BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23576_g3_i1 len=1334 path=[1328:0-710 2039:711-734 16321:735-758
16345:759-767 5510:768-951 2296:952-976 2321:977-1333]

Length=1334
                                                                      Score     E

dbj|BAO57278.1|  alpha-expansin                                         398   6e-134   
ref|XP_011084824.1|  PREDICTED: expansin-A2-like                        367   9e-122   
gb|AEQ55270.1|  expansin                                                366   2e-121   
emb|CDP13911.1|  unnamed protein product                                364   5e-121   
gb|ADC35364.1|  alpha-expansin 1                                        365   5e-121   Coffea arabica [arabica coffee]
ref|XP_010031088.1|  PREDICTED: expansin-A8-like                        362   4e-120   
gb|ABB59694.1|  alpha-expansin 2                                        361   1e-119   Gossypium hirsutum [American cotton]
dbj|BAK05504.1|  predicted protein                                      361   1e-119   
ref|XP_009780854.1|  PREDICTED: expansin-A4-like                        360   2e-119   
gb|AAC96081.1|  alpha-expansin precursor                                360   4e-119   Nicotiana tabacum [American tobacco]
gb|AEQ55272.1|  expansin                                                360   6e-119   
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          360   6e-119   Sorghum bicolor [broomcorn]
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               359   9e-119   Ricinus communis
gb|AEE69072.1|  expansin-5                                              359   9e-119   
ref|NP_001265970.1|  expansin-A8-like precursor                         359   1e-118   
gb|AGU13763.1|  expansin                                                359   1e-118   
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        358   2e-118   
ref|XP_011080662.1|  PREDICTED: expansin-A4-like                        358   2e-118   
gb|KEH34458.1|  expansin A10                                            358   2e-118   
gb|EYU20096.1|  hypothetical protein MIMGU_mgv1a012489mg                358   3e-118   
gb|AEQ55284.1|  expansin                                                358   4e-118   
gb|AEQ55269.1|  expansin                                                358   4e-118   
gb|ACA05166.1|  expansin 3                                              357   5e-118   Dimocarpus longan [longan]
gb|KDP45714.1|  hypothetical protein JCGZ_17321                         357   6e-118   
gb|AFK39658.1|  unknown                                                 357   6e-118   
gb|ACJ85313.1|  unknown                                                 357   6e-118   Medicago truncatula
gb|ABM66452.1|  expansin                                                357   7e-118   Vicia faba [broad bean]
ref|XP_002325925.2|  alpha-expansin 8 precursor family protein          357   8e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        356   1e-117   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             357   1e-117   
gb|AAR09169.1|  alpha-expansin 2                                        356   1e-117   Populus tremula x Populus tremuloides
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        356   1e-117   
gb|AAC33529.1|  expansin                                                356   1e-117   Prunus armeniaca
ref|NP_001044656.1|  Os01g0823100                                       356   2e-117   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ84647.1|  unknown                                                 356   2e-117   Medicago truncatula
ref|XP_009594513.1|  PREDICTED: expansin-A4-like                        356   2e-117   
emb|CDM84777.1|  unnamed protein product                                355   2e-117   
gb|AAR82851.1|  expansin-3                                              355   2e-117   Petunia x hybrida [garden petunia]
gb|AFZ78604.1|  expansin protein                                        355   3e-117   
ref|NP_001234165.1|  expansin precursor                                 355   3e-117   
emb|CAC06433.1|  expansin                                               355   3e-117   Festuca pratensis [meadow ryegrass]
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             355   3e-117   
gb|ABO32366.1|  expansin                                                355   3e-117   Litchi chinensis [litchi]
gb|AAG13982.1|AF297521_1  expansin 1                                    355   3e-117   Prunus avium [gean]
dbj|BAJ10398.1|  alpha-expansin                                         355   4e-117   
gb|AFK24458.1|  expansin 5                                              355   4e-117   
emb|CDM84787.1|  unnamed protein product                                355   4e-117   
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         355   5e-117   
ref|XP_002319409.1|  expansin S1 precursor family protein               354   6e-117   Populus trichocarpa [western balsam poplar]
ref|XP_007017076.1|  Expansin A8, ALPHA 1.11,EXPA8                      355   6e-117   
ref|XP_011021020.1|  PREDICTED: expansin-A8-like                        354   7e-117   
gb|ACX69842.1|  expansin                                                354   8e-117   
ref|XP_006358751.1|  PREDICTED: expansin-A8                             354   1e-116   
ref|XP_010108480.1|  hypothetical protein L484_010673                   354   1e-116   
emb|CDP04049.1|  unnamed protein product                                354   1e-116   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             353   2e-116   
gb|ACK43222.1|  expansin 2                                              353   2e-116   Ziziphus jujuba [Chinese jujube]
ref|NP_001105040.1|  alpha expansin1 precursor                          353   2e-116   Zea mays [maize]
gb|KHN04238.1|  Expansin-A8                                             353   2e-116   
ref|NP_001275780.1|  expansin 2 precursor                               353   2e-116   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        353   2e-116   
ref|XP_003564501.1|  PREDICTED: expansin-A2                             352   3e-116   
ref|XP_003538280.1|  PREDICTED: expansin-A8                             352   6e-116   
gb|EYU46016.1|  hypothetical protein MIMGU_mgv1a012336mg                352   7e-116   
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        352   8e-116   
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        352   9e-116   
emb|CBI15823.3|  unnamed protein product                                351   9e-116   
gb|ABR17119.1|  unknown                                                 352   9e-116   Picea sitchensis
gb|KEH35550.1|  expansin A10                                            352   1e-115   
gb|AAB38074.1|  expansin Os-EXPA2                                       351   1e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004961745.1|  PREDICTED: expansin-A4-like                        351   1e-115   
gb|KEH35551.1|  expansin A10                                            351   1e-115   
gb|AAF35901.1|AF230332_1  expansin 2                                    351   1e-115   Zinnia violacea [garden zinnia]
ref|NP_001267550.1|  expansin-A8-like precursor                         351   2e-115   
gb|AFK24457.1|  expansin 4                                              351   2e-115   
ref|XP_002276565.3|  PREDICTED: expansin-A4                             351   2e-115   Vitis vinifera
ref|XP_002518284.1|  Alpha-expansin 8 precursor, putative               351   2e-115   Ricinus communis
ref|XP_010253098.1|  PREDICTED: expansin-A8-like                        351   2e-115   
ref|XP_004294733.1|  PREDICTED: expansin-A8-like                        350   2e-115   
dbj|BAH36861.1|  alpha expansin                                         350   3e-115   Rosa hybrid cultivar
gb|ACJ70084.1|  expansin                                                350   3e-115   Diospyros kaki [Japanese persimmon]
ref|XP_009384771.1|  PREDICTED: expansin-A2                             350   3e-115   
gb|AFZ78603.1|  expansin protein                                        350   3e-115   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        350   4e-115   
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        350   4e-115   
gb|AEC46865.1|  expansin                                                350   4e-115   
dbj|BAC66696.1|  expansin                                               350   5e-115   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AFK38068.1|  unknown                                                 350   5e-115   
gb|AFK41150.1|  unknown                                                 350   5e-115   
gb|AEQ55268.1|  expansin                                                350   5e-115   
ref|XP_002280300.1|  PREDICTED: expansin-A8                             349   5e-115   Vitis vinifera
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   349   6e-115   
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        349   6e-115   
ref|XP_009804397.1|  PREDICTED: expansin-A10                            350   7e-115   
dbj|BAN09211.1|  alpha expansin                                         349   8e-115   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        349   8e-115   
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        349   8e-115   
dbj|BAJ34927.1|  similar to expansin                                    349   8e-115   
gb|KHN48407.1|  Expansin-A8                                             348   1e-114   
ref|NP_001289251.1|  expansin-A4-like precursor                         348   2e-114   
gb|AAB81662.1|  expansin                                                348   2e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_010103644.1|  hypothetical protein L484_011237                   348   2e-114   
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             348   2e-114   
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        348   2e-114   
gb|ACK87022.1|  expansin                                                348   2e-114   Diospyros kaki [Japanese persimmon]
gb|AAT94292.1|  alpha-expansin EXPA2                                    348   3e-114   Triticum aestivum [Canadian hard winter wheat]
gb|ADC35366.1|  alpha-expansin 3                                        348   3e-114   Coffea arabica [arabica coffee]
ref|NP_001055842.1|  Os05g0477600                                       347   3e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008456949.1|  PREDICTED: expansin-A8-like                        348   3e-114   
ref|NP_001281040.1|  expansin-A4-like precursor                         347   3e-114   
gb|AAD47901.1|AF085330_1  expansin                                      347   4e-114   Pinus taeda
dbj|BAJ99188.1|  predicted protein                                      347   4e-114   
ref|XP_007146869.1|  hypothetical protein PHAVU_006G077200g             347   4e-114   
ref|XP_002441263.1|  hypothetical protein SORBIDRAFT_09g023440          347   5e-114   Sorghum bicolor [broomcorn]
ref|XP_010525408.1|  PREDICTED: expansin-A8                             347   5e-114   
ref|XP_006644922.1|  PREDICTED: expansin-A2-like                        347   6e-114   
gb|ACK43884.1|  expansin                                                347   7e-114   Diospyros kaki [Japanese persimmon]
ref|NP_001240113.1|  expansin precursor                                 347   7e-114   
gb|AAB40635.1|  expansin                                                346   8e-114   Pinus taeda
ref|XP_009776279.1|  PREDICTED: expansin-A8-like isoform X1             346   1e-113   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        346   1e-113   Mirabilis jalapa
gb|KHG29916.1|  Expansin-A8 -like protein                               346   1e-113   
gb|ABY65114.1|  putative expansin                                       345   1e-113   Gerbera hybrid cultivar
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        346   1e-113   
gb|ABO30977.1|  alpha expansin protein 3                                346   2e-113   Calotropis procera
gb|ACK43886.1|  expansin                                                345   2e-113   Diospyros kaki [Japanese persimmon]
ref|NP_001242219.1|  uncharacterized protein LOC100777044 precursor     345   2e-113   
ref|XP_006842458.1|  hypothetical protein AMTR_s00077p00063420          345   2e-113   
ref|XP_003519289.1|  PREDICTED: expansin-A8-like                        345   3e-113   
ref|NP_001234085.1|  expansin precursor                                 345   3e-113   
gb|AAW88315.1|  expansin EXPA11                                         345   3e-113   Triticum aestivum [Canadian hard winter wheat]
gb|KHN40987.1|  Expansin-A8                                             344   3e-113   
gb|KHG13406.1|  Expansin-A8 -like protein                               345   3e-113   
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        345   4e-113   
ref|XP_006365348.1|  PREDICTED: expansin-A8-like                        345   4e-113   
gb|ACU14460.1|  unknown                                                 345   4e-113   Glycine max [soybeans]
ref|XP_003568245.1|  PREDICTED: expansin-A4                             345   4e-113   
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        345   5e-113   
gb|KHG27586.1|  Expansin-A8 -like protein                               344   6e-113   
gb|ACB45302.1|  expansin EXPA11                                         344   6e-113   Hordeum vulgare [barley]
gb|AAB40637.1|  expansin                                                343   6e-113   Pinus taeda
ref|XP_009387743.1|  PREDICTED: expansin-A2-like                        344   7e-113   
gb|ABF48653.1|  expansin precursor                                      344   7e-113   Vasconcellea cundinamarcensis
ref|XP_009631918.1|  PREDICTED: expansin-A4-like                        344   1e-112   
gb|ABK22806.1|  unknown                                                 343   1e-112   Picea sitchensis
gb|ACM90161.1|  expansin 3                                              343   1e-112   Pyrus pyrifolia [sha li]
gb|AAB40634.1|  expansin                                                343   1e-112   Pinus taeda
gb|ABC55453.1|  expansin protein                                        343   1e-112   Rosa x borboniana [Bourbon rose]
gb|ADN03964.1|  EXP1                                                    343   1e-112   
gb|AAS48872.1|  expansin EXPA3                                          343   1e-112   Triticum aestivum [Canadian hard winter wheat]
gb|ABG49444.1|  expansin                                                343   1e-112   Citrus sinensis [apfelsine]
ref|XP_004240235.1|  PREDICTED: expansin-A8-like                        343   2e-112   
gb|AAB40636.1|  expansin                                                342   2e-112   Pinus taeda
gb|AAW88314.1|  expansin EXPA10                                         343   2e-112   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009404081.1|  PREDICTED: expansin-A15                            342   3e-112   
ref|XP_006338442.1|  PREDICTED: expansin-A10-like                       343   4e-112   
gb|AAL87025.1|  cell wall protein Exp1 precursor                        342   4e-112   Mirabilis jalapa
gb|ABR16833.1|  unknown                                                 342   4e-112   Picea sitchensis
ref|XP_002532867.1|  Alpha-expansin 8 precursor, putative               342   5e-112   Ricinus communis
gb|ACK36942.1|  expansin                                                342   5e-112   Annona cherimola [cherimoya]
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             342   5e-112   
ref|XP_006415956.1|  hypothetical protein EUTSA_v10008578mg             342   5e-112   
ref|XP_003613849.1|  Expansin                                           342   6e-112   
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        342   7e-112   
ref|XP_008648280.1|  PREDICTED: alpha-expansin 5 isoform X1             341   7e-112   
gb|AAW88316.1|  expansin EXPA12                                         341   8e-112   Triticum aestivum [Canadian hard winter wheat]
emb|CDP00351.1|  unnamed protein product                                344   9e-112   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             341   1e-111   
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             341   1e-111   
gb|KHG01029.1|  Expansin-A15 -like protein                              341   1e-111   
ref|XP_008798561.1|  PREDICTED: expansin-A8-like                        341   1e-111   
gb|AAP48991.1|  expansin                                                341   1e-111   Sambucus nigra
ref|XP_007046062.1|  Expansin A1, ALPHA 1.2,EXPA1                       347   1e-111   
ref|XP_010108685.1|  hypothetical protein L484_015671                   340   1e-111   
ref|XP_010498998.1|  PREDICTED: expansin-A10-like isoform X2            341   1e-111   
ref|XP_003616026.1|  Expansin                                           340   2e-111   
ref|XP_010498997.1|  PREDICTED: expansin-A10-like isoform X1            341   2e-111   
ref|XP_008446373.1|  PREDICTED: expansin-A1                             340   2e-111   
ref|XP_009607404.1|  PREDICTED: expansin-A10-like                       340   3e-111   
ref|XP_010460264.1|  PREDICTED: expansin-A10-like                       340   3e-111   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        340   3e-111   
gb|AAR27327.1|  expansin EXPA1                                          340   3e-111   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009765412.1|  PREDICTED: expansin-A10                            340   4e-111   
ref|XP_009115410.1|  PREDICTED: expansin-A10 isoform X1                 339   6e-111   
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        339   6e-111   
ref|XP_009115411.1|  PREDICTED: expansin-A10 isoform X2                 339   8e-111   
gb|ACI02326.1|  expansion-related protein                               339   8e-111   Gladiolus grandiflorus
gb|AAM22622.1|AF428175_1  expansin 8 precursor                          339   8e-111   Rumex palustris
gb|AEX07594.1|  expansin 2                                              338   9e-111   
gb|AEQ55277.1|  expansin                                                338   9e-111   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             341   9e-111   
ref|XP_008456774.1|  PREDICTED: expansin-A8-like                        338   1e-110   
ref|XP_004138396.1|  PREDICTED: expansin-A8-like                        338   1e-110   
ref|XP_009141922.1|  PREDICTED: expansin-A8-like                        338   1e-110   
ref|XP_009387755.1|  PREDICTED: expansin-A2                             338   1e-110   
gb|KHN28805.1|  Expansin-A15                                            338   1e-110   
gb|AAM22621.1|  expansin 7 precursor                                    338   1e-110   Rumex palustris
gb|KHG18125.1|  Expansin-A10 -like protein                              338   1e-110   
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        338   1e-110   
ref|XP_002323665.1|  expansin S1 precursor family protein               338   1e-110   Populus trichocarpa [western balsam poplar]
ref|NP_001238053.1|  uncharacterized protein LOC100527059 precursor     338   2e-110   
ref|XP_010477818.1|  PREDICTED: expansin-A10 isoform X2                 338   2e-110   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        338   2e-110   
ref|XP_010477817.1|  PREDICTED: expansin-A10 isoform X1                 338   2e-110   
gb|ACA05165.1|  expansin 2                                              338   2e-110   Dimocarpus longan [longan]
ref|NP_001266116.1|  expansin-A15-like precursor                        338   2e-110   
ref|XP_007011319.1|  Expansin A8, ALPHA 1.11,EXPA8                      338   2e-110   
gb|AAF32409.1|AF230276_1  alpha-expansin 3                              337   2e-110   Triphysaria versicolor
ref|XP_010043148.1|  PREDICTED: expansin-A4-like                        338   2e-110   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       337   3e-110   
ref|XP_002522457.1|  Alpha-expansin 1 precursor, putative               337   3e-110   Ricinus communis
gb|ABQ45887.1|  expansin                                                337   3e-110   Pyrus pyrifolia [sha li]
ref|XP_010670609.1|  PREDICTED: expansin-A4                             337   3e-110   
gb|AAK48845.1|AF350936_1  expansin                                      337   3e-110   Prunus cerasus [pie cherry]
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                337   3e-110   
gb|AEQ28765.1|  expansin 3                                              337   4e-110   
gb|ABR04073.1|  expansin 1                                              337   4e-110   Pyrus pyrifolia [sha li]
gb|AGF90535.1|  alpha-expansin 1                                        337   4e-110   
ref|XP_004502832.1|  PREDICTED: expansin-A8-like                        337   4e-110   
ref|NP_001240136.1|  expansin-A1-like precursor                         337   4e-110   
gb|AGR44457.1|  expansin 4                                              337   5e-110   
ref|NP_173999.1|  expansin A10                                          337   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307732.1|  PREDICTED: expansin-A8-like                        337   5e-110   
ref|XP_010678491.1|  PREDICTED: expansin-A10-like                       337   5e-110   
gb|AAM62474.1|  alpha-expansin 10 precursor (At-EXP10) (AtEx10) (...    337   5e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AAR88517.1|  expansin A2                                             335   5e-110   Craterostigma plantagineum
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  337   6e-110   
emb|CDY62413.1|  BnaCnng40260D                                          337   6e-110   
gb|AGF90536.1|  expansin 2                                              336   6e-110   
ref|XP_002269517.1|  PREDICTED: expansin-A10                            336   7e-110   Vitis vinifera
gb|ABJ90221.1|  expansin 2                                              337   7e-110   Malus hupehensis
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  336   8e-110   
ref|NP_001077599.1|  expansin A10                                       337   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    336   9e-110   
gb|AAG13983.1|AF297522_1  expansin 2                                    336   9e-110   Prunus avium [gean]
gb|AAM12782.1|  putative expansin                                       335   1e-109   Capsicum annuum
dbj|BAD00014.1|  expansin                                               335   1e-109   Malus domestica [apple tree]
ref|XP_007226005.1|  hypothetical protein PRUPE_ppa010379mg             336   1e-109   
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        336   1e-109   
ref|XP_010508833.1|  PREDICTED: expansin-A8-like                        336   1e-109   
ref|XP_002315043.1|  expansin 4 family protein                          336   1e-109   Populus trichocarpa [western balsam poplar]
dbj|BAC67191.1|  expansin                                               336   1e-109   Pyrus communis
gb|ABO30978.2|  alpha expansin protein 4                                335   1e-109   Calotropis procera
gb|KHG14727.1|  Expansin-A8 -like protein                               336   1e-109   
ref|XP_011011315.1|  PREDICTED: expansin-A8-like                        336   1e-109   
ref|XP_006305472.1|  hypothetical protein CARUB_v10009909mg             337   1e-109   
dbj|BAD00015.1|  expansin                                               334   1e-109   Malus domestica [apple tree]
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         335   2e-109   
gb|ABL09849.1|  expansin 1                                              335   2e-109   Cunninghamia lanceolata [China fir]
ref|XP_006411329.1|  hypothetical protein EUTSA_v10017120mg             335   2e-109   
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             335   2e-109   
ref|XP_011075523.1|  PREDICTED: expansin-A10                            335   2e-109   
emb|CDY24897.1|  BnaC03g22750D                                          335   2e-109   
gb|AEQ55280.1|  expansin                                                335   2e-109   
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    335   2e-109   
ref|XP_009360325.1|  PREDICTED: expansin-A1                             335   2e-109   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             335   2e-109   
ref|XP_008374794.1|  PREDICTED: expansin-A8-like                        335   2e-109   
gb|AFZ78600.1|  expansin protein                                        335   2e-109   
ref|XP_010066900.1|  PREDICTED: expansin-A1                             335   2e-109   
ref|XP_008389456.1|  PREDICTED: expansin-A10                            335   2e-109   
ref|XP_009762738.1|  PREDICTED: expansin-A10-like                       335   2e-109   
gb|AAL40354.1|AF448467_1  alpha-expansin                                335   2e-109   Prunus cerasus [pie cherry]
gb|AAD49956.1|AF167360_1  expansin                                      335   3e-109   Rumex palustris
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        335   3e-109   
ref|XP_006296492.1|  hypothetical protein CARUB_v10025678mg             335   3e-109   
ref|NP_001288831.1|  expansin precursor                                 335   3e-109   
ref|XP_010517501.1|  PREDICTED: expansin-A8                             335   3e-109   
ref|XP_004297292.1|  PREDICTED: expansin-A1-like                        335   3e-109   
ref|XP_002312253.1|  expansin 4 family protein                          335   4e-109   Populus trichocarpa [western balsam poplar]
ref|XP_010505810.1|  PREDICTED: expansin-A8-like                        335   4e-109   
gb|AFB77225.1|  expansin 3                                              334   4e-109   
emb|CDY23890.1|  BnaC04g01470D                                          334   4e-109   
gb|AEQ55281.1|  expansin                                                334   5e-109   
ref|XP_010670610.1|  PREDICTED: expansin-A2-like                        334   6e-109   
ref|XP_011070988.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A10...    334   6e-109   
ref|XP_008361782.1|  PREDICTED: expansin-A1-like                        334   6e-109   
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        334   7e-109   
ref|XP_008221599.1|  PREDICTED: expansin-A1                             334   7e-109   
gb|AAM47002.1|AF512544_1  alpha-expansin precursor                      333   8e-109   
ref|XP_002881731.1|  ATEXPA8                                            334   8e-109   
gb|ABA62612.1|  expansin                                                333   8e-109   
gb|AAR09170.1|  alpha-expansin 3                                        333   8e-109   
gb|AAF35902.1|AF230333_1  expansin 3                                    333   9e-109   
ref|XP_009142702.1|  PREDICTED: expansin-A8                             334   9e-109   
gb|AFK34543.1|  unknown                                                 333   9e-109   
ref|XP_009389577.1|  PREDICTED: expansin-A10-like                       333   1e-108   
ref|NP_001280181.1|  expansin-A8 precursor                              333   1e-108   
gb|ACM90160.1|  expansin 2                                              333   1e-108   
gb|AAL87022.1|  cell wall protein EXP3 precursor                        333   1e-108   
ref|XP_007157607.1|  hypothetical protein PHAVU_002G083600g             333   1e-108   
ref|NP_181593.1|  expansin A8                                           333   1e-108   
dbj|BAC67192.1|  expansin                                               333   1e-108   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       333   1e-108   
dbj|BAJ10397.1|  alpha-expansin                                         333   1e-108   
gb|AAC33530.1|  expansin                                                333   1e-108   
dbj|BAC67189.1|  expansin                                               333   2e-108   
ref|XP_006438715.1|  hypothetical protein CICLE_v10032548mg             333   2e-108   
ref|XP_010551434.1|  PREDICTED: expansin-A10 isoform X2                 333   2e-108   
ref|XP_007137631.1|  hypothetical protein PHAVU_009G142800g             333   2e-108   
ref|XP_009629442.1|  PREDICTED: expansin-A10-like                       333   2e-108   
ref|XP_003607738.1|  Expansin                                           334   2e-108   
ref|XP_010551433.1|  PREDICTED: expansin-A10 isoform X1                 333   2e-108   
ref|XP_010093601.1|  hypothetical protein L484_006489                   332   3e-108   
ref|XP_004490713.1|  PREDICTED: expansin-A8-like                        332   3e-108   
ref|XP_010527915.1|  PREDICTED: expansin-A15                            332   3e-108   
ref|NP_001289209.1|  expansin precursor                                 332   3e-108   
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             332   3e-108   
ref|XP_008369371.1|  PREDICTED: expansin-A8                             332   3e-108   
gb|AAM22627.1|AF428180_1  expansin 13 precursor                         332   4e-108   
ref|NP_001266033.1|  expansin-A15-like precursor                        332   4e-108   
ref|NP_001289231.1|  expansin precursor                                 332   4e-108   
ref|XP_007218849.1|  hypothetical protein PRUPE_ppa010382mg             332   5e-108   
ref|XP_004246275.1|  PREDICTED: expansin-A10-like                       332   5e-108   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             332   5e-108   
ref|XP_009384320.1|  PREDICTED: expansin-A2-like                        332   5e-108   
ref|XP_008783801.1|  PREDICTED: expansin-A10                            332   5e-108   
gb|AIG88581.1|  expansin                                                332   6e-108   
gb|ADY68810.1|  alpha-expansin 1                                        332   6e-108   
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        332   6e-108   
gb|ABY55298.1|  expansin                                                331   6e-108   
gb|AFB77224.1|  expansin 2                                              331   7e-108   
ref|XP_007205756.1|  hypothetical protein PRUPE_ppa010260mg             332   7e-108   
gb|AAM22628.1|AF428181_1  expansin 14 precursor                         331   7e-108   
gb|AAM22632.1|AF428185_1  expansin 18 precursor                         331   7e-108   
gb|AEN70871.1|  alpha-expansin 1                                        332   7e-108   
gb|AFQ21787.1|  EXP4 protein                                            331   8e-108   
ref|XP_010937180.1|  PREDICTED: expansin-A10-like                       331   8e-108   
ref|XP_007099524.1|  Expansin A8, ALPHA 1.11,EXPA8                      331   8e-108   
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         331   9e-108   
gb|ACK43223.1|  alpha-expansin                                          331   9e-108   
ref|XP_009399909.1|  PREDICTED: expansin-A2-like                        333   1e-107   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        331   1e-107   
emb|CBI31944.3|  unnamed protein product                                330   1e-107   
ref|XP_009369278.1|  PREDICTED: expansin-A1-like                        331   1e-107   
ref|XP_002272879.1|  PREDICTED: expansin-A10                            330   1e-107   
emb|CDP02244.1|  unnamed protein product                                330   1e-107   
gb|AEN70887.1|  alpha-expansin 1                                        331   1e-107   
gb|AEN70881.1|  alpha-expansin 1                                        330   2e-107   
gb|AEN70869.1|  alpha-expansin 1                                        330   2e-107   
ref|XP_002893383.1|  alpha-expansin 10 precursor                        330   2e-107   
gb|AEN70867.1|  alpha-expansin 1                                        330   2e-107   
gb|KHG02505.1|  Expansin-A2                                             330   2e-107   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             330   2e-107   
gb|AEN70885.1|  alpha-expansin 1                                        330   2e-107   
ref|XP_009589509.1|  PREDICTED: expansin-A10-like                       330   2e-107   
gb|AEN70868.1|  alpha-expansin 1                                        330   2e-107   
gb|ABD48785.1|  alpha-expansin 1                                        330   2e-107   
gb|AEQ28764.1|  expansin 1                                              330   2e-107   
gb|EYU35213.1|  hypothetical protein MIMGU_mgv1a020600mg                329   2e-107   
ref|XP_006346675.1|  PREDICTED: expansin-A10-like                       330   2e-107   
ref|XP_009760985.1|  PREDICTED: expansin-A10-like                       329   3e-107   
ref|XP_009399925.1|  PREDICTED: expansin-A15-like                       330   3e-107   
gb|AAF17570.1|AF202119_1  alpha-expansin                                330   3e-107   
gb|AEN70875.1|  alpha-expansin 1                                        330   3e-107   
dbj|BAO57280.1|  alpha-expansin                                         329   3e-107   
ref|XP_008780525.1|  PREDICTED: expansin-A15-like isoform X2            329   4e-107   
ref|XP_008245002.1|  PREDICTED: expansin-A4-like                        330   4e-107   
dbj|BAD00012.1|  expansin                                               328   4e-107   
gb|ABR18394.1|  unknown                                                 329   4e-107   
ref|XP_008393347.1|  PREDICTED: expansin-A1-like                        329   4e-107   
gb|KFK33492.1|  hypothetical protein AALP_AA5G020100                    329   5e-107   
gb|ABK25460.1|  unknown                                                 328   6e-107   
gb|KHN18562.1|  Expansin-A15                                            329   6e-107   
gb|ACD37706.1|  alpha expansin                                          329   6e-107   
ref|XP_008374554.1|  PREDICTED: expansin-A1-like                        329   7e-107   
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          328   7e-107   
gb|AAM08930.1|  expansin 1                                              329   7e-107   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       328   7e-107   
ref|XP_008367551.1|  PREDICTED: expansin-A1-like                        328   9e-107   
gb|AAU90318.1|  Alpha-expansin 1 precursor , putative                   328   1e-106   
gb|ABL86681.1|  EX4                                                     328   1e-106   
emb|CDY64407.1|  BnaC02g47920D                                          327   1e-106   
gb|AEN70883.1|  alpha-expansin 1                                        328   1e-106   
dbj|BAC66697.1|  expansin                                               328   2e-106   
gb|ABF74687.1|  expansin                                                327   2e-106   
gb|KDP31268.1|  hypothetical protein JCGZ_11644                         328   2e-106   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               328   2e-106   
gb|AAM46997.1|AF512539_1  alpha-expansin precursor                      328   2e-106   
ref|XP_009390308.1|  PREDICTED: expansin-A10-like                       328   2e-106   
gb|KFK41377.1|  hypothetical protein AALP_AA2G122700                    327   2e-106   
emb|CAH18934.1|  expansin                                               328   2e-106   
gb|ABL86680.1|  EXA1                                                    328   2e-106   
ref|XP_002887242.1|  ATEXPA1                                            327   2e-106   
ref|XP_004299347.1|  PREDICTED: expansin-A1-like                        327   2e-106   
ref|XP_006600699.1|  PREDICTED: expansin-A15-like isoform X2            328   2e-106   
ref|XP_002876856.1|  ATEXPA15                                           327   2e-106   
ref|NP_178409.2|  expansin A15                                          327   3e-106   
ref|XP_010029307.1|  PREDICTED: expansin-A10-like                       327   3e-106   
ref|XP_006395739.1|  hypothetical protein EUTSA_v10004804mg             327   3e-106   
gb|ADY68811.1|  alpha-expansin 1                                        327   3e-106   
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        327   3e-106   
gb|AAY43797.1|  expansin                                                327   3e-106   
ref|XP_010532759.1|  PREDICTED: expansin-A10 isoform X1                 327   3e-106   
ref|XP_010532766.1|  PREDICTED: expansin-A10 isoform X2                 327   3e-106   
gb|AAC32927.1|  putative expansin                                       327   3e-106   
ref|XP_009339059.1|  PREDICTED: expansin-A1-like                        327   3e-106   
ref|XP_008230781.1|  PREDICTED: expansin-A15                            327   4e-106   
ref|NP_001234364.1|  expansin precursor                                 327   4e-106   
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       327   4e-106   
gb|EYU22406.1|  hypothetical protein MIMGU_mgv1a012585mg                327   4e-106   
ref|XP_009346913.1|  PREDICTED: expansin-A4-like                        327   4e-106   
ref|XP_003549683.2|  PREDICTED: expansin-A15-like isoform X1            327   4e-106   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              327   4e-106   
ref|XP_010502317.1|  PREDICTED: expansin-A15                            327   4e-106   
ref|XP_004302596.1|  PREDICTED: expansin-A2-like                        327   4e-106   
ref|XP_010670611.1|  PREDICTED: expansin-A10                            327   4e-106   
dbj|BAB32732.1|  expansin                                               325   5e-106   
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             327   5e-106   
gb|AEQ55276.1|  expansin                                                326   5e-106   
ref|XP_011098644.1|  PREDICTED: expansin-A10                            326   6e-106   
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             326   6e-106   
ref|XP_004953873.1|  PREDICTED: expansin-A5-like                        328   6e-106   
gb|AEN70870.1|  alpha-expansin 1                                        326   7e-106   
ref|XP_007138173.1|  hypothetical protein PHAVU_009G186400g             326   7e-106   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       326   8e-106   
gb|AAF32411.1|AF230278_1  alpha-expansin 1                              326   8e-106   
ref|XP_006364587.1|  PREDICTED: expansin-A15-like                       326   8e-106   
ref|XP_009129104.1|  PREDICTED: expansin-A15                            326   8e-106   
emb|CDY03019.1|  BnaC07g22080D                                          326   8e-106   
gb|AEQ55273.1|  expansin                                                326   9e-106   
ref|XP_008802577.1|  PREDICTED: expansin-A10-like                       325   1e-105   
ref|XP_002283741.1|  PREDICTED: expansin-A10                            325   1e-105   
gb|AAR88519.1|  expansin A1                                             326   1e-105   
ref|XP_008370248.1|  PREDICTED: expansin-A4-like                        325   1e-105   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       325   2e-105   
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       327   2e-105   
ref|XP_008363931.1|  PREDICTED: expansin-A4-like                        325   2e-105   
ref|XP_002284858.1|  PREDICTED: expansin-A1                             325   2e-105   
ref|XP_011017384.1|  PREDICTED: expansin-A1-like                        325   2e-105   
ref|XP_006445551.1|  hypothetical protein CICLE_v10017738mg             325   2e-105   
gb|AAC39512.1|  expansin                                                325   2e-105   
ref|XP_010532776.1|  PREDICTED: expansin-A10 isoform X3                 325   3e-105   
ref|NP_001105642.1|  alpha expansin2 precursor                          325   3e-105   
emb|CDX93168.1|  BnaC04g47280D                                          343   3e-105   
ref|NP_177112.1|  expansin A1                                           324   4e-105   
gb|AAB38070.1|  expansin At-EXPA1                                       324   4e-105   
ref|XP_009767600.1|  PREDICTED: expansin-A15-like                       324   4e-105   
gb|AAO92741.1|  expansin                                                324   4e-105   
emb|CDY06975.1|  BnaA04g23400D                                          339   4e-105   
emb|CAN79985.1|  hypothetical protein VITISV_038036                     324   5e-105   
ref|XP_011095130.1|  PREDICTED: expansin-A4-like                        324   6e-105   
gb|AFW73392.1|  alpha-expansin 15                                       325   7e-105   
ref|XP_003527088.1|  PREDICTED: expansin-A15-like                       323   9e-105   
ref|XP_007215892.1|  hypothetical protein PRUPE_ppa010654mg             323   9e-105   
emb|CBI15209.3|  unnamed protein product                                325   1e-104   
ref|XP_004304289.1|  PREDICTED: expansin-A15-like                       323   1e-104   
ref|XP_003523015.1|  PREDICTED: expansin-A15-like                       323   1e-104   
emb|CDY45181.1|  BnaA06g33850D                                          323   1e-104   
emb|CDY40938.1|  BnaC06g30760D                                          323   1e-104   
ref|NP_001288866.1|  expansin-A1 precursor                              323   1e-104   
ref|XP_002306037.1|  expansin S1 precursor family protein               322   1e-104   
ref|XP_002454289.1|  hypothetical protein SORBIDRAFT_04g028090          324   1e-104   
gb|AFZ78601.1|  expansin protein                                        322   2e-104   
ref|XP_006366709.1|  PREDICTED: expansin-A10-like                       322   2e-104   
ref|XP_010552569.1|  PREDICTED: expansin-A1-like                        322   2e-104   
gb|AEQ55278.1|  expansin                                                322   2e-104   
gb|ABD98053.1|  cell wall protein Exp4 precursor                        323   2e-104   
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       322   2e-104   
emb|CDY44070.1|  BnaA02g14340D                                          322   3e-104   
gb|KDO43109.1|  hypothetical protein CISIN_1g025809mg                   322   3e-104   
ref|XP_010651411.1|  PREDICTED: expansin-A10                            322   3e-104   
ref|XP_003616412.1|  Expansin                                           322   4e-104   
ref|XP_010321849.1|  PREDICTED: expansin-A10-like                       321   4e-104   
dbj|BAH36863.1|  alpha expansin                                         321   4e-104   
gb|AAM46998.1|AF512540_1  alpha-expansin precursor                      322   5e-104   
gb|AAK48847.1|AF350938_1  expansin                                      321   5e-104   
gb|EPS58017.1|  hypothetical protein M569_16799                         321   5e-104   
gb|ACG38925.1|  alpha-expansin 15 precursor                             323   5e-104   
ref|NP_001288907.1|  expansin-A15-like precursor                        321   6e-104   
gb|AAQ08016.1|  expansin                                                321   8e-104   
gb|AEQ55279.1|  expansin                                                320   1e-103   
gb|AFK38404.1|  unknown                                                 320   1e-103   
ref|XP_009409119.1|  PREDICTED: expansin-A10-like                       320   1e-103   
ref|XP_006398992.1|  hypothetical protein EUTSA_v10015496mg             320   2e-103   
ref|XP_003554526.2|  PREDICTED: expansin-A15-like isoform X1            320   2e-103   
ref|NP_001117573.1|  expansin A1                                        321   2e-103   
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     319   2e-103   
ref|XP_010543681.1|  PREDICTED: expansin-A2                             320   2e-103   
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         319   3e-103   
ref|XP_002297611.1|  expansin S1 precursor family protein               319   3e-103   
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        320   3e-103   
ref|XP_004141444.1|  PREDICTED: expansin-A5-like                        319   3e-103   
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             319   4e-103   
ref|XP_009406842.1|  PREDICTED: expansin-A15-like                       319   4e-103   
ref|XP_011002483.1|  PREDICTED: expansin-A10-like                       319   4e-103   
ref|NP_849869.1|  expansin A1                                           320   4e-103   
emb|CDY71146.1|  BnaCnng71550D                                          319   5e-103   
ref|NP_001048101.1|  Os02g0744200                                       320   5e-103   
ref|XP_006443365.1|  hypothetical protein CICLE_v10021887mg             318   6e-103   
ref|XP_004172109.1|  PREDICTED: expansin-A5-like                        318   6e-103   
ref|XP_002974898.1|  hypothetical protein SELMODRAFT_174522             319   7e-103   
gb|KHN26255.1|  Expansin-A15                                            317   7e-103   
ref|XP_008459328.1|  PREDICTED: expansin-A5-like                        318   8e-103   
ref|XP_010032826.1|  PREDICTED: expansin-A10-like                       318   1e-102   
gb|ACZ57921.1|  expansin protein 1                                      318   1e-102   
gb|KCW52314.1|  hypothetical protein EUGRSUZ_J01729                     320   1e-102   
gb|AIX87539.1|  EXP1                                                    318   1e-102   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        318   2e-102   
ref|XP_011048141.1|  PREDICTED: expansin-A15-like                       317   2e-102   



