIE  T V HTL DP   I K GG    PLTY SF     +L  +P+  
Sbjct  112   DTQARELAEKHGIEVITTVGHTLHDPEQYIAKAGGADKIPLTYSSFGTLFRRLGKVPAAL  171

Query  781   ssplstslsslppIGNLGSLQVSA--VPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
             S+P          +    +L      VP+L+++GY    ++    F GGE+EAL R+R  
Sbjct  172   SAPTKEDFPQSSTLVRTDALDDHRFDVPSLKDMGYEWNDDEHEVRFPGGETEALERMRRH  231

Query  955   IANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPP  1134
             +  K W+A+FEKPK +P+  L P+TT LSPYLKFGCLS R FY  +  V    + H  PP
Sbjct  232   LQRKAWIAHFEKPKTSPNT-LEPSTTGLSPYLKFGCLSPRLFYHELARVYAEYRDHAKPP  290

Query  1135  VSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAI  1314
             VSL GQLLWR+FF+   +   +FDRM GNRIC+QI W  +D LLAAW ++RTG+PWIDA 
Sbjct  291   VSLHGQLLWREFFHMCGYAVKNFDRMEGNRICRQIDWDTNDALLAAWENARTGYPWIDAC  350

Query  1315  MVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  1494
             M QLR+ GW+HHLARH+VACFLTRGDL+  WEKG  VF+RLL+D+DW +N+ NWMWLSCS
Sbjct  351   MTQLRREGWLHHLARHAVACFLTRGDLYQSWEKGAQVFDRLLVDADWHLNSANWMWLSCS  410

Query  1495  SFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIG  1674
             SFFYQY R+YSP+ FGKK DP G YIR +LP LK  P +YIYEPW AP  +QR   CIIG
Sbjct  411   SFFYQYFRVYSPVAFGKKTDPSGAYIRKYLPQLKAFPDKYIYEPWKAPPGVQRSCGCIIG  470

Query  1675  IDYPKPVVSHDSASKECRQRLGEAYELNKK  1764
              DYP+P+V H   S   + R+   Y+  K+
Sbjct  471   KDYPEPIVDHAEVSAANKARIRACYDALKQ  500



>ref|XP_002595074.1| hypothetical protein BRAFLDRAFT_60127 [Branchiostoma floridae]
 gb|EEN51085.1| hypothetical protein BRAFLDRAFT_60127 [Branchiostoma floridae]
Length=507

 Score =   513 bits (1321),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 250/493 (51%), Positives = 334/493 (68%), Gaps = 17/493 (3%)
 Frame = +1

Query  256   AMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAG  435
             A   +  ++ WFRKGLR HDNP+L HA   S   +P++V+D ++M+           R G
Sbjct  2     ANKVQHSTIHWFRKGLRFHDNPSLLHALRTSRHVYPVYVVDQNWMKEH-------DIRYG  54

Query  436   LNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQA  615
              N  RF+++ L +LD+ L   G RL V+RG          ++W +++L  + DTEP+Y+ 
Sbjct  55    ANWWRFVIQCLEELDTRLRKYGLRLFVVRGSAEDFFKEHFRKWKVTQLTHDVDTEPFYRI  114

Query  616   LDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKL---AGIPSWAss  786
              D  V+  AS  G+E  T V+HTL+D    + +NGGTPPLTY+ FLK+    G P     
Sbjct  115   RDVAVRKIASDMGVEVVTHVAHTLYDIDRTVERNGGTPPLTYRKFLKVYNEMGKPPKEKE  174

Query  787   plstslsslppI--GNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIA  960
               +T   +   +    L   +   V TLEELG + C  D    F GGE+EALRRL +S+ 
Sbjct  175   TATTEHFANCTLPPEALQDKKFDMV-TLEELG-MRC--DFPAKFVGGETEALRRLEKSLE  230

Query  961   NKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVS  1140
             +K+WV  FEKPK +P++ L P+TTVLSPY+  GCLS+R FY  + ++    K H+ PPVS
Sbjct  231   DKDWVLKFEKPKTSPNSLL-PSTTVLSPYITVGCLSARLFYHQLDKIYSKAKNHSQPPVS  289

Query  1141  LLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMV  1320
             L GQL+WR+FFYT A  TP+F++M GNR+C QIPW ++DE L  WR+++TGFPWIDA M 
Sbjct  290   LHGQLIWREFFYTAAAHTPNFNQMEGNRVCLQIPWNKNDEHLTRWRNAQTGFPWIDAAMT  349

Query  1321  QLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSF  1500
             QLRK GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N GNWMWLS S+F
Sbjct  350   QLRKEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSLNAGNWMWLSASAF  409

Query  1501  FYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGID  1680
             F+QY R+YSPI FGKK DP G +IRH+LPVLK+ PKEYIYEPW AP ++Q KA CI+G D
Sbjct  410   FHQYFRVYSPIVFGKKTDPKGTFIRHYLPVLKNFPKEYIYEPWKAPRNVQEKAGCIVGKD  469

Query  1681  YPKPVVSHDSASK  1719
             YP+P+V H  AS+
Sbjct  470   YPRPIVDHKEASQ  482



>gb|AAH44204.1| Cry5 protein, partial [Danio rerio]
Length=545

 Score =   513 bits (1321),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 258/507 (51%), Positives = 336/507 (66%), Gaps = 16/507 (3%)
 Frame = +1

Query  241   MHPATAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPG  420
             +H   A      ++ WFRKGLR+HDNPAL  A       +PLF++DP +         P 
Sbjct  19    LHSPKATTMSHNTIHWFRKGLRLHDNPALIAALKDCRHIYPLFLLDPWF---------PK  69

Query  421   STRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTE  600
             +TR G+NR RFL+E L DLDSSL  L SRL V+RG P++VL +  K+W I++L FE DTE
Sbjct  70    NTRIGINRWRFLIEALKDLDSSLKKLNSRLFVVRGSPTEVLPKLFKQWKITRLTFEVDTE  129

Query  601   PYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIP  771
             PY Q+ D +V   A   G+E    +SHTL++   II +N G  P+TY   QS +K  G P
Sbjct  130   PYSQSRDKEVMKLAKEYGVEVTPKISHTLYNIDRIIDENNGKTPMTYIRLQSVVKAMGHP  189

Query  772   SWAssplstslsslppIG-NLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLR  948
                    +           +    +   +PTLE+LG +D S      F GGE EALRRL 
Sbjct  190   KKPIPAPTNEDMRGVSTPLSDDHEEKFGIPTLEDLG-LDTSSLGPHLFPGGEQEALRRLD  248

Query  949   ESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTS  1128
             E +    WV  FEKPK +P++ + P+TTVLSPY++FGCLS+R F+  + +V R  K H+ 
Sbjct  249   EHMERTNWVCKFEKPKTSPNSLI-PSTTVLSPYVRFGCLSARIFWWRLADVYRG-KTHSD  306

Query  1129  PPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWID  1308
             PPVSL GQLLWR+FFYT A G P+F++M GN  C Q+ W  + E LAAWR++RTGFP+ID
Sbjct  307   PPVSLHGQLLWREFFYTTAVGIPNFNKMEGNSACVQVDWDNNPEHLAAWREARTGFPFID  366

Query  1309  AIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLS  1488
             AIM QLR+ GW+HHLARH+VACFLTRGDL+I WE+G+ VFE LL+DSDW++N GNW WLS
Sbjct  367   AIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGQKVFEELLLDSDWSLNAGNWQWLS  426

Query  1489  CSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCI  1668
              S+FF+QY R+YSPI FGKK D  G+YI+ +LPVLK  P EYIYEPW AP S+Q +A CI
Sbjct  427   ASTFFHQYFRVYSPIAFGKKTDKHGDYIKKYLPVLKKFPTEYIYEPWKAPRSVQERAGCI  486

Query  1669  IGIDYPKPVVSHDSASKECRQRLGEAY  1749
             +G DYP+P+V H+   K+   R+  AY
Sbjct  487   VGKDYPRPIVDHEVVHKKNILRMKAAY  513



>ref|XP_009045182.1| hypothetical protein LOTGIDRAFT_180057 [Lottia gigantea]
 gb|ESP04097.1| hypothetical protein LOTGIDRAFT_180057 [Lottia gigantea]
Length=525

 Score =   511 bits (1316),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 258/501 (51%), Positives = 334/501 (67%), Gaps = 15/501 (3%)
 Frame = +1

Query  271   SCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIR  450
             S S+ WFRKGLR+HDNPAL  A +   +   +F++DP +++         + + G+NR R
Sbjct  3     SRSVHWFRKGLRLHDNPALLAALDKCVEFRAVFILDPWFVK---------NYKVGINRWR  53

Query  451   FLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKV  630
             FL+E+L DLD+SL  L SRL ++RG P  V     K+W I++L +E DTEPY    D  +
Sbjct  54    FLIESLTDLDNSLRKLNSRLYIIRGKPESVFPALFKKWKITQLSYEIDTEPYALRRDKAI  113

Query  631   KNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLT---YQSFLKLAGIPSWAssplsts  801
                A    ++    VSHTL+D   II KNGG  PLT    QS +K  G PS      +  
Sbjct  114   DILAEELNVKILKHVSHTLYDTNRIIEKNGGKAPLTISKLQSIVKQVGNPSKPLDAPTLQ  173

Query  802   lsslppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                   I +   +  +  VPTLEELG  D S      + GGE+E+L+RL  SIA   W+A
Sbjct  174   HFKDIKIESDEDISENYKVPTLEELGQ-DPSLCGPVLYPGGETESLKRLENSIAKPSWIA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKP   P++ L P+TTVLSPY+KFGCLS R FY  +QEV   VK+HT+PPVSL GQLL
Sbjct  233   SFEKPNTEPNS-LSPSTTVLSPYIKFGCLSPRLFYWKIQEVYDKVKKHTAPPVSLHGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             +R+ FYTV + TP+FD+M  N IC QIPW+ ++E L AWR+ +TG+P+IDAIM QLR+ G
Sbjct  292   FRELFYTVGYVTPNFDKMVDNPICTQIPWQNNEEYLKAWREGKTGYPFIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+ HWE+G+ VFE  L+D+DW++N GNWMWLS SSFFYQY R
Sbjct  352   WIHHLARHAVACFLTRGDLWCHWEEGQKVFEEYLLDADWSLNAGNWMWLSASSFFYQYFR  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSP+ FGKK DP+G YI+ +LPVLK +P  YIYEPW AP S+Q  A CIIG DYPK +V
Sbjct  412   VYSPVAFGKKTDPNGLYIKKYLPVLKKLPSNYIYEPWKAPKSVQEAAGCIIGKDYPKRIV  471

Query  1699  SHDSASKECRQRLGEAYELNK  1761
              HD       +R+ EAY  +K
Sbjct  472   DHDIVRPINIERMHEAYAKHK  492



>ref|XP_003079123.1| cryptochrome-like protein 1 (ISS) [Ostreococcus tauri]
Length=1646

 Score =   542 bits (1396),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 269/562 (48%), Positives = 354/562 (63%), Gaps = 56/562 (10%)
 Frame = +1

Query  217   SLSARRTSMHPA-TAMASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYME  393
             S  +RR +M  A T+ A++  +L+WFRK LR+HDNPAL      +T C P+FV+DP + +
Sbjct  1080  SRCSRRGAMSVASTSAAAKGRTLVWFRKALRVHDNPALSRGTLHATACQPVFVLDPWFCQ  1139

Query  394   PDPTAFSPGSTRAGLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSIS  573
             P         +R G NR+RFLL++L DLD+ L   GS LLVL G+P  VL R  K+W + 
Sbjct  1140  P---------SRVGANRMRFLLQSLRDLDAQLRARGSSLLVLHGEPRVVLPRACKKWRVD  1190

Query  574   KLCFEYDTEPYYQALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFL  753
              + +E+D EPY +  DA V+     AG+E      HTL+D  +++ K  G PP TYQ F 
Sbjct  1191  SVTWEHDIEPYAKIRDAAVRGALERAGVECHAASGHTLYDVDEMLEKCKGAPPTTYQGFF  1250

Query  754   KLA---GIPSWAssplstslsslppIGN------LGSLQVSAVPTLEELGYVDCSEDERT  906
             K+    G P+     +     S             G      +PTLE+LGY    +DE  
Sbjct  1251  KIVDKMGAPNAPIDAMEKMPGSFASSDEETKALVQGVADAYGIPTLEDLGYEPLGDDEGF  1310

Query  907   SFRGGESEALRRLRESIANKEWVAYFEKPKGNPS--------------------------  1008
                GGE+E LRRLR  +A KEW+  FEKP  NP+                          
Sbjct  1311  PGVGGETEGLRRLRLMLARKEWIGQFEKPSTNPTTRFHGLSQSGKTKPKSPFEIAAGRSK  1370

Query  1009  ----------AFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVK-RHTSPPVSLLGQL  1155
                       A + P+TT LSPY+KFGC+S R FY  +  V + ++ +H+ PP SL+GQL
Sbjct  1371  DGDASTSGAEALMIPSTTALSPYMKFGCVSPRVFYHELTAVYKELEGKHSKPPTSLMGQL  1430

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             +WR+F+Y VA GT +FD+M GN IC+QIPWK+  EL AAW +++TGFPWIDA M QLR+ 
Sbjct  1431  MWREFYYLVAAGTKNFDKMEGNAICRQIPWKKDRELFAAWENAQTGFPWIDAAMTQLRRE  1490

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDLFIHWE GRD F+R L+D+DWA+NNGNWMWLSCS+FFYQY 
Sbjct  1491  GWLHHLARHAVACFLTRGDLFIHWEWGRDAFDRDLVDADWALNNGNWMWLSCSAFFYQYF  1550

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
             R+YSPI F KKYD DG Y+RH+LPVLK+MP +Y+YEPW APL +Q+KA C++G+DYP P+
Sbjct  1551  RVYSPIAFAKKYDKDGQYVRHYLPVLKNMPSKYVYEPWLAPLDVQKKAGCVVGVDYPAPI  1610

Query  1696  VSHDSASKECRQRLGEAYELNK  1761
             V H +ASK C   +  AY  +K
Sbjct  1611  VDHSAASKRCVDDIATAYAAHK  1632



>ref|NP_571863.1| cryptochrome 5 [Danio rerio]
 dbj|BAA96852.1| 6-4 photolyase [Danio rerio]
Length=519