>dbj|BAO57278.1| alpha-expansin [Ipomoea nil]
Length=249

 Score =   398 bits (1022),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 202/226 (89%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTNIAALSTALFNNGLACGSCYE
Sbjct  24   GDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNIAALSTALFNNGLACGSCYE  83

Query  385  LMCTGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            LMC GPYC+PGS+TITATDFCPPNPGL NDNGGWCN PR HFDMA+PAYLQI +YRAGIV
Sbjct  84   LMCNGPYCVPGSITITATDFCPPNPGLSNDNGGWCNSPRQHFDMAQPAYLQIAIYRAGIV  143

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV+YRRVPCRKKGGIRFTINGH +FNLVLVTNVGG GDVHAVAIKGS+TGWQQMSRNWGQ
Sbjct  144  PVSYRRVPCRKKGGIRFTINGHTYFNLVLVTNVGGSGDVHAVAIKGSKTGWQQMSRNWGQ  203

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNSVL+GQSLSFQVTTGDGRTV S NAAP++W FGQT+EGAQF
Sbjct  204  NWQSNSVLDGQSLSFQVTTGDGRTVISNNAAPANWHFGQTFEGAQF  249



>ref|XP_011084824.1| PREDICTED: expansin-A2-like [Sesamum indicum]
Length=273

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 218/253 (86%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRT  309
            MAVP+   +  LL  F +FC+   +GDYGGWQ+A+ATFYGG DASGTMGGACGYGNLY  
Sbjct  21   MAVPTMSMLSLLLFSFFTFCLRATYGDYGGWQSAYATFYGGGDASGTMGGACGYGNLYSQ  80

Query  310  GYGTNIAALSTALFNNGLACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndngg  483
            GYGTN AALSTALFNNGL+CG+C+EL C+G   +CL GS+ +TAT+FCPPNP LPN+NGG
Sbjct  81   GYGTNTAALSTALFNNGLSCGACFELRCSGQPKWCLSGSIMVTATNFCPPNPSLPNNNGG  140

Query  484  WCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNV  663
            WCNPPR HFD+A+PA+LQI  YRAGIVPV++RRVPCRKKGGIRFTINGH +FNLVL+TNV
Sbjct  141  WCNPPRQHFDLAQPAFLQIAQYRAGIVPVSFRRVPCRKKGGIRFTINGHSYFNLVLITNV  200

Query  664  GGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPS  843
             G GDVH+V+IKGSRTGWQ MSRNWGQNWQSNS LNGQSLSF+VTT DGRTVTS+N  P 
Sbjct  201  AGAGDVHSVSIKGSRTGWQSMSRNWGQNWQSNSYLNGQSLSFRVTTSDGRTVTSYNVVPG  260

Query  844  DWQFGQTYEGAQF  882
            +WQFGQT+EG QF
Sbjct  261  NWQFGQTFEGGQF  273



>gb|AEQ55270.1| expansin [Breonia chinensis]
 gb|AEQ55285.1| expansin [Breonia chinensis]
Length=252

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 208/234 (89%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+   FGDYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+
Sbjct  19   CLRTTFGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  78

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPPR HFD+AEPA+LQI
Sbjct  79   CGSCYEIRCDSDPKWCLPGTITVTATNFCPPNPALPNDNGGWCNPPRQHFDLAEPAFLQI  138

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV ++RVPCRKKGG+RFTINGH +FNLVLVTNV G GDVH+V+IKGSRTGWQ
Sbjct  139  AQYRAGIVPVAFQRVPCRKKGGVRFTINGHSYFNLVLVTNVAGAGDVHSVSIKGSRTGWQ  198

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQ+T+ DGRT+TS+N AP++WQFGQT+EG QF
Sbjct  199  PMSRNWGQNWQSNSYLNGQSLSFQITSSDGRTLTSYNVAPANWQFGQTFEGGQF  252



>emb|CDP13911.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   364 bits (935),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 207/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+  AFGDYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGLA
Sbjct  2    CIPTAFGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGLA  61

Query  367  CGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C      CLPG++T+TAT+FCPPNP LPNDNGGWCNPPR HFD+AEPA+LQI
Sbjct  62   CGSCYEIRCDSDPQACLPGTITVTATNFCPPNPALPNDNGGWCNPPRQHFDLAEPAFLQI  121

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV+++RVPC KKGG+R+TINGH +FNLVLVTNV G GDVH VAIKGSRTGWQ
Sbjct  122  AQYRAGIVPVSFQRVPCSKKGGVRYTINGHSYFNLVLVTNVAGAGDVHTVAIKGSRTGWQ  181

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQ+LSFQ+TT DGRT+TS+N AP++WQFGQT+EG QF
Sbjct  182  SMSRNWGQNWQSNSYLNGQTLSFQITTSDGRTLTSYNVAPANWQFGQTFEGGQF  235



>gb|ADC35364.1| alpha-expansin 1 [Coffea arabica]
Length=257

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 205/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+  AFGDYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGLA
Sbjct  24   CIPTAFGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGLA  83

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C      CLPG++T+TAT+FCP NP LPNDNGGWCNPPR HFD+AEPA+LQI
Sbjct  84   CGSCYEIRCDSDPEACLPGTITVTATNFCPANPALPNDNGGWCNPPRQHFDLAEPAFLQI  143

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV ++RVPC KKGG+R+TINGH +FNLVLVTNV G GDVH VAIKGSRTGWQ
Sbjct  144  AQYRAGIVPVAFQRVPCSKKGGVRYTINGHSYFNLVLVTNVAGAGDVHTVAIKGSRTGWQ  203

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQ+LSFQ+TT DGRT+TS+N AP++WQFGQT+EG QF
Sbjct  204  SMSRNWGQNWQSNSYLNGQTLSFQITTSDGRTLTSYNVAPANWQFGQTFEGGQF  257



>ref|XP_010031088.1| PREDICTED: expansin-A8-like [Eucalyptus grandis]
 gb|KCW50355.1| hypothetical protein EUGRSUZ_J00120 [Eucalyptus grandis]
Length=249

 Score =   362 bits (930),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 206/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+  AFGDYGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+
Sbjct  16   CLKSAFGDYGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  75

Query  367  CGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYE+ C     +CLPG++ +TAT+FCPPN  L NDNGGWCNPP  HFDMAEPA+LQI
Sbjct  76   CGACYEMRCNDDPRWCLPGTIMVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQI  135

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVPV++RRVPC KKGG+RFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ
Sbjct  136  AQYKAGIVPVSFRRVPCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQ  195

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSN+ +NGQ+LSFQVTT DGRTVTS+NAAP++WQFGQT+EG+QF
Sbjct  196  AMSRNWGQNWQSNAYMNGQALSFQVTTSDGRTVTSYNAAPANWQFGQTFEGSQF  249



>gb|ABB59694.1| alpha-expansin 2 [Gossypium hirsutum]
Length=252

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 204/235 (87%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDY-GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+  AFGDY GGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  18   CLRGAFGDYVGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  77

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQ
Sbjct  78   SCGSCYEMRCDSDPKWCLPGSITVTATNFCPPNLALSNDNGGWCNPPLQHFDLAEPAFLQ  137

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVP+++RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGW
Sbjct  138  IAQYRAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGW  197

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSNS LNGQSLSFQVTT DGRTVTS+N AP +WQFGQT+EG QF
Sbjct  198  QSMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTFEGDQF  252



>dbj|BAK05504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GDYG WQTAHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGDYGSWQTAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMCTGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            YEL C G  C+PGS+TITAT+ CPPN  LPND+GGWCNPPR HFDMAEPAYLQIG+YRAG
Sbjct  82   YELKCQGSSCVPGSITITATNLCPPNYALPNDDGGWCNPPRAHFDMAEPAYLQIGIYRAG  141

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+YRRVPC KKGG+RFTINGH +FNLVLVTNV G GDV +V+IKGS +GWQ MSRNW
Sbjct  142  IVPVSYRRVPCVKKGGMRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSSGWQAMSRNW  201

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSN+ L+GQSLSF+VT  DGRTVTS NAAP+ W FGQT+EG QF
Sbjct  202  GQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPAGWSFGQTFEGGQF  249



>ref|XP_009780854.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=253

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 203/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H  F DYGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  20   CFHATFADYGGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLT  79

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C   G  CL GS+ +TAT+FCPPNP LPN+NGGWCNPP  HFD+A+PA+LQI
Sbjct  80   CGACYELTCNNDGQSCLQGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQI  139

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV++RRVPCR+KGG+RFTINGH FFNLVLVTNVGG GDV +V+IKGS TGWQ
Sbjct  140  AKYRAGIVPVSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGSNTGWQ  199

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQ+N+ LNGQSLSFQVTT DGRT+TS NAAP++WQFGQT+EGAQF
Sbjct  200  TMSRNWGQNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEGAQF  253



>gb|AAC96081.1| alpha-expansin precursor [Nicotiana tabacum]
Length=249

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 203/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H  F DYGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  16   CFHATFADYGGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLT  75

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C   G  CL GS+ +TAT+FCPPNP LPN+NGGWCNPP  HFD+A+PA+LQI
Sbjct  76   CGACYELTCNNDGQSCLQGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQI  135

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV++RRVPCR+KGG+RFTINGH FFNLVLVTNVGG GDV +V+IKGS TGWQ
Sbjct  136  AKYRAGIVPVSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGSNTGWQ  195

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQ+N+ LNGQSLSFQVTT DGRT+TS NAAP++WQFGQT+EGAQF
Sbjct  196  TMSRNWGQNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEGAQF  249



>gb|AEQ55272.1| expansin [Breonia chinensis]
 gb|AEQ55287.1| expansin [Breonia chinensis]
Length=253

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 206/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+   FG YG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+
Sbjct  20   CLRTTFGYYGSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  79

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPPR HFD+AEPA+LQI
Sbjct  80   CGSCYEIRCDSDPKWCLPGTITVTATNFCPPNPALPNDNGGWCNPPRQHFDLAEPAFLQI  139

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV ++RVPC KKGG+RFTINGH +FNLVLVTNVGG GDVH+V+IKG+RTGWQ
Sbjct  140  AQYRAGIVPVAFQRVPCGKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGARTGWQ  199

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQ+TT DGRT+TS+N AP++WQFGQT+EG QF
Sbjct  200  SMSRNWGQNWQSNSYLNGQSLSFQITTSDGRTLTSYNVAPANWQFGQTFEGGQF  253



>ref|XP_002456550.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
 gb|EES01670.1| hypothetical protein SORBIDRAFT_03g038290 [Sorghum bicolor]
Length=252

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 203/233 (87%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
             H A GDYGGWQ+AHATFYGG DASGTMGGACGYGN+Y TGYGTN AALSTALFN+G AC
Sbjct  20   AHRAAGDYGGWQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALFNDGAAC  79

Query  370  GSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYEL C   G  CLPG++T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMA+PA+LQI 
Sbjct  80   GSCYELRCDNDGQSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQPAFLQIA  139

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ 
Sbjct  140  QYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTGWQP  199

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS+L+GQSLSFQVT  DGRTVTS   AP+ WQFGQT+EGAQF
Sbjct  200  MSRNWGQNWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGWQFGQTFEGAQF  252



>ref|XP_002520863.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
 gb|EEF41572.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
Length=252

 Score =   359 bits (922),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 202/229 (88%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +GDYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCY
Sbjct  24   YGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCY  83

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CLPG++T+TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  YRA
Sbjct  84   EMRCDNDPKWCLPGTITVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRA  143

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV++RR+PC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGS+TGWQ MSRN
Sbjct  144  GIVPVSFRRIPCAKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQTMSRN  203

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS +NGQSLSFQVTT DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  204  WGQNWQSNSYMNGQSLSFQVTTSDGRTVTSYNVAPANWQFGQTFEGGQF  252



>gb|AEE69072.1| expansin-5 [Petunia hybrid cultivar]
Length=258

 Score =   359 bits (922),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 206/232 (89%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H+ F DYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG
Sbjct  27   HVTFADYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCG  86

Query  373  SCYELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CY+LMC     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+LQ+  
Sbjct  87   ACYQLMCRNDAQWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLQLAQ  146

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVLVTNVGG GDV++V+IKG+R+GWQ M
Sbjct  147  YRAGIVPVSFRRVPCNKKGGIRFTINGHSYFNLVLVTNVGGAGDVNSVSIKGARSGWQTM  206

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSN  LNGQSLSFQVTT DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  207  SRNWGQNWQSNVNLNGQSLSFQVTTSDGRTVTSYNVAPANWQFGQTFEGLQF  258



>ref|NP_001265970.1| expansin-A8-like precursor [Cicer arietinum]
 emb|CAC19184.1| alpha-expansin [Cicer arietinum]
Length=260

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +  A  DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  28   MQSAIADYGGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  87

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPNP L N+NGGWCNPP  HFDMAEPA+LQI 
Sbjct  88   GSCYEMRCNDDPRWCKPGSIIVTATNFCPPNPSLANNNGGWCNPPLQHFDMAEPAFLQIA  147

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGSRTGWQ 
Sbjct  148  EYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSRTGWQS  207

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ LSFQVTT DGRT+TS+N APS+WQFGQT++GAQF
Sbjct  208  MSRNWGQNWQSNSYLNGQPLSFQVTTSDGRTMTSYNVAPSNWQFGQTFQGAQF  260



>gb|AGU13763.1| expansin [Rehmannia glutinosa]
 gb|AGU13764.1| expansin [Rehmannia glutinosa]
Length=253

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 207/233 (89%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +   +GDYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  21   LRATYGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  80

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYEL C+    +CL GS+ +TAT+FCPPNP LPNDNGGWCNPPR HFD+A+PA+LQI 
Sbjct  81   GSCYELTCSSDPRWCLRGSIIVTATNFCPPNPSLPNDNGGWCNPPRQHFDLAQPAFLQIA  140

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPCRKKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGS+TGWQ 
Sbjct  141  QYRAGIVPVSFRRVPCRKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSKTGWQS  200

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            +SRNWGQNWQSNS LNGQSLSF+VTT DGRT+ S N AP++WQFGQT+EG+QF
Sbjct  201  LSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTLISNNVAPANWQFGQTFEGSQF  253



>ref|XP_010252076.1| PREDICTED: expansin-A8-like [Nelumbo nucifera]
Length=253

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 200/229 (87%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            FGDYGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+CY
Sbjct  25   FGDYGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACY  84

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CLPG++T+TAT+FCPPN  L NDNGGWCNPP  HFDMAEPA+LQI  YRA
Sbjct  85   EMKCNDDPKWCLPGTITVTATNFCPPNFALANDNGGWCNPPLQHFDMAEPAFLQIAQYRA  144

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRTGWQ MSRN
Sbjct  145  GIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQAMSRN  204

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQ+LSFQVTT DGRT+TS+N AP+ WQFGQT+EGAQF
Sbjct  205  WGQNWQSNSYLNGQTLSFQVTTSDGRTITSYNVAPAGWQFGQTFEGAQF  253



>ref|XP_011080662.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=253

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 201/233 (86%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H    DYGGW   HATFYGGSDASGTMGGACGYGNLY  GYGTN  ALSTALFNNGL C
Sbjct  21   LHTTEADYGGWDNGHATFYGGSDASGTMGGACGYGNLYSQGYGTNTVALSTALFNNGLTC  80

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CYE+ C     +CLPG++T+TAT+FCPPN  LPN++GGWCNPP  HFDMAEPA+LQI 
Sbjct  81   GACYEMRCANDPKWCLPGTITVTATNFCPPNFALPNNDGGWCNPPLQHFDMAEPAFLQIA  140

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTING+++FNLVL+TNVGG GDVHAV+IKGSRTGWQ 
Sbjct  141  QYRAGIVPVVFRRVPCVKKGGIRFTINGNLYFNLVLITNVGGAGDVHAVSIKGSRTGWQP  200

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS L+GQSLSFQVTT DGRT+TS+N APSDWQFGQT+EG QF
Sbjct  201  MSRNWGQNWQSNSYLHGQSLSFQVTTSDGRTLTSYNVAPSDWQFGQTFEGGQF  253



>gb|KEH34458.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 202/230 (88%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC
Sbjct  31   AIADYGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  90

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +C PGS+ +TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPAYLQI  YR
Sbjct  91   YEMRCNDDPRWCKPGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAYLQIAEYR  150

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC KKGG+RFTINGH +FNLVLVTNVGG GDVH+++IKGSRTGWQ MSR
Sbjct  151  AGIVPVSFRRVPCFKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSISIKGSRTGWQPMSR  210

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRT+TSFN AP++WQFGQT++GAQF
Sbjct  211  NWGQNWQSNSYLNGQSLSFQVTTSDGRTMTSFNVAPANWQFGQTFQGAQF  260



>gb|EYU20096.1| hypothetical protein MIMGU_mgv1a012489mg [Erythranthe guttata]
Length=249

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 205/234 (88%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+   +GDYGGW TAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  16   CLTATYGDYGGWDTAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLT  75

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C     +CL G++T+TAT+FCPPNP LPNDNGGWCNPPR HFD+AEPA+LQI
Sbjct  76   CGACYELSCASDPKWCLGGTITVTATNFCPPNPSLPNDNGGWCNPPRQHFDLAEPAFLQI  135

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV++RRVPC+KKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGS TGWQ
Sbjct  136  AQYRAGIVPVSFRRVPCKKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSNTGWQ  195

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS +NGQSLSFQVTT DGRT+TS NAAP+ WQFGQT+ G+QF
Sbjct  196  AMSRNWGQNWQSNSYINGQSLSFQVTTSDGRTLTSNNAAPAGWQFGQTFTGSQF  249



>gb|AEQ55284.1| expansin [Breonia chinensis]
Length=255

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 200/233 (86%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H    DYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTA+FNNGLAC
Sbjct  23   LHFTKADYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNNGLAC  82

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C G   +CL G++T+TAT+FCPPN  LPNDNGGWCNPPR HFD+AEPA+LQI 
Sbjct  83   GSCYEMRCDGDPKWCLSGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIA  142

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRV C KKG IRFTINGH +FNLVLVTNV G GD+HAV+IKGSRTGWQ 
Sbjct  143  QYRAGIVPVAFRRVTCVKKGSIRFTINGHSYFNLVLVTNVAGAGDIHAVSIKGSRTGWQS  202

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQSLSF VT  DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  203  MSRNWGQNWQSNSYLNGQSLSFMVTASDGRTVTSYNVAPANWQFGQTFEGGQF  255



>gb|AEQ55269.1| expansin [Breonia chinensis]
Length=255

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 200/233 (86%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H    DYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTA+FNNGLAC
Sbjct  23   LHFTKADYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNNGLAC  82

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C G   +CL G++T+TAT+FCPPN  LPNDNGGWCNPPR HFD+AEPA+LQI 
Sbjct  83   GSCYEMRCDGDPKWCLSGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIA  142

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRV C KKG IRFTINGH +FNLVLVTNV G GD+HAV+IKGSRTGWQ 
Sbjct  143  QYRAGIVPVAFRRVTCVKKGSIRFTINGHSYFNLVLVTNVAGAGDIHAVSIKGSRTGWQS  202

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQSLSF VT  DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  203  MSRNWGQNWQSNSYLNGQSLSFMVTASDGRTVTSYNVAPANWQFGQTFEGGQF  255



>gb|ACA05166.1| expansin 3 [Dimocarpus longan]
Length=253

 Score =   357 bits (917),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/253 (72%), Positives = 209/253 (83%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRT  309
            MAV +  ++  L     S C+   +GD GGWQ+ HATFYGG DASGTMGGACGYGNLY  
Sbjct  1    MAVAAFSAVSLLFFMLISLCLQAVYGDDGGWQSGHATFYGGGDASGTMGGACGYGNLYGQ  60

Query  310  GYGTNIAALSTALFNNGLACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndngg  483
            GYGTN AALSTALFNNGL+CGSCYE+ C     +CLPGSV +TAT+FCPPN  L NDNGG
Sbjct  61   GYGTNTAALSTALFNNGLSCGSCYEMKCDKDPKWCLPGSVIVTATNFCPPNNALANDNGG  120

Query  484  WCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNV  663
            WCNPP  HFDMAEPA+LQI  YRAGIVP+++RRVPC KKGGIRFT+NGH +FNLVL+TNV
Sbjct  121  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTVNGHSYFNLVLITNV  180

Query  664  GGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPS  843
             G GDVH+V+IKGS+TGWQ MSRNWGQNWQSNS LNGQSLSFQVTT DG+TVTS+N  P+
Sbjct  181  AGAGDVHSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTSYNVVPA  240

Query  844  DWQFGQTYEGAQF  882
            +WQFGQT+ GAQF
Sbjct  241  NWQFGQTFSGAQF  253



>gb|KDP45714.1| hypothetical protein JCGZ_17321 [Jatropha curcas]
Length=253

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H    DYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  21   LHAILADYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  80

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CYE+ C     +CL G++T+TAT+FCPPNP LPN+NGGWCNPP  HFD+AEPA+LQI 
Sbjct  81   GACYEMRCDDDPRWCLSGTITVTATNFCPPNPALPNNNGGWCNPPLQHFDLAEPAFLQIA  140

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGS+TGWQ 
Sbjct  141  QYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSKTGWQA  200

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQSLSFQVTT DGRTVTS+N  P+ WQFGQT+ GAQF
Sbjct  201  MSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVVPAGWQFGQTFAGAQF  253



>gb|AFK39658.1| unknown [Medicago truncatula]
 gb|KEH34460.1| expansin A10 [Medicago truncatula]
Length=254

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/227 (80%), Positives = 202/227 (89%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYGGW++AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  28   DYGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEM  87

Query  388  MCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C     +C PGS+ +TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPAYLQI  YRAGI
Sbjct  88   RCNDDPRWCKPGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAYLQIAEYRAGI  147

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV++RRV C KKGG+RFTINGH +FNLVLVTNVGG GDVH+++IKGSRTGWQ MSRNWG
Sbjct  148  VPVSFRRVACFKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSISIKGSRTGWQPMSRNWG  207

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSNS LNGQSLSFQVTT DGRT+TSFN AP++WQFGQT++GAQF
Sbjct  208  QNWQSNSYLNGQSLSFQVTTSDGRTMTSFNVAPANWQFGQTFQGAQF  254



>gb|ACJ85313.1| unknown [Medicago truncatula]
Length=254

 Score =   357 bits (916),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/227 (80%), Positives = 202/227 (89%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYGGW++AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  28   DYGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEM  87

Query  388  MCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C     +C PGS+ +TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPAYLQI  YRAGI
Sbjct  88   RCNDDPRWCKPGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAYLQIAEYRAGI  147

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV++RRV C KKGG+RFTINGH +FNLVLVTNVGG GDVH+++IKGSRTGWQ MSRNWG
Sbjct  148  VPVSFRRVACFKKGGVRFTINGHSYFNLVLVTNVGGTGDVHSISIKGSRTGWQPMSRNWG  207

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSNS LNGQSLSFQVTT DGRT+TSFN AP++WQFGQT++GAQF
Sbjct  208  QNWQSNSYLNGQSLSFQVTTSDGRTMTSFNVAPANWQFGQTFQGAQF  254



>gb|ABM66452.1| expansin [Vicia faba]
Length=254

 Score =   357 bits (916),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGW++AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE
Sbjct  27   GDYGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYE  86

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C     +C PGS+ +TAT+FCPPNP   N++GGWCNPP  HFDMAEPA+LQI  YRAG
Sbjct  87   MRCNDDPRWCKPGSIIVTATNFCPPNPAQANNDGGWCNPPLQHFDMAEPAFLQIAEYRAG  146

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV++RRVPC KKGG+RFTINGH +F+LVLVTNVGG GDVH+++IKGSRT WQ MSRNW
Sbjct  147  IVPVSFRRVPCFKKGGVRFTINGHSYFDLVLVTNVGGAGDVHSISIKGSRTSWQPMSRNW  206

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQSLSFQVTT DGRT+TS+N AP++WQFGQT++GAQF
Sbjct  207  GQNWQSNSYLNGQSLSFQVTTSDGRTITSYNVAPANWQFGQTFQGAQF  254



>ref|XP_002325925.2| alpha-expansin 8 precursor family protein [Populus trichocarpa]
 gb|EEF00307.2| alpha-expansin 8 precursor family protein [Populus trichocarpa]
Length=250

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 197/229 (86%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +GD GGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCY
Sbjct  22   YGDSGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCY  81

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CLPGS+T+TAT+FCPPN  L  DNGGWCNPP  HFDMAEPA+LQI  YRA
Sbjct  82   EMRCDNDPKWCLPGSITVTATNFCPPNSALSKDNGGWCNPPLQHFDMAEPAFLQIAQYRA  141

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVP+++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGS+TGWQ MSRN
Sbjct  142  GIVPISFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQAMSRN  201

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQSLSFQVTT DGRTVTS+NA P +WQFGQT+ G QF
Sbjct  202  WGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNAVPENWQFGQTFSGGQF  250



>ref|XP_011089527.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=249

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H A  DYG W++AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL C
Sbjct  17   LHAAVADYGAWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTC  76

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CY++ C     +CLPG++T+TAT+FCPPN  LPN+NGGWCNPP  HFDMA+PA+LQI 
Sbjct  77   GACYQVRCDNDPQWCLPGTITVTATNFCPPNYALPNNNGGWCNPPLQHFDMAQPAFLQIA  136

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRTGWQ+
Sbjct  137  RYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQR  196

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LN QSLSFQVTT DGRTVT++N APS+WQFGQT+EG QF
Sbjct  197  MSRNWGQNWQSNSYLNAQSLSFQVTTSDGRTVTNYNVAPSNWQFGQTFEGGQF  249



>ref|XP_007205762.1| hypothetical protein PRUPE_ppa010314mg [Prunus persica]
 gb|EMJ06961.1| hypothetical protein PRUPE_ppa010314mg [Prunus persica]
Length=254

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H AF DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGAFADYGGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCNNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNTYLNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>gb|AAR09169.1| alpha-expansin 2 [Populus tremula x Populus tremuloides]
Length=250

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 203/236 (86%), Gaps = 4/236 (2%)
 Frame = +1

Query  187  CVHLA--FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNG  360
            C HL   F DYGGWQ  HATFYGG DA+GTMGGACGYGNLY  GYGT+ AALSTALFNNG
Sbjct  15   CFHLQGIFADYGGWQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTSTAALSTALFNNG  74

Query  361  LACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            L+CGSCYE+ C     +CLPG++T+TAT+FCPPNP  PN+NGGWCNPP  HFDMAEPA+L
Sbjct  75   LSCGSCYEMRCDDDPKWCLPGTITVTATNFCPPNPSQPNNNGGWCNPPLQHFDMAEPAFL  134

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            QI  YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TG
Sbjct  135  QIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTG  194

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS+NA P+ WQFGQT+EG QF
Sbjct  195  WQAMSRNWGQNWQSNTYLNGQSLSFQVTTSDGRTVTSYNAVPAGWQFGQTFEGGQF  250



>ref|XP_011076589.1| PREDICTED: expansin-A4-like [Sesamum indicum]
Length=252

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 204/230 (89%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+GDYGGW +AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+C
Sbjct  23   AYGDYGGWDSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGAC  82

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C+G   +CLPG++T+TAT+FCPPNP LPNDNGGWCNPPR HFD+AEPAYLQI  Y+
Sbjct  83   YELTCSGEPRWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPRQHFDLAEPAYLQIAQYK  142

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC+KKGGIRFTINGH +FNLVLVTNVGG GD+ +V+IKGS TGWQ MSR
Sbjct  143  AGIVPVSFRRVPCQKKGGIRFTINGHSYFNLVLVTNVGGAGDIRSVSIKGSNTGWQPMSR  202

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGR +TS++ A + WQFGQT+EG QF
Sbjct  203  NWGQNWQSNSYLNGQSLSFQVTTSDGRIITSYDVASTGWQFGQTFEGGQF  252



>gb|AAC33529.1| expansin [Prunus armeniaca]
Length=254

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H AF DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGAFADYGGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCNNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>ref|NP_001044656.1| Os01g0823100 [Oryza sativa Japonica Group]
 sp|Q40636.2|EXPA2_ORYSJ RecName: Full=Expansin-A2; AltName: Full=Alpha-expansin-2; AltName: 
Full=OsEXP2; AltName: Full=OsEXPA2; AltName: Full=OsaEXPa1.23; 
AltName: Full=RiExB; AltName: Full=RiExC; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAL24480.1|AF394544_1 alpha-expansin OsEXPA2 [Oryza sativa]
 dbj|BAB86504.1| expansin Os-EXPA2 [Oryza sativa Japonica Group]
 dbj|BAB93180.1| expansin Os-EXPA2 [Oryza sativa Japonica Group]
 dbj|BAF06570.1| Os01g0823100 [Oryza sativa Japonica Group]
 gb|EAY76315.1| hypothetical protein OsI_04249 [Oryza sativa Indica Group]
 gb|EAZ13980.1| hypothetical protein OsJ_03905 [Oryza sativa Japonica Group]
Length=251

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALST LFN+G ACGSC
Sbjct  22   AAADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAACGSC  81

Query  379  YELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C   G +CLPGSVT+TAT+ CPPN  LPND+GGWCNPPRPHFDMAEPA+LQIGVYR
Sbjct  82   YELRCDNDGQWCLPGSVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ MSR
Sbjct  142  AGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS L+GQSLSFQV   DGRTVTS N  P+ WQFGQT+EG QF
Sbjct  202  NWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFGQTFEGGQF  251



>gb|ACJ84647.1| unknown [Medicago truncatula]
Length=260

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 201/230 (87%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYGGW+  HATFYGG DASGTMGG CGYGNLY  GYGTN AALSTALFNNGL+CGSC
Sbjct  31   AIADYGGWEGGHATFYGGGDASGTMGGVCGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  90

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +C PGS+ +TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPAYLQI  YR
Sbjct  91   YEMRCNDDPRWCNPGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAYLQIAEYR  150

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC KKGG+RFTINGH +FNLVLVTNVGG GDVH+++IKGSRTGWQ MSR
Sbjct  151  AGIVPVSFRRVPCFKKGGVRFTINGHSYFNLVLVTNVGGAGDVHSISIKGSRTGWQPMSR  210

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRT+TSFN AP++WQFGQT++GAQF
Sbjct  211  NWGQNWQSNSYLNGQSLSFQVTTSDGRTMTSFNVAPANWQFGQTFQGAQF  260



>ref|XP_009594513.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=253

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 202/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H  F DYGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  20   CFHGIFADYGGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLT  79

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C      CL GS+ +TAT+FCPPNP LPN+NGGWCNPP  HFD+A+PA++QI
Sbjct  80   CGACYELTCNNQAQSCLQGSIIVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFVQI  139

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV++RRVPCR+KGG+RFTINGH FFNLVLVTNVGG GDV +V+IKGS TGWQ
Sbjct  140  AKYRAGIVPVSFRRVPCRRKGGVRFTINGHSFFNLVLVTNVGGAGDVQSVSIKGSNTGWQ  199

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQ+N+ LNGQSLSFQVTT DGRT+TS NAAP++WQFGQT+EGAQF
Sbjct  200  TMSRNWGQNWQNNANLNGQSLSFQVTTSDGRTLTSNNAAPANWQFGQTFEGAQF  253



>emb|CDM84777.1| unnamed protein product [Triticum aestivum]
Length=251

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GDYG WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C      CLPGS+TITAT+ CPPN  LPND+GGWCNPPR HFDMAEPAYLQIG+YR
Sbjct  82   YELKCQDVSSSCLPGSITITATNLCPPNYALPNDDGGWCNPPRAHFDMAEPAYLQIGIYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIV V YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +VAIKGS TGWQ M+R
Sbjct  142  AGIVAVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVAIKGSSTGWQAMAR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ L+GQSLSF+VT  DGRTVTS NAAP+ W FGQT+EGAQF
Sbjct  202  NWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPAGWSFGQTFEGAQF  251



>gb|AAR82851.1| expansin-3 [Petunia x hybrida]
Length=251

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 203/227 (89%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYGGWQTAHATF GG DASGTMGGACGYGNLY  GYGT  AALSTALFN+GL+CG+C+EL
Sbjct  25   DYGGWQTAHATFCGGGDASGTMGGACGYGNLYSQGYGTKTAALSTALFNDGLSCGACFEL  84

Query  388  MCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C G   +CLPG++T+TAT+FCPPN  LP+DNGGWCNPPRPHFDMAEPA+LQI  YRAGI
Sbjct  85   RCAGEPRWCLPGTITVTATNFCPPNFALPSDNGGWCNPPRPHFDMAEPAFLQIAQYRAGI  144

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VP+ +RRVPC KKGGIRFTINGH +FNLVLVTNV G GD+H+V+IKGSRTGWQ MSRNWG
Sbjct  145  VPIAFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDIHSVSIKGSRTGWQPMSRNWG  204

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSNS LNGQ+LSF+VT+GDGRT+TS+N AP++WQFGQT+EG QF
Sbjct  205  QNWQSNSYLNGQTLSFRVTSGDGRTLTSYNVAPTNWQFGQTFEGGQF  251



>gb|AFZ78604.1| expansin protein [Populus tomentosa]
Length=250

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 203/236 (86%), Gaps = 4/236 (2%)
 Frame = +1

Query  187  CVHLA--FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNG  360
            C+HL     DYGGWQ  HATFYGG DA+GTMGGACGYGNLY  GYGT+ AALSTALFNNG
Sbjct  15   CLHLQGILADYGGWQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTSTAALSTALFNNG  74

Query  361  LACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            L+CGSCYE+ C     +CLPG++T+TAT+FCPPNP  PN+NGGWCNPP  HFDMAEPA+L
Sbjct  75   LSCGSCYEMRCDDDPKWCLPGTITVTATNFCPPNPSQPNNNGGWCNPPLQHFDMAEPAFL  134

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            QI  YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TG
Sbjct  135  QIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTG  194

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS+NA P+ WQFGQT+EG QF
Sbjct  195  WQAMSRNWGQNWQSNTYLNGQSLSFQVTTSDGRTVTSYNAVPAGWQFGQTFEGGQF  250



>ref|NP_001234165.1| expansin precursor [Solanum lycopersicum]
 gb|AAC64201.1| expansin [Solanum lycopersicum]
 emb|CAB43197.1| expansin2 [Solanum lycopersicum]
Length=247

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/234 (77%), Positives = 203/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C +  F DYGGWQTAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  14   CFYSTFADYGGWQTAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLT  73

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C     +CL G++T+TAT+FCPPNP LPN+NGGWCNPP  HFD+A+PA+LQI
Sbjct  74   CGACYELTCNNAAQWCLQGTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLQI  133

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVPV++RRVPC +KGGIRFT+NGH FFNLVLVTNVGG GD+ +V+IKGS TGWQ
Sbjct  134  AKYKAGIVPVSFRRVPCMRKGGIRFTVNGHSFFNLVLVTNVGGAGDIQSVSIKGSNTGWQ  193

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQVTT DGRT+ S NAAP++WQFGQT+EGAQF
Sbjct  194  AMSRNWGQNWQSNSNLNGQSLSFQVTTSDGRTLISNNAAPNNWQFGQTFEGAQF  247



>emb|CAC06433.1| expansin [Festuca pratensis]
Length=252

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/234 (78%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
              LA GDYG WQ+AHATFYG +DASG MGGACGYGNLY TGYGTN AALSTALFN+G AC
Sbjct  19   ARLAAGDYGSWQSAHATFYGEADASGAMGGACGYGNLYSTGYGTNTAALSTALFNDGAAC  78

Query  370  GSCYELMC---TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            GSCYEL C    G YC  GS+TITAT+ CPPN  LPND GGWCNPPR HFDMAEPAYLQI
Sbjct  79   GSCYELKCDAAVGTYCRAGSITITATNLCPPNYALPNDAGGWCNPPRAHFDMAEPAYLQI  138

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
            GVYRAGIVPVNYRRVPC KKG IRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ
Sbjct  139  GVYRAGIVPVNYRRVPCVKKGEIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTGWQ  198

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSN+ L+GQSLSF+VT  DGRT+ S NAAP+ WQFGQT+EG QF
Sbjct  199  AMSRNWGQNWQSNADLDGQSLSFKVTISDGRTIVSNNAAPAGWQFGQTFEGGQF  252



>ref|XP_006435913.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
 gb|ESR49153.1| hypothetical protein CICLE_v10032524mg [Citrus clementina]
Length=254

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 200/235 (85%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C    FGDYGG WQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  20   CFRGTFGDYGGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  79

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+ +TAT+FCPPN  L NDNGGWCNPP  HFDMAEPA+LQ
Sbjct  80   SCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQ  139

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVP+++RR+PC KKGGIRFT+NGH +FNLVLVTNVGG GDVH+V+IKGS+TGW
Sbjct  140  IAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLVTNVGGAGDVHSVSIKGSKTGW  199

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSNS LNGQSLSFQVT  DGRTVTS N  P++WQFGQT+EG QF
Sbjct  200  QAMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSNNVVPANWQFGQTFEGGQF  254



>gb|ABO32366.1| expansin [Litchi chinensis]
Length=253

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/253 (72%), Positives = 208/253 (82%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRT  309
            MAV +  ++  L     S C+   +GD GGWQ+ HATFYGG DASGTMGGACGYGNLY  
Sbjct  1    MAVAAFSAVSLLFSMLISLCLQGVYGDDGGWQSGHATFYGGGDASGTMGGACGYGNLYSQ  60

Query  310  GYGTNIAALSTALFNNGLACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndngg  483
            GYGTN AALSTALFNNGL+CGSCYE+ C     +CLPGSV +TAT+FCPPN  L NDNGG
Sbjct  61   GYGTNTAALSTALFNNGLSCGSCYEMKCGNDPKWCLPGSVIVTATNFCPPNNALANDNGG  120

Query  484  WCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNV  663
            WCNPP  HFDMAEPA+LQI  YRAGIVP+++RRVPC KKGGIRFT+NGH +FNLVL+TNV
Sbjct  121  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTVNGHSYFNLVLITNV  180

Query  664  GGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPS  843
             G GDVH+V+IKGS+TGWQ MSRNWGQNWQSNS LNGQSLSFQVTT DG+TVTS+N  P 
Sbjct  181  AGAGDVHSVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTSYNVVPD  240

Query  844  DWQFGQTYEGAQF  882
            +WQFGQT+ G+QF
Sbjct  241  NWQFGQTFTGSQF  253



>gb|AAG13982.1|AF297521_1 expansin 1 [Prunus avium]
 gb|AAK48846.1|AF350937_1 expansin [Prunus cerasus]
Length=254

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H AF DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGAFADYGGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCNNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVT++N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNTYLNGQSLSFQVTTSDGRTVTNYNVAPGNWQFGQTFSGGQF  254



>dbj|BAJ10398.1| alpha-expansin [Dianthus caryophyllus]
Length=252

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/235 (77%), Positives = 208/235 (89%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+H A+GDYGG W +AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL
Sbjct  18   CLHGAYGDYGGGWTSAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGL  77

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CG+CY+L C+G   +CLPGS+ +TAT+FCPPNP LPNDNGGWCNPP  HFD+AEP++L+
Sbjct  78   SCGACYQLQCSGDPKWCLPGSIMVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPSFLR  137

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVPV++RRVPC +KGG+RFTINGH +FNLVLVTNVGG GDVHAV+IKGSRTGW
Sbjct  138  IAQYRAGIVPVSFRRVPCARKGGVRFTINGHSYFNLVLVTNVGGAGDVHAVSIKGSRTGW  197

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSN  +NGQSLSFQVTT DGRT+TS N APS+WQFGQT+EG QF
Sbjct  198  QPMSRNWGQNWQSNGYMNGQSLSFQVTTSDGRTITSNNVAPSNWQFGQTFEGGQF  252



>gb|AFK24458.1| expansin 5 [Ziziphus jujuba]
Length=254

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 196/227 (86%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYGGWQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  28   DYGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEM  87

Query  388  MCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C+    +CLPGS+ +TAT+FCPPN  L N NGGWCNPP  HFD+AEPA+L I  YRAGI
Sbjct  88   RCSNDAKWCLPGSIIVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLHIAQYRAGI  147

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV++RRVPC KKGGIRFTINGH +FNLVL+TNVGG GD HAV+IKGS+TGWQ MSRNWG
Sbjct  148  VPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDAHAVSIKGSKTGWQAMSRNWG  207

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSNS LNGQSLSFQVT  DGRTVTS+N AP+ WQFGQT+EG QF
Sbjct  208  QNWQSNSYLNGQSLSFQVTASDGRTVTSYNVAPAGWQFGQTFEGVQF  254



>emb|CDM84787.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26303.1| unnamed protein product [Triticum aestivum]
Length=251

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GDYG WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C      CLPGS+TITAT+ CPPN  LPND+GGWCNPPR HFDMAEPAYLQIG+YR
Sbjct  82   YELKCQDVSSSCLPGSITITATNLCPPNYALPNDDGGWCNPPRAHFDMAEPAYLQIGIYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIV V YRRVPC KKGG+RFTINGH +FNLVLVTNV G GDV +VAIKGS TGWQ M+R
Sbjct  142  AGIVAVAYRRVPCVKKGGMRFTINGHSYFNLVLVTNVAGAGDVQSVAIKGSSTGWQAMAR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ L+GQSLSF+VT  DGRTVTS NAAP+ W FGQT+EGAQF
Sbjct  202  NWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPAGWSFGQTFEGAQF  251



>gb|KDP21654.1| hypothetical protein JCGZ_03325 [Jatropha curcas]
Length=252

 Score =   355 bits (910),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 212/253 (84%), Gaps = 3/253 (1%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRT  309
            MA+P TFS   LLLF  + C    +GDYGGWQ+ HATFYGG DASGTMGGACGYGNLY  
Sbjct  1    MAIP-TFSAATLLLFVLNLCFRGTYGDYGGWQSGHATFYGGGDASGTMGGACGYGNLYSQ  59

Query  310  GYGTNIAALSTALFNNGLACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndngg  483
            GYGTN AALSTALFN+GL+CGSCYE+ C     +CLPGS+ +TAT+FCPPN  L NDNGG
Sbjct  60   GYGTNTAALSTALFNSGLSCGSCYEMRCDNDPKWCLPGSIIVTATNFCPPNYALANDNGG  119

Query  484  WCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNV  663
            WCNPP  HFDMAEPA+LQI  YRAGIVP+++RRVPC KKGGIRFTINGH +FNLVL++NV
Sbjct  120  WCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLISNV  179

Query  664  GGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPS  843
            GG GDVH+V+IKGS+TGWQ MSRNWGQNWQSN  LNGQSLSFQVTT DG+TVTS+N  PS
Sbjct  180  GGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNGYLNGQSLSFQVTTSDGKTVTSYNVVPS  239

Query  844  DWQFGQTYEGAQF  882
            +WQFGQT+ G QF
Sbjct  240  NWQFGQTFAGGQF  252



>ref|XP_002319409.1| expansin S1 precursor family protein [Populus trichocarpa]
 gb|EEE95332.1| expansin S1 precursor family protein [Populus trichocarpa]
Length=250

 Score =   354 bits (909),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 204/236 (86%), Gaps = 4/236 (2%)
 Frame = +1

Query  187  CVHLA--FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNG  360
            C+HL     DYGGWQ  HATFYGG DA+GTMGGACGYGNLY  GYGT+ AALSTALFNNG
Sbjct  15   CLHLQSILADYGGWQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTSTAALSTALFNNG  74

Query  361  LACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            L+CG+CYE+ C     +CLPG++T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+L
Sbjct  75   LSCGACYEMRCDDDPKWCLPGTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFL  134

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            QI  YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TG
Sbjct  135  QIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTG  194

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS+NA P+ WQFGQT+EG QF
Sbjct  195  WQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTVTSYNAVPAGWQFGQTFEGGQF  250



>ref|XP_007017076.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
 gb|EOY34695.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
Length=254

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H   GDYGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGT  AALSTALFNNGL+C
Sbjct  22   LHGITGDYGGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTKTAALSTALFNNGLSC  81

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +CL G++T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCNDDPKWCLSGTITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGS+TGWQ 
Sbjct  142  QYRAGIVPVVFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGEGDVHAVSIKGSKTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ LSFQVTT DG+TVTS+N  P+DWQFGQT+EG QF
Sbjct  202  MSRNWGQNWQSNSYLNGQGLSFQVTTSDGQTVTSYNVVPADWQFGQTFEGGQF  254



>ref|XP_011021020.1| PREDICTED: expansin-A8-like [Populus euphratica]
Length=250

 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 204/236 (86%), Gaps = 4/236 (2%)
 Frame = +1

Query  187  CVHLA--FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNG  360
            C+HL     DYGGWQ  HATFYGG DA+GTMGGACGYGNLY  GYGT+ AALSTALFNNG
Sbjct  15   CLHLQGILADYGGWQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTSTAALSTALFNNG  74

Query  361  LACGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            L+CG+CYE+ C     +CLPG++T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+L
Sbjct  75   LSCGACYEMRCDDDPRWCLPGTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFL  134

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            QI  YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TG
Sbjct  135  QIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTG  194

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS+NA P+ WQFGQT+EG QF
Sbjct  195  WQAMSRNWGQNWQSNTYLNGQSLSFQVTTSDGRTVTSYNAVPAGWQFGQTFEGGQF  250



>gb|ACX69842.1| expansin [Rubus idaeus]
Length=253

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 196/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  F DYGGW +AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG
Sbjct  22   HSTFADYGGWNSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCG  81

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYE+MC     +C PG + +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  
Sbjct  82   SCYEMMCDNDPRWCRPGRIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQ  141

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRVPC KKGGIRFTINGH  FNLVL+TNV G GDVH+V+IKGSRTGWQ M
Sbjct  142  YRAGIVPVAFRRVPCVKKGGIRFTINGHSHFNLVLITNVAGAGDVHSVSIKGSRTGWQSM  201

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSFQVTT DGRTVTS+N AP +WQFGQTY+G QF
Sbjct  202  SRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTYQGGQF  253



>ref|XP_006358751.1| PREDICTED: expansin-A8 [Solanum tuberosum]
Length=247

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/234 (76%), Positives = 203/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C +  F DYGGWQTAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  14   CFYSTFADYGGWQTAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLT  73

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C     +CL G++T+TAT+FCPPNP LPN+NGGWCNPP  HFD+A+PA+L+I
Sbjct  74   CGACYELTCNNAAQWCLQGTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLEI  133

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVPV++RRVPC +KGGIRFT+NGH FFNLVLVTNVGG GD+ +V+IKGS TGWQ
Sbjct  134  AKYQAGIVPVSFRRVPCMRKGGIRFTVNGHSFFNLVLVTNVGGAGDIQSVSIKGSNTGWQ  193

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQVTT DGRT+ S NAAP++WQFGQT+EGAQF
Sbjct  194  AMSRNWGQNWQSNSNLNGQSLSFQVTTSDGRTLISNNAAPTNWQFGQTFEGAQF  247



>ref|XP_010108480.1| hypothetical protein L484_010673 [Morus notabilis]
 gb|EXC19542.1| hypothetical protein L484_010673 [Morus notabilis]
Length=254

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H    +YGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL C
Sbjct  22   LHGTAANYGGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CY++ C     +CLPG++T+TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GACYQMRCNNDPRWCLPGTITVTATNFCPPNFALSNNNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVG  GDVHAV+IKGS+TGWQ 
Sbjct  142  QYRAGIVPVVFRRVPCVKKGGIRFTINGHSYFNLVLITNVGSAGDVHAVSIKGSKTGWQA  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQSLSFQVT  DGRTVTSFN AP+ WQFGQT+EG+QF
Sbjct  202  MSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAPAGWQFGQTFEGSQF  254



>emb|CDP04049.1| unnamed protein product [Coffea canephora]
Length=254

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 198/231 (86%), Gaps = 2/231 (1%)
 Frame = +1

Query  196  LAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
            L   DYGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+
Sbjct  24   LIKADYGGWQGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGA  83

Query  376  CYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            CYE+ C G   +CL G++T+TAT+FCPPN  LPNDNGGWCNPPR HFD+AEPA+LQI  Y
Sbjct  84   CYEMRCDGDPKWCLGGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQY  143

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVPV YRRVPC KKGGIRFT+NGH FFNLVLVTNV G GD+HAV+IKGSRTGWQ MS
Sbjct  144  RAGIVPVAYRRVPCAKKGGIRFTVNGHSFFNLVLVTNVAGAGDIHAVSIKGSRTGWQTMS  203

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSNS LNGQSLS  VT  DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  204  RNWGQNWQSNSHLNGQSLSITVTASDGRTVTSYNVAPANWQFGQTFEGGQF  254



>ref|XP_003544930.1| PREDICTED: expansin-A8 [Glycine max]
 gb|KHN01887.1| Expansin-A8 [Glycine soja]
Length=254

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 196/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H A  DYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  23   HGATADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  82

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYE+ C     +C PG++ +TAT+FCPPN  L N+NGGWCNPP  HFDMAEPA+LQI  
Sbjct  83   ACYEMRCDDDPRWCKPGTIVVTATNFCPPNFALANNNGGWCNPPLQHFDMAEPAFLQIAQ  142

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRT WQ M
Sbjct  143  YRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTSWQPM  202

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSFQVT  DGRTVTSFN APSDWQFGQT++G QF
Sbjct  203  SRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAPSDWQFGQTFQGGQF  254



>gb|ACK43222.1| expansin 2 [Ziziphus jujuba]
Length=259

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 201/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+   FGD GGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+
Sbjct  26   CLRGTFGDNGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  85

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPGS+ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI
Sbjct  86   CGSCYEMRCDSDPKWCLPGSILVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQI  145

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVP+++RRVPC KKGG+RFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ
Sbjct  146  AQYKAGIVPISFRRVPCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQ  205

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQVTT DGRT+TS+N  P++WQFGQT+ G+QF
Sbjct  206  TMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSYNVVPANWQFGQTFAGSQF  259



>ref|NP_001105040.1| alpha expansin1 precursor [Zea mays]
 gb|AAK56119.1|AF332169_1 alpha-expansin 1 [Zea mays]
 gb|ACG30766.1| alpha-expansin 10 precursor [Zea mays]
 gb|ACR38172.1| unknown [Zea mays]
 tpg|DAA57054.1| TPA: alpha expansin1 [Zea mays]
Length=253

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 202/234 (86%), Gaps = 3/234 (1%)
 Frame = +1

Query  190  VHLAFG-DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
             H A G DYG WQ+AHATFYGG DASGTMGGACGYGN+Y TGYGTN AALSTALFN+G A
Sbjct  20   AHRAAGVDYGSWQSAHATFYGGGDASGTMGGACGYGNMYSTGYGTNTAALSTALFNDGAA  79

Query  367  CGSCYELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYEL C   G  CLPG++T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMA+PA+LQI
Sbjct  80   CGSCYELRCDNNGQSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQPAFLQI  139

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ
Sbjct  140  AQYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTGWQ  199

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS+L+GQSLSFQVT  DGRTVTS   AP+ WQFGQT+EGAQF
Sbjct  200  PMSRNWGQNWQSNSLLDGQSLSFQVTASDGRTVTSNGVAPAGWQFGQTFEGAQF  253



>gb|KHN04238.1| Expansin-A8 [Glycine soja]
Length=255

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +  A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+C
Sbjct  23   IQGATADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSC  82

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI 
Sbjct  83   GSCYEMRCDDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIA  142

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDV++V+IKGS+TGWQ 
Sbjct  143  EYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQP  202

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQSLSFQVTT DGRTVTSFN AP++WQFGQT++G QF
Sbjct  203  MSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANWQFGQTFQGGQF  255



>ref|NP_001275780.1| expansin 2 precursor [Citrus sinensis]
 gb|ACN87961.1| expansin 2 [Citrus sinensis]
 gb|KDO42952.1| hypothetical protein CISIN_1g025347mg [Citrus sinensis]
Length=254

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/235 (76%), Positives = 199/235 (85%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C    FGDYGG WQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  20   CFRGTFGDYGGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  79

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+ +TAT+FCPPN  L NDNGGWCNPP  HFDMAEPA+LQ
Sbjct  80   SCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQ  139

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVP+++RR+PC KKGGIRFT+NGH +FNLVL+TNVGG GDVH+V+IKGS+TGW
Sbjct  140  IAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGW  199

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSNS LNGQSLSFQ+T  DGRTVTS N  P +WQFGQT+EG QF
Sbjct  200  QAMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNWQFGQTFEGGQF  254



>ref|XP_008242138.1| PREDICTED: expansin-A8-like [Prunus mume]
Length=254

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H AF DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGAFADYGGWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCNNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVTFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ LNGQSLSFQVTT DGRTVTS++ AP +WQFGQT+ G Q+
Sbjct  202  MSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTVTSYSVAPGNWQFGQTFSGGQY  254