 Score =   509 bits (1312),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 255/495 (52%), Positives = 332/495 (67%), Gaps = 16/495 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL  A       +PLF++DP +         P +TR G+NR RFL
Sbjct  5     TIHWFRKGLRLHDNPALIAALKDCRHIYPLFLLDPWF---------PKNTRIGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             +E L DLDSSL  L SRL V+RG P++VL +  K+W I++L FE DTEPY Q+ D +V  
Sbjct  56    IEALKDLDSSLKKLNSRLFVVRGSPTEVLPKLFKQWKITRLTFEVDTEPYSQSRDKEVMK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplstsls  807
              A   G+E    +SHTL++   II +N G  P+TY   QS +K  G P       +    
Sbjct  116   LAKEYGVEVTPKISHTLYNIDRIIDENNGKTPMTYIRLQSVVKAMGHPKKPIPAPTNEDM  175

Query  808   slppIG-NLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
                    +    +   +PTLE+LG +D S      F GGE EALRRL E +    WV  F
Sbjct  176   RGVSTPLSDDHEEKFGIPTLEDLG-LDTSSLGPHLFPGGEQEALRRLDEHMERTNWVCKF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             EKPK +P++ + P+TTVLSPY++FGCLS+R F+  + +V R  K H+ PPVSL GQLLWR
Sbjct  235   EKPKTSPNSLI-PSTTVLSPYVRFGCLSARTFWWRLADVYRG-KTHSDPPVSLHGQLLWR  292

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A G P+F++M GN  C Q+ W  + E LAAWR++RTGFP+ID IM QLR+ GW+
Sbjct  293   EFFYTTAVGIPNFNKMEGNSACVQVDWDNNPEHLAAWREARTGFPFIDTIMTQLRQEGWI  352

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL+I WE+G+ VFE LL+DSDW++N GNW WLS S+FF+QY R+Y
Sbjct  353   HHLARHAVACFLTRGDLWISWEEGQKVFEELLLDSDWSLNAGNWQWLSASTFFHQYFRVY  412

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
             SPI FGKK D  G+YI+ +LPVLK  P EYIYEPW AP S+Q +A CI+G DYP+P+V H
Sbjct  413   SPIAFGKKTDKHGDYIKKYLPVLKKFPTEYIYEPWKAPRSVQERAGCIVGKDYPRPIVDH  472

Query  1705  DSASKECRQRLGEAY  1749
             +   K+   R+  AY
Sbjct  473   EVVHKKNILRMKAAY  487



>ref|XP_001417651.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95944.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=562

 Score =   511 bits (1316),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 254/545 (47%), Positives = 334/545 (61%), Gaps = 59/545 (11%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             SL+WFRK LR+HDNPAL      +    P+FV+DP + +P         +R G NR+RFL
Sbjct  13    SLIWFRKALRVHDNPALAAGIARAKSAQPVFVLDPWFCKP---------SRVGANRMRFL  63

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L++L DLD++L   GS LLVL G+P  VL R  K W +  + +E+D EPY +  D  V+ 
Sbjct  64    LQSLRDLDATLRERGSSLLVLHGEPRVVLPRACKTWKVDLVTWEHDIEPYAKMRDTAVRG  123

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLA---GIPSWAssplstsls  807
                 AG+E  +   HTL+D  +++ K  G PP TY  FLK+    G P+ A        +
Sbjct  124   ALERAGVECASSSGHTLYDVEEMLAKCHGKPPTTYSQFLKIVDKMGAPAAALDAPKAMPA  183

Query  808   slppIGN------LGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKE  969
                           G      +PTLEELGY    +DE     GGE+E LRRLR  ++  E
Sbjct  184   PFTGTAEETKELVAGVADAYGIPTLEELGYEAMHDDEGFQAIGGETEGLRRLRRQLSRTE  243

Query  970   WVAYFEKPKGNPSAF--------------------------------------LRPATTV  1035
             WV  F+KP  NP+                                        + P+TT 
Sbjct  244   WVHTFQKPDTNPTTLFHALGAKKPKPKSPFEIAARDAGSKNDATNTAANSDMLMTPSTTA  303

Query  1036  LSPYLKFGCLSSRYFYQCVQEVLRSVK---RHTSPPVSLLGQLLWRDFFYTVAFGTPSFD  1206
             LSPY+KFGC+S R FY  +  VL   +   + + PPVSL+GQL+WR+F+Y V  GTP+FD
Sbjct  304   LSPYMKFGCVSPRVFYHELNAVLAKFEGKGQPSQPPVSLMGQLMWREFYYLVGAGTPNFD  363

Query  1207  RMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHHLARHSVACFLTR  1386
             +M GN IC+QIPW +  EL AAW +++TGFPWIDA M QLR  GW+HHLARH+VACFLTR
Sbjct  364   KMEGNPICRQIPWNKDRELFAAWENAQTGFPWIDAAMTQLRLEGWIHHLARHAVACFLTR  423

Query  1387  GDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSPITFGKKYDPDGN  1566
             GDLF+HWE GRD F+R L+D+DWA+NNGNWMWLSCS FFYQY R+Y P +F KKYD DG 
Sbjct  424   GDLFVHWEWGRDTFDRDLVDADWALNNGNWMWLSCSCFFYQYFRVYGPHSFAKKYDKDGA  483

Query  1567  YIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDSASKECRQRLGEA  1746
             Y++H+LPVLK+MP +Y+YEPW APL +Q+KA C++G+DYP P+V H +ASK C  ++  A
Sbjct  484   YVKHYLPVLKNMPAKYVYEPWLAPLDVQKKAGCVVGVDYPAPIVDHATASKACIDKIATA  543

Query  1747  YELNK  1761
             Y  +K
Sbjct  544   YAAHK  548



>ref|XP_005091065.1| PREDICTED: cryptochrome-1-like [Aplysia californica]
Length=526

 Score =   509 bits (1311),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 332/493 (67%), Gaps = 18/493 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL  A   +++ +P+FV+DP +      A SP     G NR RFL
Sbjct  6     AIHWFRKGLRLHDNPALLKACEQASELYPIFVLDPWF------ASSP-QCHVGCNRWRFL  58

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD SL +L  RL V+RG P   + +  ++WSI+KL +E DTEPY    DAKV+ 
Sbjct  59    LQALQDLDQSLQSLNLRLFVIRGQPEVEIEKLCQQWSITKLTYEADTEPYAVQRDAKVEA  118

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSF---LKLAGIPSWAssplstsls  807
                  G+E    VSHTLFD    +  NGG  PLTYQ F   L   G P+ A    + +  
Sbjct  119   RMEALGVEVIKCVSHTLFDVNLTVKNNGGCAPLTYQKFQSVLSKMGTPAKALLSPTLTDL  178

Query  808   slppIGNLGSL-QVSAVPTLEELGYV--DCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                      S  Q   VPTLEELG    DC       F GGE+EAL R+   +    W+ 
Sbjct  179   EGCKTPVSSSHDQYYGVPTLEELGKSSSDCGP---LLFPGGETEALDRMERHLKKINWIC  235

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPK +P++ L P+TTVLSPYLKFGCLS R FY  +Q+V  S K+H+ PPVSL GQLL
Sbjct  236   NFEKPKTSPNS-LSPSTTVLSPYLKFGCLSPRLFYHRLQQVY-SGKKHSQPPVSLHGQLL  293

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYTV   TP+FDRM+GN +C+QIPW    E L AW ++RTG+P+IDA+M QLR  G
Sbjct  294   WREFFYTVGAVTPNFDRMKGNPVCRQIPWGSKPEHLEAWTEARTGYPFIDAVMTQLRLEG  353

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW++N GNWMWLS S+FF+QY R
Sbjct  354   WIHHLARHAVACFLTRGDLWVSWEQGMKVFEELLLDADWSLNAGNWMWLSASAFFHQYFR  413

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSP+ FGKK DP+G+Y+R +LPVLK  P +YI+EPW AP S+Q+ A CI+G DYP+P+V
Sbjct  414   VYSPVAFGKKTDPNGDYLRKYLPVLKKFPAKYIFEPWLAPSSVQQAAGCIVGKDYPRPIV  473

Query  1699  SHDSASKECRQRL  1737
              HD A +E  +++
Sbjct  474   DHDRARQENIKKM  486



>ref|XP_005155462.1| PREDICTED: cryptochrome 5 isoform X1 [Danio rerio]
Length=519

 Score =   508 bits (1309),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 255/495 (52%), Positives = 332/495 (67%), Gaps = 16/495 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL  A       +PLF++DP +         P +TR G+NR RFL
Sbjct  5     TIHWFRKGLRLHDNPALIAALKDCRHIYPLFLLDPWF---------PKNTRIGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             +E L DLDSSL  L SRL V+RG P++VL +  K+W I++L FE DTEPY Q+ D +V  
Sbjct  56    IEALKDLDSSLKKLNSRLFVVRGSPTEVLPKLFKQWKITRLTFEVDTEPYSQSRDKEVMK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplstsls  807
              A   G+E    +SHTL++   II +N G  P+TY   QS +K  G P       +    
Sbjct  116   LAKEYGVEVTPKISHTLYNIDRIIDENNGKTPMTYIRLQSVVKAMGHPKKPIPAPTNEDM  175

Query  808   slppIG-NLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
                    +    +   +PTLE+LG +D S      F GGE EALRRL E +    WV  F
Sbjct  176   RGVSTPLSDDHEEKFGIPTLEDLG-LDTSSLGPHLFPGGEQEALRRLDEHMERTNWVCKF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             EKPK +P++ + P+TTVLSPY++FGCLS+R F+  + +V R  K H+ PPVSL GQLLWR
Sbjct  235   EKPKTSPNSLI-PSTTVLSPYVRFGCLSARTFWWRLADVYRG-KTHSDPPVSLHGQLLWR  292

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A G P+F++M GN  C Q+ W  + E LAAWR++RTGFP+IDAIM QLR+ GW+
Sbjct  293   EFFYTTAVGIPNFNKMEGNSACVQVDWDNNPEHLAAWREARTGFPFIDAIMTQLRQEGWI  352

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL+I WE+G+ VFE LL+DSDW++N GNW WLS S+FF+QY R+Y
Sbjct  353   HHLARHAVACFLTRGDLWISWEEGQKVFEELLLDSDWSLNAGNWQWLSASTFFHQYFRVY  412

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
             SPI FGKK D  G+YI+ +LPVLK    EYIYEPW AP S+Q +A CI+G DYP+P+V H
Sbjct  413   SPIAFGKKTDKHGDYIKKYLPVLKKFSTEYIYEPWKAPRSVQERAGCIVGKDYPRPIVDH  472

Query  1705  DSASKECRQRLGEAY  1749
             +   K+   R+  AY
Sbjct  473   EVVHKKNILRMKAAY  487



>ref|XP_004067451.1| PREDICTED: cryptochrome-1-like [Oryzias latipes]
Length=521

 Score =   508 bits (1309),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 247/493 (50%), Positives = 331/493 (67%), Gaps = 15/493 (3%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             + WFRKGLR+HDNPAL  A     + +PLF++DP+  +            AG+NR+RFL+
Sbjct  6     IHWFRKGLRLHDNPALMAALRDCKELYPLFILDPYLYD---------QNLAGINRLRFLI  56

Query  460   ETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNY  639
              +L DLD SL  L SRL V+RG P +VL +   +W+++KL +EYDTEPY ++ D  V   
Sbjct  57    SSLQDLDCSLRKLNSRLFVVRGKPEEVLPKLFTKWNVTKLTYEYDTEPYSRSRDKNVTML  116

Query  640   ASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplstslss  810
             A    I+    +SHTL+D   II +N G PPLTY   +  +K  G P       +     
Sbjct  117   AEEQRIQVIYKISHTLYDIDRIIEENNGKPPLTYNRLRDIVKALGSPKKPIPAPTVEDMK  176

Query  811   lppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFEK  990
                  +        +P+LEELG +D S      F GGE EALRRL   +    WV  FEK
Sbjct  177   NIAPFSEKHKPEYGIPSLEELG-LDTSSLAEEIFPGGEQEALRRLDTYMQRPGWVCSFEK  235

Query  991   PKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRDF  1170
             P  +P++ L P+TTVLSPY+ FGCLS+R F+  + EV +  K+H+ PPVSL GQLLWR+F
Sbjct  236   PNTSPNS-LSPSTTVLSPYVTFGCLSARTFWWRLAEVYQG-KKHSDPPVSLHGQLLWREF  293

Query  1171  FYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMHH  1350
             FYT + G P+F++M GN  C Q+ W E+ E LAAWR++RTGFP+IDAIM QLR+ GW+HH
Sbjct  294   FYTASVGIPNFNKMTGNPACTQVDWDENQEYLAAWREARTGFPFIDAIMTQLRQEGWIHH  353

Query  1351  LARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYSP  1530
             LARH+VACFLTRGDL+I WE+G+ VFE+LL+D DWA+N GNW WLS S+FF+Q+ R+YSP
Sbjct  354   LARHAVACFLTRGDLWISWEEGQKVFEKLLLDGDWALNAGNWQWLSASTFFHQFFRVYSP  413

Query  1531  ITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHDS  1710
             + FGKK D +G+YI+ +LP+LK  P +YIYEPW AP S+Q+ A CI+G DYPKP++ H+ 
Sbjct  414   VAFGKKTDKNGDYIKKYLPILKKFPPQYIYEPWKAPRSVQQAAGCIVGKDYPKPIIEHEV  473

Query  1711  ASKECRQRLGEAY  1749
              SK+  QR+ +AY
Sbjct  474   ISKKNIQRMKQAY  486



>ref|XP_001747506.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ87586.1| predicted protein [Monosiga brevicollis MX1]
Length=486

 Score =   507 bits (1305),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 248/504 (49%), Positives = 318/504 (63%), Gaps = 42/504 (8%)
 Frame = +1

Query  259   MASESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGL  438
             M+S S SL WFRKG R+HDNPAL  A   +T+ +P+FVIDPH+ +P+           G+
Sbjct  1     MSSSSISLHWFRKGQRLHDNPALWRALRGATQVYPVFVIDPHFAKPE---------NVGV  51