>ref|XP_003564501.1| PREDICTED: expansin-A2 [Brachypodium distachyon]
Length=252

 Score =   352 bits (904),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAADYGSWQSAHATFYGGDDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMC--TGP-YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            YEL C   GP YC PGS+TITAT+ CPPN  LPND+GGWCNPPR HFDMAEPAYLQIGVY
Sbjct  82   YELKCDNAGPSYCRPGSITITATNLCPPNYALPNDDGGWCNPPRAHFDMAEPAYLQIGVY  141

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ MS
Sbjct  142  RAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTGWQPMS  201

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSNS L+GQSLSF+VT  DGRT+TS   AP+ WQFGQT+EG QF
Sbjct  202  RNWGQNWQSNSDLDGQSLSFRVTLSDGRTLTSDGVAPAGWQFGQTFEGGQF  252



>ref|XP_003538280.1| PREDICTED: expansin-A8 [Glycine max]
Length=255

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 202/233 (87%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +  A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+C
Sbjct  23   IQGATADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSC  82

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI 
Sbjct  83   GSCYEMRCDDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIA  142

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDV++V+IKGS+TGWQ 
Sbjct  143  EYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQP  202

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQSLSFQVTT DGRTVTSFN AP++WQFGQT++G Q+
Sbjct  203  MSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANWQFGQTFQGGQY  255



>gb|EYU46016.1| hypothetical protein MIMGU_mgv1a012336mg [Erythranthe guttata]
Length=253

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 197/232 (85%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H    DYGGW+  HATFYGG DASGTMGGACGYGNLY  GY TN AALSTALFNNGL CG
Sbjct  22   HSVEADYGGWENGHATFYGGGDASGTMGGACGYGNLYSQGYATNTAALSTALFNNGLTCG  81

Query  373  SCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYE+ C     +CL G++TITAT+FCPPN  LPNDNGGWCNPP  HFDMAEPA+LQI  
Sbjct  82   ACYEMRCENDPKWCLSGTITITATNFCPPNFALPNDNGGWCNPPLQHFDMAEPAFLQIAQ  141

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GD+HA++IKGS+TGWQ M
Sbjct  142  YRAGIVPVAFRRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDIHALSIKGSKTGWQPM  201

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSFQVT  DGRT+TS++ APS+WQFGQTYEG QF
Sbjct  202  SRNWGQNWQSNSYLNGQSLSFQVTASDGRTITSYDVAPSNWQFGQTYEGGQF  253



>ref|XP_004970396.1| PREDICTED: expansin-A2-like [Setaria italica]
Length=251

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 201/230 (87%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GDYGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G +CG C
Sbjct  22   AAGDYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGASCGQC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +EL C   G  CLPG++T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMA+PA+LQI  YR
Sbjct  82   FELRCDNAGASCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAQPAFLQIAQYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ MSR
Sbjct  142  AGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVSIKGSSTGWQAMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS+L+GQ+LSF+VT  DGR VTS NAAP+ W FGQT+EG+QF
Sbjct  202  NWGQNWQSNSLLDGQALSFKVTASDGRCVTSNNAAPAGWSFGQTFEGSQF  251



>ref|XP_009622932.1| PREDICTED: expansin-A8-like [Nicotiana tomentosiformis]
Length=254

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 203/232 (88%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  F DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  23   HGTFADYGGWKNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  82

Query  373  SCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYEL C+    +CL G++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+LQ+  
Sbjct  83   ACYELTCSNDAQWCLQGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLQLAQ  142

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV++RRVPC+KKGGIRFTINGH +FNLVLVTNVGG GDV++V+IKGS +GWQ M
Sbjct  143  YRAGIVPVSFRRVPCKKKGGIRFTINGHSYFNLVLVTNVGGAGDVNSVSIKGSGSGWQTM  202

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LN QSLSFQVTT DGRT+TS+N AP +WQFGQT+EG QF
Sbjct  203  SRNWGQNWQSNSYLNSQSLSFQVTTSDGRTITSYNVAPHNWQFGQTFEGVQF  254



>emb|CBI15823.3| unnamed protein product [Vitis vinifera]
Length=233

 Score =   351 bits (900),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DY GW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C
Sbjct  4    ASADYSGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGAC  63

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C     +CLPGS+T+TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  64   FEMRCDNDPRWCLPGSITVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYR  123

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RRVPC KKGGIRFTINGH +F LVLVTNV G GD+H+V+IKGSRTGWQ MSR
Sbjct  124  AGIVPVAFRRVPCAKKGGIRFTINGHKYFILVLVTNVAGAGDIHSVSIKGSRTGWQTMSR  183

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNSVLNGQSLSF VT GDGRTVTSFN APS WQFG+TYEG+QF
Sbjct  184  NWGQNWQSNSVLNGQSLSFMVTAGDGRTVTSFNVAPSGWQFGRTYEGSQF  233



>gb|ABR17119.1| unknown [Picea sitchensis]
Length=253

 Score =   352 bits (902),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 199/226 (88%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YG W++AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  28   YGDWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMQ  87

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG++ +TAT+FCPPN  LPN++GGWCNPP  HFDMAEP+YL+I  YR+GIV
Sbjct  88   CNDDPQWCLPGTIMVTATNFCPPNNALPNNDGGWCNPPLQHFDMAEPSYLKIAKYRSGIV  147

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ YRRVPC +KGGIRFT+NGH +FNLVL+TNVGG GDVHAV+IKGSRTGWQ MSRNWGQ
Sbjct  148  PILYRRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  207

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNS LNGQSLSFQVTT DGRTV S+NAAPS+WQFGQT+EG Q 
Sbjct  208  NWQSNSYLNGQSLSFQVTTSDGRTVVSYNAAPSNWQFGQTFEGGQL  253



>gb|KEH35550.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+   FGDYGG W+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  19   CLRGTFGDYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  78

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+ +TAT+FCPPN    N NGGWCNPP  HFD+AEPA+LQ
Sbjct  79   SCGSCYEMKCNSDPKWCLPGSILVTATNFCPPNFAESNTNGGWCNPPLQHFDLAEPAFLQ  138

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  Y+AGIVP+++RRVPC KKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGS+TGW
Sbjct  139  IAQYKAGIVPISFRRVPCMKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSKTGW  198

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSN+ LNGQSLSFQVTT DGRT+TS N  P +WQFGQT+ G QF
Sbjct  199  QAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNVVPGNWQFGQTFTGGQF  253



>gb|AAB38074.1| expansin Os-EXPA2 [Oryza sativa Japonica Group]
Length=251

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALST LFN+G AC SC
Sbjct  22   AAADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAACRSC  81

Query  379  YELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C   G +CLPGSVT+TAT+ CPPN  LPND+GGWCNPPRPHFDMAEPA+LQIGVYR
Sbjct  82   YELRCDNDGQWCLPGSVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS TGWQ MSR
Sbjct  142  AGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS L+GQSLSFQV   DGRTVTS N  P+ WQF QT+EG QF
Sbjct  202  NWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFXQTFEGGQF  251



>ref|XP_004961745.1| PREDICTED: expansin-A4-like [Setaria italica]
Length=248

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 200/232 (86%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
              A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY +GYGTN AALSTALFN+G ACG
Sbjct  17   EAAAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSSGYGTNTAALSTALFNDGAACG  76

Query  373  SCYELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYEL C   G  CLPGS+T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  
Sbjct  77   SCYELRCQNAGGSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQ  136

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+I+GSRTGWQ M
Sbjct  137  YRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVRSVSIRGSRTGWQPM  196

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSN+ L+ Q+LSFQVT  DGRTVTS NAAP+ WQFGQT+EG QF
Sbjct  197  SRNWGQNWQSNAFLDRQALSFQVTASDGRTVTSTNAAPAGWQFGQTFEGRQF  248



>gb|KEH35551.1| expansin A10 [Medicago truncatula]
Length=253

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 198/235 (84%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+   FGDYGG W+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  19   CLKGTFGDYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  78

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+ +TAT+FCPPN    N NGGWCNPP  HFD+AEPA+LQ
Sbjct  79   SCGSCYEMKCNSDPKWCLPGSILVTATNFCPPNFAESNTNGGWCNPPLQHFDLAEPAFLQ  138

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  Y+AGIVP+++RRVPC KKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGS+TGW
Sbjct  139  IAQYKAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSKTGW  198

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSN+ LNGQSLSFQVTT DGRT+TS N  P +WQFGQT+ G QF
Sbjct  199  QAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNVVPGNWQFGQTFTGRQF  253



>gb|AAF35901.1|AF230332_1 expansin 2 [Zinnia violacea]
Length=245

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 200/226 (88%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ 
Sbjct  20   YGGWENGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMR  79

Query  391  CTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPGS+ +TAT+FCPPNPGL NDNGGWCNPP  HFD+AEPA+LQI  YRAGIV
Sbjct  80   CNDDPKWCLPGSIVVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  139

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P++++RVPC KKGG+RFTINGH +FNL+L+TNVGG GDVH+V+IKGS+TGWQ MSRNWGQ
Sbjct  140  PISFQRVPCVKKGGVRFTINGHSYFNLILITNVGGAGDVHSVSIKGSKTGWQSMSRNWGQ  199

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNS LNGQSLSFQVTT DGRT+TS+N APS+WQFGQT++G QF
Sbjct  200  NWQSNSYLNGQSLSFQVTTSDGRTITSYNVAPSNWQFGQTFQGGQF  245



>ref|NP_001267550.1| expansin-A8-like precursor [Cucumis sativus]
 gb|AAB37746.1| expansin S1 precursor [Cucumis sativus]
 gb|KGN50732.1| Expansin S1 [Cucumis sativus]
Length=250

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 199/231 (86%), Gaps = 2/231 (1%)
 Frame = +1

Query  196  LAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
              F DYGGWQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN  ALSTALFNNGL+CG+
Sbjct  20   FTFADYGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTVALSTALFNNGLSCGA  79

Query  376  CYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            C+E+ CT    +CLPG++ +TAT+FCPPN  LPN+NGGWCNPP  HFDMAEPA+LQI  Y
Sbjct  80   CFEMTCTNDPKWCLPGTIRVTATNFCPPNFALPNNNGGWCNPPLQHFDMAEPAFLQIAQY  139

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVPV++RRVPC KKGG+RFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MS
Sbjct  140  RAGIVPVSFRRVPCMKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQSMS  199

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSN+ LNGQ LSFQVT  DGRT+T++N  PS+WQFGQTYEG QF
Sbjct  200  RNWGQNWQSNNYLNGQGLSFQVTLSDGRTLTAYNLVPSNWQFGQTYEGPQF  250



>gb|AFK24457.1| expansin 4 [Ziziphus jujuba]
Length=253

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 200/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+   FGD GGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+
Sbjct  20   CLRGTFGDNGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS  79

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPGS+ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI
Sbjct  80   CGSCYEMRCDSDPKWCLPGSILVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQI  139

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVP+++RRVPC KKGG+RFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ
Sbjct  140  AQYKAGIVPISFRRVPCVKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQ  199

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MS+NWGQNWQSNS LNGQSLSFQVTT DGRT+TS+N  P++WQFGQT  G+QF
Sbjct  200  TMSKNWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSYNVVPANWQFGQTSAGSQF  253



>ref|XP_002276565.3| PREDICTED: expansin-A4 [Vitis vinifera]
Length=253

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DY GW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C
Sbjct  24   ASADYSGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGAC  83

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C     +CLPGS+T+TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  84   FEMRCDNDPRWCLPGSITVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYR  143

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RRVPC KKGGIRFTINGH +F LVLVTNV G GD+H+V+IKGSRTGWQ MSR
Sbjct  144  AGIVPVAFRRVPCAKKGGIRFTINGHKYFILVLVTNVAGAGDIHSVSIKGSRTGWQTMSR  203

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNSVLNGQSLSF VT GDGRTVTSFN APS WQFG+TYEG+QF
Sbjct  204  NWGQNWQSNSVLNGQSLSFMVTAGDGRTVTSFNVAPSGWQFGRTYEGSQF  253



>ref|XP_002518284.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
 gb|EEF44044.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
Length=256

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 200/229 (87%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
              DYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALF+NGL+CG+CY
Sbjct  28   LADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFDNGLSCGACY  87

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ CT    +CLPG++T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI  YRA
Sbjct  88   EMKCTDDPKWCLPGTITVTATNFCPPNPALPNNNGGWCNPPLQHFDMAEPAFLQIAQYRA  147

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV AV+IKGS+TGWQ MSRN
Sbjct  148  GIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRN  207

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQSLSFQVT  DGRT+TS++ APS WQFGQT+EG+QF
Sbjct  208  WGQNWQSNSYLNGQSLSFQVTASDGRTLTSYDVAPSGWQFGQTFEGSQF  256



>ref|XP_010253098.1| PREDICTED: expansin-A8-like [Nelumbo nucifera]
Length=254

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 197/229 (86%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            FGDYGGW   HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNG +CG+CY
Sbjct  26   FGDYGGWIAGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGFSCGACY  85

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CLPG++T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRA
Sbjct  86   EMRCNDDPKWCLPGTITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRA  145

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGS+TGWQ MSRN
Sbjct  146  GIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQSMSRN  205

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQSLSFQVTT DGRTVTS+N AP+ WQFGQT++G QF
Sbjct  206  WGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPAGWQFGQTFQGGQF  254



>ref|XP_004294733.1| PREDICTED: expansin-A8-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 195/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  F DYGGW   HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG
Sbjct  22   HSTFADYGGWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCG  81

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  
Sbjct  82   SCYEMRCDNDPRWCRPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQ  141

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTGWQ M
Sbjct  142  YRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQSM  201

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQ+LSFQVTT DGRTVTS+N AP +WQFGQTY+G QF
Sbjct  202  SRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTYQGGQF  253



>dbj|BAH36861.1| alpha expansin [Rosa hybrid cultivar]
Length=253

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 195/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  F DYGGW   HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG
Sbjct  22   HSTFADYGGWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCG  81

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  
Sbjct  82   SCYEMRCDNDPRWCRPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQ  141

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ M
Sbjct  142  YRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQSM  201

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQ LSFQVTT DGRTVTS+N AP +WQFGQTY+G QF
Sbjct  202  SRNWGQNWQSNSYLNGQLLSFQVTTSDGRTVTSYNVAPGNWQFGQTYQGGQF  253



>gb|ACJ70084.1| expansin [Diospyros kaki]
Length=254

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 202/228 (89%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGT  AALSTALFNNGL+CG+CYE
Sbjct  27   GDYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYE  86

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            L C     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+L+I  YRAG
Sbjct  87   LKCNDDARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAG  146

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+++RVPC KKGGIRFTINGH +FNLVL++NVGG GDVHAV++KGSRTGWQ MSRNW
Sbjct  147  IVPVSFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNW  206

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSN+ LNGQSLSFQ+T  DGRTVTS+N APS+WQFGQT+EG+QF
Sbjct  207  GQNWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNWQFGQTFEGSQF  254



>ref|XP_009384771.1| PREDICTED: expansin-A2 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
             GD   WQ+AHATFYGG DASGTMGGACGYG+LY  GYGTN AALSTALFN+GL+CGSCY
Sbjct  27   LGDSYDWQSAHATFYGGGDASGTMGGACGYGDLYSQGYGTNTAALSTALFNDGLSCGSCY  86

Query  382  ELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            EL C     +CLPGS+ ITAT+FCPPN  LP+D+GGWCNPPRPHFDMAEPA+LQI  YRA
Sbjct  87   ELKCDDDPRWCLPGSIVITATNFCPPNYALPSDDGGWCNPPRPHFDMAEPAFLQIAQYRA  146

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV +RRVPC KKGG+RFTINGH +FNLVL+TNV G GDV AV+IKGSRTGWQ MSRN
Sbjct  147  GIVPVAFRRVPCAKKGGVRFTINGHSYFNLVLITNVAGAGDVCAVSIKGSRTGWQVMSRN  206

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSN+ L+GQSLSFQVTT DGRT+TS++  P+DWQFGQT+EG QF
Sbjct  207  WGQNWQSNAYLDGQSLSFQVTTSDGRTITSYDVVPTDWQFGQTFEGGQF  255



>gb|AFZ78603.1| expansin protein [Populus tomentosa]
Length=250

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 199/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            CV   +GD GGWQ  HATFYGG DASGTMGGACGYG+LY  GYGTN AALSTALFNNGL+
Sbjct  17   CVAGTYGDDGGWQGGHATFYGGGDASGTMGGACGYGDLYSQGYGTNTAALSTALFNNGLS  76

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPGS+T+TAT+FCPPN  L NDNGGWCNPP  HFDMAEPA+LQI
Sbjct  77   CGSCYEMRCDSDPKWCLPGSITVTATNFCPPNSALSNDNGGWCNPPLQHFDMAEPAFLQI  136

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y AGIVP+++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV +V+IKGS+TGWQ
Sbjct  137  AQYSAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVQSVSIKGSKTGWQ  196

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQVTT DG+TVTS+NA P +WQFG+T+ G+QF
Sbjct  197  AMSRNWGQNWQSNSYLNGQSLSFQVTTSDGKTVTSYNAVPENWQFGRTFSGSQF  250



>ref|XP_008354429.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=254

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 197/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H AF  YG W+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGAFAVYGSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCDNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ+LSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>ref|XP_009410516.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=253

 Score =   350 bits (898),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 198/226 (88%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            Y GW++AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYEL 
Sbjct  28   YSGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYELK  87

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPGS+ +TAT+FCPPN  LP+DNGGWCNPPRPHFDMA+PA+LQI  YRAGIV
Sbjct  88   CDDDPRWCLPGSIVVTATNFCPPNNALPSDNGGWCNPPRPHFDMAQPAFLQIAQYRAGIV  147

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV +RRVPC KKGG+RFTINGH +FNLVL+TNV G GDVH+V+IKGS++GWQ MSRNWGQ
Sbjct  148  PVAFRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKSGWQVMSRNWGQ  207

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNS L+GQSLSF++T  DGRT+TSFN AP+ WQFGQT+EG QF
Sbjct  208  NWQSNSYLDGQSLSFRITASDGRTITSFNVAPAGWQFGQTFEGGQF  253



>gb|AEC46865.1| expansin [Glycine max]
Length=254

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 199/230 (87%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+CGSC
Sbjct  25   ATADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGSC  84

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +C PGS+T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI  YR
Sbjct  85   YEMRCDDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEYR  144

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDV++V+IKGS+TGWQ MSR
Sbjct  145  AGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQPMSR  204

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRT TSFN AP++WQFG T++G QF
Sbjct  205  NWGQNWQSNSYLNGQSLSFQVTTSDGRTATSFNVAPANWQFGHTFQGGQF  254



>dbj|BAC66696.1| expansin [Vitis labrusca x Vitis vinifera]
Length=252

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GDYGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+C
Sbjct  23   ANGDYGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGAC  82

Query  379  YELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPG++T+TAT+FCPPN  L N NGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  83   YEMKCNDDPKWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYR  142

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV AV+IKGS+TGWQ MSR
Sbjct  143  AGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSR  202

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSFQVT  DGRT+TS N AP+ WQFGQTYEGAQF
Sbjct  203  NWGQNWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGWQFGQTYEGAQF  252



>gb|AFK38068.1| unknown [Medicago truncatula]
Length=253

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 197/235 (84%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+   FGDYGG W+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  19   CLKGTFGDYGGGWENAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  78

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+ +TAT+FCPPN    N NGGWCNPP  HFD+AEPA+LQ
Sbjct  79   SCGSCYEMKCNSDPKWCLPGSILVTATNFCPPNFAESNTNGGWCNPPLQHFDLAEPAFLQ  138

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  Y+AGIVP++ RRVPC KKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGS+TGW
Sbjct  139  IAQYKAGIVPISIRRVPCVKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSKTGW  198

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSN+ LNGQSLSFQVTT DGRT+TS N  P +WQFGQT+ G QF
Sbjct  199  QAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTITSNNVVPGNWQFGQTFTGRQF  253



>gb|AFK41150.1| unknown [Lotus japonicus]
Length=254

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 199/230 (87%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYGGW++AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC
Sbjct  25   AAADYGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGLSCGSC  84

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +C PGS+ +TAT+FCPPNP L N+NGGWCNPP  HFDMAEPA+LQI  YR
Sbjct  85   YEMRCDDDPRWCKPGSIIVTATNFCPPNPSLANNNGGWCNPPLQHFDMAEPAFLQIAQYR  144

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RRVPC KKGGIRFTINGH +F+LVL+TNVGG GDVH+ +IKGSR+GWQ MSR
Sbjct  145  AGIVPVAFRRVPCAKKGGIRFTINGHSYFSLVLITNVGGAGDVHSASIKGSRSGWQPMSR  204

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSFQVTT DGRTVTS N AP++WQFGQT++G QF
Sbjct  205  NWGQNWQSNSYLNGQALSFQVTTSDGRTVTSINVAPANWQFGQTFQGGQF  254



>gb|AEQ55268.1| expansin [Breonia chinensis]
 gb|AEQ55283.1| expansin [Breonia chinensis]
Length=255

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 197/227 (87%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+CYE+
Sbjct  29   DYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEM  88

Query  388  MCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C     +CL G++T+TAT+FCPPN  LPNDNGGWCNPPR HFD+AEPA+LQI  YRAGI
Sbjct  89   RCDNDPKWCLGGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDLAEPAFLQIAQYRAGI  148

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV +RRVPC KKGG+RFTINGH +FNLVLVTNV G GD+H+V+IKGSRTGWQ MSRNWG
Sbjct  149  VPVAFRRVPCVKKGGLRFTINGHSYFNLVLVTNVAGAGDIHSVSIKGSRTGWQTMSRNWG  208

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSNS LNGQSLS  VT  DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  209  QNWQSNSYLNGQSLSIMVTASDGRTVTSYNVAPANWQFGQTFEGGQF  255



>ref|XP_002280300.1| PREDICTED: expansin-A8 [Vitis vinifera]
 dbj|BAC66695.1| expansin [Vitis labrusca x Vitis vinifera]
 emb|CAN70346.1| hypothetical protein VITISV_012578 [Vitis vinifera]
 emb|CBI25362.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   349 bits (896),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 196/228 (86%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE
Sbjct  25   GDYGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYE  84

Query  385  LMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C     +CLPG++T+TAT+FCPPN  L N NGGWCNPP  HFD+AEPA+LQI  YRAG
Sbjct  85   MKCNDDPKWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAG  144

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV AV+IKGS+TGWQ MSRNW
Sbjct  145  IVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNW  204

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQ+LSFQVT  DGRT+TS N AP+ WQFGQTYEGAQF
Sbjct  205  GQNWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGWQFGQTYEGAQF  252



>gb|KDO49685.1| hypothetical protein CISIN_1g025193mg [Citrus sinensis]
Length=256

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 200/233 (86%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            VH   GDYGGWQ AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  24   VHAINGDYGGWQIAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  83

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CYE+ C     +CLPG++T+TAT+FCPPN  L NDNGGWCNPP  HFD+A+P++L I 
Sbjct  84   GACYEIRCANDPQWCLPGTITVTATNFCPPNYALSNDNGGWCNPPLQHFDLAQPSFLHIA  143

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDV AV IKGS+TGWQ 
Sbjct  144  QYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVKAVFIKGSKTGWQA  203

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS L+GQSLSF+VTT DGRT+TS+N  P++W+FGQT+EG+Q 
Sbjct  204  MSRNWGQNWQSNSYLDGQSLSFKVTTSDGRTITSYNVVPANWKFGQTFEGSQL  256



>ref|XP_003523276.1| PREDICTED: expansin-A8-like [Glycine max]
Length=250

 Score =   349 bits (896),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 201/230 (87%), Gaps = 3/230 (1%)
 Frame = +1

Query  202  FGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            + DYGG WQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNG++CGSC
Sbjct  21   YADYGGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGSC  80

Query  379  YELMC-TGP-YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C T P +CLPGS+ +TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI  Y+
Sbjct  81   YEMKCDTDPKWCLPGSIIVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYK  140

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSR
Sbjct  141  AGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQTMSR  200

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRT+TS N  P++WQFGQT+EGAQF
Sbjct  201  NWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSNNIVPANWQFGQTFEGAQF  250



>ref|XP_009804397.1| PREDICTED: expansin-A10 [Nicotiana sylvestris]
Length=266

 Score =   350 bits (897),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 204/234 (87%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C++ +F D GGWQ+AHAT YGG DASGTMGGACGYGNL   GYGTN AALSTALFNNGL 
Sbjct  33   CINESFADNGGWQSAHATAYGGGDASGTMGGACGYGNLNSQGYGTNTAALSTALFNNGLT  92

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CYEL C   G +C+ G++T+TAT+FCPPNP LP++NGGWCNPP  HFD+A+PA+L+I
Sbjct  93   CGACYELKCNNDGKWCISGTITVTATNFCPPNPSLPSNNGGWCNPPLQHFDLAQPAFLKI  152

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVPV++RRVPC KKGGIRFTINGH ++NLVLVTNVGG GDVH+++IKGS+ GWQ
Sbjct  153  AQYKAGIVPVSFRRVPCNKKGGIRFTINGHSYYNLVLVTNVGGAGDVHSISIKGSKNGWQ  212

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQVTT D +TVTS+NAAP++WQFGQT+EG QF
Sbjct  213  SMSRNWGQNWQSNSYLNGQSLSFQVTTSDEKTVTSYNAAPANWQFGQTFEGGQF  266



>dbj|BAN09211.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=249

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 200/230 (87%), Gaps = 3/230 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
             GDYGGWQTAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+CY
Sbjct  20   LGDYGGWQTAHATFYGGGDASGTMGGACGYGNLYSAGYGTNTAALSTALFNNGLSCGACY  79

Query  382  ELMCTG---PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
             + C+     YCL G +T+TAT+FCPPNP LPNDNGGWCN PR HFD+AEPAYLQI  YR
Sbjct  80   AIKCSSSDPKYCLGGMITVTATNFCPPNPALPNDNGGWCNFPRQHFDLAEPAYLQIAQYR  139

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++ RVPC+KKGGIRFTINGH +FNLVLVTNVGG GDVH++++KGSRTGW  +SR
Sbjct  140  AGIVPVDFMRVPCKKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSISVKGSRTGWVPLSR  199

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRT+TS N AP +WQFGQT+EG QF
Sbjct  200  NWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSNNVAPPNWQFGQTFEGNQF  249



>ref|XP_009374380.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=254

 Score =   349 bits (896),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 195/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H     YG W+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  23   HGVLAVYGSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  82

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYE+MC     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  
Sbjct  83   SCYEMMCNNDPRWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIAQ  142

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTGWQ M
Sbjct  143  YRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQPM  202

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQ+LSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  203  SRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>ref|XP_010938009.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=256

 Score =   349 bits (896),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 198/230 (86%), Gaps = 3/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GD  GWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC
Sbjct  28   ALGD-SGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  86

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+ +TAT++CPPN  LPNDNGGWCNPPR HFD+AEPA+LQI  YR
Sbjct  87   YEMRCADDPQWCLPGSIIVTATNYCPPNYALPNDNGGWCNPPREHFDLAEPAFLQIAQYR  146

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVP++YRRVPC KKGG+RFTINGH +FNLVL+TNV G GDVHAV+IKGS TGWQ MSR
Sbjct  147  AGIVPISYRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSNTGWQAMSR  206

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN  LNGQSLSFQVT+ DG+TVTS+N  P++WQFGQT+EG QF
Sbjct  207  NWGQNWQSNGYLNGQSLSFQVTSSDGKTVTSYNVVPANWQFGQTFEGEQF  256



>dbj|BAJ34927.1| similar to expansin [Vitis hybrid cultivar]
Length=252

 Score =   349 bits (895),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 196/228 (86%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE
Sbjct  25   GDYGGWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGACYE  84

Query  385  LMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C     +CLPG++T+TAT+FCPPN  L N NGGWCNPP  HFD+AEPA+LQI  YRAG
Sbjct  85   MKCNDDPKWCLPGTLTVTATNFCPPNLALSNTNGGWCNPPLQHFDLAEPAFLQIAQYRAG  144

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV AV+IKGS+TGWQ MSRNW
Sbjct  145  IVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQPMSRNW  204

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQ+LSFQVT  DGRT+TS N AP+ WQFGQTYEGAQF
Sbjct  205  GQNWQSNSYLNGQTLSFQVTASDGRTMTSLNVAPAGWQFGQTYEGAQF  252



>gb|KHN48407.1| Expansin-A8 [Glycine soja]
Length=255

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 201/231 (87%), Gaps = 3/231 (1%)
 Frame = +1

Query  199  AFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
            A  DYGG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+CGS
Sbjct  25   ATADYGGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGS  84

Query  376  CYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            CYE+ C     +C PGS+T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI  Y
Sbjct  85   CYEMRCDDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEY  144

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV++V+IKGS+TGWQ MS
Sbjct  145  RAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVNSVSIKGSKTGWQPMS  204

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSNS LNGQSLSFQVTT DGRTVTSFN AP++WQFGQT++G QF
Sbjct  205  RNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANWQFGQTFQGGQF  255



>ref|NP_001289251.1| expansin-A4-like precursor [Pyrus x bretschneideri]
 dbj|BAC67190.1| expansin [Pyrus communis]
 gb|AGR44456.1| expansin 3 [Pyrus x bretschneideri]
Length=254

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/233 (76%), Positives = 196/233 (84%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H  F  YG W+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGVFAVYGSWEGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMRCDNDPRWCRPGSIIVTATNFCPPNFAQSNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ+LSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>gb|AAB81662.1| expansin [Oryza sativa Indica Group]
Length=246

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 196/226 (87%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+G ACGSCYEL 
Sbjct  21   YGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELR  80

Query  391  C--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C   G  CLPGS+T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  YRAGIV
Sbjct  81   CDNAGSSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIV  140

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV++RRVPC KKGGIRFT+NGH +FNLVLVTNV G GDV +V+IKGSRTGWQ MSRNWGQ
Sbjct  141  PVSFRRVPCVKKGGIRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ  200

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSN+ L+GQSLSFQVT  DGRTVTS N A   WQFGQT+EG QF
Sbjct  201  NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF  246



>ref|XP_010103644.1| hypothetical protein L484_011237 [Morus notabilis]
 gb|EXB96527.1| hypothetical protein L484_011237 [Morus notabilis]
Length=253

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 200/229 (87%), Gaps = 3/229 (1%)
 Frame = +1

Query  202  FGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            +GDYGG WQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN AALST+LFNNGL+CG+C
Sbjct  24   YGDYGGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNNGLSCGAC  83

Query  379  YELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  84   YEMRCDNDPKWCLPGSITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYR  143

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNVGG GD+H+V+IKGS+TGWQ MSR
Sbjct  144  AGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDIHSVSIKGSKTGWQSMSR  203

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            NWGQNWQSNS LNGQSLSFQVT  DGRT+TS + AP+ WQFGQT+EGAQ
Sbjct  204  NWGQNWQSNSYLNGQSLSFQVTLSDGRTITSNSVAPAGWQFGQTFEGAQ  252



>ref|XP_006429564.1| hypothetical protein CICLE_v10013804mg [Citrus clementina]
 ref|XP_006481180.1| PREDICTED: expansin-A8-like [Citrus sinensis]
 gb|ESR42804.1| hypothetical protein CICLE_v10013804mg [Citrus clementina]
Length=256

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 199/233 (85%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            VH   GDYGGWQ AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  24   VHAINGDYGGWQIAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  83

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CYE+ C     +CLPG++T+TAT+FCPPN  L NDNGGWCNPP  HFD+A+P++L I 
Sbjct  84   GACYEIRCANDPQWCLPGTITVTATNFCPPNYALSNDNGGWCNPPLQHFDLAQPSFLHIA  143

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RR PC KKGGIRFTINGH +FNLVL+TNVGG GDV AV IKGS+TGWQ 
Sbjct  144  QYRAGIVPVLFRRAPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVKAVFIKGSKTGWQA  203

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS L+GQSLSF+VTT DGRT+TS+N  P++W+FGQT+EG+Q 
Sbjct  204  MSRNWGQNWQSNSYLDGQSLSFKVTTSDGRTITSYNVVPANWKFGQTFEGSQL  256



>ref|XP_006654542.1| PREDICTED: expansin-A4-like [Oryza brachyantha]
Length=246

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 197/226 (87%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+G ACGSCYEL 
Sbjct  21   YGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELR  80

Query  391  CT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C   G +CLPGS+T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  YRAGIV
Sbjct  81   CDNDGRWCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIV  140

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV+YRRVPC K+GGIRFT+NGH +FNLVLVTNV G GDV +V+IKGSRTGWQ MSRNWGQ
Sbjct  141  PVSYRRVPCVKRGGIRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ  200

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSN+ L+GQSLSFQVT  DGRTVTS N A   WQFGQT+EG QF
Sbjct  201  NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF  246



>gb|ACK87022.1| expansin [Diospyros kaki]
Length=254

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 201/227 (89%), Gaps = 2/227 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGT  AALSTALFNNGL+CG+CYE
Sbjct  27   GDYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYE  86

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            L C     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+L+I  YRAG
Sbjct  87   LKCNDDARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAG  146

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+++RVPC KKGGIRFTINGH +FNLVL++NVGG GDVHAV++KGSRTGWQ MSRNW
Sbjct  147  IVPVSFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNW  206

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            GQNWQSN+ LNGQSLSFQ+T  DGRTVTS+N APS+WQFGQT+EG+Q
Sbjct  207  GQNWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNWQFGQTFEGSQ  253



>gb|AAT94292.1| alpha-expansin EXPA2 [Triticum aestivum]
Length=251

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GDYG WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALF +G ACGSC
Sbjct  22   AAGDYGSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFYDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C      CLPGS+TITAT+ CPPN  LPND+GGWCNPPR HFDMAEPAYLQIG+YR
Sbjct  82   YELKCQDVSSSCLPGSITITATNLCPPNYALPNDDGGWCNPPRAHFDMAEPAYLQIGIYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIV V YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +VAIKGS TG Q M+R
Sbjct  142  AGIVAVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVAIKGSSTGCQAMAR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ L+GQSLSF+VT  DGRTVTS NAAP+ W FGQT+EGAQF
Sbjct  202  NWGQNWQSNADLDGQSLSFRVTLSDGRTVTSNNAAPAGWSFGQTFEGAQF  251



>gb|ADC35366.1| alpha-expansin 3 [Coffea arabica]
Length=254

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 200/242 (83%), Gaps = 10/242 (4%)
 Frame = +1

Query  187  CVHLAF--------GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALST  342
            C+ +AF         DYGGWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALST
Sbjct  13   CIIIAFVLRFSLIKADYGGWQGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALST  72

Query  343  ALFNNGLACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDM  516
            ALFNNGL CG+CYE+ C G   +CL G++T+TAT+FCPPN  LPNDNGGWCNPPR HFD+
Sbjct  73   ALFNNGLTCGACYEMRCDGDPKWCLGGTITVTATNFCPPNFALPNDNGGWCNPPRQHFDL  132

Query  517  AEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAI  696
            AEPA+LQI  YRAGIVPV YRRVPC KKGGIRFTINGH FFNLVLVTNV G GD+  V+I
Sbjct  133  AEPAFLQIAQYRAGIVPVAYRRVPCAKKGGIRFTINGHSFFNLVLVTNVAGAGDILTVSI  192

Query  697  KGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGA  876
            KGSRTGWQ MSRNWGQNWQSNS LNGQSLS  VT  DGRTVTS++ AP++WQFGQT+EG 
Sbjct  193  KGSRTGWQTMSRNWGQNWQSNSHLNGQSLSIMVTASDGRTVTSYSVAPANWQFGQTFEGG  252

Query  877  QF  882
            QF
Sbjct  253  QF  254



>ref|NP_001055842.1| Os05g0477600 [Oryza sativa Japonica Group]
 sp|Q0DHB7.1|EXPA4_ORYSJ RecName: Full=Expansin-A4; AltName: Full=Alpha-expansin-4; AltName: 
Full=OsEXP4; AltName: Full=OsEXPA4; AltName: Full=OsaEXPa1.22; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2Y5R6.1|EXPA4_ORYSI RecName: Full=Expansin-A4; AltName: Full=Alpha-expansin-4; AltName: 
Full=OsEXP4; AltName: Full=OsEXPA4; AltName: Full=OsaEXPa1.22; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|AAL24481.1|AF394545_1 alpha-expansin OsEXPA4 [Oryza sativa]
 gb|AAT01362.1| alpha-expansin [Oryza sativa Japonica Group]
 dbj|BAF17756.1| Os05g0477600 [Oryza sativa Japonica Group]
 gb|EAY98426.1| hypothetical protein OsI_20341 [Oryza sativa Indica Group]
 dbj|BAG94480.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64095.1| hypothetical protein OsJ_18926 [Oryza sativa Japonica Group]
Length=246

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 196/226 (87%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+G ACGSCYEL 
Sbjct  21   YGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELR  80

Query  391  C--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C   G  CLPGS+T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  YRAGIV
Sbjct  81   CDNAGSSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIV  140

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV++RRVPC KKGG+RFT+NGH +FNLVLVTNV G GDV +V+IKGSRTGWQ MSRNWGQ
Sbjct  141  PVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ  200

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSN+ L+GQSLSFQVT  DGRTVTS N A   WQFGQT+EG QF
Sbjct  201  NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF  246



>ref|XP_008456949.1| PREDICTED: expansin-A8-like [Cucumis melo]
Length=252

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 2/231 (1%)
 Frame = +1

Query  196  LAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
              F DYGGWQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN  ALST LFNNGL+CG+
Sbjct  22   FTFADYGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTVALSTTLFNNGLSCGA  81

Query  376  CYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            C+E+ CT    +CLPG++ +TAT+FCPPN  LPN+NGGWCNPP  HFDMAEPA+LQI  Y
Sbjct  82   CFEMTCTNDPKWCLPGTIRVTATNFCPPNFALPNNNGGWCNPPLQHFDMAEPAFLQIAQY  141

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVPV++RRVPC KKGG+RFTINGH +FNLVL+TNVGG GDVHAV+IKGSRTGWQ MS
Sbjct  142  RAGIVPVSFRRVPCMKKGGVRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQAMS  201

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSN+ LNGQ LSFQVT  DG T+T++N  PS+WQFGQTYEG QF
Sbjct  202  RNWGQNWQSNNYLNGQGLSFQVTLSDGHTLTAYNLVPSNWQFGQTYEGPQF  252



>ref|NP_001281040.1| expansin-A4-like precursor [Malus domestica]
 gb|AAM08928.1| expansin 1 [Malus domestica]
Length=254

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 194/233 (83%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H     YG W+  HATFYGG DAS TMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  22   LHGVLAVYGSWEGVHATFYGGGDASATMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+MC     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMMCNNDPRWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ+LSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNSYLNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  254



>gb|AAD47901.1|AF085330_1 expansin [Pinus taeda]
Length=253

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW++AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  28   YGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMR  87

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG+VT+TAT+FCPPN  LPNDNGGWCNPP  HFDMAEPA+L+I  YR GIV
Sbjct  88   CNDDPQWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  147

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ Y RVPC +KGGIRFT+NGH +FNLVL+TNVGG GDVHAV+IKGSR+GWQ MSRNWGQ
Sbjct  148  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRSGWQPMSRNWGQ  207

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            NWQSNS LNGQSLSFQVTT DGRTV S N APS+WQFGQT+EG+Q
Sbjct  208  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNWQFGQTFEGSQ  252



>dbj|BAJ99188.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03604.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 198/232 (85%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
              A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACG
Sbjct  20   QAAAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACG  79

Query  373  SCYELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYEL C   G  C PGS+ +TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  
Sbjct  80   SCYELRCDNAGSSCRPGSIMVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQ  139

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GD  +V+IKG+RTGWQ M
Sbjct  140  YRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDARSVSIKGTRTGWQAM  199

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWG NWQSN+ L+GQ LSF+VT+ DGRTVTS  AAP+ WQFGQT+EGAQF
Sbjct  200  SRNWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPAGWQFGQTFEGAQF  251



>ref|XP_007146869.1| hypothetical protein PHAVU_006G077200g [Phaseolus vulgaris]
 gb|ESW18863.1| hypothetical protein PHAVU_006G077200g [Phaseolus vulgaris]
Length=255

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A  DYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+CGSC
Sbjct  26   ATADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGSC  85

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C     +C PG++T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI  YR
Sbjct  86   FEMRCDDDPRWCKPGTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEYR  145

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSR
Sbjct  146  AGIVPVAFRRVPCAKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQPMSR  205

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSFQVTT DGRTV S+N AP +WQFGQT++G QF
Sbjct  206  NWGQNWQSNSYLNGQALSFQVTTSDGRTVASYNVAPGNWQFGQTFQGGQF  255



>ref|XP_002441263.1| hypothetical protein SORBIDRAFT_09g023440 [Sorghum bicolor]
 gb|EES19693.1| hypothetical protein SORBIDRAFT_09g023440 [Sorghum bicolor]
Length=248

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 197/223 (88%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC--  393
            WQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSCYEL C  
Sbjct  26   WQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSCYELRCDN  85

Query  394  TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
             G  CLPG++T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  YRAGIVPV 
Sbjct  86   AGRSCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVA  145

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            +RRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+I+GSRTGWQ MSRNWGQNWQ
Sbjct  146  FRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVRSVSIRGSRTGWQPMSRNWGQNWQ  205

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SN+ L+GQ+LSFQVT  DGRTVTS NAAP+ WQFGQT+EGAQF
Sbjct  206  SNADLDGQALSFQVTASDGRTVTSNNAAPAGWQFGQTFEGAQF  248



>ref|XP_010525408.1| PREDICTED: expansin-A8 [Tarenaya hassleriana]
Length=253

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 183/253 (72%), Positives = 205/253 (81%), Gaps = 2/253 (1%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRT  309
            M +PS   +  ++    S  +   + DYGGWQ  HATFYGG DASGTMGGACGYGNLY  
Sbjct  1    MYIPSRIKVSLIISLLGSLLLRETYADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQ  60

Query  310  GYGTNIAALSTALFNNGLACGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndngg  483
            GYGT+ AALSTALFNNGL CG+CYEL C     +CL G++T+TAT+FCPPN GL NDNGG
Sbjct  61   GYGTSTAALSTALFNNGLTCGACYELRCDNDQRWCLSGTITVTATNFCPPNFGLANDNGG  120

Query  484  WCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNV  663
            WCNPP  HFD+AEPA+LQI  YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV
Sbjct  121  WCNPPLEHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLITNV  180

Query  664  GGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPS  843
             G GDVHAV+IKGS TGWQ MSRNWGQNWQSNS LNGQSLSFQVTT DGRTVTS N APS
Sbjct  181  AGAGDVHAVSIKGSNTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSNNVAPS  240

Query  844  DWQFGQTYEGAQF  882
             WQFGQT++G QF
Sbjct  241  GWQFGQTFQGGQF  253



>ref|XP_006644922.1| PREDICTED: expansin-A2-like [Oryza brachyantha]
Length=248

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 196/233 (84%), Gaps = 4/233 (2%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
              LA GDYG    AHATFYGG DASGTMGGACGYGNLY TGYGTN AALST LFN+G AC
Sbjct  18   ARLAAGDYG--SCAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAAC  75

Query  370  GSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYEL C   G +CLPGSVT+TAT+ CPPN  LPND+GGWCNPPRPHFDMAEPA+LQIG
Sbjct  76   GSCYELRCDNDGQWCLPGSVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIG  135

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
            VYRAGIVPV YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+IKGS +GWQ 
Sbjct  136  VYRAGIVPVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSSGWQP  195

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS L+GQSLSFQV   DGRTVTS N  P+ WQFGQT+EG QF
Sbjct  196  MSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFGQTFEGGQF  248



>gb|ACK43884.1| expansin [Diospyros kaki]
 gb|ACK43885.1| expansin [Diospyros kaki]
Length=254

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGT  AALSTALFNNGL+CG+CYE
Sbjct  27   GDYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYE  86

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            L C     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+L+I  YRAG
Sbjct  87   LKCNDDARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAG  146

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+++RVPC KKGGIRFTINGH +FNLVL++NVGG GDVHAV++KGSRTGWQ MSRNW
Sbjct  147  IVPVSFQRVPCVKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSVKGSRTGWQPMSRNW  206

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSN+ LNGQSLSFQ+T  DGRTVTS+N APS+WQFGQT+ G+QF
Sbjct  207  GQNWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNWQFGQTFGGSQF  254



>ref|NP_001240113.1| expansin precursor [Glycine max]
 gb|ACU19992.1| unknown [Glycine max]
 gb|KHN25812.1| Expansin-A8 [Glycine soja]
Length=250

 Score =   347 bits (889),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 200/230 (87%), Gaps = 3/230 (1%)
 Frame = +1

Query  202  FGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            + DYGG WQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNG++CGSC
Sbjct  21   YADYGGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGSC  80

Query  379  YELMC-TGP-YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C T P +CLPGS+ +TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI  Y+
Sbjct  81   YEMKCDTDPKWCLPGSIIVTATNFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYK  140

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRV C KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSR
Sbjct  141  AGIVPVSFRRVSCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQTMSR  200

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRT+TS N  P++WQFGQT+EGAQF
Sbjct  201  NWGQNWQSNSYLNGQSLSFQVTTSDGRTLTSNNIVPANWQFGQTFEGAQF  250



>gb|AAB40635.1| expansin, partial [Pinus taeda]
Length=232

 Score =   346 bits (887),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 198/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW++AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  7    YGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMR  66

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG+VT+TAT+FCPPN  LPNDNGGWCNPP  HFDMAEPA+L+I  YR GIV
Sbjct  67   CNDDPQWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ Y RVPC +KGGIRFT+NGH +FNLVL+TNVGG GDVHAV+IKGSR+GWQ MSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRSGWQPMSRNWGQ  186

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            NWQSNS LNGQSLSFQVTT DGRTV S N APS+WQFGQT+EG+Q
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNWQFGQTFEGSQ  231



>ref|XP_009776279.1| PREDICTED: expansin-A8-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009776280.1| PREDICTED: expansin-A8-like isoform X1 [Nicotiana sylvestris]
Length=254

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 201/232 (87%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  F DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  23   HGTFADYGGWKNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  82

Query  373  SCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYEL C+    +CL G++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+L++  
Sbjct  83   ACYELTCSNDAQWCLQGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKLAQ  142

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV++RRV C KKGGIRFTINGH +FNLVLVTNVGG GDV++V+IKGS +GWQ M
Sbjct  143  YRAGIVPVSFRRVSCNKKGGIRFTINGHSYFNLVLVTNVGGAGDVNSVSIKGSGSGWQAM  202

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LN QSLSFQVTT DGRT+TS+N AP +WQFGQT+EG QF
Sbjct  203  SRNWGQNWQSNSYLNSQSLSFQVTTSDGRTITSYNVAPHNWQFGQTFEGVQF  254



>gb|AAL87023.1| cell wall protein Exp4 precursor [Mirabilis jalapa]
Length=252

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 194/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW TAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  28   GGWTTAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMKC  87

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +C PGS+ +TAT+FCPPN  L N+NGGWCNPP  HFDMA+PA+LQI  YRAGIVP
Sbjct  88   NDDPKWCRPGSIVVTATNFCPPNYALANNNGGWCNPPLQHFDMAQPAFLQIAQYRAGIVP  147

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            +++RRVPC KKGGIRFT+NGH +FNLVLVTNV G GDVHAV+IKGS+TGWQ MSRNWGQN
Sbjct  148  ISFRRVPCAKKGGIRFTVNGHSYFNLVLVTNVAGAGDVHAVSIKGSKTGWQAMSRNWGQN  207

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSFQVT  DGRTVTS N AP++WQFGQTY GAQF
Sbjct  208  WQSNSYLNGQSLSFQVTASDGRTVTSNNIAPANWQFGQTYVGAQF  252



>gb|KHG29916.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=253

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 193/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTGP--Y  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CGSCYE+ C     +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGSCYEMRCDNDPRW  94

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLPGSVT+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRAGIVP+++RRV
Sbjct  95   CLPGSVTVTATNFCPPNLALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRV  154

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGGIRFTINGH +FNLVL++NVGG GDVHAV+IKGS+TGWQ MSRNWGQNWQSNS 
Sbjct  155  PCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNSY  214

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  215  LNGQSLSFQVTTSDGRTVTSYNVAPANWQFGQTFEGGQF  253



>gb|ABY65114.1| putative expansin [Gerbera hybrid cultivar]
Length=245

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 202/232 (87%), Gaps = 5/232 (2%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            HLA GD   WQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG
Sbjct  17   HLAHGD---WQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCG  73

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYE+ C     +CLPG++ +TAT+FCPPNPGL NDNGGWCNPP  HFD+AEPA+LQI  
Sbjct  74   SCYEMKCNDDPRWCLPGTIIVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQ  133

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV+++RVPC KKGG+RFTINGH +FNLVL+TNVGG GDVHAV+IKGS+TGWQ M
Sbjct  134  YRAGIVPVSFQRVPCAKKGGVRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSKTGWQAM  193

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSFQVTT DGRT+TS + APS+WQFGQT++GAQF
Sbjct  194  SRNWGQNWQSNSYLNGQSLSFQVTTSDGRTITSNDVAPSNWQFGQTFQGAQF  245



>ref|XP_008792215.1| PREDICTED: expansin-A8-like [Phoenix dactylifera]
Length=255

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 199/233 (85%), Gaps = 3/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            V   FGD  GWQTAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  24   VRRTFGD-SGWQTAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  82

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+CYE+ C     +CLPG++ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  83   GACYEMKCADDPTWCLPGTIVVTATNFCPPNYALSNDNGGWCNPPLQHFDLAEPAFLQIA  142

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGG+RFT+NGH +FNLVL+TNV G GDVHAV+IKGS+TGWQ 
Sbjct  143  QYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQA  202

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ L GQSLSFQVTT DGRTVTS++A P+ WQFGQT++G QF
Sbjct  203  MSRNWGQNWQSNAYLGGQSLSFQVTTSDGRTVTSYDAVPAGWQFGQTFQGGQF  255



>gb|ABO30977.1| alpha expansin protein 3 [Calotropis procera]
Length=252

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 202/236 (86%), Gaps = 5/236 (2%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C+     DYGGWQ+ HATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+
Sbjct  18   CLRETLADYGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLS  77

Query  367  CGSCYELMCTGP----YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            CGSC+EL C+      +CLPG++T+TAT+FCPPNP LPN+NGGWCNPP  HFD+AEPA+L
Sbjct  78   CGSCFELRCSSSADPRWCLPGTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAEPAFL  137

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            QI  YRAGIVPV + RVPCR++G  + TINGH +FNLVL+TNVGG GDVH+V+IKG+RTG
Sbjct  138  QIAQYRAGIVPVEFMRVPCRRRGN-KVTINGHSYFNLVLITNVGGAGDVHSVSIKGTRTG  196

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQSNS LNGQSLSFQVTT DGRT+TS+NA P+ WQFGQT+EGAQF
Sbjct  197  WQPMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTITSYNAVPAGWQFGQTFEGAQF  252



>gb|ACK43886.1| expansin [Diospyros kaki]
Length=254

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 200/228 (88%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GDYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGT  AALSTALFNNGL+CG+CYE
Sbjct  27   GDYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTGTAALSTALFNNGLSCGACYE  86

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            L C     +CLPG++T+TAT+FCPPNP LPNDNGGWCNPP  HFD+AEPA+L+I  YRAG
Sbjct  87   LKCNDDARWCLPGTITVTATNFCPPNPSLPNDNGGWCNPPLQHFDLAEPAFLKIAQYRAG  146

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+++RVPC KKGGIRFTINGH +FNLV ++NVGG GDVHAV++KG RTGWQ MSRNW
Sbjct  147  IVPVSFQRVPCVKKGGIRFTINGHSYFNLVSISNVGGAGDVHAVSVKGPRTGWQPMSRNW  206

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSN+ LNGQSLSFQ+T  DGRTVTS+N APS+WQFGQT+EG+QF
Sbjct  207  GQNWQSNNYLNGQSLSFQLTASDGRTVTSYNVAPSNWQFGQTFEGSQF  254



>ref|NP_001242219.1| uncharacterized protein LOC100777044 precursor [Glycine max]
 gb|ACU24064.1| unknown [Glycine max]
Length=255

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 200/231 (87%), Gaps = 3/231 (1%)
 Frame = +1

Query  199  AFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
            A  DYGG WQ+AHATFY G DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+CG+
Sbjct  25   ATADYGGGWQSAHATFYDGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSCGT  84

Query  376  CYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            CYE+ C     +C PGS+T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI  Y
Sbjct  85   CYEMRCDDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAEY  144

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV++V+IKGS+TGWQ MS
Sbjct  145  RAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVNSVSIKGSKTGWQPMS  204

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSNS LNGQSLSFQVTT DGRTVTSFN AP++WQFGQT++G QF
Sbjct  205  RNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANWQFGQTFQGGQF  255



>ref|XP_006842458.1| hypothetical protein AMTR_s00077p00063420 [Amborella trichopoda]
 gb|ERN04133.1| hypothetical protein AMTR_s00077p00063420 [Amborella trichopoda]
Length=253

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 199/230 (87%), Gaps = 3/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            AFGDYG WQ  HATFYGG DA+GTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSC
Sbjct  25   AFGDYG-WQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSC  83

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+ +TAT+FCPPN GL NDNGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  84   YEMRCNDDPRWCLPGSIVVTATNFCPPNLGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYR  143

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RR+PC KKGGIRFTINGH +FNLVL+TNVGG GD+HAV+IKGS  GWQ MSR
Sbjct  144  AGIVPVAFRRIPCVKKGGIRFTINGHSYFNLVLITNVGGAGDIHAVSIKGSNGGWQPMSR  203

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSFQVTT DGRTVTS+N APS+WQFGQT+ G+QF
Sbjct  204  NWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNVAPSNWQFGQTFSGSQF  253



>ref|XP_003519289.1| PREDICTED: expansin-A8-like [Glycine max]
Length=254

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 194/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H A  DYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  23   HGATADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  82

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CY + C     +C PG++ +TAT+FCPPN  L N+NGGWCNPP  HFDMAEPA+LQI  
Sbjct  83   ACYAMKCDDDPRWCKPGTIIVTATNFCPPNFALANNNGGWCNPPLQHFDMAEPAFLQIAQ  142

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRV C K+GGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRT WQ M
Sbjct  143  YRAGIVPVAFRRVSCVKRGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTSWQPM  202

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSFQVT  DGRTVTSFN APS+WQFGQT++G QF
Sbjct  203  SRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAPSNWQFGQTFQGGQF  254



>ref|NP_001234085.1| expansin precursor [Solanum lycopersicum]
 gb|AAD13633.1| expansin precursor [Solanum lycopersicum]
Length=239

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 190/226 (84%), Gaps = 10/226 (4%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW  AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFNNGL+CG+C++LM
Sbjct  21   YGGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNNGLSCGACFQLM  80

Query  391  CT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C   G YCLPG +T+TAT+FCPP          WC+PPRPHFD+++P +L+I  YRAGIV
Sbjct  81   CVNAGQYCLPGIITVTATNFCPPGG--------WCDPPRPHFDLSQPIFLRIAQYRAGIV  132

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV YRRVPCR+ GGIRFTINGH +FNLVLVTNVGG GDVH+V IKGSRT WQ MSRNWGQ
Sbjct  133  PVAYRRVPCRRSGGIRFTINGHSYFNLVLVTNVGGSGDVHSVYIKGSRTQWQPMSRNWGQ  192

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQ+N+ LNGQSLSF+VTTGDGRTV S+NAAPS W FGQT+ G QF
Sbjct  193  NWQNNAYLNGQSLSFKVTTGDGRTVVSYNAAPSSWSFGQTFSGGQF  238



>gb|AAW88315.1| expansin EXPA11 [Triticum aestivum]
Length=251

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C   G  C PGS+ +TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  YR
Sbjct  82   YELRCDNAGSSCRPGSILVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GD  +V+IKG+RTGWQ MSR
Sbjct  142  AGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDARSVSIKGTRTGWQAMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWG NWQSN+ L+GQ LSF+VT+ DGRTVTS  AAP+ W FGQT+EGAQF
Sbjct  202  NWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPAGWHFGQTFEGAQF  251



>gb|KHN40987.1| Expansin-A8 [Glycine soja]
Length=235

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 194/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H A  DYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  4    HGATADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  63

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CY + C     +C PG++ +TAT+FCPPN  L N+NGGWCNPP  HFDMAEPA+LQI  
Sbjct  64   ACYAMKCDDDPRWCKPGTIIVTATNFCPPNFALANNNGGWCNPPLQHFDMAEPAFLQIAQ  123

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV +RRV C K+GGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRT WQ M
Sbjct  124  YRAGIVPVAFRRVSCVKRGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTSWQPM  183

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSFQVT  DGRTVTSFN APS+WQFGQT++G QF
Sbjct  184  SRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAPSNWQFGQTFQGGQF  235



>gb|KHG13406.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=253

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 193/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C     +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCDSDPKW  94

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLPGS+T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRAGIVP+++RRV
Sbjct  95   CLPGSITVTATNFCPPNLALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRV  154

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSRNWGQNWQSNS 
Sbjct  155  PCIKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQLMSRNWGQNWQSNSY  214

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRTVTS+N AP +WQFGQT+EG QF
Sbjct  215  LNGQSLSFQVTTSDGRTVTSYNVAPGNWQFGQTFEGGQF  253



>ref|XP_008782645.1| PREDICTED: expansin-A2-like [Phoenix dactylifera]
Length=257

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 200/230 (87%), Gaps = 3/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            AFGD  GWQTAHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C
Sbjct  29   AFGD-SGWQTAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLSCGAC  87

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+ +TAT+FCPPN  LPNDNGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  88   YEMRCADDSRWCLPGSIIVTATNFCPPNNALPNDNGGWCNPPLQHFDLAEPAFLQIAQYR  147

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGS+TGWQ MS+
Sbjct  148  AGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGSGDVHAVSIKGSKTGWQAMSQ  207

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ L+GQSLSFQVTT DGRTVTS + AP+ WQFGQT+EG QF
Sbjct  208  NWGQNWQSNAYLDGQSLSFQVTTSDGRTVTSNDVAPAGWQFGQTFEGGQF  257



>ref|XP_006365348.1| PREDICTED: expansin-A8-like [Solanum tuberosum]
Length=258

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 204/236 (86%), Gaps = 4/236 (2%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C + +FGD GGWQ+AHAT YGG DASGTMGGACGYGNL   GYGTN AALST+LFNNGL 
Sbjct  23   CFNESFGDNGGWQSAHATLYGGGDASGTMGGACGYGNLNSQGYGTNTAALSTSLFNNGLT  82

Query  367  CGSCYELMCT---GPYCLPGS-VTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            CG+CY+L C       CLPG+ +T+TAT+FCPPNP LPN+NGGWCNPP  HFD+A+PA+L
Sbjct  83   CGACYQLKCNNNDAKLCLPGTTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFL  142

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            +I  Y+AGIVP++++RVPC KKGGIRFTINGH ++NLVLVTNVGG GDVH+V+IKGS+ G
Sbjct  143  KIAQYKAGIVPISFQRVPCMKKGGIRFTINGHSYYNLVLVTNVGGAGDVHSVSIKGSKNG  202

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQSN+ LNGQSLSFQVTT DGRT+TS NAAPS+WQFGQT+EGAQF
Sbjct  203  WQLMSRNWGQNWQSNAYLNGQSLSFQVTTSDGRTITSNNAAPSNWQFGQTFEGAQF  258



>gb|ACU14460.1| unknown [Glycine max]
Length=257

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 199/231 (86%), Gaps = 2/231 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +  A  DYG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGT+  ALSTALFNNGL+C
Sbjct  23   IQGATADYGSWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTVALSTALFNNGLSC  82

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C     +C PGS+T+TAT+FCPPNP LPN+NGGWCNPP  HFDMAEPA+LQI 
Sbjct  83   GSCYEMRCDDDPRWCKPGSITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIA  142

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDV++V+IKGS+TGWQ 
Sbjct  143  EYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVNSVSIKGSKTGWQP  202

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGA  876
            MSRNWGQN QSNS LNGQSLSFQVTT DGRTVTSFN AP++WQFGQT++ A
Sbjct  203  MSRNWGQNRQSNSYLNGQSLSFQVTTSDGRTVTSFNVAPANWQFGQTFQEA  253



>ref|XP_003568245.1| PREDICTED: expansin-A4 [Brachypodium distachyon]
Length=251

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 198/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C   G +CLPGS+ +TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  YR
Sbjct  82   YELRCDNDGKWCLPGSIMVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV +RRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V++KG+RT WQ MSR
Sbjct  142  AGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVRSVSVKGTRTAWQTMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ L+GQ LSF+VT+ DGRTVTS  A P+ WQFGQT+EGAQF
Sbjct  202  NWGQNWQSNTYLDGQCLSFRVTSSDGRTVTSNAAVPAGWQFGQTFEGAQF  251



>ref|XP_009399910.1| PREDICTED: expansin-A2-like [Musa acuminata subsp. malaccensis]
Length=255

 Score =   345 bits (884),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 199/230 (87%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G+  GWQ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSC
Sbjct  26   AVGNSYGWQNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSC  85

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+ +TAT+FCPPN  LPNDNGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  86   YEMRCADDPRWCLPGSIVVTATNFCPPNNALPNDNGGWCNPPLQHFDLAEPAFLQIAQYR  145