Query  439   NRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQAL  618
              R  FLLE+L DLD  L  LGSRL VLRG P + L +  KEW +++L +E DTEPY +  
Sbjct  52    LRYNFLLESLKDLDEQLRGLGSRLYVLRGKPEEQLPKKFKEWKVTRLTYELDTEPYARVR  111

Query  619   DAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplst  798
             DA + + A    +E      H L DP   + K GG                         
Sbjct  112   DAAINDLAKKHNVEVIAEAGHMLHDPESYLKKCGGA------------------------  147

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                           +   VPTL+E+GY      +   F GGE EAL+RL   I  K W+A
Sbjct  148   --------SKDRQDKSYDVPTLKEMGYSPIKAPQMVLFPGGEREALKRLEHFIKKKNWIA  199

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FEKPK NP+A L P TT LSPY+K GCLS R F+  VQ+V    K H++PP SL GQLL
Sbjct  200   TFEKPKTNPAA-LDPDTTGLSPYMKMGCLSVRKFWYDVQKVYDEKKDHSTPPESLHGQLL  258

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             +R+ F+   +   +FD+M+GNRIC+QI W  S++ L AW +S+TG+PWIDA M QLR  G
Sbjct  259   FRELFHLCGYAVKNFDKMKGNRICRQIDWDYSEKFLDAWENSKTGYPWIDACMAQLRHEG  318

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             WMHHLARH+VACFLTRGDL+  WE G  +FE+ L+D+DW +NN NWMWLSCSSFFYQY R
Sbjct  319   WMHHLARHAVACFLTRGDLYQSWEHGARIFEKHLVDADWHLNNANWMWLSCSSFFYQYFR  378

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
             +YSPI FG+KYD +G +IR +LPVLKDMPK+YIYEPW AP  +Q+KAKCIIG DYP+P+V
Sbjct  379   VYSPIGFGQKYDKEGAFIRKYLPVLKDMPKKYIYEPWKAPKEVQQKAKCIIGKDYPEPIV  438

Query  1699  SHDSASKECRQRLGEAYELNKKLG  1770
              H   S+  + R+   Y+ +K+ G
Sbjct  439   DHSDVSETNKDRMKACYDAHKRGG  462



>ref|XP_008276779.1| PREDICTED: cryptochrome-1-like [Stegastes partitus]
Length=522

 Score =   505 bits (1301),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/507 (50%), Positives = 339/507 (67%), Gaps = 33/507 (7%)
 Frame = +1

Query  265   SESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             +++C + WFRKGLR+HDNPAL  A     + +P+F++DPH            +T  G+NR
Sbjct  2     AQTC-IHWFRKGLRLHDNPALMAALRDCKELYPVFILDPHLH---------NNTCVGINR  51

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDA  624
              RFL+  L DLD SL  L SRL V+RG P  VL +  ++W+++KL +EYDTEPY  + D 
Sbjct  52    WRFLIGALKDLDCSLRKLNSRLFVMRGRPEDVLPKLFQKWNVTKLTYEYDTEPYSLSRDK  111

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAsspls  795
             KV   A   G+E    +SHTL+D   II +N G  PLTY   Q+ +K  G P        
Sbjct  112   KVTELAKEHGVEVIYKISHTLYDIERIIEENNGKTPLTYNRLQAIVKGLGSPK-------  164

Query  796   tslsslppIGNLGSLQVS---------AVPTLEELGYVDCSEDERTSFRGGESEALRRLR  948
                   P + N+  ++            +P LEELG+   S  E   F GGE EALRRL 
Sbjct  165   -RPIPAPAMENMKDVKTPCSEKHEEKYGIPALEELGHDTTSLGEDL-FPGGEQEALRRLD  222

Query  949   ESIANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTS  1128
             E +    WV  FEKP+ +P++ L P+TTVLSPY+ FGCLS R F+  + +V +  K+H++
Sbjct  223   EHMKRTGWVCNFEKPQTSPNS-LSPSTTVLSPYVTFGCLSVRTFWWRLTDVYQG-KKHSA  280

Query  1129  PPVSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWID  1308
             PPVSL GQLLWR+FFYT + G P+F++M+GN +C Q+ W  + E LAAWR++RTGFP+ID
Sbjct  281   PPVSLHGQLLWREFFYTASVGIPNFNKMKGNHVCTQVDWDTNPEHLAAWREARTGFPFID  340

Query  1309  AIMVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLS  1488
             AIM QLR+ GW+HHLARH+VACFLTRGDL+I+WE+G+ VFE LL+D DWA+N GNW WLS
Sbjct  341   AIMTQLRQEGWIHHLARHAVACFLTRGDLWINWEEGQKVFEELLLDGDWALNAGNWQWLS  400

Query  1489  CSSFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCI  1668
              S+FF+Q+ R+YSP+ FGKK D +G+YI+ +LP+LK  P +YIYEPW AP SIQ+ A CI
Sbjct  401   ASTFFHQFFRVYSPVAFGKKTDKNGDYIKKYLPLLKKFPAQYIYEPWKAPRSIQQAAGCI  460

Query  1669  IGIDYPKPVVSHDSASKECRQRLGEAY  1749
             +G DYP+P+V H+  SK+  QR+  AY
Sbjct  461   VGKDYPRPIVEHEVISKKNIQRMKMAY  487



>ref|XP_004539639.1| PREDICTED: cryptochrome-1-like [Maylandia zebra]
Length=518

 Score =   505 bits (1300),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/494 (51%), Positives = 329/494 (67%), Gaps = 16/494 (3%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             + WFRKGLR+HDNPAL  A     + +P+F++DP+            +   G+NR RFL+
Sbjct  6     IHWFRKGLRLHDNPALMAALKDCKQLYPVFILDPYLH---------NNACVGINRWRFLI  56

Query  460   ETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNY  639
               L DLD SL  L SRL V+RG P  VL +   +W +++L +EYDTEPY    D+KV + 
Sbjct  57    GALKDLDGSLRKLNSRLFVVRGKPEDVLPKLFTKWKVTRLTYEYDTEPYSLQRDSKVTSL  116

Query  640   ASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplstslss  810
             A   G+E    VSHTL++   II +N G PPLTY   Q+  K  G P       +     
Sbjct  117   AKERGVEVIYKVSHTLYNIERIIEENNGKPPLTYTKLQAIAKTIGPPKRPIPAPTMDDMK  176

Query  811   lppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
                  +  + +    +PTLEELG +D +      F GGE EALRRL E +   +WV  FE
Sbjct  177   DVKTPSSENHEKEYGIPTLEELG-LDTAPLGEDLFPGGEQEALRRLDEHMKRTKWVCTFE  235

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KP+ +P++ L P+TTVLSPY+ FGCLS R F+  + EV R  K H+ PPVSL GQLLWR+
Sbjct  236   KPQTSPNS-LSPSTTVLSPYVTFGCLSVRTFWWRLTEVYRGNK-HSDPPVSLHGQLLWRE  293

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYT + G PSF++M GN +C Q+ W  + + LAAWR++RTG+P+IDAIM QLR+ GW+H
Sbjct  294   FFYTASLGIPSFNKMEGNSVCTQVDWDTNPDYLAAWREARTGYPFIDAIMTQLRQEGWIH  353

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH+VACFLTRGDL+I WE+G+ VFE+LL+D DWA+N GNW WLS S+FF+QY R+YS
Sbjct  354   HLARHAVACFLTRGDLWISWEEGQKVFEQLLLDGDWALNAGNWQWLSASTFFHQYFRVYS  413

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             P+ FGKK D +G+YIR +LP+LK  P EYIYEPW AP SIQ+ A CI+G DYP P+V H+
Sbjct  414   PVAFGKKTDKNGDYIRKYLPLLKKFPAEYIYEPWKAPRSIQQAAGCIVGKDYPHPIVQHE  473

Query  1708  SASKECRQRLGEAY  1749
               SK+  QR+  AY
Sbjct  474   VISKKNIQRMKLAY  487



>ref|XP_005934599.1| PREDICTED: cryptochrome-1-like isoform X1 [Haplochromis burtoni]
 ref|XP_005934600.1| PREDICTED: cryptochrome-1-like isoform X2 [Haplochromis burtoni]
Length=519

 Score =   504 bits (1299),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/494 (51%), Positives = 329/494 (67%), Gaps = 16/494 (3%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             + WFRKGLR+HDNPAL  A     + +P+F++DP+            +   G+NR RFL+
Sbjct  6     IHWFRKGLRLHDNPALMAALKDCKQLYPVFILDPYLH---------NNACVGINRWRFLI  56

Query  460   ETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNY  639
               L DLD SL  L SRL V+RG P  VL +   +W +++L +EYDTEPY    D+KV + 
Sbjct  57    GALKDLDGSLRKLNSRLFVVRGKPEDVLPKLFTKWKVTRLTYEYDTEPYSLQRDSKVTSL  116

Query  640   ASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplstslss  810
             A   G+E    VSHTL++   II +N G PPLTY   Q+  K  G P       +     
Sbjct  117   AKERGVEVIYKVSHTLYNIERIIEENNGKPPLTYTKLQAIAKTIGPPKRPIPAPTMDDMK  176

Query  811   lppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
                  +  + +    +PTLEELG +D +      F GGE EALRRL E +   +WV  FE
Sbjct  177   DVKTPSSENHEKEYGIPTLEELG-LDTAPLGEDLFPGGEQEALRRLDEHMKRTKWVCSFE  235

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KP+ +P++ L P+TTVLSPY+ FGCLS R F+  + EV R  K H+ PPVSL GQLLWR+
Sbjct  236   KPQTSPNS-LSPSTTVLSPYVTFGCLSVRTFWWRLTEVYRGNK-HSDPPVSLHGQLLWRE  293

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYT + G PSF++M GN +C Q+ W  + + LAAWR++RTG+P+IDAIM QLR+ GW+H
Sbjct  294   FFYTASLGIPSFNKMEGNSVCTQVDWDTNPDYLAAWREARTGYPFIDAIMTQLRQEGWIH  353

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH+VACFLTRGDL+I WE+G+ VFE+LL+D DWA+N GNW WLS S+FF+QY R+YS
Sbjct  354   HLARHAVACFLTRGDLWISWEEGQKVFEQLLLDGDWALNAGNWQWLSASTFFHQYFRVYS  413

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             P+ FGKK D +G+YIR +LP+LK  P EYIYEPW AP SIQ+ A CI+G DYP P+V H+
Sbjct  414   PVAFGKKTDKNGDYIRKYLPLLKKFPAEYIYEPWKAPRSIQQAAGCIVGKDYPHPIVQHE  473

Query  1708  SASKECRQRLGEAY  1749
               SK+  QR+  AY
Sbjct  474   VISKKNIQRMKLAY  487



>ref|XP_003437646.1| PREDICTED: cryptochrome-1-like [Oreochromis niloticus]
Length=522

 Score =   504 bits (1299),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 332/499 (67%), Gaps = 17/499 (3%)
 Frame = +1

Query  265   SESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             + +C + WFRKGLR+HDNPAL  A     + +P+F++DP+                G+NR
Sbjct  2     AHTC-IHWFRKGLRLHDNPALMAALKDCKQLYPVFILDPYLQ---------NKACVGINR  51

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDA  624
              RFL+  L DLD SL  L SRL V+RG P  VL +   +W +++L +EYDTEPY    D+
Sbjct  52    WRFLIGALKDLDGSLRKLNSRLFVVRGKPEDVLPKLFTKWKVTRLAYEYDTEPYSLQRDS  111

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAsspls  795
             KV + A   G+E    VSHTL++   II +N G PPLTY   Q+ +K  G P       +
Sbjct  112   KVTSLAKEHGVEVIYKVSHTLYNIDRIIEENNGKPPLTYTKLQAIVKTIGPPKRPIPAPT  171

Query  796   tslsslppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                       +  + +    +PTLEELG +D +      F GGE EALRRL E +   +W
Sbjct  172   MDDMKDVKTPSSENHEKEYGIPTLEELG-LDTAPLGEDLFPGGEQEALRRLDEHMKRTKW  230

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             V  FEKP+ +P++ L P+TTVLSPY+ FGCLS R F+  + EV R  K H+ PPVSL GQ
Sbjct  231   VCSFEKPQTSPNS-LSPSTTVLSPYVTFGCLSVRTFWWRLTEVYRGNK-HSDPPVSLHGQ  288

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWR+FFYT + G P+F++M GN +C Q+ W  + + LAAWR++RTG+P+IDAIM QLR+
Sbjct  289   LLWREFFYTASLGIPNFNKMEGNSVCTQVDWDTNPDYLAAWREARTGYPFIDAIMTQLRQ  348

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GW+HHLARH+VACFLTRGDL+I WE+G+ VFE+LL+D DWA+N GNW WLS S+FF+QY
Sbjct  349   EGWIHHLARHAVACFLTRGDLWISWEEGQKVFEQLLLDGDWALNAGNWQWLSASTFFHQY  408

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
              R+YSP+ FGKK D +G+YIR +LP+LK  P EYIYEPW AP SIQ+ A CI+G DYP P
Sbjct  409   FRVYSPVAFGKKTDKNGDYIRKYLPLLKKFPAEYIYEPWKAPRSIQQAAGCIVGKDYPHP  468

Query  1693  VVSHDSASKECRQRLGEAY  1749
             +V H+  SK+  QR+  AY
Sbjct  469   IVQHEVISKKNIQRMKLAY  487



>ref|XP_001636303.1| predicted protein [Nematostella vectensis]
 gb|EDO44240.1| predicted protein [Nematostella vectensis]
Length=533

 Score =   505 bits (1300),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 252/507 (50%), Positives = 333/507 (66%), Gaps = 20/507 (4%)
 Frame = +1

Query  259   MASESC--SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRA  432
             MAS+    ++ WFR GLR+HDNPAL+ A   S    PL+V+DP  ++         +   
Sbjct  1     MASKKTHQTVHWFRNGLRLHDNPALKEAFETSQTVRPLYVLDPDVLK---------NGNI  51

Query  433   GLNRIRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQ  612
             G+ R RF+LE+L DLD++L  L SRL V+RG PS+V  +  KEW ISKL FE DT    +
Sbjct  52    GVVRWRFILESLADLDNNLKKLNSRLFVVRGRPSEVFPKLFKEWKISKLTFEVDTTEPAR  111

Query  613   ALDAKVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLA------GIPS  774
               DA+V   A+  G++    VSHTL+D   I++KNGGT PLTY+ F  +         P 
Sbjct  112   KQDAEVLKIANKLGVDIEQRVSHTLYDLDRIVNKNGGTAPLTYKKFQSIVSSLGPPAAPL  171

Query  775   WAssplstslsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRES  954
              A      +  + P   N    ++  VPTLEE+G     E     + GGE+EAL RL   
Sbjct  172   PAIDKKMVAGCNTPTTANHD--KIYGVPTLEEIGQEVPEESREVLYPGGETEALERLEVY  229

Query  955   IANKEWVAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPP  1134
             +  ++WV  FEKP   P++ + P+TTVLSPY+ +GCLS+R FY  + E+    K+H+ PP
Sbjct  230   MKKEDWVCKFEKPNTAPNS-IEPSTTVLSPYMTYGCLSARLFYTRLAEIYAKKKKHSQPP  288

Query  1135  VSLLGQLLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAI  1314
             VSL GQLLWR+FF T A+ TP+F++M GN +C Q+PW ++DE LAAW ++RTG+P+IDAI
Sbjct  289   VSLHGQLLWREFFTTAAYKTPNFNKMVGNSLCLQVPWDQNDEYLAAWAEARTGYPYIDAI  348

Query  1315  MVQLRKWGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCS  1494
             M QLR+ GW+HHLARHSVACFLTRGDL+I WE+G  VFERLLID DW +N GNWMWLS S
Sbjct  349   MTQLRREGWVHHLARHSVACFLTRGDLWISWEEGLKVFERLLIDHDWNLNAGNWMWLSAS  408

Query  1495  SFFYQYHRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIG  1674
             SFF+ Y R+YSP+ FGKK DP+G+YIR ++P L   P +YIYEPW APL++Q KA C+IG
Sbjct  409   SFFHAYFRVYSPVAFGKKTDPNGDYIRKYIPKLSRYPPKYIYEPWNAPLAVQEKAGCVIG  468

Query  1675  IDYPKPVVSHDSASKECRQRLGEAYEL  1755
              DYP P+V H+        R+ EA  L
Sbjct  469   RDYPCPIVDHNKVVTRNMSRMKEARSL  495



>ref|NP_001017311.2| cryptochrome 1 (photolyase-like) [Xenopus (Silurana) tropicalis]
 gb|AAI61038.1| Unknown (protein for MGC:184712) [Xenopus (Silurana) tropicalis]
Length=618

 Score =   508 bits (1308),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWKITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITAEVM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P + +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPVLDDHD--EKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  +TT LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASTTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LP+LK  P +YIY+PW AP ++Q+ AKCIIG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPILKGFPPKYIYDPWNAPETVQKVAKCIIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>pdb|4CT0|A Chain A, Crystal Structure Of Mouse Cryptochrome1 In Complex 
With Period2
Length=507

 Score =   503 bits (1296),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 246/498 (49%), Positives = 333/498 (67%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPADTITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCMTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYE  1752
             +H  AS+   +R+ + Y+
Sbjct  472   NHAEASRLNIERMKQIYQ  489



>ref|XP_006779921.1| PREDICTED: cryptochrome-1-like isoform X1 [Neolamprologus brichardi]
 ref|XP_006779922.1| PREDICTED: cryptochrome-1-like isoform X2 [Neolamprologus brichardi]
 ref|XP_006779923.1| PREDICTED: cryptochrome-1-like isoform X3 [Neolamprologus brichardi]
Length=519

 Score =   504 bits (1297),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 331/499 (66%), Gaps = 17/499 (3%)
 Frame = +1

Query  265   SESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             + +C + WFRKGLR+HDNPAL  A     + +P+F++DP+            +   G+NR
Sbjct  2     AHTC-IHWFRKGLRLHDNPALMAAIKDCKQLYPVFILDPYLH---------NNACVGINR  51

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDA  624
              RFL+  L DLD SL  L SRL V+RG P  VL +   +W +++L +EYDTEPY    D+
Sbjct  52    WRFLIGALKDLDGSLRKLNSRLFVVRGKPEDVLPKLFTKWKVTRLTYEYDTEPYSLQRDS  111

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAsspls  795
             KV + A   G+E    VSHTL++   II +N G PPLTY   Q+  K  G P       +
Sbjct  112   KVTSLAKERGVEVIYKVSHTLYNIDRIIEENNGKPPLTYTKLQAIAKTIGPPKRPIPAPT  171

Query  796   tslsslppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                       +  + +    +PTLEELG +D +      F GGE EALRRL E +   +W
Sbjct  172   MDDMKDVKTSSSENHEKEYGIPTLEELG-LDTAPLGEDLFPGGEREALRRLDEHMKRTKW  230

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             V  FEKP+ +P++ L P+TTVLSPY+ FGCLS R F+  + EV R  K H+ PPVSL GQ
Sbjct  231   VCSFEKPQTSPNS-LSPSTTVLSPYVTFGCLSVRTFWWRLTEVYRGNK-HSDPPVSLHGQ  288

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWR+FFYT + G P+F++M GN +C Q+ W    + LAAWR++RTG+P+IDAIM QLR+
Sbjct  289   LLWREFFYTASLGIPNFNKMEGNSVCTQVDWDTKPDYLAAWREARTGYPFIDAIMTQLRQ  348

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GW+HHLARH+VACFLTRGDL+I WE+G+ VFE+LL+D DWA+N GNW WLS S+FF+QY
Sbjct  349   EGWIHHLARHAVACFLTRGDLWISWEEGQKVFEQLLLDGDWALNAGNWQWLSASTFFHQY  408

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
              R+YSP+ FGKK D +G+YIR +LP+LK  P EYIYEPW AP SIQ+ A CI+G DYP P
Sbjct  409   FRVYSPVAFGKKTDKNGDYIRKYLPLLKKFPAEYIYEPWKAPRSIQQAAGCIVGKDYPHP  468

Query  1693  VVSHDSASKECRQRLGEAY  1749
             +V H+  SK+  QR+  AY
Sbjct  469   IVQHEVISKKNIQRMKLAY  487



>gb|EDM17107.1| cryptochrome 1 (photolyase-like) [Rattus norvegicus]
Length=555

 Score =   505 bits (1300),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPADTITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCTTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>dbj|BAI82611.1| cryptochrome 1 [Xenopus (Silurana) tropicalis]
Length=605

 Score =   507 bits (1305),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 249/503 (50%), Positives = 335/503 (67%), Gaps = 19/503 (4%)
 Frame = +1

Query  286   WFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLLET  465
             WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFLL+ 
Sbjct  1     WFRKGLRLHDNPALRECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFLLQC  51

Query  466   LVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNYAS  645
             L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K  AS
Sbjct  52    LEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWKITKLSIEYDSEPFGKERDAAIKKLAS  111

Query  646   VAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplstsls  807
              AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +       
Sbjct  112   EAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITAEVMEKC  171

Query  808   slppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
             + P + +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA FE
Sbjct  172   TTPVLDDHD--EKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWVANFE  228

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             +P+ N ++ L  +TT LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLLWR+
Sbjct  229   RPRMNANSLL-ASTTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWRE  287

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ GW+H
Sbjct  288   FFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIH  347

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+   Y 
Sbjct  348   HLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFHCYC  407

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             P+ FG++ DP+G+YIR +LP+LK  P +YIY+PW AP ++Q+ AKCIIG++YPKP+V+H 
Sbjct  408   PVGFGRRTDPNGDYIRRYLPILKGFPPKYIYDPWNAPETVQKVAKCIIGVNYPKPMVNHA  467

Query  1708  SASKECRQRLGEAYELNKKLGGM  1776
              AS+   +R+ + Y+   +  G+
Sbjct  468   EASRLNIERMKQIYQQLSRYRGL  490



>ref|XP_005039907.1| PREDICTED: cryptochrome-1-like isoform X4 [Ficedula albicollis]
Length=589

 Score =   506 bits (1303),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>gb|AAK94665.1| cryptochrome 1 [Xenopus laevis]
Length=616

 Score =   507 bits (1305),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWKITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SKMDPLEIPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  +TT LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASTTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPCFDKMDGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FGK+ DP+G+YIR +LP+LK  P +YIY+PW AP ++Q+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGKRTDPNGDYIRRYLPILKGFPPKYIYDPWNAPETVQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_001081129.1| cryptochrome circadian clock 1 [Xenopus laevis]
 gb|AAH72120.1| Cry1-A protein [Xenopus laevis]
Length=616

 Score =   507 bits (1305),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWKITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SKMDPLEIPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  +TT LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASTTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMDGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FGK+ DP+G+YIR +LP+LK  P +YIY+PW AP ++Q+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGKRTDPNGDYIRRYLPILKGFPPKYIYDPWNAPETVQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007614122.1| PREDICTED: cryptochrome-1 [Cricetulus griseus]
 gb|ERE92127.1| cryptochrome-1-like protein [Cricetulus griseus]
Length=587

 Score =   506 bits (1303),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPAETITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCMTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005989314.1| PREDICTED: cryptochrome-1 [Latimeria chalumnae]
Length=653

 Score =   508 bits (1308),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 252/507 (50%), Positives = 338/507 (67%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+ A         ++++DP +          GS+  G+NR RFL
Sbjct  5     AIHWFRKGLRLHDNPALREAIQGGDCIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+IS+L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNISRLSFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    ++HTL+D   II  NGG PPLTY+ F  L  I       L     +  
Sbjct  116   LASEAGVEVIVRITHTLYDLDRIIELNGGQPPLTYKRFQTL--ISRMEPLDLPVETINSE  173

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +GN  S  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  174   VMGNC-STPVSDDHDEKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + +TGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGKTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  +Q+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGVQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V H  AS+   +R+ + Y+   +  G+
Sbjct  471   VHHAEASRLNIERMKQIYQQLSRYRGL  497



>gb|ABH03083.1| cryptochrome 1b [Sylvia borin]
Length=587

 Score =   505 bits (1301),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005039906.1| PREDICTED: cryptochrome-1-like isoform X3 [Ficedula albicollis]
Length=587

 Score =   505 bits (1301),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005733435.1| PREDICTED: cryptochrome-1-like [Pundamilia nyererei]
Length=519

 Score =   503 bits (1294),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 331/499 (66%), Gaps = 17/499 (3%)
 Frame = +1

Query  265   SESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             + +C + WF KGLR+HDNPAL  A     + +P+F++DP+            +   G+NR
Sbjct  2     THTC-IHWFSKGLRLHDNPALMAALKDCKQLYPVFILDPYLH---------NNACVGINR  51

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDA  624
              RFL+  L DLD SL  L SRL V+RG P  VL +   +W +++L +EYDTEPY    D+
Sbjct  52    WRFLIGALKDLDGSLRKLNSRLFVVRGKPEDVLPKLFTKWKVTRLTYEYDTEPYSLQRDS  111

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAsspls  795
             KV + A   G+E    VSHTL++   II +N G PPLTY   Q+  K  G P       +
Sbjct  112   KVTSLAKERGVEVIYKVSHTLYNIERIIEENNGKPPLTYTKLQAIAKTIGPPKRPIPAPT  171

Query  796   tslsslppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                       +  + +    +PTLEELG +D +      F GGE EALRRL E +   +W
Sbjct  172   MDDMKDVKTPSSENHEKEYGIPTLEELG-LDTAPLGEDLFPGGEQEALRRLDEHMKRTKW  230

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             V  FEKP+ +P++ L P+TTVLSPY+ FGCLS R F+  + EV R  K H+ PPVSL GQ
Sbjct  231   VCTFEKPQTSPNS-LSPSTTVLSPYVTFGCLSVRTFWWRLTEVYRGNK-HSDPPVSLHGQ  288

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWR+FFYT + G PSF++M GN +C Q+ W  + + LAAWR++RTG+P+IDAIM QLR+
Sbjct  289   LLWREFFYTASLGIPSFNKMEGNSVCTQVDWDTNPDYLAAWREARTGYPFIDAIMTQLRQ  348

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GW+HHLARH+VACFLTRGDL+I WE+G+ VFE+LL+D DWA+N GNW WLS S+FF+QY
Sbjct  349   EGWIHHLARHAVACFLTRGDLWISWEEGQKVFEQLLLDGDWALNAGNWQWLSASTFFHQY  408

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
              R+YSP+ FGKK D +G+YIR +LP+LK  P EYIYEPW AP SIQ+ A CI+G DYP P
Sbjct  409   FRVYSPVAFGKKTDKNGDYIRKYLPLLKKFPAEYIYEPWKAPRSIQQAAGCIVGKDYPHP  468

Query  1693  VVSHDSASKECRQRLGEAY  1749
             +V H+  SK+  QR+  AY
Sbjct  469   IVQHEVISKKNIQRMKLAY  487



>ref|XP_005150476.1| PREDICTED: cryptochrome-1-like [Melopsittacus undulatus]
Length=621

 Score =   506 bits (1304),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>sp|Q6ZZY0.1|CRY1_SYLBO RecName: Full=Cryptochrome-1 [Sylvia borin]
 emb|CAG14931.1| cryptochrome 1 [Sylvia borin]
Length=620

 Score =   506 bits (1304),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005358310.1| PREDICTED: cryptochrome-1 [Microtus ochrogaster]
Length=580

 Score =   505 bits (1300),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEWSI+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWSITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPAETITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGTCVTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFL+RGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLSRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_989576.1| cryptochrome-1 [Gallus gallus]
 sp|Q8QG61.1|CRY1_CHICK RecName: Full=Cryptochrome-1 [Gallus gallus]
 gb|AAK61385.1| cryptochrome 1 [Gallus gallus]
Length=621

 Score =   506 bits (1304),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIRGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEWSI+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWSIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMQKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP S+Q+ AKC+IG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESVQKAAKCVIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005491227.1| PREDICTED: cryptochrome-1-like [Zonotrichia albicollis]
Length=620

 Score =   506 bits (1303),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006987024.1| PREDICTED: cryptochrome-1 [Peromyscus maniculatus bairdii]
Length=587

 Score =   505 bits (1300),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPAETITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCMTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005527592.1| PREDICTED: cryptochrome-1-like [Pseudopodoces humilis]
Length=620