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVP+++RRVPC KKGGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGS+TGWQ MSR
Sbjct  146  AGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSKTGWQTMSR  205

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS L+GQSLSFQ+TT DGRT+TS+N A + WQFGQT++G QF
Sbjct  206  NWGQNWQSNSYLDGQSLSFQLTTSDGRTITSYNVASAGWQFGQTFQGGQF  255



>gb|KHG27586.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=253

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 192/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE+ C     +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMKCDNDPKW  94

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLPGS+ +TAT+FCPPN  L NDNGGWCNPP  HFDMAEPA+LQI  YRAGIVP+++RRV
Sbjct  95   CLPGSIIVTATNFCPPNFALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRV  154

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGS+TGWQ MSRNWGQNWQSNS 
Sbjct  155  PCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNSY  214

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRTVTS+N AP++WQFGQT+EG QF
Sbjct  215  LNGQSLSFQVTTSDGRTVTSYNVAPANWQFGQTFEGGQF  253



>gb|ACB45302.1| expansin EXPA11 [Hordeum vulgare]
Length=251

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C   G  C PGS+ +TAT+FCPPN GLP+D+GGWCNPPRPH DMAEPA+L I  YR
Sbjct  82   YELRCDNAGSSCRPGSIMVTATNFCPPNYGLPSDDGGWCNPPRPHLDMAEPAFLHIAQYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVP++YRRVPC KKGGIRFTINGH +FNLVLVTNV G GD  +V+IKG+RTGWQ MSR
Sbjct  142  AGIVPLSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDARSVSIKGTRTGWQAMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWG NWQSN+ L+GQ LSF+VT+ DGRTVTS  AAP+ WQFGQT+EGAQF
Sbjct  202  NWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPAGWQFGQTFEGAQF  251



>gb|AAB40637.1| expansin, partial [Pinus taeda]
Length=232

 Score =   343 bits (881),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW++AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  7    YGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMQ  66

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG+VT+TAT+FCPPN  LPNDNGGWCNPP  HFDMAEPA+L+I  YR GIV
Sbjct  67   CNDDPQWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ Y RVPC +KGGIRFT+NGH +FNLVL+TNVGG GDV+AV+IKGSR+GWQ MSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVNAVSIKGSRSGWQPMSRNWGQ  186

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            NWQSNS LNGQSLSFQVTT DGRTV S N APS+WQFGQT+EG+Q
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNWQFGQTFEGSQ  231



>ref|XP_009387743.1| PREDICTED: expansin-A2-like [Musa acuminata subsp. malaccensis]
Length=255

 Score =   344 bits (883),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 206/255 (81%), Gaps = 4/255 (2%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHL--AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLY  303
            MA+P       L     S C  L  A  D  GW+ AHATFYGG DASGTMGGACGYGNLY
Sbjct  1    MALPKCSLYHVLFFSLPSLCFFLSGALADSYGWRNAHATFYGGGDASGTMGGACGYGNLY  60

Query  304  RTGYGTNIAALSTALFNNGLACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndn  477
              GYGTN AALSTALF+NGL+CG+CYE+ C     +CLPGSV +TAT+FCPPN  LPNDN
Sbjct  61   GQGYGTNTAALSTALFDNGLSCGACYEMRCADNPQWCLPGSVVVTATNFCPPNYALPNDN  120

Query  478  ggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVT  657
            GGWCNPP  HFD+AEPA+LQI  YRAGIVPV++RRVPC +KGGIRFT+NGH +FNLVL+T
Sbjct  121  GGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCVRKGGIRFTVNGHSYFNLVLIT  180

Query  658  NVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAA  837
            NVGG GDVHAV+IKGS+TGWQ MSRNWGQNWQSNS L+GQSLSFQVTTGDG TVTS+N A
Sbjct  181  NVGGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNSYLDGQSLSFQVTTGDGSTVTSYNVA  240

Query  838  PSDWQFGQTYEGAQF  882
            P+ WQFGQT+EG Q 
Sbjct  241  PAGWQFGQTFEGGQL  255



>gb|ABF48653.1| expansin precursor [Vasconcellea cundinamarcensis]
Length=258

 Score =   344 bits (883),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 193/227 (85%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYGGW+ AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  29   DYGGWENAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEM  88

Query  388  MCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C     +CLPGS+T+TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI  YRAGI
Sbjct  89   QCNDDPRWCLPGSITVTATNFCPPNFALSNNNGGWCNPPLQHFDLAEPAFLQIAQYRAGI  148

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV +RRV C KKGGIRFTINGH +FNLVL+TNV G GDV AV+IKGS+TGWQ MSRNWG
Sbjct  149  VPVVFRRVSCAKKGGIRFTINGHSYFNLVLITNVAGAGDVRAVSIKGSKTGWQAMSRNWG  208

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSNS LNG SLSFQVTT DGRTVTS+N AP++WQFGQT E   F
Sbjct  209  QNWQSNSYLNGHSLSFQVTTSDGRTVTSYNVAPANWQFGQTLEVVIF  255



>ref|XP_009631918.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=265

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 202/234 (86%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            CV+ +F D GGWQ+AHAT YGG DASGTMGGACGY NL   GYGTN AALSTALFNNGL 
Sbjct  32   CVNESFADNGGWQSAHATAYGGGDASGTMGGACGYVNLNSQGYGTNTAALSTALFNNGLT  91

Query  367  CGSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+CY+L C   G  C+ G++T+TAT+FCPPNP LP++NGGWCNPP  HFD+A+PA+L+I
Sbjct  92   CGACYQLKCNNDGKRCISGTITVTATNFCPPNPSLPSNNGGWCNPPLQHFDLAQPAFLKI  151

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AGIVPV++RRVPC+KKGGIRFTINGH ++NLVLVTNVGG GDVH+++IKGS+ GW 
Sbjct  152  AQYKAGIVPVSFRRVPCKKKGGIRFTINGHSYYNLVLVTNVGGAGDVHSISIKGSKNGWT  211

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSF+VTT DGRTVTS NAAP++WQFGQT+EG QF
Sbjct  212  SMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVTSNNAAPANWQFGQTFEGRQF  265



>gb|ABK22806.1| unknown [Picea sitchensis]
 gb|ACN40324.1| unknown [Picea sitchensis]
Length=251

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 191/226 (85%), Gaps = 7/226 (3%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW++A ATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  31   YGGWESARATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMQ  90

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG VT+TAT+FCPPN         WCNPP  HFDMAEPA+ QI +Y+ G+V
Sbjct  91   CNDDPQWCLPGIVTVTATNFCPPNSNGG-----WCNPPLQHFDMAEPAFQQIAIYKGGVV  145

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ YRRVPC +KGGIRFT+NGH +FNLVL+TNVGG GDVHAV+IKGSRTGWQ MSRNWGQ
Sbjct  146  PILYRRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  205

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNS LNGQSLSF+VTT DGRTV S+NAAPS+WQF QT+EG+Q 
Sbjct  206  NWQSNSYLNGQSLSFRVTTSDGRTVVSYNAAPSNWQFSQTFEGSQL  251



>gb|ACM90161.1| expansin 3 [Pyrus pyrifolia]
Length=254

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 195/233 (84%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H  F  YG W+ AHATFYGG DASGTMGGACGYG LY  GYGTN AAL+TALFNNGL+C
Sbjct  22   LHGVFAVYGSWEGAHATFYGGGDASGTMGGACGYGTLYSQGYGTNTAALNTALFNNGLSC  81

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+MC     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI 
Sbjct  82   GSCYEMMCNNDPRWCRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL+TNV G GDV++V+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLITNVAGAGDVYSVSIKGSRTGWQP  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ+LSFQVTT DG TVTS+N AP +WQFGQT+ G QF
Sbjct  202  MSRNWGQNWQSNSYLNGQALSFQVTTSDGSTVTSYNVAPGNWQFGQTFSGGQF  254



>gb|AAB40634.1| expansin, partial [Pinus taeda]
Length=232

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 197/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW++AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  7    YGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMR  66

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG+VT+TAT+FCPPN  LPNDNGGWCNPP  HFDMAEPA+L+I  YR GIV
Sbjct  67   CNDDPQWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ Y RVPC +KGGIRFT+NGH +FNLVL+TNVGG GDVHAV+IKGS +GWQ MSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSYFNLVLITNVGGAGDVHAVSIKGSMSGWQPMSRNWGQ  186

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            NWQSNS LNGQSLSFQVTT DGRT+ S N APS+WQFGQT+EG+Q
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTIVSNNVAPSNWQFGQTFEGSQ  231



>gb|ABC55453.1| expansin protein [Rosa x borboniana]
Length=253

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/232 (75%), Positives = 193/232 (83%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  F DYGGW   HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG
Sbjct  22   HSTFADYGGWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCG  81

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYE+ C     +C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  
Sbjct  82   SCYEMRCDNDPRWCRPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQIAQ  141

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIV V +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTGWQ M
Sbjct  142  YRAGIVSVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVVGAGDVHSVSIKGSRTGWQSM  201

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS L+GQ LSFQVTT DGRTVTS+N AP +WQFGQTY+G QF
Sbjct  202  SRNWGQNWQSNSYLSGQLLSFQVTTSDGRTVTSYNVAPGNWQFGQTYQGGQF  253



>gb|ADN03964.1| EXP1 [Phytolacca acinosa]
Length=252

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 196/231 (85%), Gaps = 3/231 (1%)
 Frame = +1

Query  199  AFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
            A+ DYGG W  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGS
Sbjct  22   AYADYGGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGS  81

Query  376  CYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            CYE+ C     +CLPGS+ ITAT+FCPPN  L NDNGGWCNPP  HFDMA+PA+L+I  Y
Sbjct  82   CYEMKCNDDPRWCLPGSIIITATNFCPPNYALANDNGGWCNPPLQHFDMAQPAFLKIAQY  141

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            RAGIVP+++RRVPC +KGGIRFTINGH +FNLVL++NV G GD+HAV+IKGSRTGWQ MS
Sbjct  142  RAGIVPISFRRVPCVRKGGIRFTINGHSYFNLVLISNVAGAGDIHAVSIKGSRTGWQTMS  201

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            RNWGQNWQSNS LN Q+LSFQ+T  DGRTVTS N  PS+WQFGQTY GAQF
Sbjct  202  RNWGQNWQSNSYLNAQTLSFQLTASDGRTVTSNNIVPSNWQFGQTYVGAQF  252



>gb|AAS48872.1| expansin EXPA3 [Triticum aestivum]
Length=251

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 192/230 (83%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G YG WQ+AHATFYGG DASGTMGGACGYGNLY +GYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGGYGSWQSAHATFYGGGDASGTMGGACGYGNLYSSGYGTNAAALSTALFNDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C      CLPGS+TITAT+ CPPN  LPND  GWCNPPR HFDMAEPAYLQIG+YR
Sbjct  82   YELKCQEVSSSCLPGSITITATNLCPPNYALPNDERGWCNPPRAHFDMAEPAYLQIGIYR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIV V YRRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +VAIKG  TGWQ M+R
Sbjct  142  AGIVAVAYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVQSVAIKGYSTGWQAMAR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             WGQNWQSN+ L+GQS SF+VT  DGRTVTS NAAP+ W FGQT+EGAQF
Sbjct  202  IWGQNWQSNADLDGQSFSFRVTFSDGRTVTSNNAAPAGWSFGQTFEGAQF  251



>gb|ABG49444.1| expansin [Citrus sinensis]
Length=252

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/234 (73%), Positives = 188/234 (80%), Gaps = 3/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C    FGDYGG WQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  20   CFRGTFGDYGGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  79

Query  364  ACGSCYELMCTG-PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            +CGSCYE+ C   P  LP  +  TAT+FCPP          WCNPP  HFDMAEPA+LQI
Sbjct  80   SCGSCYEMKCENDPSVLP-LIIFTATNFCPPTLPCLTTTAVWCNPPLQHFDMAEPAFLQI  138

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVP+++RR+PC KKGGIRFT+NGH +FNLVLVTNVGG GDVH+V+IKGS+TGWQ
Sbjct  139  AQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLVTNVGGAGDVHSVSIKGSKTGWQ  198

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSFQ+T  DGRTVTS N  P +WQFGQT+EG QF
Sbjct  199  AMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTVTSNNVVPGNWQFGQTFEGGQF  252



>ref|XP_004240235.1| PREDICTED: expansin-A8-like [Solanum lycopersicum]
Length=258

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 203/236 (86%), Gaps = 4/236 (2%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C + +FGD GGWQ+AHAT YGG DASGTMGGACGYGNL   GYGTN AALST+LFNNGL 
Sbjct  23   CFNESFGDNGGWQSAHATLYGGGDASGTMGGACGYGNLNSQGYGTNTAALSTSLFNNGLT  82

Query  367  CGSCYELMCTG---PYCLPGS-VTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYL  534
            CG+CY+L C       CLPG+ +T+TAT+FCPPNP L N+NGGWCNPP  HFD+A+PA+L
Sbjct  83   CGACYKLKCNNNDDKLCLPGTTITVTATNFCPPNPSLSNNNGGWCNPPLQHFDLAQPAFL  142

Query  535  QIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG  714
            +I  Y+AGIVP++++RVPC KKGGIRFTINGH ++NL+LVTNVGG GDVH+V+IKGS+ G
Sbjct  143  KIAQYKAGIVPISFQRVPCMKKGGIRFTINGHSYYNLILVTNVGGAGDVHSVSIKGSKNG  202

Query  715  WQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ MSRNWGQNWQ+N+ LNGQSLSFQVTT DGRT+TS NAAPS+WQFGQT+EGAQF
Sbjct  203  WQLMSRNWGQNWQNNAYLNGQSLSFQVTTSDGRTITSNNAAPSNWQFGQTFEGAQF  258



>gb|AAB40636.1| expansin, partial [Pinus taeda]
Length=232

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 196/225 (87%), Gaps = 2/225 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW++AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CG+CYE+ 
Sbjct  7    YGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGACYEMQ  66

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG+VTITAT+FCPPN  LPNDNGGWCNPP  HFDMAEPA+L+I  YR GIV
Sbjct  67   CNDDPQWCLPGTVTITATNFCPPNNALPNDNGGWCNPPLQHFDMAEPAFLKIAKYRGGIV  126

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            P+ Y RVPC +KGGIRFT+NGH  FNLVL+TNVGG GDVHAV+IKG R+GWQ MSRNWGQ
Sbjct  127  PILYTRVPCLRKGGIRFTVNGHSCFNLVLITNVGGAGDVHAVSIKGPRSGWQPMSRNWGQ  186

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQ  879
            NWQSNS LNGQSLSFQVTT DGRTV S N APS+WQFGQT+EG+Q
Sbjct  187  NWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNWQFGQTFEGSQ  231



>gb|AAW88314.1| expansin EXPA10 [Triticum aestivum]
Length=250

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 197/232 (85%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
              A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACG
Sbjct  19   QAAAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACG  78

Query  373  SCYELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYEL C   G  C PGS+ +TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  
Sbjct  79   TCYELRCDNAGSSCRPGSILVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQ  138

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GD  +V+IKG+RTGWQ M
Sbjct  139  YRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDARSVSIKGTRTGWQAM  198

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWG NWQSN+ L+GQ LSF+VT+ DGRTVTS  AAP+ W FGQT+EGA+F
Sbjct  199  SRNWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPAGWHFGQTFEGAEF  250



>ref|XP_009404081.1| PREDICTED: expansin-A15 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G  GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C
Sbjct  20   AHGYGGGWTRAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGAC  79

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YELMC     YCL G++ +TAT+FCPPN  LPND GGWCNPP  HFD+++P +L+I  YR
Sbjct  80   YELMCVNDHQYCLRGTIVVTATNFCPPNSALPNDAGGWCNPPLQHFDLSQPVFLRIAQYR  139

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV YRRVPCRK+GGIRFTINGH +FNLVL+TNVGG GDV+AV++KGSRTGWQ MSR
Sbjct  140  AGIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVNAVSVKGSRTGWQSMSR  199

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSF+VTTGDGR++ S+N AP+ W FGQT+ G QF
Sbjct  200  NWGQNWQSNSYLNGQALSFKVTTGDGRSLVSYNVAPASWSFGQTFSGGQF  249



>ref|XP_006338442.1| PREDICTED: expansin-A10-like [Solanum tuberosum]
Length=279

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 189/225 (84%), Gaps = 10/225 (4%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFNNGL+CGSC++LMC
Sbjct  62   GGWINAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNNGLSCGSCFQLMC  121

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G YCLPG +T+TAT+FCPP          WC+PPRPHFD+++P +L+I  YRAGIVP
Sbjct  122  VNAGQYCLPGIITVTATNFCPPGG--------WCDPPRPHFDLSQPIFLRIAQYRAGIVP  173

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR+ GGIRFTINGH +FNLVLVTNVGG GDVH+V IKGSRT WQ MSRNWGQN
Sbjct  174  VAYRRVPCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVHSVYIKGSRTQWQPMSRNWGQN  233

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQ+N+ LNGQSLSF+VTTGDGRTV S+NAAPS W FGQT+ G QF
Sbjct  234  WQNNAYLNGQSLSFKVTTGDGRTVVSYNAAPSSWSFGQTFSGGQF  278



>gb|AAL87025.1| cell wall protein Exp1 precursor [Mirabilis jalapa]
Length=252

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 197/232 (85%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H  + +YGGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  21   HGVYANYGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCG  80

Query  373  SCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            SCYEL C G   +CL GS+ ITAT+FCPPN  L N+NGGWCNPP  HFDMA+PA+L+I  
Sbjct  81   SCYELKCNGDPKWCLRGSIIITATNFCPPNYALANNNGGWCNPPLQHFDMAQPAFLKIAQ  140

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV++RRVPC ++GGIRFTINGH +FNLVL++NVGG GD+HAV+IKGSRTGWQ M
Sbjct  141  YRAGIVPVSFRRVPCMRRGGIRFTINGHSYFNLVLISNVGGAGDIHAVSIKGSRTGWQTM  200

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSN+ LNGQ+LSF+VTT DGR+VTS N  P  WQFGQT+ GAQF
Sbjct  201  SRNWGQNWQSNAYLNGQTLSFRVTTSDGRSVTSNNIVPYHWQFGQTFVGAQF  252



>gb|ABR16833.1| unknown [Picea sitchensis]
Length=250

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 196/225 (87%), Gaps = 4/225 (2%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC--  393
            WQ+AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+CYE+ C  
Sbjct  26   WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYEMKCNE  85

Query  394  -TGP-YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
             T P +CLPG+VT+TAT+FCPPN  LPNDNGGWCNPP  HFDMA+PAY QI +YR GIVP
Sbjct  86   ETDPQWCLPGTVTVTATNFCPPNNALPNDNGGWCNPPLQHFDMAQPAYQQIAIYRGGIVP  145

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            + +RRVPC +KGG+RFTINGH +FNLVL+TNVGG GDV AV+IKGS +GWQ MSRNWGQN
Sbjct  146  IMFRRVPCVRKGGVRFTINGHSYFNLVLITNVGGAGDVEAVSIKGSNSGWQAMSRNWGQN  205

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSFQVTT DGRTVTS+N AP++WQFGQT+EG Q 
Sbjct  206  WQSNSYLNGQTLSFQVTTSDGRTVTSYNVAPANWQFGQTFEGLQL  250



>ref|XP_002532867.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
 gb|EEF29521.1| Alpha-expansin 8 precursor, putative [Ricinus communis]
Length=248

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/234 (74%), Positives = 198/234 (85%), Gaps = 2/234 (1%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H  +GD  GWQ AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNG +
Sbjct  15   CSHGTYGDNRGWQAAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGYS  74

Query  367  CGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+C+++ C     +CL  ++T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI
Sbjct  75   CGACFQIRCNSDPQWCLSRTITVTATNFCPPNFALANDNGGWCNPPLQHFDLAEPAFLQI  134

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAGIVPV +RRVPC KKGG+RFTINGH +FNLVL++NV G GD+ AVAIKG+RTGWQ
Sbjct  135  AQYRAGIVPVLFRRVPCVKKGGMRFTINGHSYFNLVLISNVAGAGDIGAVAIKGARTGWQ  194

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSF+VTT DGRT+TSFN AP++WQFGQT+EG QF
Sbjct  195  TMSRNWGQNWQSNSYLNGQSLSFRVTTSDGRTITSFNVAPANWQFGQTFEGGQF  248



>gb|ACK36942.1| expansin [Annona cherimola]
Length=248

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 194/224 (87%), Gaps = 2/224 (1%)
 Frame = +1

Query  217  GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT  396
            GW+  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C 
Sbjct  25   GWEGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCN  84

Query  397  GP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPV  570
                +CLPG++T+TAT FCPPN  L N+NGGWCNPP  HFD+AEPA+LQI  YRAGIVPV
Sbjct  85   DDPRWCLPGTITVTATYFCPPNFALANNNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPV  144

Query  571  NYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNW  750
            ++RRVPC KKGGIRFTINGH +FNLVLVTNV G GDVH+V+IKGS+TGW+ MSRNWGQNW
Sbjct  145  SFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVHSVSIKGSKTGWRAMSRNWGQNW  204

Query  751  QSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QSNS LNGQSLSFQVTT DGRTVTS+N  P+ WQFGQT++GAQF
Sbjct  205  QSNSYLNGQSLSFQVTTSDGRTVTSYNVVPAGWQFGQTFQGAQF  248



>ref|XP_007142047.1| hypothetical protein PHAVU_008G248000g [Phaseolus vulgaris]
 gb|ESW14041.1| hypothetical protein PHAVU_008G248000g [Phaseolus vulgaris]
Length=251

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 198/235 (84%), Gaps = 4/235 (2%)
 Frame = +1

Query  190  VHL--AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            +HL  AF DYGGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL
Sbjct  17   MHLKTAFADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGL  76

Query  364  ACGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CG+C+E+ C     +C  G++ +TAT+FCPPN  LPN+NGGWCNPP  HFDMAEPA+LQ
Sbjct  77   SCGACFEMRCDDDPRWCKAGTIVVTATNFCPPNFALPNNNGGWCNPPLQHFDMAEPAFLQ  136

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVPV +RRV C KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRT W
Sbjct  137  IAQYRAGIVPVAFRRVSCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTSW  196

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSNS LNGQSLSFQ+T  DGRT+T+FN AP +WQFGQT++G+QF
Sbjct  197  QPMSRNWGQNWQSNSYLNGQSLSFQLTASDGRTLTAFNVAPDNWQFGQTFQGSQF  251



>ref|XP_006415956.1| hypothetical protein EUTSA_v10008578mg [Eutrema salsugineum]
 gb|ESQ34309.1| hypothetical protein EUTSA_v10008578mg [Eutrema salsugineum]
Length=249

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E+ C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFEIRC  83

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRAGIVP
Sbjct  84   ENDGKWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRNWGQN
Sbjct  144  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV SFNAAPS W FGQT+ G QF
Sbjct  204  WQSNSYLNGQALSFKVTTSDGRTVVSFNAAPSGWSFGQTFAGGQF  248



>ref|XP_003613849.1| Expansin [Medicago truncatula]
 gb|AES96807.1| expansin A10 [Medicago truncatula]
 gb|AFK37003.1| unknown [Medicago truncatula]
Length=248

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 199/230 (87%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+G  GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSC
Sbjct  18   AYGYGGGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSC  77

Query  379  YELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C G   +CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P +L+I  Y+
Sbjct  78   FEIRCAGDRKWCLPGSILVTATNFCPPNTALPNNNGGWCNPPLQHFDLAQPVFLRIAQYK  137

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPCR++GGIRFTINGH +FNLVLVTNVGG GDVH+VAIKGSR+GW QMSR
Sbjct  138  AGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAIKGSRSGWMQMSR  197

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ LNGQ+LSF+VTT DG+TV S N APS W FGQTY GAQF
Sbjct  198  NWGQNWQSNNYLNGQALSFKVTTSDGKTVISNNVAPSGWSFGQTYTGAQF  247



>ref|XP_010922733.1| PREDICTED: expansin-A2-like [Elaeis guineensis]
Length=254

 Score =   342 bits (876),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 199/233 (85%), Gaps = 3/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            VH  FGD   W++AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+C
Sbjct  23   VHSIFGD-SDWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTSSAALSTALFNNGLSC  81

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYEL C     +CLPG++ +TAT+FCPPN  L NDNGGWCNPPR HFD+AEPA+L+I 
Sbjct  82   GSCYELRCDDDPKWCLPGTIVVTATNFCPPNYALANDNGGWCNPPRQHFDLAEPAFLRIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVLVTNV G GDVHAV+IKGS+TGWQ 
Sbjct  142  QYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVHAVSIKGSKTGWQA  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MS+NWGQNWQSN+ L+GQSLSF+VTT DGRTVTS++  P+ W FGQT+EG QF
Sbjct  202  MSQNWGQNWQSNAYLDGQSLSFRVTTSDGRTVTSYDVVPAGWHFGQTFEGDQF  254



>ref|XP_008648280.1| PREDICTED: alpha-expansin 5 isoform X1 [Zea mays]
 gb|AFW78383.1| hypothetical protein ZEAMMB73_019156 [Zea mays]
Length=245

 Score =   341 bits (875),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 197/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGT+ AALSTALFN+G ACGSCYEL C
Sbjct  21   GGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTSTAALSTALFNDGAACGSCYELRC  80

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPG++T+TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L+I  YRAGIVP
Sbjct  81   DNDGRWCLPGTITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLRIAQYRAGIVP  140

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V +RRVPC KKGGIRFTINGH +FNLVLVTNV G GDV +V+I+GSRTGWQ MSRNWGQN
Sbjct  141  VAFRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDVRSVSIRGSRTGWQPMSRNWGQN  200

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS L+ Q+LSFQVT  DGRTVTS  A P+ WQFGQT+EG QF
Sbjct  201  WQSNSYLDRQALSFQVTASDGRTVTSNGAVPAGWQFGQTFEGGQF  245



>gb|AAW88316.1| expansin EXPA12 [Triticum aestivum]
Length=250

 Score =   341 bits (875),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 175/232 (75%), Positives = 197/232 (85%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
              A G YGGWQ+AHATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALF++G ACG
Sbjct  19   QAAAGGYGGWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFDDGAACG  78

Query  373  SCYELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYEL C   G  C PGS+ +TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  
Sbjct  79   TCYELRCDNAGSSCRPGSILVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQ  138

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            YRAGIVPV+YRRVPC KKGGIRFTINGH +FNLVLVTNV G GD  +V+IKG+RTGWQ M
Sbjct  139  YRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDARSVSIKGTRTGWQAM  198

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWG NWQSN+ L+GQ LSF+VT+ DGRTVTS  AAP+ W FGQT+EGA+F
Sbjct  199  SRNWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPAGWHFGQTFEGAEF  250



>emb|CDP00351.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   344 bits (882),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 194/225 (86%), Gaps = 1/225 (0%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E+ 
Sbjct  102  YGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFEIR  161

Query  391  CT-GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
            C    YCLPG++ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P + ++  YRAGIVP
Sbjct  162  CVNSKYCLPGAILVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQRMAQYRAGIVP  221

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPC ++GG+RFTINGH +FNLVLVTNVGG GDVH+VAIKGSRTGWQQMSRNWGQN
Sbjct  222  VAYRRVPCSRRGGMRFTINGHSYFNLVLVTNVGGAGDVHSVAIKGSRTGWQQMSRNWGQN  281

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSF+VTT DGR+V S+NAAP+ W FGQTY GAQF
Sbjct  282  WQSNSYLNGQSLSFKVTTSDGRSVVSYNAAPAGWSFGQTYTGAQF  326



>ref|XP_011013147.1| PREDICTED: expansin-A1 [Populus euphratica]
Length=249

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  83

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ ITAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  YRAGIVP
Sbjct  84   VNDPKWCLPGSIVITATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSRNWGQN
Sbjct  144  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGRTV S+N APS W FGQT+ GAQF
Sbjct  204  WQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPSSWSFGQTFSGAQF  248



>ref|XP_010921134.1| PREDICTED: expansin-A2-like isoform X1 [Elaeis guineensis]
Length=255

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 200/230 (87%), Gaps = 3/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A GD  GWQT HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C
Sbjct  27   ALGD-SGWQTGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGAC  85

Query  379  YELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+ +TAT+FCPPN  LPNDNGGWCNPP  HFD+AEPA+LQI  YR
Sbjct  86   YEMQCANDPQWCLPGSIIVTATNFCPPNYALPNDNGGWCNPPLQHFDLAEPAFLQISQYR  145

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVP+++RRVPC KKGGIRFT+NGH +FNLVL++NVGG GDV+AV+IKGS+TGWQ MS+
Sbjct  146  AGIVPISFRRVPCVKKGGIRFTVNGHSYFNLVLISNVGGAGDVNAVSIKGSKTGWQAMSQ  205

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ L+GQSLSFQVTT DGRTVTS++  P++WQFGQT+EG QF
Sbjct  206  NWGQNWQSNAYLDGQSLSFQVTTSDGRTVTSYDVVPANWQFGQTFEGGQF  255



>gb|KHG01029.1| Expansin-A15 -like protein [Gossypium arboreum]
Length=248

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  82

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  YRAGIVP
Sbjct  83   MDDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIVP  142

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR+KGGIRFTINGH +FNLVL+TNVGG GDVHAVAIKGSRTGWQ MSRNWGQN
Sbjct  143  VAYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQPMSRNWGQN  202

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGRTV S N AP+ W FGQT+ G QF
Sbjct  203  WQSNTYLNGQSLSFKVTTSDGRTVVSSNIAPAGWSFGQTFTGRQF  247



>ref|XP_008798561.1| PREDICTED: expansin-A8-like [Phoenix dactylifera]
Length=250

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/233 (75%), Positives = 198/233 (85%), Gaps = 3/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            V    GD  GW++AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALF +GL+C
Sbjct  19   VRRTVGD-SGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFKDGLSC  77

Query  370  GSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYEL C     +CLPG++ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+L+I 
Sbjct  78   GSCYELRCNDDPRWCLPGTIVVTATNFCPPNNALANDNGGWCNPPLQHFDLAEPAFLRIA  137

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV++RRVPC KKGGIRFTINGH +FNLVL++NV G GDVHAV+IKGS+TGWQ 
Sbjct  138  QYRAGIVPVSFRRVPCVKKGGIRFTINGHSYFNLVLISNVAGAGDVHAVSIKGSKTGWQA  197

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ LNGQSLSF+VTT DGRTVTS+NA P+ WQFGQT+EG QF
Sbjct  198  MSRNWGQNWQSNAYLNGQSLSFRVTTSDGRTVTSYNAVPAGWQFGQTFEGGQF  250