 Score =   506 bits (1303),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_942045.2| cryptochrome-1 [Rattus norvegicus]
 ref|XP_008763447.1| PREDICTED: cryptochrome-1 isoform X1 [Rattus norvegicus]
 sp|Q32Q86.1|CRY1_RAT RecName: Full=Cryptochrome-1 [Rattus norvegicus]
 gb|AAI07678.1| Cryptochrome 1 (photolyase-like) [Rattus norvegicus]
Length=588

 Score =   505 bits (1300),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPADTITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCTTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_009555905.1| PREDICTED: cryptochrome-1, partial [Cuculus canorus]
 gb|KFO73699.1| Cryptochrome-1, partial [Cuculus canorus]
Length=617

 Score =   506 bits (1302),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  3     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  53

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  54    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  113

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  114   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  170

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  171   EVMEKCATPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  229

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  230   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  288

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  289   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  348

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  349   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  408

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  409   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  468

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  469   VNHAEASRLNIERMKQIYQQLSRYRGL  495



>ref|XP_005039904.1| PREDICTED: cryptochrome-1-like isoform X1 [Ficedula albicollis]
 ref|XP_005039905.1| PREDICTED: cryptochrome-1-like isoform X2 [Ficedula albicollis]
Length=620

 Score =   506 bits (1303),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMKKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005861714.1| PREDICTED: cryptochrome-1-like isoform X2 [Myotis brandtii]
 ref|XP_005861715.1| PREDICTED: cryptochrome-1-like isoform X3 [Myotis brandtii]
 ref|XP_005861716.1| PREDICTED: cryptochrome-1-like isoform X4 [Myotis brandtii]
Length=587

 Score =   504 bits (1299),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVQISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACF+TRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFVTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006769397.1| PREDICTED: cryptochrome-1 isoform X5 [Myotis davidii]
Length=563

 Score =   504 bits (1297),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVQISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACF+TRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFVTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005237400.1| PREDICTED: cryptochrome-1-like [Falco peregrinus]
Length=620

 Score =   506 bits (1302),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 251/507 (50%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006769393.1| PREDICTED: cryptochrome-1 isoform X1 [Myotis davidii]
 ref|XP_006769394.1| PREDICTED: cryptochrome-1 isoform X2 [Myotis davidii]
 ref|XP_006769395.1| PREDICTED: cryptochrome-1 isoform X3 [Myotis davidii]
 ref|XP_006769396.1| PREDICTED: cryptochrome-1 isoform X4 [Myotis davidii]
Length=587

 Score =   504 bits (1299),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVQISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACF+TRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFVTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005861717.1| PREDICTED: cryptochrome-1-like isoform X5 [Myotis brandtii]
Length=563

 Score =   504 bits (1297),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVQISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACF+TRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFVTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007432429.1| PREDICTED: cryptochrome-1-like isoform X1 [Python bivittatus]
 ref|XP_007432430.1| PREDICTED: cryptochrome-1-like isoform X2 [Python bivittatus]
Length=630

 Score =   506 bits (1303),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 336/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     SVHWFRKGLRLHDNPALREVIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+ISKL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNISKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LATEAGLEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              + +  +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMSKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP  +Q+ AKCIIGI+YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPEGVQKAAKCIIGINYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007432431.1| PREDICTED: cryptochrome-1-like isoform X3 [Python bivittatus]
Length=628

 Score =   506 bits (1303),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 249/507 (49%), Positives = 336/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     SVHWFRKGLRLHDNPALREVIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+ISKL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNISKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LATEAGLEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              + +  +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMSKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP  +Q+ AKCIIGI+YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPEGVQKAAKCIIGINYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_003405361.1| PREDICTED: cryptochrome-1 [Loxodonta africana]
Length=583

 Score =   504 bits (1298),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWDITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  I       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--ISKMEPLEIPVETITSE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCTTPLSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>sp|Q8WP19.1|CRY1_MACFA RecName: Full=Cryptochrome-1 [Macaca fascicularis]
 dbj|BAB72089.1| cryptochrome 1 [Macaca fascicularis]
Length=586

 Score =   504 bits (1298),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VKR++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKRNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>gb|AAQ11980.1| cryptochrome 1 [Rattus norvegicus]
Length=588

 Score =   504 bits (1298),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRWVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPADTITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCTTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>pdb|4K0R|A Chain A, Crystal Structure Of Mouse Cryptochrome 1
Length=617

 Score =   505 bits (1300),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPADTITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCMTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007101410.1| PREDICTED: cryptochrome-1, partial [Physeter catodon]
Length=529

 Score =   502 bits (1292),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007885950.1| PREDICTED: cryptochrome-2 [Callorhinchus milii]
Length=571

 Score =   503 bits (1296),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 332/498 (67%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPALQ A + +     ++++DP +          GS+   +N+ RFL
Sbjct  5     SVHWFRKGLRLHDNPALQAAVSGADTVRSVYILDPWFA---------GSSNVRINKWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD SL  L SRL V+RG P+ V  R  KEW++++L FEYD+EP+ +  D  + N
Sbjct  56    LQCLEDLDISLRKLKSRLFVVRGQPTDVFPRLFKEWNVTRLTFEYDSEPFGKERDVAIVN  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSF------LKLAGIPSWAssplst  798
              A  AG+ET    SHTL+D   II  NG  PPLTY+ F      L+L   P  + +    
Sbjct  116   LARKAGVETIVHTSHTLYDVNRIIEANGNKPPLTYKRFQAIISRLELPKSPVGSVTLEQM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                +     N    +   +P+L+ELG+ + SE    ++ GGE EAL RL + +  K WVA
Sbjct  176   ENCTTDVEANHS--EKYGIPSLDELGF-NTSELGPATWNGGEIEALARLNKHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              +E+PK N  + +  + T LSPYL+FGCLS R FY  +QE+ ++VK+   PP+SL GQLL
Sbjct  233   NYERPKLNADSLVS-SPTGLSPYLRFGCLSCRLFYYRLQELYKTVKKGAIPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FDRM GN IC QIPW ++   L  W D  TGFPWIDAIM QLRK G
Sbjct  292   WREFFYTTATNNPKFDRMEGNPICVQIPWDKNPHALTKWADGLTGFPWIDAIMKQLRKEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+V+CFLTRGDL+I WE+G  VFE LL+D+D++IN G+WMWLSCS+FF Q+  
Sbjct  352   WIHHLARHAVSCFLTRGDLWISWEEGMKVFEELLLDADFSINAGSWMWLSCSAFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FGK+ DP G+YIR +LP+LK+ P +YIYEPW APL++Q+ AKCIIGIDYPKP+V
Sbjct  412   CYCPVGFGKRTDPSGDYIRRYLPLLKEYPTKYIYEPWNAPLAVQKAAKCIIGIDYPKPIV  471

Query  1699  SHDSASKECRQRLGEAYE  1752
             +H  AS+   +R+ + Y+
Sbjct  472   NHAEASRLNIERMKQIYQ  489



>ref|XP_002823736.1| PREDICTED: cryptochrome-1 [Pongo abelii]
Length=586

 Score =   504 bits (1297),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_031797.1| cryptochrome-1 [Mus musculus]
 sp|P97784.1|CRY1_MOUSE RecName: Full=Cryptochrome-1 [Mus musculus]
 gb|AAD39548.1|AF156986_1 cryptochrome 1 [Mus musculus]
 dbj|BAA19175.1| photolyase/blue-light receptor homolog [Mus musculus]
 gb|AAH22174.1| Cryptochrome 1 (photolyase-like) [Mus musculus]
 gb|AAH85499.1| Cryptochrome 1 (photolyase-like) [Mus musculus]
 dbj|BAE36931.1| unnamed protein product [Mus musculus]
 gb|EDL21416.1| cryptochrome 1 (photolyase-like) [Mus musculus]
Length=606

 Score =   504 bits (1298),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  +       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--VSKMEPLEMPADTITSD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              IG   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIGKCMTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>gb|AHW46848.1| cryptochrome-1 [Columba livia]
Length=620

 Score =   504 bits (1299),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 337/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ +  L    S          +  P
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRYQTLI---SRMEPLEMPVETITP  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGVKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007066204.1| PREDICTED: cryptochrome-1-like isoform X2 [Chelonia mydas]
Length=588

 Score =   503 bits (1296),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 334/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADSVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTSPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP SIQ+ AKC+IG+ YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPESIQKAAKCVIGVHYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006092785.1| PREDICTED: cryptochrome-1 [Myotis lucifugus]
Length=587

 Score =   503 bits (1296),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVQISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITLEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACF+TRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFVTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRAFPAKYIYDPWNAPESIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007066205.1| PREDICTED: cryptochrome-1-like isoform X3 [Chelonia mydas]
Length=585

 Score =   503 bits (1296),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 334/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADSVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTSPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP SIQ+ AKC+IG+ YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPESIQKAAKCVIGVHYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008108808.1| PREDICTED: cryptochrome-1 isoform X2 [Anolis carolinensis]
Length=597

 Score =   504 bits (1297),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 247/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALREVIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL++   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYELDKIIELNGGQPPLTYKRFQTLI---SRMEPLEIPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              + +  +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMSKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  +Q+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPDGVQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQMYQQLSRYRGL  497



>ref|XP_007946421.1| PREDICTED: cryptochrome-1 [Orycteropus afer afer]
Length=587

 Score =   503 bits (1296),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWDITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +   T
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVT  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005655590.1| PREDICTED: cryptochrome-1 isoform X3 [Sus scrofa]
Length=544

 Score =   502 bits (1292),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004053891.1| PREDICTED: cryptochrome-1 [Gorilla gorilla gorilla]
Length=583

 Score =   503 bits (1295),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 246/504 (49%), Positives = 337/504 (67%), Gaps = 15/504 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFL----KLAGIPSWAssplstsl  804
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F     K+  + +   +  S  +
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLETPVETITSEVI  175

Query  805   sslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
                    +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA F
Sbjct  176   EKCTTPLSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVANF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             E+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLLWR
Sbjct  235   ERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWR  293

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ GW+
Sbjct  294   EFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWI  353

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+   Y
Sbjct  354   HHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCY  413

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
              P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V+H
Sbjct  414   CPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNH  473

Query  1705  DSASKECRQRLGEAYELNKKLGGM  1776
               AS+   +R+ + Y+   +  G+
Sbjct  474   AEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008703869.1| PREDICTED: cryptochrome-1 isoform X2 [Ursus maritimus]
Length=563

 Score =   502 bits (1293),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_010379691.1| PREDICTED: cryptochrome-1 [Rhinopithecus roxellana]
Length=586

 Score =   503 bits (1295),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_002752992.1| PREDICTED: cryptochrome-1 [Callithrix jacchus]
Length=586

 Score =   503 bits (1295),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005322380.1| PREDICTED: cryptochrome-1 [Ictidomys tridecemlineatus]
Length=587

 Score =   503 bits (1295),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_010755355.1| PREDICTED: cryptochrome-1-like isoform X1 [Larimichthys crocea]
Length=523

 Score =   501 bits (1289),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 329/494 (67%), Gaps = 16/494 (3%)
 Frame = +1

Query  280   LMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLL  459
             + WFRKGLR+HDNPAL  A     + +P+F++DPH            +T  G+NR RFL+
Sbjct  6     IHWFRKGLRLHDNPALMAALRDCKELYPVFILDPHLY---------NNTCMGINRWRFLI  56

Query  460   ETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNY  639
              +L DLD SL  L SRL VLRG P  V  +   +W ++KL +EYDTEPY  + D  V   
Sbjct  57    GSLKDLDCSLRKLDSRLFVLRGKPEDVFPKLFNKWKVTKLTYEYDTEPYSLSRDQTVTAL  116

Query  640   ASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTY---QSFLKLAGIPSWAssplstslss  810
             A   G+E    VSHTL+D   II +N G  PLT+   Q+ +K  G P       +     
Sbjct  117   AKEHGVEVIYSVSHTLYDIDRIIEENNGKAPLTFIRMQAIVKTLGPPKRPIPAPTMENMK  176

Query  811   lppIGNLGSLQVS-AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
                     S + + A+PT+EE+G  D +  E   F GGE EALRRL E +    WV  FE
Sbjct  177   DVKTPCSESHEKNYAIPTMEEVGQ-DTAALEEEKFPGGEQEALRRLDEHMKRTGWVCNFE  235

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             KP  +P++ L P+TTVLSPY+ FGCLS+R F+  + +V +  K+H++PPVSL GQLLWR+
Sbjct  236   KPHTSPNS-LSPSTTVLSPYVTFGCLSARTFWWRLTDVYQG-KKHSAPPVSLHGQLLWRE  293

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             F+YT + G P+F +M GN +C Q+ W  + E LAAWR++RTGFP+IDAIM QLR+ GW+H
Sbjct  294   FYYTASVGIPNFSKMEGNPVCTQVDWDTNAEYLAAWREARTGFPFIDAIMTQLRQEGWIH  353

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH+VACFLTRGDL+I+WE+G+ VFE LL+D DWA+N GNW WLS S+FF+Q+ R+YS
Sbjct  354   HLARHAVACFLTRGDLWINWEEGQKVFEELLLDGDWALNAGNWQWLSASAFFHQFFRVYS  413

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             P+ FGKK D +G+YI+ +LP+LK  P +YIYEPW AP SIQ+ A CI+G DYP P+V H+
Sbjct  414   PVAFGKKTDKNGDYIKKYLPLLKKFPAQYIYEPWKAPRSIQQAAGCIVGKDYPHPIVQHE  473

Query  1708  SASKECRQRLGEAY  1749
               SK+  QR+  AY
Sbjct  474   VISKKNIQRMKLAY  487



>ref|XP_005300861.1| PREDICTED: cryptochrome-1 [Chrysemys picta bellii]
Length=618

 Score =   504 bits (1298),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 334/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADSVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK++ SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNRSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P++FG++ DP+G+YIR +LP+L+  P +YIY+PW AP SIQ+ AKC+IG+ YPKP+
Sbjct  411   HCYCPVSFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPESIQKAAKCVIGVHYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006024339.1| PREDICTED: cryptochrome-1-like isoform X1 [Alligator sinensis]
Length=620

 Score =   504 bits (1298),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATSNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  +Q+ AKC+IGI+YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGVQKAAKCMIGINYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004675775.1| PREDICTED: cryptochrome-1 [Condylura cristata]
Length=585

 Score =   503 bits (1295),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_001181088.1| cryptochrome-1 [Macaca mulatta]
 ref|XP_003907145.1| PREDICTED: cryptochrome-1 [Papio anubis]
 ref|XP_005572176.1| PREDICTED: cryptochrome-1 isoform X1 [Macaca fascicularis]
 ref|XP_005572177.1| PREDICTED: cryptochrome-1 isoform X2 [Macaca fascicularis]
 ref|XP_009179878.1| PREDICTED: cryptochrome-1 [Papio anubis]
 gb|EHH21146.1| hypothetical protein EGK_04148 [Macaca mulatta]
 gb|EHH66671.1| hypothetical protein EGM_03711 [Macaca fascicularis]
Length=586

 Score =   503 bits (1295),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006865309.1| PREDICTED: cryptochrome-1 isoform X1 [Chrysochloris asiatica]
Length=587

 Score =   503 bits (1295),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 334/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPALQ     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALQECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA ++ 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWDITKLSIEYDSEPFGKERDAAIRK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  I             +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--ISKMEPLETPVETITSE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              +G   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VMGKCVTPLSDDHDEKYGVPSLEELGF-DTDGLSLAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMAQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWITWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006865310.1| PREDICTED: cryptochrome-1 isoform X2 [Chrysochloris asiatica]
Length=588

 Score =   503 bits (1295),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 334/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPALQ     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALQECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA ++ 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWDITKLSIEYDSEPFGKERDAAIRK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  I             +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--ISKMEPLETPVETITSE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              +G   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VMGKCVTPLSDDHDEKYGVPSLEELGF-DTDGLSLAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMAQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWITWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006271722.1| PREDICTED: cryptochrome-1-like isoform X1 [Alligator mississippiensis]
 ref|XP_006271723.1| PREDICTED: cryptochrome-1-like isoform X2 [Alligator mississippiensis]
Length=620

 Score =   504 bits (1298),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATSNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  +Q+ AKC+IGI+YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGVQKAAKCMIGINYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004269459.1| PREDICTED: cryptochrome-1 [Orcinus orca]
Length=587

 Score =   503 bits (1295),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007165787.1| PREDICTED: cryptochrome-1 isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=587

 Score =   503 bits (1295),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007165788.1| PREDICTED: cryptochrome-1 isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=563

 Score =   502 bits (1292),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008002745.1| PREDICTED: cryptochrome-1 [Chlorocebus sabaeus]
 ref|XP_008002746.1| PREDICTED: cryptochrome-1 [Chlorocebus sabaeus]
Length=586

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006205926.1| PREDICTED: cryptochrome-1 isoform X1 [Vicugna pacos]
 ref|XP_006205927.1| PREDICTED: cryptochrome-1 isoform X2 [Vicugna pacos]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007066203.1| PREDICTED: cryptochrome-1-like isoform X1 [Chelonia mydas]
Length=620

 Score =   504 bits (1297),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 334/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALRECIQGADSVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMEKCTSPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP SIQ+ AKC+IG+ YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPESIQKAAKCVIGVHYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004650303.1| PREDICTED: cryptochrome-1 [Jaculus jaculus]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEII  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006069628.1| PREDICTED: cryptochrome-1 isoform X1 [Bubalus bubalis]
 ref|XP_006069629.1| PREDICTED: cryptochrome-1 isoform X2 [Bubalus bubalis]
 ref|XP_006069630.1| PREDICTED: cryptochrome-1 isoform X3 [Bubalus bubalis]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004743134.1| PREDICTED: cryptochrome-1 [Mustela putorius furo]
 ref|XP_004787124.1| PREDICTED: cryptochrome-1 [Mustela putorius furo]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGANTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L  I       +     +  
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTL--ISKMEPLEMPVETITSE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              I    +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VIEKCTTPLSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005958591.1| PREDICTED: cryptochrome-1 [Pantholops hodgsonii]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_003929699.1| PREDICTED: cryptochrome-1 [Saimiri boliviensis boliviensis]
Length=586

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008841338.1| PREDICTED: cryptochrome-1 [Nannospalax galili]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_010788556.1| PREDICTED: cryptochrome-1-like [Notothenia coriiceps]
 ref|XP_010788557.1| PREDICTED: cryptochrome-1-like [Notothenia coriiceps]
Length=522

 Score =   500 bits (1288),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/499 (49%), Positives = 333/499 (67%), Gaps = 17/499 (3%)
 Frame = +1

Query  265   SESCSLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNR  444
             + +C + WFRKGLR+HDNPAL  A     + +P+F++DP+            +T  G+NR
Sbjct  2     AHTC-IHWFRKGLRLHDNPALMAALRDCKELYPVFILDPYLY---------NNTLVGINR  51

Query  445   IRFLLETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDA  624
              RFL+  L DLD SL  L SRL V+RG P +V  +  ++W ++KL +EYDTEPY  + D 
Sbjct  52    WRFLIGCLKDLDCSLRKLNSRLFVVRGKPEEVFPKLFEKWKVTKLTYEYDTEPYSLSRDK  111

Query  625   KVKNYASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSF---LKLAGIPSWAsspls  795
              V   A   G+E    +SHT+ D   II +N G  PLTY  F   LK  G P       +
Sbjct  112   TVTTLAKEHGVEVVYKISHTIHDMDRIIEENNGKAPLTYNRFRTILKAIGNPKKPIPAPA  171

Query  796   tslsslppIG-NLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEW  972
                +       +    +   +PTLE+LG+ D +      F GGE EALRRL E++A K+W
Sbjct  172   IEDTKDVKTPCSENHDKNYGIPTLEDLGH-DTTTLGEEKFPGGEQEALRRLDENMARKDW  230

Query  973   VAYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQ  1152
             V  FEKP+ +P++ L P+TTVLSPY+ FGCLS+R F+  V EV +  K+H+ PPVSL GQ
Sbjct  231   VCKFEKPQTSPNS-LSPSTTVLSPYVTFGCLSARTFWWRVTEVYQG-KKHSEPPVSLHGQ  288

Query  1153  LLWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRK  1332
             LLWR+F+Y    G P+FD+M GN +C Q+ W  + + LAAWR++RTG P+IDAIM QLR+
Sbjct  289   LLWREFYYAAGVGIPNFDKMEGNPVCTQVDWDTNPKYLAAWREARTGLPFIDAIMTQLRQ  348

Query  1333  WGWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQY  1512
              GW+HHLARH+VACFLTRGDL+I+WE+G+ VFE LL+D DWA+N GNW WLS S+FF+QY
Sbjct  349   EGWIHHLARHAVACFLTRGDLWINWEEGQKVFEYLLLDGDWALNAGNWQWLSASAFFHQY  408

Query  1513  HRIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKP  1692
              R+YSP+ FGKK D +G+YI+ +LP+LK  P +YIYEPW AP S+Q+ A CI+G DYP+P
Sbjct  409   FRVYSPVAFGKKTDKNGDYIKKYLPLLKKFPAQYIYEPWKAPRSVQQAAGCIVGKDYPQP  468

Query  1693  VVSHDSASKECRQRLGEAY  1749
             +V H+  SK+  QR+  AY
Sbjct  469   IVQHEVISKKNIQRMKLAY  487



>ref|XP_862753.1| PREDICTED: mTERF domain-containing protein 3, mitochondrial isoformX2 
[Canis lupus familiaris]
 ref|XP_005625992.1| PREDICTED: mTERF domain-containing protein 3, mitochondrial isoform 
X3 [Canis lupus familiaris]
 ref|XP_005625993.1| PREDICTED: mTERF domain-containing protein 3, mitochondrial isoform 
X4 [Canis lupus familiaris]
 ref|XP_005625994.1| PREDICTED: mTERF domain-containing protein 3, mitochondrial isoform 
X5 [Canis lupus familiaris]
Length=587

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVV  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_003126127.1| PREDICTED: cryptochrome-1 isoform X1 [Sus scrofa]
 ref|XP_005655589.1| PREDICTED: cryptochrome-1 isoform X2 [Sus scrofa]
Length=588

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_001123207.1| cryptochrome-1 [Ovis aries]
 gb|ABS44879.1| cryptochrome 1 [Ovis aries]
Length=587

 Score =   502 bits (1293),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIIRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_001098885.1| cryptochrome-1 [Bos taurus]
 ref|XP_005893754.1| PREDICTED: cryptochrome-1 isoform X1 [Bos mutus]
 ref|XP_005893755.1| PREDICTED: cryptochrome-1 isoform X2 [Bos mutus]
 gb|AAI34487.1| CRY1 protein [Bos taurus]
Length=587

 Score =   502 bits (1293),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008542303.1| PREDICTED: cryptochrome-1 isoform X2 [Equus przewalskii]
Length=534

 Score =   500 bits (1288),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  +   LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPAGLSPYLRFGCLSCRLFYFRLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>tpg|DAA29534.1| TPA: cryptochrome 1 (photolyase-like) [Bos taurus]
Length=543

 Score =   501 bits (1289),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004418125.1| PREDICTED: cryptochrome-1 [Ceratotherium simum simum]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_003989258.1| PREDICTED: cryptochrome-1 [Felis catus]
 ref|XP_007096518.1| PREDICTED: cryptochrome-1 [Panthera tigris altaica]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSELI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_509339.2| PREDICTED: cryptochrome-1 isoform X1 [Pan troglodytes]
 ref|XP_003832588.1| PREDICTED: cryptochrome-1 isoform X1 [Pan paniscus]
Length=586

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004473360.1| PREDICTED: cryptochrome-1 [Dasypus novemcinctus]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 337/506 (67%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +P   
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITPEMI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>gb|AHA91700.1| cryptochrome 1a [Astyanax mexicanus]
Length=625

 Score =   503 bits (1296),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 244/498 (49%), Positives = 334/498 (67%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNP+L+ +   +     ++++DP +          GS+  G+NR RFL
Sbjct  5     TIHWFRKGLRLHDNPSLRESIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW+I++L +EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPTDVFPRLFKEWNITRLSYEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG  PLTY+ F  L  I    +    T   +  
Sbjct  116   LASEAGVEVTVRISHTLYDLDKIIELNGGQSPLTYKRFQTL--ISKMEAVETPTEAITAD  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              +G+  +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VMGSCTTPLSDDHDEKFGVPSLEELGF-DTEGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC Q+PW  + E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQMPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP S+Q+ AKC+IG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPESVQKAAKCVIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYE  1752
              H  AS+   +R+ + Y+
Sbjct  472   HHAEASRLNIERMKQIYQ  489



>ref|NP_004066.1| cryptochrome-1 [Homo sapiens]
 ref|XP_003270025.1| PREDICTED: cryptochrome-1 [Nomascus leucogenys]
 sp|Q16526.1|CRY1_HUMAN RecName: Full=Cryptochrome-1 [Homo sapiens]
 dbj|BAA12068.1| photolyase [Homo sapiens]
 dbj|BAA12710.1| photolyase homolog [Homo sapiens]
 gb|AAH30519.1| Cryptochrome 1 (photolyase-like) [Homo sapiens]
 gb|EAW97795.1| cryptochrome 1 (photolyase-like), isoform CRA_a [Homo sapiens]
 gb|EAW97797.1| cryptochrome 1 (photolyase-like), isoform CRA_a [Homo sapiens]
 gb|ABM64209.1| photolyase-like cryptochrome 1 [Homo sapiens]
 dbj|BAF83241.1| unnamed protein product [Homo sapiens]
 dbj|BAI45709.1| cryptochrome 1 [synthetic construct]
 gb|ADZ15916.1| cryptochrome 1 (photolyase-like) [synthetic construct]
 gb|AIC54221.1| CRY1, partial [synthetic construct]
Length=586

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006731113.1| PREDICTED: cryptochrome-1 [Leptonychotes weddellii]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008703868.1| PREDICTED: cryptochrome-1 isoform X1 [Ursus maritimus]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_002927704.1| PREDICTED: cryptochrome-1-like [Ailuropoda melanoleuca]
 gb|EFB22605.1| hypothetical protein PANDA_017512 [Ailuropoda melanoleuca]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_003220970.1| PREDICTED: cryptochrome-1 isoform X1 [Anolis carolinensis]
Length=621

 Score =   503 bits (1296),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 247/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALREVIQGADTVRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL++   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYELDKIIELNGGQPPLTYKRFQTLI---SRMEPLEIPVETITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              + +  +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   EVMSKCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  +Q+ AKCIIG++YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPDGVQKAAKCIIGVNYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQMYQQLSRYRGL  497



>ref|XP_002711467.1| PREDICTED: cryptochrome-1 [Oryctolagus cuniculus]
Length=587

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 335/507 (66%), Gaps = 21/507 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I++L  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITRLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +   
Sbjct  116   LASEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SKMEPLEIPVETITS  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WV
Sbjct  173   DVIEKCTTPVSDDHDEKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M GN IC QIPW ++ E LA W + +TGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGQTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYELNKKLGGM  1776
             V+H  AS+   +R+ + Y+   +  G+
Sbjct  471   VNHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004589630.1| PREDICTED: cryptochrome-1 [Ochotona princeps]
Length=587

 Score =   502 bits (1292),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSEDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_010851672.1| PREDICTED: cryptochrome-1 [Bison bison bison]
 ref|XP_010851673.1| PREDICTED: cryptochrome-1 [Bison bison bison]
 ref|XP_010851674.1| PREDICTED: cryptochrome-1 [Bison bison bison]
Length=587

 Score =   502 bits (1292),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVTVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005801946.1| PREDICTED: cryptochrome-1-like [Xiphophorus maculatus]
Length=657

 Score =   504 bits (1298),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 334/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+ A   +     ++ +DP +          GS+  G+NR RFL
Sbjct  5     SIHWFRKGLRLHDNPALREAVRGAGTVRCVYFLDPWFA---------GSSNVGVNRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P    S    
Sbjct  116   LAMEAGVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVETLSDALM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P   + G  +   VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  176   GGCVTPVSEDHG--EKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRIERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P +YIY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKYIYDPWNAPESVQAAAKCIIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  472   HHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006175506.1| PREDICTED: cryptochrome-1 isoform X1 [Camelus ferus]
Length=587

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E     SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRTSHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_010968776.1| PREDICTED: cryptochrome-1 isoform X1 [Camelus bactrianus]
 ref|XP_010994770.1| PREDICTED: cryptochrome-1 isoform X2 [Camelus dromedarius]
Length=586