>gb|AAP48991.1| expansin [Sambucus nigra]
Length=249

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 198/226 (88%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            +GGW++AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSCY++ 
Sbjct  24   FGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTDTAALSTALFNNGLSCGSCYQIK  83

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     +CLPG++ +TAT+FCPPNPGL NDNGGWCNPP  HFD+AEPA+LQI  YRAGIV
Sbjct  84   CNDDPRWCLPGTIMVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIV  143

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV ++RVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSRNWGQ
Sbjct  144  PVAFQRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQ  203

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNS LNGQ+LS QVTT DGRTVTS N AP DWQFGQT++G QF
Sbjct  204  NWQSNSYLNGQTLSVQVTTSDGRTVTSNNVAPGDWQFGQTFQGGQF  249



>ref|XP_007046062.1| Expansin A1, ALPHA 1.2,EXPA1 [Theobroma cacao]
 gb|EOY01894.1| Expansin A1, ALPHA 1.2,EXPA1 [Theobroma cacao]
Length=423

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 195/233 (84%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            V    GD GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+C
Sbjct  190  VSAVHGDGGGWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSC  249

Query  370  GSCYELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            GSCYE+ C   G +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I 
Sbjct  250  GSCYEIKCVNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQHIA  309

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV Y+RVPC ++GGIRFTINGH +FNL+L+TNVGG GDVHAVAIKGSRTGWQ 
Sbjct  310  QYRAGIVPVAYKRVPCTRRGGIRFTINGHSYFNLILITNVGGAGDVHAVAIKGSRTGWQP  369

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSN+ LNGQSLSF+VTT DGRTV S+N AP+ W FGQT+ GAQF
Sbjct  370  MSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGWSFGQTFAGAQF  422



>ref|XP_010108685.1| hypothetical protein L484_015671 [Morus notabilis]
 gb|EXC19996.1| hypothetical protein L484_015671 [Morus notabilis]
Length=247

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+G  GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC
Sbjct  18   AYGYGGGWNNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  77

Query  379  YELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YE+ C     +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  YR
Sbjct  78   YEIKCASDPKWCLPGSILVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYR  137

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV YRRVPCR++GG+RFTINGH +FNLVL+TNVGG GDVHA +IKGSRTGWQ MSR
Sbjct  138  AGIVPVAYRRVPCRRRGGVRFTINGHSYFNLVLITNVGGAGDVHAASIKGSRTGWQAMSR  197

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSF+VTT DGRT+ S+N AP+ W FGQT+ G QF
Sbjct  198  NWGQNWQSNSYLNGQSLSFKVTTSDGRTIMSYNVAPARWSFGQTFTGRQF  247



>ref|XP_010498998.1| PREDICTED: expansin-A10-like isoform X2 [Camelina sativa]
Length=251

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+GD GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC
Sbjct  21   AYGDGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSC  80

Query  379  YELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C   G +CL GS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YR
Sbjct  81   FEIKCENDGKWCLAGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYR  140

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSR
Sbjct  141  AGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQVMSR  200

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W +GQT+ G QF
Sbjct  201  NWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSYGQTFAGGQF  250



>ref|XP_003616026.1| Expansin [Medicago truncatula]
 gb|AES98984.1| expansin A10 [Medicago truncatula]
Length=251

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/232 (73%), Positives = 196/232 (84%), Gaps = 2/232 (1%)
 Frame = +1

Query  193  HLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACG  372
            H    +YGGWQ+ HATFYGG DAS TMGGACGYGNLY  GYGTN AALSTALFNNGL+CG
Sbjct  20   HGVIANYGGWQSGHATFYGGGDASATMGGACGYGNLYNQGYGTNTAALSTALFNNGLSCG  79

Query  373  SCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGV  546
            +CYE+ C G   +C   ++ +TAT+FCPPN  LPN+NGGWCNPP  HFDMAEPA+LQI  
Sbjct  80   ACYEMRCVGDPRWCKHSTIVVTATNFCPPNSALPNNNGGWCNPPLQHFDMAEPAFLQIAQ  139

Query  547  YRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQM  726
            Y+AGIVPV++RRV C KKGGIRFTINGH +FNL+L+TNV G GD HAV+IKGS+T WQ M
Sbjct  140  YKAGIVPVSFRRVSCIKKGGIRFTINGHSYFNLILITNVAGAGDAHAVSIKGSKTSWQPM  199

Query  727  SRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SRNWGQNWQSNS LNGQSLSF+VTTGDGRTVTS+N AP++WQFGQT+ G+QF
Sbjct  200  SRNWGQNWQSNSYLNGQSLSFKVTTGDGRTVTSYNVAPANWQFGQTFHGSQF  251



>ref|XP_010498997.1| PREDICTED: expansin-A10-like isoform X1 [Camelina sativa]
Length=261

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+GD GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC
Sbjct  31   AYGDGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSC  90

Query  379  YELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C   G +CL GS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YR
Sbjct  91   FEIKCENDGKWCLAGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYR  150

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSR
Sbjct  151  AGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQVMSR  210

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W +GQT+ G QF
Sbjct  211  NWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSYGQTFAGGQF  260



>ref|XP_008446373.1| PREDICTED: expansin-A1 [Cucumis melo]
Length=248

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  24   GGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  83

Query  394  TGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  YRAGIVP
Sbjct  84   ASDPRWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSRNWGQN
Sbjct  144  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSF+VTT DGRTV S NA P+ W FGQTY GAQF
Sbjct  204  WQSNSYLNGQSLSFKVTTSDGRTVISNNAVPAGWSFGQTYSGAQF  248



>ref|XP_009607404.1| PREDICTED: expansin-A10-like [Nicotiana tomentosiformis]
Length=263

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 195/230 (85%), Gaps = 4/230 (2%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            G Y GW  AHATFYGG+DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE
Sbjct  34   GGYSGWNNAHATFYGGADASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYE  93

Query  385  LMCTG----PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            L C       +CL G +T+TAT+FCPPN  L N+NGGWCNPP  HFD+AEPA+L+I +YR
Sbjct  94   LKCNANADHRWCLAGIITVTATNFCPPNYALANNNGGWCNPPLQHFDLAEPAFLKIALYR  153

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV YRRVPC KKGG+RFTINGH +FNLVL+TNVGG GD+ +VAIKGSRTGWQ MSR
Sbjct  154  AGIVPVLYRRVPCMKKGGMRFTINGHSYFNLVLITNVGGAGDIRSVAIKGSRTGWQNMSR  213

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQS+S LNGQSLSF+VT  DG+T+TS+N  P++WQFGQT+EG QF
Sbjct  214  NWGQNWQSHSYLNGQSLSFKVTASDGKTITSYNVVPANWQFGQTFEGGQF  263



>ref|XP_010460264.1| PREDICTED: expansin-A10-like [Camelina sativa]
 ref|XP_010460265.1| PREDICTED: expansin-A10-like [Camelina sativa]
Length=251

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+GD GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC
Sbjct  21   AYGDGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSC  80

Query  379  YELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C   G +CL GS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YR
Sbjct  81   FEIKCENDGKWCLAGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYR  140

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSR
Sbjct  141  AGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQVMSR  200

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W +GQT+ G QF
Sbjct  201  NWGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSYGQTFAGGQF  250



>ref|XP_010931357.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=253

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 194/223 (87%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG  399
            WQ+AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+CYE+ CT 
Sbjct  31   WQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEMKCTD  90

Query  400  P--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
               +CLPG++ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEP++LQI  YRAGIVPV+
Sbjct  91   DARWCLPGTIVVTATNFCPPNYALANDNGGWCNPPLRHFDLAEPSFLQIARYRAGIVPVS  150

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            +RRVPC KKGG+RFTINGH +FNLVL+TNV G GDVHAV+IKGS+TGWQ MS+NWGQNWQ
Sbjct  151  FRRVPCVKKGGVRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSKTGWQAMSQNWGQNWQ  210

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SN+ L+GQSLSFQVT  DGRT+TS+N  P+ WQFGQT+EG QF
Sbjct  211  SNAYLDGQSLSFQVTASDGRTITSYNVVPAGWQFGQTFEGVQF  253



>gb|AAR27327.1| expansin EXPA1 [Triticum aestivum]
Length=251

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 195/230 (85%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A G YGGWQ+AHATFY G DASGTMGGACGYGNLY TGYGTN AALSTALFN+G ACGSC
Sbjct  22   AAGGYGGWQSAHATFYDGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNDGAACGSC  81

Query  379  YELMC--TGPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            YEL C   G  C PGS+ +TAT+FCPPN GLP+D+GGWCNPPRPHFDMAEPA+L I  +R
Sbjct  82   YELRCDNAGSSCRPGSILVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQHR  141

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV YRRVPC KKGGIRFTINGH +FNLVLVTNV G GD  +V+IKG+RTGWQ MSR
Sbjct  142  AGIVPVPYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGAGDARSVSIKGTRTGWQAMSR  201

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWG NWQSN+ L+GQ LSF+VT+ DGRTVTS  AAP+ W FGQT+EGAQF
Sbjct  202  NWGMNWQSNTFLDGQCLSFRVTSSDGRTVTSNAAAPAGWHFGQTFEGAQF  251



>ref|XP_009765412.1| PREDICTED: expansin-A10 [Nicotiana sylvestris]
Length=249

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 189/227 (83%), Gaps = 2/227 (1%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            D GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  22   DGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEI  81

Query  388  MCTGPY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C   +  CLPGS+ +TAT+FCPPN  L ++ GGWCNPP  HFD+++P +  I  YRAGI
Sbjct  82   KCVNEHKWCLPGSILVTATNFCPPNNALSSNAGGWCNPPLHHFDLSQPTFQHIAQYRAGI  141

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV YRRVPCR+KGGIRFTINGH +FNLVLVTNVGG GDVHAVAIKGSRT WQ MSRNWG
Sbjct  142  VPVAYRRVPCRRKGGIRFTINGHSYFNLVLVTNVGGAGDVHAVAIKGSRTQWQSMSRNWG  201

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSN+ LNGQSLSF+VTT DG++V S+N AP+ W FGQTY G QF
Sbjct  202  QNWQSNNYLNGQSLSFKVTTSDGKSVVSYNVAPASWSFGQTYTGDQF  248



>ref|XP_009115410.1| PREDICTED: expansin-A10 isoform X1 [Brassica rapa]
Length=258

 Score =   339 bits (870),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 194/228 (85%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E
Sbjct  30   GYEGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFE  89

Query  385  LMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C   G +CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRAG
Sbjct  90   IRCENDGKWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRAG  149

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+YRRVPC ++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRNW
Sbjct  150  IVPVSYRRVPCMRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQAMSRNW  209

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAPS W FGQT+ G QF
Sbjct  210  GQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPSGWSFGQTFTGGQF  257



>ref|XP_004135171.1| PREDICTED: expansin-A1-like [Cucumis sativus]
 gb|KGN51933.1| Alpha-expansin 1 [Cucumis sativus]
Length=248

 Score =   339 bits (869),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  24   GGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  83

Query  394  TGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  YRAGIVP
Sbjct  84   ASDPRWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+I+GSRTGWQ MSRNWGQN
Sbjct  144  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIRGSRTGWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSF+VTT DGRTV S NA P+ W FGQTY GAQF
Sbjct  204  WQSNSYLNGQSLSFKVTTSDGRTVISNNAVPAGWSFGQTYSGAQF  248



>ref|XP_009115411.1| PREDICTED: expansin-A10 isoform X2 [Brassica rapa]
 emb|CDY16190.1| BnaA09g29240D [Brassica napus]
Length=249

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 194/228 (85%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E
Sbjct  21   GYEGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFE  80

Query  385  LMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C   G +CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRAG
Sbjct  81   IRCENDGKWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRAG  140

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+YRRVPC ++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRNW
Sbjct  141  IVPVSYRRVPCMRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQAMSRNW  200

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAPS W FGQT+ G QF
Sbjct  201  GQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPSGWSFGQTFTGGQF  248



>gb|ACI02326.1| expansion-related protein [Gladiolus grandiflorus]
Length=253

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/223 (77%), Positives = 194/223 (87%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG  399
            W+ AHATFYGG DA+GTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE+ C  
Sbjct  31   WEDAHATFYGGGDATGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEMKCND  90

Query  400  P--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
               +CL GS+ +TAT+FCPPN  LPNDNGGWCNPP  HFD+AEPA+LQI  YRAGIVPV+
Sbjct  91   DPRWCLSGSIVVTATNFCPPNFALPNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVS  150

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            +RRVPC KKGGIRFT+NGH  FNLVL++NVGG GDVHAV+IKGS+TGWQ MSRNWGQNWQ
Sbjct  151  FRRVPCIKKGGIRFTVNGHSCFNLVLISNVGGAGDVHAVSIKGSKTGWQTMSRNWGQNWQ  210

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SNS LNGQSLSFQVTT DG+T+TS+N APS+WQFGQT+EG Q 
Sbjct  211  SNSYLNGQSLSFQVTTSDGKTITSYNVAPSNWQFGQTFEGGQM  253



>gb|AAM22622.1|AF428175_1 expansin 8 precursor [Rumex palustris]
Length=252

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 176/235 (75%), Positives = 202/235 (86%), Gaps = 4/235 (2%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+  + GDYGG W++AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL
Sbjct  19   CIRGSVGDYGGGWESAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGL  78

Query  364  ACGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CG+C+++ C+G   +CL G +T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQ
Sbjct  79   SCGACFQMRCSGDPKWCLGGHITVTATNFCPPNFALSNDNGGWCNPPVQHFDLAEPAFLQ  138

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVPV++R VPC +KGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGW
Sbjct  139  IAQYRAGIVPVSFR-VPCGRKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGW  197

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSNS LNGQ+LSF VT+ DGRTVTS N APS WQFGQTY GAQF
Sbjct  198  QSMSRNWGQNWQSNSYLNGQTLSFSVTSSDGRTVTSNNVAPSGWQFGQTYVGAQF  252



>gb|AEX07594.1| expansin 2, partial [Brassica juncea]
Length=249

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 194/228 (85%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E
Sbjct  21   GYEGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFE  80

Query  385  LMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C   G +CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRAG
Sbjct  81   IRCENDGKWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRAG  140

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+YRRVPC ++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRNW
Sbjct  141  IVPVSYRRVPCMRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQAMSRNW  200

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAPS W FGQT+ G QF
Sbjct  201  GQNWQSNSYLNGQALSFKVTTSDGRTVISYNAAPSGWSFGQTFTGGQF  248



>gb|AEQ55277.1| expansin [Breonia chinensis]
 gb|AEQ55292.1| expansin [Breonia chinensis]
Length=250

 Score =   338 bits (868),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 195/224 (87%), Gaps = 2/224 (1%)
 Frame = +1

Query  217  GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT  396
            GW  AHATFYGGSDASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CG+CYEL C 
Sbjct  27   GWHGAHATFYGGSDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYELRCN  86

Query  397  G--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPV  570
            G   +CLPG++T+TAT+FCPPN  LPN+NGGWCNPP  HFD+A+PA+L++  YRAGIVPV
Sbjct  87   GNSKWCLPGTITVTATNFCPPNFALPNNNGGWCNPPLHHFDLAQPAFLRMAQYRAGIVPV  146

Query  571  NYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNW  750
             YR+VPC KKGGIRF+INGH ++NLVL+TNV G GDVHAV+IKGS TGWQQMSRNWGQNW
Sbjct  147  LYRKVPCLKKGGIRFSINGHSYYNLVLITNVAGVGDVHAVSIKGSSTGWQQMSRNWGQNW  206

Query  751  QSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QSN  LNGQSLSF+V T DGRTVTS+N  P+ WQFGQT+EGAQF
Sbjct  207  QSNLYLNGQSLSFRVATSDGRTVTSYNVVPAGWQFGQTFEGAQF  250



>ref|XP_007158645.1| hypothetical protein PHAVU_002G170300g [Phaseolus vulgaris]
 gb|ESW30639.1| hypothetical protein PHAVU_002G170300g [Phaseolus vulgaris]
Length=312

 Score =   341 bits (874),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW TAHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E+ C
Sbjct  87   GGWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFEIRC  146

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+A+P +L+I  YRAGIVP
Sbjct  147  ANDHKWCLPGSILVTATNFCPPNNALPNNAGGWCNPPLQHFDLAQPVFLRIAQYRAGIVP  206

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR+KGGIRFTINGH +FNLVL+TNVGG GDVH VA+KGS+TGW  MSRNWGQN
Sbjct  207  VSYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHGVAVKGSKTGWAPMSRNWGQN  266

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGRTV S N AP+ W FGQTY GAQF
Sbjct  267  WQSNNYLNGQSLSFKVTTSDGRTVVSNNVAPAGWSFGQTYTGAQF  311



>ref|XP_008456774.1| PREDICTED: expansin-A8-like [Cucumis melo]
Length=244

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 194/227 (85%), Gaps = 7/227 (3%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYG     HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  23   DYG-----HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEI  77

Query  388  MCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C     +CLPG + +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRAGI
Sbjct  78   TCNSDPKWCLPGKIIVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGI  137

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV+++RVPC KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSRNWG
Sbjct  138  VPVSFQRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWG  197

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSN+ LNGQSLSFQVTT DGRTVTS++A P +WQFGQT+EG QF
Sbjct  198  QNWQSNNYLNGQSLSFQVTTSDGRTVTSYDAVPGNWQFGQTFEGGQF  244



>ref|XP_004138396.1| PREDICTED: expansin-A8-like [Cucumis sativus]
 ref|XP_004164462.1| PREDICTED: expansin-A8-like [Cucumis sativus]
 gb|KGN45833.1| hypothetical protein Csa_6G014540 [Cucumis sativus]
Length=245

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 195/227 (86%), Gaps = 7/227 (3%)
 Frame = +1

Query  208  DYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYEL  387
            DYG     HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+
Sbjct  24   DYG-----HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEI  78

Query  388  MCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGI  561
             C     +CLPG + +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRAGI
Sbjct  79   TCNSDPKWCLPGKIIVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGI  138

Query  562  VPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWG  741
            VPV+++RVPC KKGGIRFTINGH +FNLVL+TNVGG GD+H+V+IKGS+TGWQ MSRNWG
Sbjct  139  VPVSFQRVPCMKKGGIRFTINGHSYFNLVLITNVGGAGDIHSVSIKGSKTGWQAMSRNWG  198

Query  742  QNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QNWQSN+ LNGQSLSFQVTT DGRTVTS++A P++WQFGQT+EG QF
Sbjct  199  QNWQSNNYLNGQSLSFQVTTSDGRTVTSYDAVPANWQFGQTFEGGQF  245



>ref|XP_009141922.1| PREDICTED: expansin-A8-like [Brassica rapa]
Length=258

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 196/229 (86%), Gaps = 3/229 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GD GGWQ+ HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+CYE
Sbjct  30   GDSGGWQSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYE  89

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C     +CL  ++T+TAT+FCPPN GL NDNGGWCNPP  HFD+AEPA+LQI  YRAG
Sbjct  90   MKCNDDPRWCLGSTITVTATNFCPPNLGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAG  149

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG-WQQMSRN  735
            IVPV++RRVPC KKGGIRFTINGH +FNLVL+++VGG GDVHAV+I GS+TG WQ MSRN
Sbjct  150  IVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISHVGGAGDVHAVSISGSKTGSWQAMSRN  209

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQSLSFQVTT DGRTV S N APS+WQFGQT++G QF
Sbjct  210  WGQNWQSNSYLNGQSLSFQVTTSDGRTVVSNNVAPSNWQFGQTFQGGQF  258



>ref|XP_009387755.1| PREDICTED: expansin-A2 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 204/255 (80%), Gaps = 4/255 (2%)
 Frame = +1

Query  130  MAVPSTfsipflllffssfCVHL--AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLY  303
            MA+P+      L     S C  L  A  +  GW+ AHATFYGG DASGTMGGACGYGNLY
Sbjct  1    MAMPNCSLYHVLFFLLPSSCFFLSGALAESYGWRNAHATFYGGGDASGTMGGACGYGNLY  60

Query  304  RTGYGTNIAALSTALFNNGLACGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndn  477
              GYGTN AALSTALF NGL+CG+CYE+ C     +CLPGS+ +TAT+FCPPN  LPNDN
Sbjct  61   GQGYGTNTAALSTALFENGLSCGACYEMRCADDPRWCLPGSIVVTATNFCPPNYALPNDN  120

Query  478  ggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVT  657
            GGWCNPP  H D+AEPA+LQI  YRAGIVPV++RRVPC +KGGIRFTING  +FNLVL+T
Sbjct  121  GGWCNPPLQHLDLAEPAFLQIAQYRAGIVPVSFRRVPCVRKGGIRFTINGRSYFNLVLIT  180

Query  658  NVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAA  837
            NVGG GDVHAV+IKGS+TGWQ MSRNWGQNWQSNS L+GQSLSFQVTTGDGRTVT +N A
Sbjct  181  NVGGAGDVHAVSIKGSKTGWQSMSRNWGQNWQSNSYLDGQSLSFQVTTGDGRTVTGYNVA  240

Query  838  PSDWQFGQTYEGAQF  882
            P+ WQFGQT+EG Q 
Sbjct  241  PAGWQFGQTFEGGQL  255



>gb|KHN28805.1| Expansin-A15 [Glycine soja]
Length=248

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  82

Query  394  TGPY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               +  CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P +L+I  Y+AGIVP
Sbjct  83   ANDHRWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFLRIAQYKAGIVP  142

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRV CR+KGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGW  MSRNWGQN
Sbjct  143  VSYRRVACRRKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWMPMSRNWGQN  202

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ L+GQSLSF+VTT DGRT+ S N APS W FGQTY GAQF
Sbjct  203  WQSNNYLDGQSLSFKVTTSDGRTIVSNNVAPSGWSFGQTYTGAQF  247



>gb|AAM22621.1| expansin 7 precursor [Rumex palustris]
Length=253

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/234 (74%), Positives = 198/234 (85%), Gaps = 3/234 (1%)
 Frame = +1

Query  190  VHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            V  AFGDYGG W   HATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+
Sbjct  20   VSSAFGDYGGDWNGGHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLS  79

Query  367  CGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CG+C+E+ CT    +C+ G +T+TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI
Sbjct  80   CGACFEMKCTADPRWCIGGVITVTATNFCPPNFALANDNGGWCNPPLQHFDLAEPAFLQI  139

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y AGIVPV++RRVPC +KGGIRFT+NGH +FNLVL+TNVGG GDVH+V+IKGS  GWQ
Sbjct  140  AQYHAGIVPVSFRRVPCGRKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSSGGWQ  199

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSF VTT DGRT+TS N APS+WQFGQT+EG+QF
Sbjct  200  AMSRNWGQNWQSNSYLNGQSLSFMVTTSDGRTLTSSNVAPSNWQFGQTFEGSQF  253



>gb|KHG18125.1| Expansin-A10 -like protein [Gossypium arboreum]
Length=248

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  82

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  Y+AGIVP
Sbjct  83   VNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYKAGIVP  142

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR+KGGIRFTINGH +FNLVL++NVG  GDVHA AIKGSRTGWQ MSRNWGQN
Sbjct  143  VSYRRVPCRRKGGIRFTINGHSYFNLVLISNVGDAGDVHAAAIKGSRTGWQPMSRNWGQN  202

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGRTV S+N AP+ W FGQT+ G QF
Sbjct  203  WQSNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGWSFGQTFTGGQF  247



>ref|XP_003518007.1| PREDICTED: expansin-A1-like [Glycine max]
 gb|KHN01248.1| Expansin-A1 [Glycine soja]
Length=250

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG  399
            W  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C  
Sbjct  27   WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCVN  86

Query  400  PY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
             +  CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +L+I  YRAGIVPV+
Sbjct  87   DHRWCLPGSIMVTATNFCPPNNALPNNAGGWCNPPMHHFDLSQPVFLRIAQYRAGIVPVS  146

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH VAIKGSRTGW  MSRNWGQNWQ
Sbjct  147  YRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHGVAIKGSRTGWMPMSRNWGQNWQ  206

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SN+ LNGQSLSF+VTT DGRTV S+N AP+ W FGQTY GAQF
Sbjct  207  SNNYLNGQSLSFKVTTSDGRTVVSYNVAPAGWSFGQTYTGAQF  249



>ref|XP_002323665.1| expansin S1 precursor family protein [Populus trichocarpa]
 gb|EEF05426.1| expansin S1 precursor family protein [Populus trichocarpa]
Length=254

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 196/233 (84%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H  +GDYGGWQ  HATFYGGSDASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+C
Sbjct  22   LHGIYGDYGGWQVGHATFYGGSDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSC  81

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+C+++ C     +C  G++T+TAT+FCPPN  L NDNGGWCNPP  HFD+A+PA+LQI 
Sbjct  82   GACFQIRCNNDPKWCHSGTITVTATNFCPPNYALSNDNGGWCNPPLKHFDLAQPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQT  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ LSF+VTT DG+TVT +N  P++WQFGQT+ G Q 
Sbjct  202  MSRNWGQNWQSNSYLNGQRLSFRVTTSDGKTVTWYNVVPANWQFGQTFAGGQL  254



>ref|NP_001238053.1| uncharacterized protein LOC100527059 precursor [Glycine max]
 gb|ACU16099.1| unknown [Glycine max]
Length=248

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  82

Query  394  TGPY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               +  CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P +L+I  Y+AGIVP
Sbjct  83   ANDHRWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFLRIAQYKAGIVP  142

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRV CR+KGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGW  MSRNWGQN
Sbjct  143  VSYRRVACRRKGGIRFTINGHSYFNLVLITNVGGTGDVHSVSIKGSRTGWMPMSRNWGQN  202

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ L+GQSLSF+VTT DGRT+ S N APS W FGQTY GAQF
Sbjct  203  WQSNNYLDGQSLSFKVTTSDGRTIVSNNVAPSGWSFGQTYTGAQF  247



>ref|XP_010477818.1| PREDICTED: expansin-A10 isoform X2 [Camelina sativa]
Length=251

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 196/229 (86%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +GD GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC+
Sbjct  22   YGDGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCF  81

Query  382  ELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C   G +C+ GS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRA
Sbjct  82   EIKCENDGKWCIAGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRA  141

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRN
Sbjct  142  GIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQVMSRN  201

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W +GQT+ G QF
Sbjct  202  WGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSYGQTFAGGQF  250



>ref|XP_010044491.1| PREDICTED: expansin-A1-like [Eucalyptus grandis]
 gb|KCW86579.1| hypothetical protein EUGRSUZ_B03214 [Eucalyptus grandis]
Length=250

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  25   GGWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  84

Query  394  TGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLP S+ +TAT+FCPPN  LP++ GGWCNPP  HFD++EP +  I  YRAGIVP
Sbjct  85   VNDRQWCLPASIVVTATNFCPPNNALPSNAGGWCNPPLQHFDLSEPVFEHIARYRAGIVP  144

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVHAV++KGSRTGW  MSRNWGQN
Sbjct  145  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSVKGSRTGWMSMSRNWGQN  204

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGR+V S+NAAP+ W FGQT+ GAQF
Sbjct  205  WQSNNYLNGQSLSFKVTTSDGRSVMSYNAAPAHWSFGQTFSGAQF  249



>ref|XP_010477817.1| PREDICTED: expansin-A10 isoform X1 [Camelina sativa]
Length=261

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 196/229 (86%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +GD GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC+
Sbjct  32   YGDGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCF  91

Query  382  ELMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C   G +C+ GS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRA
Sbjct  92   EIKCENDGKWCIAGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRA  151

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRN
Sbjct  152  GIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQVMSRN  211

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W +GQT+ G QF
Sbjct  212  WGQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSYGQTFAGGQF  260



>gb|ACA05165.1| expansin 2 [Dimocarpus longan]
Length=250

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 191/224 (85%), Gaps = 2/224 (1%)
 Frame = +1

Query  217  GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT  396
            GW + HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE+ C 
Sbjct  26   GWISGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIKCV  85

Query  397  GP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPV  570
                +CLPGS+ +TAT+FCPPN  LPND GGWCNPP+ HFD+++P +  I  YRAGIVPV
Sbjct  86   NDARWCLPGSIVVTATNFCPPNNALPNDAGGWCNPPQQHFDLSQPVFQHIAQYRAGIVPV  145

Query  571  NYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNW  750
             YRRVPCR+KGGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGSRTGWQ MSRNWGQNW
Sbjct  146  AYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQAMSRNWGQNW  205

Query  751  QSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QSN++LNGQSLSF+VTT DGRTV S N AP+ W FGQTY GAQF
Sbjct  206  QSNTLLNGQSLSFKVTTSDGRTVVSNNVAPAGWSFGQTYSGAQF  249



>ref|NP_001266116.1| expansin-A15-like precursor [Cicer arietinum]
 emb|CAD33923.1| alpha-expansin 3 [Cicer arietinum]
Length=248

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+G  GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC
Sbjct  18   AYGYGGGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSC  77

Query  379  YELMCTGPY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C   +  CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P +L+I  Y+
Sbjct  78   FEIRCANDHRWCLPGSILVTATNFCPPNNALPNNNGGWCNPPLHHFDLAQPVFLRIAQYK  137

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPCR++GGIRFTINGH +FNLVLVTNVGG GDVH+VA+KGS+TGW  MSR
Sbjct  138  AGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSKTGWMPMSR  197

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSN+ LNGQ+LSF+VTT DG+TV S N APS W FGQTY GAQF
Sbjct  198  NWGQNWQSNNYLNGQTLSFKVTTSDGQTVVSNNVAPSGWSFGQTYSGAQF  247



>ref|XP_007011319.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
 gb|EOY20129.1| Expansin A8, ALPHA 1.11,EXPA8 [Theobroma cacao]
Length=253

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C     +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCDNDPKW  94

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CL GS+ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRAGIVP+++RRV
Sbjct  95   CLAGSIIVTATNFCPPNNALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPISFRRV  154

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGS TGWQ MSRNWGQNWQSNS 
Sbjct  155  PCTKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSNTGWQPMSRNWGQNWQSNSY  214

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRTVTS+N  P  WQFGQT+EG QF
Sbjct  215  LNGQSLSFQVTTSDGRTVTSYNVVPGSWQFGQTFEGGQF  253



>gb|AAF32409.1|AF230276_1 alpha-expansin 3 [Triphysaria versicolor]
Length=247

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 191/226 (85%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTA+FN GL+CGSCYE+ 
Sbjct  21   YGGWINAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTAMFNTGLSCGSCYEIR  80

Query  391  CT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C   G +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+A+P +  I  Y+AGIV
Sbjct  81   CVNDGKWCLPGSILVTATNFCPPNSALPNNAGGWCNPPLHHFDLAQPVFQHIAQYKAGIV  140

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV YRRV CR++GGIRFTINGH +FNLVLVTNVGG GDVHAV+IKGSRTGWQ MSRNWGQ
Sbjct  141  PVAYRRVACRRRGGIRFTINGHSYFNLVLVTNVGGAGDVHAVSIKGSRTGWQPMSRNWGQ  200