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E     SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRTSHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008313617.1| PREDICTED: cryptochrome-1-like [Cynoglossus semilaevis]
Length=631

 Score =   503 bits (1295),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 246/499 (49%), Positives = 333/499 (67%), Gaps = 21/499 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNP+L+ +   +     ++++DP +          GS+  G+NR RFL
Sbjct  5     TIHWFRKGLRLHDNPSLKDSLQGADSVRCIYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L++L DLDSSL  L SRL V+RG P+ V  R  KEW+I++L +EYD+EP+ +  DA +K 
Sbjct  56    LQSLEDLDSSLRKLNSRLFVIRGQPTDVFPRLFKEWNITRLSYEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS AG+E     SHTL+D A II  NGG  PLTY+ F  L    S   +    + S   
Sbjct  116   LASEAGVEVIVRTSHTLYDLAKIIELNGGQSPLTYKRFQTLI---SRMEAVEMPTESITA  172

Query  817   pIGNLGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWV  975
              +    +  +S        VP+LEELG+ D        + GGESEAL RL   +  K WV
Sbjct  173   EVMEKCTTPLSDDHDDKFGVPSLEELGF-DTEGLSSAVWPGGESEALTRLERHLERKAWV  231

Query  976   AYFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQL  1155
             A FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQL
Sbjct  232   ANFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQL  290

Query  1156  LWRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKW  1335
             LWR+FFYT A   P FD+M  N IC QIPW  + E LA W + RTGFPWIDAIM QLR+ 
Sbjct  291   LWREFFYTAATNNPCFDKMDSNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQE  350

Query  1336  GWMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYH  1515
             GW+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+ 
Sbjct  351   GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFF  410

Query  1516  RIYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPV  1695
               Y P+ FG++ DP+G+YIR +LP+L+  P +YIY+PW AP ++Q+ AKC+IG+ YPKP+
Sbjct  411   HCYCPVGFGRRTDPNGDYIRRYLPILRGFPAKYIYDPWNAPDNVQKAAKCVIGLHYPKPM  470

Query  1696  VSHDSASKECRQRLGEAYE  1752
             V H  AS+   +R+ + Y+
Sbjct  471   VQHAEASRLNIERMKQIYQ  489



>ref|XP_006170414.1| PREDICTED: cryptochrome-1 isoform X1 [Tupaia chinensis]
 ref|XP_006170415.1| PREDICTED: cryptochrome-1 isoform X2 [Tupaia chinensis]
Length=587

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKFGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNSNSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  +Q+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGVQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_007462929.1| PREDICTED: cryptochrome-1 [Lipotes vexillifer]
Length=587

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ +G+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATESGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLSSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNAEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>gb|ADL62679.1| cryptochrome 1a [Phreatichthys andruzzii]
Length=623

 Score =   503 bits (1294),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 242/496 (49%), Positives = 338/496 (68%), Gaps = 15/496 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNP+L+ +   +     ++++DP +          GS+  G++R RFL
Sbjct  5     TVHWFRKGLRLHDNPSLRDSIQGAHTVRCVYILDPWFA---------GSSNVGISRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW+I++L +EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPTDVFPRLFKEWNITRLSYEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFL----KLAGIPSWAssplstsl  804
              A+ AG+E    +SHTL+D   II  NGG  PLTY+ F     ++  + + A +  +  +
Sbjct  116   LANEAGVEVIVRISHTLYDLDKIIELNGGQSPLTYKRFQTLISRMEAVETPAETITAEVM  175

Query  805   sslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
              +     +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA F
Sbjct  176   GTCTTPVSDDHDEKFGVPSLEELGF-DTEGLSSAVWPGGETEALTRLERHLERKAWVANF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             E+P+ N ++ L  + T LSPYL+FGCLS + FY  + ++ R VK+++SPP+SL GQLLWR
Sbjct  235   ERPRMNANSLL-ASPTGLSPYLRFGCLSCQLFYFKLTDLYRKVKKNSSPPLSLYGQLLWR  293

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ GW+
Sbjct  294   EFFYTTATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWI  353

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+   Y
Sbjct  354   HHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFHCY  413

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
              P++FG++ DP+G+YIR +LPVL+  P +YIY+PWTAP S+Q+ AKCIIG+ YPKP+V H
Sbjct  414   CPVSFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWTAPESVQKAAKCIIGVHYPKPMVHH  473

Query  1705  DSASKECRQRLGEAYE  1752
               AS+   +R+ + Y+
Sbjct  474   AEASRLNIERMKQIYQ  489



>ref|XP_007566915.1| PREDICTED: cryptochrome-1-like isoform X1 [Poecilia formosa]
Length=657

 Score =   504 bits (1297),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 250/506 (49%), Positives = 334/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPALQ A   +     ++ +DP +          GS+  G+NR RFL
Sbjct  5     SIHWFRKGLRLHDNPALQEAVRGAGTVRCVYFLDPWFA---------GSSNVGVNRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P    S    
Sbjct  116   LAMEAGVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVETLSDALM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P   + G  +   VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  176   GGCVTPVAEDHG--EKYGVPSLEELGF-DTEGLPSAVWPGGETEALTRIERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P ++IY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKFIYDPWNAPESVQAAAKCIIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  472   HHAEASRLNIERMKQLYQQLSRYRGL  497



>gb|AHF70975.1| cryptochrome 1a [Sylvia atricapilla]
Length=620

 Score =   503 bits (1294),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 250/503 (50%), Positives = 334/503 (66%), Gaps = 21/503 (4%)
 Frame = +1

Query  289   FRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFLLETL  468
             FRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFLL+ L
Sbjct  9     FRKGLRLHDNPALRECIQGADTVRCVYILDPWFA---------GSSNVGINRWRFLLQCL  59

Query  469   VDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKNYASV  648
              DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K  AS 
Sbjct  60    EDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDAAIKKLASE  119

Query  649   AGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslppIGN  828
             AG+E    +SHTL+D   II  NGG PPLTY+ F  L    S          +  P +  
Sbjct  120   AGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLI---SRMEPLEMPVETITPEVMK  176

Query  829   LGSLQVS-------AVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYFE  987
               +  VS        VP+LEELG+ D        + GGE+EAL RL   +  K WVA FE
Sbjct  177   KCTTPVSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVANFE  235

Query  988   KPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWRD  1167
             +P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLLWR+
Sbjct  236   RPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWRE  294

Query  1168  FFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWMH  1347
             FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ GW+H
Sbjct  295   FFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIH  354

Query  1348  HLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIYS  1527
             HLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+   Y 
Sbjct  355   HLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFHCYC  414

Query  1528  PITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSHD  1707
             P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP SIQ+ AKCIIG++YPKP+V+H 
Sbjct  415   PVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPESIQKAAKCIIGVNYPKPMVNHA  474

Query  1708  SASKECRQRLGEAYELNKKLGGM  1776
              AS+   +R+ + Y+   +  G+
Sbjct  475   EASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004567670.1| PREDICTED: cryptochrome-1-like isoform X4 [Maylandia zebra]
Length=618

 Score =   502 bits (1293),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+ A   ++    ++ +DP +          GS+  G+NR RFL
Sbjct  16    SIHWFRKGLRLHDNPALREAVQGASTVRCVYFLDPWFA---------GSSNVGVNRWRFL  66

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  67    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  126

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P    +    
Sbjct  127   LAMEAGVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVEMLTDTLM  186

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P + + G      VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  187   GHCVTPVLEDHGD--KYGVPSLEELGF-DTEGLPSAVWPGGETEALTRIERHLERKAWVA  243

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  244   NFERPRMNANSLLA-SPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  302

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  303   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  362

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  363   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  422

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P ++IY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  423   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKFIYDPWNAPESVQAAAKCIIGVHYPKPMV  482

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  483   HHAEASRLNIERMKQIYQQLSRYRGL  508



>ref|XP_006175507.1| PREDICTED: cryptochrome-1 isoform X2 [Camelus ferus]
 ref|XP_010994769.1| PREDICTED: cryptochrome-1 isoform X1 [Camelus dromedarius]
Length=587

 Score =   501 bits (1291),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E     SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRTSHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_005606624.1| PREDICTED: cryptochrome-1 isoform X2 [Equus caballus]
Length=563

 Score =   500 bits (1288),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  +   LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPAGLSPYLRFGCLSCRLFYFRLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_003783322.1| PREDICTED: cryptochrome-1 [Otolemur garnettii]
Length=587

 Score =   501 bits (1290),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 336/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I++L  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITRLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEII  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLFDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P +FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IGI+YPKP+V
Sbjct  412   CYCPASFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGINYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_001499263.1| PREDICTED: cryptochrome-1 isoform X1 [Equus caballus]
Length=587

 Score =   501 bits (1290),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  +   LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPAGLSPYLRFGCLSCRLFYFRLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_010968777.1| PREDICTED: cryptochrome-1 isoform X2 [Camelus bactrianus]
Length=544

 Score =   499 bits (1286),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E     SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRTSHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008542302.1| PREDICTED: cryptochrome-1 isoform X1 [Equus przewalskii]
Length=544

 Score =   499 bits (1286),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  +   LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPAGLSPYLRFGCLSCRLFYFRLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004700384.1| PREDICTED: cryptochrome-1 [Echinops telfairi]
Length=587

 Score =   501 bits (1290),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 249/504 (49%), Positives = 334/504 (66%), Gaps = 15/504 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWDITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGI--PSWAssplstslss  810
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L     P        TS   
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  811   lppIGNLGSL--QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
                +  L     +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA F
Sbjct  176   EKCVTPLSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVANF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             E+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLLWR
Sbjct  235   ERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWR  293

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ GW+
Sbjct  294   EFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWI  353

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+   Y
Sbjct  354   HHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCY  413

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
              P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V+H
Sbjct  414   CPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNH  473

Query  1705  DSASKECRQRLGEAYELNKKLGGM  1776
               AS+   +R+ + Y+   +  G+
Sbjct  474   AEASRLNIERMKQIYQQLSRYRGL  497



>ref|NP_571861.2| cryptochrome-2 [Danio rerio]
 gb|AAH46088.1| Cryptochrome 3 [Danio rerio]
Length=598

 Score =   501 bits (1291),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 242/498 (49%), Positives = 328/498 (66%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPALQ A N +     ++++DP +          GS   G+NR RFL
Sbjct  5     SVHWFRKGLRLHDNPALQEALNGADTVRCVYILDPWFA---------GSANVGVNRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DLD+SL  L SRL V+RG P+ V  R  KEW++++L FEYD+EPY +  DA +  
Sbjct  56    LESLEDLDTSLRKLNSRLFVVRGQPTDVFPRLFKEWNVTRLTFEYDSEPYGKERDAAIIK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSF------LKLAGIPSWAssplst  798
              A   G+ET    +HTL++P  II  N  +PPLT++ F      L+L   P    +    
Sbjct  116   MAQEYGVETVVRNTHTLYNPDRIIEMNNHSPPLTFKRFQAIVNRLELPRKPLPTITQEQM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             +        N    +   VP+LEELG+     D    ++GGE+EAL RL + +  K WVA
Sbjct  176   ARCRTQISDNHD--EHYGVPSLEELGF-RTQGDSLHVWKGGETEALERLNKHLDRKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ +  +   P+ T LSPYL+FGCLS R FY  ++++   ++R +SPP+SL GQLL
Sbjct  233   NFERPRISGQSLF-PSPTGLSPYLRFGCLSCRVFYYNLRDLFMKLRRRSSPPLSLFGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT     P+FD M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAGTNNPNFDHMEGNPICVQIPWDHNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE G  VFE LL+D+DW++N G+WMWLSCS+FF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWESGMKVFEELLLDADWSVNAGSWMWLSCSAFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP G+YIR ++P LKD P  YIYEPW AP S+Q+ A CI+G+DYPKP++
Sbjct  412   CYCPVGFGRRTDPSGDYIRRYIPKLKDYPNRYIYEPWNAPESVQKAANCIVGVDYPKPMI  471

Query  1699  SHDSASKECRQRLGEAYE  1752
             +H  +S+   +R+ + Y+
Sbjct  472   NHAESSRLNIERMKQVYQ  489



>ref|XP_004623988.1| PREDICTED: cryptochrome-1 [Octodon degus]
Length=587

 Score =   501 bits (1289),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCMTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQLYQQLSRYRGL  497



>ref|XP_005750863.1| PREDICTED: cryptochrome-1-like [Pundamilia nyererei]
Length=654

 Score =   503 bits (1296),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+ A   ++    ++ +DP +          GS+  G+NR RFL
Sbjct  16    SIHWFRKGLRLHDNPALREAVQGASTVRCVYFLDPWFA---------GSSNVGVNRWRFL  66

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  67    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  126

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P    +    
Sbjct  127   LAMEAGVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVEMLTDTLM  186

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P + + G      VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  187   GHCVTPVLEDHGD--KYGVPSLEELGF-DTEGLPSAVWPGGETEALTRIERHLERKAWVA  243

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  244   NFERPRMNANSLLA-SPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  302

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  303   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  362

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  363   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  422

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P ++IY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  423   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKFIYDPWNAPESVQAAAKCIIGVHYPKPMV  482

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  483   HHAEASRLNIERMKQIYQQLSRYRGL  508



>ref|XP_004844852.1| PREDICTED: cryptochrome-1 isoform X2 [Heterocephalus glaber]
Length=587

 Score =   501 bits (1289),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 248/504 (49%), Positives = 335/504 (66%), Gaps = 15/504 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGI--PSWAssplstslss  810
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L     P        TS   
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  811   lppIGNLGSL--QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
                +  L     +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA F
Sbjct  176   EKCVTPLSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVANF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             E+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLLWR
Sbjct  235   ERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWR  293

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ GW+
Sbjct  294   EFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWI  353

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+   Y
Sbjct  354   HHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCY  413

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
              P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V+H
Sbjct  414   CPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNH  473

Query  1705  DSASKECRQRLGEAYELNKKLGGM  1776
               AS+   +R+ + Y+   +  G+
Sbjct  474   AEASRLNIERMKQIYQQLSRYRGL  497



>dbj|BAA96850.1| cryptochrome3 [Danio rerio]
Length=598

 Score =   501 bits (1290),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 243/498 (49%), Positives = 328/498 (66%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPALQ A N +     ++++DP +          GS   G+NR RFL
Sbjct  5     SVHWFRKGLRLHDNPALQEALNGADTVRCVYILDPWFA---------GSANVGVNRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             LE+L DLD+SL  L SRL V+RG P+ V  R  KEW++++L FEYD+EPY +  DA +  
Sbjct  56    LESLEDLDTSLRKLNSRLSVVRGQPTDVFPRLFKEWNVTRLTFEYDSEPYGKERDAAIIK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSF------LKLAGIPSWAssplst  798
              A   G+ET    SHTL++P  II  N  +PPLT++ F      L+L   P    +    
Sbjct  116   MAQEYGVETVVRNSHTLYNPDRIIEMNNHSPPLTFKRFQAIVNRLELPRKPLPTITQEQM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
             +        N    +   VP+LEELG+     D    ++GGE+EAL RL + +  K WVA
Sbjct  176   ARCRTQISDNHD--EHYGVPSLEELGF-RTQGDSLHVWKGGETEALERLNKHLDRKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ +  +   P+ T LSPYL+FGCLS R FY  ++++   ++R +SPP+SL GQLL
Sbjct  233   NFERPRISGQSLF-PSPTGLSPYLRFGCLSCRVFYYNLRDLFMKLRRRSSPPLSLFGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT     P+FD M GN IC QIPW  + E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAGTNNPNFDHMEGNPICVQIPWDHNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE G  VFE LL+D+DW++N G+WMWLSCS+FF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWESGMKVFEELLLDADWSVNAGSWMWLSCSAFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP G+YIR ++P LKD P  YIYEPW AP S+Q+ A CI+G+DYPKP++
Sbjct  412   CYCPVGFGRRTDPSGDYIRRYIPKLKDYPNRYIYEPWNAPESVQKAANCIVGVDYPKPMI  471

Query  1699  SHDSASKECRQRLGEAYE  1752
             +H  +S+   +R+ + Y+
Sbjct  472   NHAESSRLNIERMKQVYQ  489



>ref|XP_004567668.1| PREDICTED: cryptochrome-1-like isoform X2 [Maylandia zebra]
Length=654

 Score =   503 bits (1295),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+ A   ++    ++ +DP +          GS+  G+NR RFL
Sbjct  16    SIHWFRKGLRLHDNPALREAVQGASTVRCVYFLDPWFA---------GSSNVGVNRWRFL  66

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  67    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  126

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P    +    
Sbjct  127   LAMEAGVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVEMLTDTLM  186

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P + + G      VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  187   GHCVTPVLEDHGD--KYGVPSLEELGF-DTEGLPSAVWPGGETEALTRIERHLERKAWVA  243

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  244   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  302

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  303   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  362

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  363   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  422

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P ++IY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  423   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKFIYDPWNAPESVQAAAKCIIGVHYPKPMV  482

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  483   HHAEASRLNIERMKQIYQQLSRYRGL  508



>ref|XP_004373851.1| PREDICTED: cryptochrome-1 [Trichechus manatus latirostris]
Length=587

 Score =   501 bits (1289),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 334/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWDITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPEETITSEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCSIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006633149.1| PREDICTED: cryptochrome-1-like isoform X3 [Lepisosteus oculatus]
Length=590

 Score =   501 bits (1289),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 245/498 (49%), Positives = 331/498 (66%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HD+PAL+ +   +     ++++DP +          GS+  G+NR RFL
Sbjct  5     TVHWFRKGLRLHDSPALRESLKGAASLRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW+I++L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPADVFPRLFKEWNINRLSFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS A +E    VSHTL+D   II  NGG PPLTY+ F  L  I             +  
Sbjct  116   LASEADVEVIVRVSHTLYDLDKIIELNGGQPPLTYKRFQTL--ISRMDPLETPAEPITAE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              +G   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VMGKCTTPVSDDHDEKFGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR  G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRHEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP S+Q+ AKC+IG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPDSVQKAAKCVIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYE  1752
              H  AS+   +R+ + Y+
Sbjct  472   HHAEASRLNIERMKQIYQ  489



>ref|XP_005374693.1| PREDICTED: cryptochrome-1 [Chinchilla lanigera]
Length=587

 Score =   500 bits (1288),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 334/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LAMEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITAEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCMTPLADDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQLYQQLSRYRGL  497



>ref|XP_008142937.1| PREDICTED: cryptochrome-1 [Eptesicus fuscus]
Length=587

 Score =   500 bits (1288),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLDS+L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDSNLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L        IP    +    
Sbjct  116   LATEAGVEVIVQISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITLEVI  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                + P   +    +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  176   EKCTTPLSDDHD--EKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QL + G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLHQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACF+TRGDL+I WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFVTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V
Sbjct  412   CYCPVGFGRRADPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
             +H  AS+   +R+ + Y+   +  G+
Sbjct  472   NHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004844851.1| PREDICTED: cryptochrome-1 isoform X1 [Heterocephalus glaber]
Length=611

 Score =   501 bits (1290),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 248/504 (49%), Positives = 335/504 (66%), Gaps = 15/504 (3%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HDNPAL+     +     ++++DP +          GS+  G+NR RFL
Sbjct  5     AVHWFRKGLRLHDNPALKECIRGADTIRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW+I+KL  EYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGI--PSWAssplstslss  810
              A+ AG+E    +SHTL+D   II  NGG PPLTY+ F  L     P        TS   
Sbjct  116   LATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVI  175

Query  811   lppIGNLGSL--QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVAYF  984
                +  L     +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA F
Sbjct  176   EKCVTPLSDDHDEKYGVPSLEELGF-DTDGLPSAVWPGGETEALTRLERHLERKAWVANF  234

Query  985   EKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLLWR  1164
             E+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLLWR
Sbjct  235   ERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWR  293

Query  1165  DFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWGWM  1344
             +FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR+ GW+
Sbjct  294   EFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWI  353

Query  1345  HHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHRIY  1524
             HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW+IN G+WMWLSCSSFF Q+   Y
Sbjct  354   HHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCY  413

Query  1525  SPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVVSH  1704
              P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP  IQ+ AKC+IG++YPKP+V+H
Sbjct  414   CPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNH  473

Query  1705  DSASKECRQRLGEAYELNKKLGGM  1776
               AS+   +R+ + Y+   +  G+
Sbjct  474   AEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_004567667.1| PREDICTED: cryptochrome-1-like isoform X1 [Maylandia zebra]
Length=669

 Score =   503 bits (1295),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+ A   ++    ++ +DP +          GS+  G+NR RFL
Sbjct  16    SIHWFRKGLRLHDNPALREAVQGASTVRCVYFLDPWFA---------GSSNVGVNRWRFL  66

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  67    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  126

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P    +    
Sbjct  127   LAMEAGVEVIVKISHTLYDLDKIIELNGGQPPLTYKRFQTLISRLDPPEMPVEMLTDTLM  186

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P + + G      VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  187   GHCVTPVLEDHGD--KYGVPSLEELGF-DTEGLPSAVWPGGETEALTRIERHLERKAWVA  243

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  244   NFERPRMNANSLLA-SPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  302

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  303   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  362

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  363   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  422

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P ++IY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  423   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKFIYDPWNAPESVQAAAKCIIGVHYPKPMV  482

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  483   HHAEASRLNIERMKQIYQQLSRYRGL  508



>ref|XP_010780397.1| PREDICTED: cryptochrome-1-like [Notothenia coriiceps]
Length=653

 Score =   503 bits (1294),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 251/506 (50%), Positives = 332/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL  A   +     ++ +DP +          GS+  G+NR RFL
Sbjct  5     SIHWFRKGLRLHDNPALLQAVKGAGTVRCVYFLDPWFA---------GSSNVGVNRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD++L  L SRL V+RG P+ V  R  KEW IS+L FEYDTEP+ +  DA +K 
Sbjct  56    LQCLEDLDANLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDTEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E     SHTL+D   II  NGG PPLTY+ F  L        +P    S    
Sbjct  116   LAMEAGVEVIVKTSHTLYDLDKIIELNGGQPPLTYKRFQTLISRMDPPEMPVETLSDALM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P   + G  +   VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  176   GRCVTPVSEDHG--EEYGVPSLEELGF-DTEGLPTGVWPGGETEALTRIERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLRK G
Sbjct  292   WREFFYTTATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRKEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P +YIY+PW AP S+Q  AKCIIG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKYIYDPWNAPESVQAAAKCIIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  472   HHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_008317159.1| PREDICTED: cryptochrome-1-like [Cynoglossus semilaevis]
Length=651

 Score =   502 bits (1293),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 335/506 (66%), Gaps = 19/506 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             S+ WFRKGLR+HDNPAL+ A   +     ++ +DP +          GS+  G+NR RFL
Sbjct  5     SIHWFRKGLRLHDNPALREAVRGADTVRCVYFLDPWFA---------GSSNVGVNRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW IS+L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPANVFPRLFKEWKISRLTFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAG------IPSWAssplst  798
              A  AG+E    +SHTL+D   II  NGG PPLTY+ F  L        +P+   +  + 
Sbjct  116   LAMEAGVEVNVKISHTLYDLDRIIELNGGQPPLTYKRFQTLISRLDPPEMPAETMTDSTM  175

Query  799   slsslppIGNLGSLQVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
                  P   + G      VP+LEELG+ D        + GGE+EAL R+   +  K WVA
Sbjct  176   GGCVTPISDDHGD--KYGVPSLEELGF-DTEGLPTAVWPGGETEALTRIERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ R VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYRKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC +IPW ++ E LA W +++TGFPWIDAIM QLR+ G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVRIPWDKNPEALAKWAEAKTGFPWIDAIMTQLRQEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL+I WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G++IR +LPVL+  P +YIY+PW AP S+Q  AKC+IG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDFIRRYLPVLRGFPAKYIYDPWNAPESVQAAAKCVIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYELNKKLGGM  1776
              H  AS+   +R+ + Y+   +  G+
Sbjct  472   HHAEASRLNIERMKQIYQQLSRYRGL  497



>ref|XP_006633148.1| PREDICTED: cryptochrome-1-like isoform X2 [Lepisosteus oculatus]
Length=615

 Score =   501 bits (1290),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/498 (49%), Positives = 331/498 (66%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HD+PAL+ +   +     ++++DP +          GS+  G+NR RFL
Sbjct  5     TVHWFRKGLRLHDSPALRESLKGAASLRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW+I++L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPADVFPRLFKEWNINRLSFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS A +E    VSHTL+D   II  NGG PPLTY+ F  L  I             +  
Sbjct  116   LASEADVEVIVRVSHTLYDLDKIIELNGGQPPLTYKRFQTL--ISRMDPLETPAEPITAE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              +G   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VMGKCTTPVSDDHDEKFGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR  G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRHEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP S+Q+ AKC+IG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPDSVQKAAKCVIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYE  1752
              H  AS+   +R+ + Y+
Sbjct  472   HHAEASRLNIERMKQIYQ  489



>ref|XP_006633147.1| PREDICTED: cryptochrome-1-like isoform X1 [Lepisosteus oculatus]
Length=619

 Score =   501 bits (1290),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/498 (49%), Positives = 331/498 (66%), Gaps = 19/498 (4%)
 Frame = +1

Query  277   SLMWFRKGLRIHDNPALQHAANASTKCFPLFVIDPHYMEPDPTAFSPGSTRAGLNRIRFL  456
             ++ WFRKGLR+HD+PAL+ +   +     ++++DP +          GS+  G+NR RFL
Sbjct  5     TVHWFRKGLRLHDSPALRESLKGAASLRCVYILDPWFA---------GSSNVGINRWRFL  55

Query  457   LETLVDLDSSLNNLGSRLLVLRGDPSQVLIRCLKEWSISKLCFEYDTEPYYQALDAKVKN  636
             L+ L DLD+SL  L SRL V+RG P+ V  R  KEW+I++L FEYD+EP+ +  DA +K 
Sbjct  56    LQCLEDLDASLRKLNSRLFVIRGQPADVFPRLFKEWNINRLSFEYDSEPFGKERDAAIKK  115

Query  637   YASVAGIETFTPVSHTLFDPADIIHKNGGTPPLTYQSFLKLAGIPSWAssplstslsslp  816
              AS A +E    VSHTL+D   II  NGG PPLTY+ F  L  I             +  
Sbjct  116   LASEADVEVIVRVSHTLYDLDKIIELNGGQPPLTYKRFQTL--ISRMDPLETPAEPITAE  173

Query  817   pIGNLGSL------QVSAVPTLEELGYVDCSEDERTSFRGGESEALRRLRESIANKEWVA  978
              +G   +       +   VP+LEELG+ D        + GGE+EAL RL   +  K WVA
Sbjct  174   VMGKCTTPVSDDHDEKFGVPSLEELGF-DTEGLPSAVWPGGETEALTRLERHLERKAWVA  232

Query  979   YFEKPKGNPSAFLRPATTVLSPYLKFGCLSSRYFYQCVQEVLRSVKRHTSPPVSLLGQLL  1158
              FE+P+ N ++ L  + T LSPYL+FGCLS R FY  + ++ + VK+++SPP+SL GQLL
Sbjct  233   NFERPRMNANSLL-ASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL  291

Query  1159  WRDFFYTVAFGTPSFDRMRGNRICKQIPWKESDELLAAWRDSRTGFPWIDAIMVQLRKWG  1338
             WR+FFYT A   P FD+M GN IC QIPW ++ E LA W + RTGFPWIDAIM QLR  G
Sbjct  292   WREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRHEG  351

Query  1339  WMHHLARHSVACFLTRGDLFIHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYHR  1518
             W+HHLARH+VACFLTRGDL++ WE+G  VFE LL+D+DW++N G+WMWLSCSSFF Q+  
Sbjct  352   WIHHLARHAVACFLTRGDLWVSWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH  411

Query  1519  IYSPITFGKKYDPDGNYIRHFLPVLKDMPKEYIYEPWTAPLSIQRKAKCIIGIDYPKPVV  1698
              Y P+ FG++ DP+G+YIR +LPVL+  P +YIY+PW AP S+Q+ AKC+IG+ YPKP+V
Sbjct  412   CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPDSVQKAAKCVIGVHYPKPMV  471

Query  1699  SHDSASKECRQRLGEAYE  1752
              H  AS+   +R+ + Y+
Sbjct  472   HHAEASRLNIERMKQIYQ  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6842889476158