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSNS LNGQSLSF+VTT DGRTV S+N AP+ W FGQT+ G QF
Sbjct  201  NWQSNSNLNGQSLSFKVTTSDGRTVLSYNVAPARWSFGQTFAGGQF  246



>ref|XP_010043148.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW88332.1| hypothetical protein EUGRSUZ_A00721 [Eucalyptus grandis]
Length=256

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/228 (75%), Positives = 194/228 (85%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            G+YG WQ+AHATFYGG DASGTMGGACGYGNLY  GYGT  AALSTALFN+GL+CGSCYE
Sbjct  29   GNYGPWQSAHATFYGGHDASGTMGGACGYGNLYSQGYGTQTAALSTALFNSGLSCGSCYE  88

Query  385  LMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            L C+G   +CLP ++ +TAT+FCPPN  L  DNGGWCNPPR HFD+AEPA+LQI  YRAG
Sbjct  89   LRCSGDPKWCLPHAIMVTATNFCPPNYALAGDNGGWCNPPRAHFDLAEPAFLQIAQYRAG  148

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV++RRVPC KKGG+RFTINGH +FNLVLVTNV G GDV +V+IKGSRTGW  MSRNW
Sbjct  149  IVPVSFRRVPCVKKGGMRFTINGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWMPMSRNW  208

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQSLSF VT  +GRT+T++N  P+ WQFGQT+EG QF
Sbjct  209  GQNWQSNSYLNGQSLSFTVTASNGRTLTTYNVVPAGWQFGQTFEGDQF  256



>ref|XP_003529476.1| PREDICTED: expansin-A15-like [Glycine max]
 gb|KHN28137.1| Expansin-A15 [Glycine soja]
Length=248

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  23   GGWTNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRC  82

Query  394  TGPY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               +  CLPGS+ +TAT+FCPPN  LPNDNGGWCNPP  HFD+A+P +L+I  Y+AGIVP
Sbjct  83   ANDHRWCLPGSIVVTATNFCPPNNALPNDNGGWCNPPLQHFDLAQPVFLRIAQYKAGIVP  142

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V++RRV CR+KGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGW  MSRNWGQN
Sbjct  143  VSFRRVACRRKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWMPMSRNWGQN  202

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGRTV S N APS W FGQTY GAQF
Sbjct  203  WQSNNYLNGQSLSFKVTTSDGRTVASNNVAPSGWSFGQTYTGAQF  247



>ref|XP_002522457.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
 gb|EEF39949.1| Alpha-expansin 1 precursor, putative [Ricinus communis]
Length=249

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 191/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE+ C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIRC  83

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  YRAGIVP
Sbjct  84   VNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQHIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVHAVAIKGSRTGWQ MSRNWGQN
Sbjct  144  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQSLSF+VTT DGR+V S+N AP  W FGQT+ GAQF
Sbjct  204  WQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPVSWSFGQTFSGAQF  248



>gb|ABQ45887.1| expansin [Pyrus pyrifolia]
Length=236

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  A ATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CGSCYE+ C
Sbjct  11   GGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLGCGSCYEIRC  70

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  Y+AG+VP
Sbjct  71   VNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPIFQHIAQYKAGVVP  130

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSRNWGQN
Sbjct  131  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQAMSRNWGQN  190

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  191  WQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  235



>ref|XP_010670609.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=253

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 194/235 (83%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYGG-WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+   FGDYGG W  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+G 
Sbjct  19   CLRGVFGDYGGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGQ  78

Query  364  ACGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYEL C     +CLPGS+ ITAT+FCPPN  L NDNGGWCNPP  HFDMA+P++L+
Sbjct  79   SCGSCYELKCNDDPRWCLPGSIIITATNFCPPNFALSNDNGGWCNPPLEHFDMAQPSFLK  138

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVPV++RRVPC +KGGIRFTINGH +FNLVL+TNV G GDV +V+IKGS TGW
Sbjct  139  IAQYRAGIVPVSFRRVPCVRKGGIRFTINGHSYFNLVLITNVAGAGDVRSVSIKGSNTGW  198

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSN+ LNGQSLSFQVT  DGRT+TS N A   WQFGQTYEG QF
Sbjct  199  QAMSRNWGQNWQSNAYLNGQSLSFQVTASDGRTITSNNVASRGWQFGQTYEGGQF  253



>gb|AAK48845.1|AF350936_1 expansin [Prunus cerasus]
Length=253

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE+ C     +
Sbjct  35   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGLSCGSCYEMRCDSDPKW  94

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLPGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  YRAGIVPV++RRV
Sbjct  95   CLPGSIIVTATNFCPPNLAQSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRV  154

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
             C KKGGIRFT+NGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSRNWGQNWQSNS 
Sbjct  155  SCVKKGGIRFTVNGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSY  214

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQ+LSFQVTT DGRTVTS NA P+DWQFGQT+ G QF
Sbjct  215  LNGQALSFQVTTSDGRTVTSTNAVPADWQFGQTFSGGQF  253



>gb|EYU28773.1| hypothetical protein MIMGU_mgv1a012521mg [Erythranthe guttata]
Length=248

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+CY++ C
Sbjct  23   GGWVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYQIRC  82

Query  394  TGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P + +I  YRAGIVP
Sbjct  83   ANERRWCLPGSILVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYRAGIVP  142

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRV CR++GGIRFTINGH +FNLVL+TNVGG GDVHAV++KGSRTGWQ MSRNWGQN
Sbjct  143  VAYRRVACRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSVKGSRTGWQPMSRNWGQN  202

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSF+VTT DGRTV S+NAAP+ W FGQT+ GAQF
Sbjct  203  WQSNSNLNGQSLSFKVTTSDGRTVVSYNAAPASWNFGQTFAGAQF  247



>gb|AEQ28765.1| expansin 3 [Prunus salicina]
Length=252

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 196/234 (84%), Gaps = 4/234 (2%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H A+G  GGW  A ATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  20   CAH-AYGG-GGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLG  77

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPG++ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I
Sbjct  78   CGSCYEIRCVNDPKWCLPGAIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHI  137

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              YRAG+VPV YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V++KGSRTGWQ
Sbjct  138  AQYRAGVVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSVKGSRTGWQ  197

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  198  AMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  251



>gb|ABR04073.1| expansin 1 [Pyrus pyrifolia]
Length=252

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG CYE+ C
Sbjct  27   GGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLGCGPCYEIRC  86

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  Y+AG+VP
Sbjct  87   VNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPIFQHIAQYKAGVVP  146

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V++KGSRTGWQ MSRNWGQN
Sbjct  147  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSVKGSRTGWQAMSRNWGQN  206

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  207  WQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  251



>gb|AGF90535.1| alpha-expansin 1 [Ammopiptanthus nanus]
Length=248

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = +1

Query  217  GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT  396
            GW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AA+STALFNNGL+CGSCYE+ C 
Sbjct  24   GWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAAVSTALFNNGLSCGSCYEIRCV  83

Query  397  G--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPV  570
                +CLPGS+ +TAT+FCPPN GLPN+ GGWCNPP+ HFD+++P +L+I  Y+AGIVPV
Sbjct  84   NDNKWCLPGSIVVTATNFCPPNNGLPNNAGGWCNPPQQHFDLSQPVFLRIAQYKAGIVPV  143

Query  571  NYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNW  750
            +YRRVPCR+KGGIRFTINGH +FNLVL+TNVGG GDVHAVA+KGSRTGW  MSRNWGQNW
Sbjct  144  SYRRVPCRRKGGIRFTINGHSYFNLVLITNVGGAGDVHAVAVKGSRTGWMPMSRNWGQNW  203

Query  751  QSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QSN+ LNGQSLSF+VTT DG TV S+N AP+ W FGQTY GAQF
Sbjct  204  QSNNYLNGQSLSFKVTTSDGHTVVSYNVAPAGWNFGQTYTGAQF  247



>ref|XP_004502832.1| PREDICTED: expansin-A8-like [Cicer arietinum]
Length=250

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C     +
Sbjct  32   HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCDSDPKW  91

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLPGS+ +TAT+FCPPN    N NGGWCNPP  HFD+AEPA+LQI  Y+AGIVP+++RRV
Sbjct  92   CLPGSILVTATNFCPPNFAQSNTNGGWCNPPLQHFDLAEPAFLQIAQYKAGIVPISFRRV  151

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGGIRFTINGH +FNLVLVTNVGG GDVH+V+IKGSRTGWQ MSRNWGQNWQSN+ 
Sbjct  152  PCVKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSRTGWQTMSRNWGQNWQSNNY  211

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRT+TS N  P++WQFGQT+ G QF
Sbjct  212  LNGQSLSFQVTTSDGRTITSNNIVPTNWQFGQTFSGGQF  250



>ref|NP_001240136.1| expansin-A1-like precursor [Glycine max]
 ref|XP_006574400.1| PREDICTED: expansin-A1-like isoform X1 [Glycine max]
 gb|ACU24340.1| unknown [Glycine max]
 gb|AEK69292.1| expansin A4 [Glycine max]
 gb|KHN12193.1| Expansin-A1 [Glycine soja]
Length=250

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG  399
            W  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C  
Sbjct  27   WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIRCVN  86

Query  400  PY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
             +  CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +L+I  YRAGIVPV+
Sbjct  87   DHRWCLPGSIMVTATNFCPPNNALPNNAGGWCNPPMHHFDLSQPVFLRIAQYRAGIVPVS  146

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH VAIKGSRTGW  MSRNWGQNWQ
Sbjct  147  YRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHGVAIKGSRTGWMPMSRNWGQNWQ  206

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SN+ LNGQSLSF+VTT DGRT  S+N AP+ W FGQTY GAQF
Sbjct  207  SNNYLNGQSLSFKVTTSDGRTAVSYNVAPAGWSFGQTYTGAQF  249



>gb|AGR44457.1| expansin 4 [Pyrus x bretschneideri]
Length=252

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  A ATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CGSCYE+ C
Sbjct  27   GGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLGCGSCYEIRC  86

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  Y+AG+VP
Sbjct  87   VNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPIFQHIAQYKAGVVP  146

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSRNWGQN
Sbjct  147  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQAMSRNWGQN  206

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  207  WQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  251



>ref|NP_173999.1| expansin A10 [Arabidopsis thaliana]
 sp|Q9LDR9.1|EXP10_ARATH RecName: Full=Expansin-A10; Short=AtEXPA10; AltName: Full=Alpha-expansin-10; 
Short=At-EXP10; Short=AtEx10; AltName: Full=Ath-ExpAlpha-1.1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF61712.1|AF229437_1 expansin 10 [Arabidopsis thaliana]
 gb|AAF61713.1|AF229431_1 expansin 10 [Arabidopsis thaliana]
 gb|AAF87031.1|AC006535_9 T24P13.15 [Arabidopsis thaliana]
 gb|AAK97717.1| At1g26770/T24P13_14 [Arabidopsis thaliana]
 gb|AAL31125.1| At1g26770/T24P13_14 [Arabidopsis thaliana]
 gb|AEE30731.1| expansin A10 [Arabidopsis thaliana]
Length=249

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC+E+ C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRC  83

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPGS+ +TAT+FCPPN  L N+NGGWCNPP  HFD+A+P + +I  YRAGIVP
Sbjct  84   ENDGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRT WQ MSRNWGQN
Sbjct  144  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV SFNAAP+ W +GQT+ G QF
Sbjct  204  WQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGWSYGQTFAGGQF  248



>ref|XP_004307732.1| PREDICTED: expansin-A8-like [Fragaria vesca subsp. vesca]
 gb|AAF21101.1|AF159563_1 expansin [Fragaria x ananassa]
Length=253

 Score =   337 bits (864),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 194/235 (83%), Gaps = 3/235 (1%)
 Frame = +1

Query  187  CVHLAFGDYG-GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGL  363
            C+   + DYG GW   HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL
Sbjct  19   CIRGTYADYGAGWVGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGL  78

Query  364  ACGSCYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQ  537
            +CGSCYE+ C     +CLPGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQ
Sbjct  79   SCGSCYEMRCDNDPRWCLPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLQ  138

Query  538  IGVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGW  717
            I  YRAGIVPV++RRV C KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGS+ GW
Sbjct  139  IAQYRAGIVPVSFRRVACVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKGGW  198

Query  718  QQMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            Q MSRNWGQNWQSN+ LNGQ+LSFQVTT DGRTVTS N AP +WQFGQT+ G QF
Sbjct  199  QSMSRNWGQNWQSNNYLNGQALSFQVTTSDGRTVTSNNVAPGNWQFGQTFSGGQF  253



>ref|XP_010678491.1| PREDICTED: expansin-A10-like [Beta vulgaris subsp. vulgaris]
Length=251

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 189/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN GL+CG+C+E+ C
Sbjct  26   GGWTDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNQGLSCGACFEMRC  85

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+A+P + QI  Y+AGIVP
Sbjct  86   VSDAKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLRHFDLAQPVFQQIAHYKAGIVP  145

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V++RRVPCRKKGGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGSRT WQ MSRNWGQN
Sbjct  146  VSFRRVPCRKKGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTNWQSMSRNWGQN  205

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSF+VT  DGRTVT+ N AP +W FGQTY G QF
Sbjct  206  WQSNSFLNGQSLSFKVTASDGRTVTALNVAPPNWSFGQTYHGGQF  250



>gb|AAM62474.1| alpha-expansin 10 precursor (At-EXP10) (AtEx10) (Ath-ExpAlpha-1.1) 
[Arabidopsis thaliana]
Length=249

 Score =   337 bits (863),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC+E+ C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRC  83

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPGS+ +TAT+FCPPN  L N+NGGWCNPP  HFD+A+P + +I  YRAGIVP
Sbjct  84   ENDGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRT WQ MSRNWGQN
Sbjct  144  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV SFNAAP+ W +GQT+ G QF
Sbjct  204  WQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGWSYGQTFAGGQF  248



>gb|AAR88517.1| expansin A2 [Craterostigma plantagineum]
Length=219

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 191/219 (87%), Gaps = 3/219 (1%)
 Frame = +1

Query  235  ATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTGP---Y  405
            ATFYGG DASGTMGGACGYGNLY TGYGTN AALSTALFNNGL CG+CYEL C      +
Sbjct  1    ATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTALFNNGLTCGACYELTCNNDPRGW  60

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CL G++ +TAT+FCPPNP LPNDNGGWCNPPR HFD+AEPA+LQI  Y+AGIVPVNYRRV
Sbjct  61   CLSGTIMVTATNFCPPNPSLPNDNGGWCNPPRQHFDLAEPAFLQIAQYKAGIVPVNYRRV  120

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC+KKGGIRFTINGH FFNLVLVTNVGG GDVH+V+IKGS  GWQ +SRNWGQNWQSNS 
Sbjct  121  PCQKKGGIRFTINGHSFFNLVLVTNVGGVGDVHSVSIKGSNGGWQPLSRNWGQNWQSNSY  180

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRTVTS++ AP  WQFGQT+EG QF
Sbjct  181  LNGQSLSFQVTTSDGRTVTSYDVAPRGWQFGQTFEGGQF  219



>ref|XP_010258310.1| PREDICTED: expansin-A1 isoform X1 [Nelumbo nucifera]
Length=252

 Score =   337 bits (863),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 194/229 (85%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C+
Sbjct  23   YGYGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACF  82

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  YRA
Sbjct  83   EIRCVNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRA  142

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV YRRVPCRK+GGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGSRTGWQ MSRN
Sbjct  143  GIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRN  202

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSN+ LNGQSLSF+VTT DGR+V S+N AP+ W FGQT+ GAQF
Sbjct  203  WGQNWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQTFSGAQF  251



>emb|CDY62413.1| BnaCnng40260D [Brassica napus]
Length=249

 Score =   337 bits (863),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 193/228 (85%), Gaps = 2/228 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E
Sbjct  21   GYEGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFE  80

Query  385  LMCT--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C   G +CLPGS+ +TAT+FCPPN  LPN+NGGWCNPP  HFD+A+P + +I  YRAG
Sbjct  81   IRCENDGKWCLPGSIVVTATNFCPPNNALPNNNGGWCNPPLQHFDLAQPVFQRIAQYRAG  140

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNW  738
            IVPV+YRRVPC ++GGIRFTINGH +FNLVL+TNVG  GDVH+ AIKGSRTGWQ MSRNW
Sbjct  141  IVPVSYRRVPCMRRGGIRFTINGHSYFNLVLITNVGDAGDVHSAAIKGSRTGWQAMSRNW  200

Query  739  GQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            GQNWQSNS LNGQ+LSF+VTT DGRTV S+NAAPS W FGQT+ G QF
Sbjct  201  GQNWQSNSYLNGQALSFKVTTSDGRTVVSYNAAPSGWSFGQTFTGGQF  248



>gb|AGF90536.1| expansin 2 [Ammopiptanthus nanus]
Length=248

 Score =   336 bits (862),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = +1

Query  217  GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT  396
            GW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C 
Sbjct  24   GWTNAHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLSCGSCYEIRCV  83

Query  397  GPY--CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPV  570
              +  CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+A+P +L+I  Y+AGIVPV
Sbjct  84   SDHRWCLPGSIMVTATNFCPPNNALPNNAGGWCNPPQHHFDLAQPVFLRIAQYKAGIVPV  143

Query  571  NYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNW  750
             YRR+PCR++GGIRFTINGH +FNLVL+TNVGG GDVHA AIKGSRTGW  MSRNWGQNW
Sbjct  144  AYRRMPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAAAIKGSRTGWISMSRNWGQNW  203

Query  751  QSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QSN+ LNGQSLSF+VTT DGRTV S+N AP  W FGQTY GAQF
Sbjct  204  QSNNYLNGQSLSFKVTTSDGRTVVSYNVAPPAWSFGQTYTGAQF  247



>ref|XP_002269517.1| PREDICTED: expansin-A10 [Vitis vinifera]
 dbj|BAC66694.1| expansin [Vitis labrusca x Vitis vinifera]
 emb|CAN77596.1| hypothetical protein VITISV_001302 [Vitis vinifera]
 emb|CBI35311.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   336 bits (862),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = +1

Query  217  GWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT  396
            GW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C 
Sbjct  22   GWINAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTAALSTALFNNGLSCGSCYEIKCV  81

Query  397  --GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPV  570
              G +CLPGS+ ITAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  YRAGIVPV
Sbjct  82   NDGKWCLPGSIVITATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQHIAQYRAGIVPV  141

Query  571  NYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNW  750
            +YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVHAVAIKGSRTGWQ MSRNWGQNW
Sbjct  142  SYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQSMSRNWGQNW  201

Query  751  QSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            QSN+ LNGQSLSF+VTT +G T+ S+N  P+ W FGQT+ GAQF
Sbjct  202  QSNTYLNGQSLSFKVTTSNGHTIVSYNCVPAHWSFGQTFSGAQF  245



>gb|ABJ90221.1| expansin 2 [Malus hupehensis]
Length=253

 Score =   337 bits (863),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  A ATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CGSCYE+ C
Sbjct  28   GGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLGCGSCYEIRC  87

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPG++ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  Y+AG+VP
Sbjct  88   VNDPKWCLPGTIAVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYKAGVVP  147

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V++KGSRTGWQ MSRNWGQN
Sbjct  148  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSVKGSRTGWQAMSRNWGQN  207

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  208  WQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  252



>ref|XP_010258311.1| PREDICTED: expansin-A1 isoform X2 [Nelumbo nucifera]
Length=250

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 194/229 (85%), Gaps = 2/229 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C+
Sbjct  21   YGYGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACF  80

Query  382  ELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  YRA
Sbjct  81   EIRCVNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQYRA  140

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRN  735
            GIVPV YRRVPCRK+GGIRFTINGH +FNLVL+TNVGG GDVHAV+IKGSRTGWQ MSRN
Sbjct  141  GIVPVAYRRVPCRKRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSIKGSRTGWQPMSRN  200

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSN+ LNGQSLSF+VTT DGR+V S+N AP+ W FGQT+ GAQF
Sbjct  201  WGQNWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQTFSGAQF  249



>ref|NP_001077599.1| expansin A10 [Arabidopsis thaliana]
 gb|AEE30732.1| expansin A10 [Arabidopsis thaliana]
Length=259

 Score =   337 bits (863),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC+E+ C
Sbjct  34   GGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRC  93

Query  394  T--GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
               G +CLPGS+ +TAT+FCPPN  L N+NGGWCNPP  HFD+A+P + +I  YRAGIVP
Sbjct  94   ENDGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVP  153

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRT WQ MSRNWGQN
Sbjct  154  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTVWQAMSRNWGQN  213

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV SFNAAP+ W +GQT+ G QF
Sbjct  214  WQSNSYLNGQALSFKVTTSDGRTVVSFNAAPAGWSYGQTFAGGQF  258



>ref|XP_004155305.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A1-like [Cucumis sativus]
Length=248

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C
Sbjct  24   GGWTGAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKC  83

Query  394  TGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  YRAGIVP
Sbjct  84   ASDPRWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+I+GSRTGWQ MSRNWGQN
Sbjct  144  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIRGSRTGWQAMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQSLSF+VTT  GRTV S NA P+ W FGQTY GAQF
Sbjct  204  WQSNSYLNGQSLSFKVTTSXGRTVISNNAVPAGWSFGQTYSGAQF  248



>gb|AAG13983.1|AF297522_1 expansin 2 [Prunus avium]
Length=252

 Score =   336 bits (862),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 196/234 (84%), Gaps = 4/234 (2%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H A+G  GGW  A ATFYGGSDASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  20   CAH-AYGG-GGWVDARATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLG  77

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPG++ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I
Sbjct  78   CGSCYEIRCVNDPKWCLPGAIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHI  137

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AG+VPV YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V++KGSRTGWQ
Sbjct  138  AQYKAGVVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSVKGSRTGWQ  197

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSF+VTT DGRTV S+NAAP+ W FGQTY GAQ 
Sbjct  198  AMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQL  251



>gb|AAM12782.1| putative expansin [Capsicum annuum]
Length=239

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 187/226 (83%), Gaps = 10/226 (4%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW  AHATFYGG DASGTMGGACGYGNLY +GYGTN AALSTALFNNGL+CG C++LM
Sbjct  21   YGGWINAHATFYGGGDASGTMGGACGYGNLYSSGYGTNTAALSTALFNNGLSCGQCFQLM  80

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C     YCLPG +T+TAT+FCPP          WC+PP  HFD+++P +L+I  YRAGIV
Sbjct  81   CVNARQYCLPGIITVTATNFCPPGG--------WCDPPNHHFDLSQPIFLRIAQYRAGIV  132

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV YRRVPCR++GGIRFTINGH +FNLVLVTNVGG GDVH+V IKGSRT WQ MSRNWGQ
Sbjct  133  PVAYRRVPCRRRGGIRFTINGHSYFNLVLVTNVGGSGDVHSVYIKGSRTQWQPMSRNWGQ  192

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQ+N+ LNGQSLSF+VTTGDGRTV S+NAAPS W FGQT+ G QF
Sbjct  193  NWQNNAYLNGQSLSFKVTTGDGRTVVSYNAAPSSWSFGQTFSGGQF  238



>dbj|BAD00014.1| expansin [Malus domestica]
Length=220

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 190/219 (87%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+ C     +
Sbjct  2    HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMKCGSDPKW  61

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLPGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+L+I  YRAGIVPV++RRV
Sbjct  62   CLPGSIIVTATNFCPPNFAQANDNGGWCNPPLQHFDLAEPAFLKIAQYRAGIVPVSFRRV  121

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
             C KKGGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSRNWGQNWQSNS 
Sbjct  122  SCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSY  181

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQSLSFQVTT DGRT+T+ N AP +WQFGQT+EG+QF
Sbjct  182  LNGQSLSFQVTTSDGRTLTADNVAPGNWQFGQTFEGSQF  220



>ref|XP_007226005.1| hypothetical protein PRUPE_ppa010379mg [Prunus persica]
 dbj|BAC66786.1| expansin [Prunus persica]
 gb|EMJ27204.1| hypothetical protein PRUPE_ppa010379mg [Prunus persica]
Length=252

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 196/234 (84%), Gaps = 4/234 (2%)
 Frame = +1

Query  187  CVHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLA  366
            C H A+G  GGW  A ATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL 
Sbjct  20   CAH-AYGG-GGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLG  77

Query  367  CGSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQI  540
            CGSCYE+ C     +CLPG++ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I
Sbjct  78   CGSCYEIRCVSDPKWCLPGAIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHI  137

Query  541  GVYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQ  720
              Y+AG+VPV YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V++KGSRTGWQ
Sbjct  138  AQYKAGVVPVAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSVKGSRTGWQ  197

Query  721  QMSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
             MSRNWGQNWQSNS LNGQSLSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  198  AMSRNWGQNWQSNSYLNGQSLSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  251



>ref|XP_008239926.1| PREDICTED: expansin-A1-like [Prunus mume]
Length=249

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 194/230 (84%), Gaps = 2/230 (1%)
 Frame = +1

Query  199  AFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSC  378
            A+G  GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CG+C
Sbjct  20   AYGSDGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGAC  79

Query  379  YELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYR  552
            +E+ C     +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+A+P + +I  YR
Sbjct  80   FEIRCASDPKWCLPGSIFVTATNFCPPNNALPNNAGGWCNPPQQHFDLAQPVFQRIAQYR  139

Query  553  AGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSR  732
            AGIVPV+YRRVPC KKGGIRFTINGH +FNL+L+TNVGG GDVHAV+IKGS+TGWQ MSR
Sbjct  140  AGIVPVSYRRVPCIKKGGIRFTINGHSYFNLILITNVGGAGDVHAVSIKGSKTGWQTMSR  199

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS LNGQSLSF+VTT DGRTV + N AP+ W FGQT+ G QF
Sbjct  200  NWGQNWQSNSYLNGQSLSFKVTTSDGRTVVANNVAPAGWSFGQTFSGVQF  249



>ref|XP_010508833.1| PREDICTED: expansin-A8-like [Camelina sativa]
Length=257

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 196/230 (85%), Gaps = 3/230 (1%)
 Frame = +1

Query  202  FGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCY  381
            +GD GGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+CY
Sbjct  28   YGDDGGWQGGHATFYGGGDASGTMGGACGYGNLYGQGYGTNTAALSTALFNNGLTCGACY  87

Query  382  ELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRA  555
            E+ C     +CL  ++T+TAT+FCPPNPGL NDNGGWCNPP  HFD+AEPA+LQI  YRA
Sbjct  88   EMKCNDDPRWCLSSTITVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRA  147

Query  556  GIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRT-GWQQMSR  732
            GIVPV++RRVPC KKGGIRFTINGH +FNLVL++NVGG GDVHAV+IKGS+T  WQ MSR
Sbjct  148  GIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTQSWQAMSR  207

Query  733  NWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWGQNWQSNS +N QSLSFQVTT DGRTV S + APS+WQFGQTY+G QF
Sbjct  208  NWGQNWQSNSYMNDQSLSFQVTTSDGRTVISNDVAPSNWQFGQTYQGGQF  257



>ref|XP_002315043.1| expansin 4 family protein [Populus trichocarpa]
 ref|XP_006378591.1| hypothetical protein POPTR_0010s17440g [Populus trichocarpa]
 gb|ABK96086.1| unknown [Populus trichocarpa]
 gb|EEF01214.1| expansin 4 family protein [Populus trichocarpa]
 gb|ERP56388.1| hypothetical protein POPTR_0010s17440g [Populus trichocarpa]
Length=249

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 192/223 (86%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG  399
            W  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSCYE+ C  
Sbjct  26   WINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIRCVN  85

Query  400  --PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
               +CLPGS+ ITAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  +RAGIVPV+
Sbjct  86   DPKWCLPGSIVITATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQFRAGIVPVS  145

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSRTGWQ MSRNWGQNWQ
Sbjct  146  YRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRTGWQPMSRNWGQNWQ  205

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SN+ LNGQSLSF+VTT DGRTV S+NAAPS W FGQT+ GAQF
Sbjct  206  SNNYLNGQSLSFKVTTSDGRTVVSYNAAPSSWSFGQTFSGAQF  248



>dbj|BAC67191.1| expansin [Pyrus communis]
Length=252

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 192/225 (85%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  A ATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CGSCYE+ C
Sbjct  27   GGWVNARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLGCGSCYEIRC  86

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP+ HFD+++P +  I  Y+AG+VP
Sbjct  87   VNDPKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPIFQHIAQYKAGVVP  146

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V+YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+V+IKGSR+GWQ MSRNWGQN
Sbjct  147  VSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSRSGWQAMSRNWGQN  206

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSNS LNGQ+LSF+VTT DGRTV S+NAAP+ W FGQTY GAQF
Sbjct  207  WQSNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSFGQTYSGAQF  251



>gb|ABO30978.2| alpha expansin protein 4 [Calotropis procera]
Length=244

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 193/226 (85%), Gaps = 2/226 (1%)
 Frame = +1

Query  211  YGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELM  390
            YGGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSC+E+ 
Sbjct  18   YGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCFEIR  77

Query  391  CTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIV  564
            C G   +CLPG++ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  Y+AGIV
Sbjct  78   CVGQPRWCLPGTIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQHIAQYKAGIV  137

Query  565  PVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQ  744
            PV YRRV CR++GGIRFTINGH +FNL+L+TNVGG GDVH+VAIKGSRTGWQQ+SRNWGQ
Sbjct  138  PVAYRRVACRRRGGIRFTINGHSYFNLILITNVGGAGDVHSVAIKGSRTGWQQLSRNWGQ  197

Query  745  NWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            NWQSN+ LNGQSLSF+VTT DGR+V S+N AP+ W FGQTY GAQF
Sbjct  198  NWQSNTYLNGQSLSFKVTTSDGRSVVSYNVAPAGWSFGQTYTGAQF  243



>gb|KHG14727.1| Expansin-A8 -like protein [Gossypium arboreum]
Length=254

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 192/219 (88%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTG--PY  405
            HATFYGG DASGTMGGACGYGNLY  G+GTN AALSTALFNNGL+CGSCYE+ C G   +
Sbjct  36   HATFYGGGDASGTMGGACGYGNLYSQGFGTNTAALSTALFNNGLSCGSCYEMRCDGDPKW  95

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            CLP ++ +TAT+FCPPN  L NDNGGWCNPP  HFD+AEPA+LQI  YRAGIVPV++RRV
Sbjct  96   CLPATIMVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRV  155

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGG+RFTINGH +FNLVL+TNVGG GDVH+V+IKGS+TGWQ MSRNWGQNWQSN+ 
Sbjct  156  PCIKKGGVRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNTY  215

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQ+LSFQVTT DG+T+TS+N  P++WQFGQT+EG QF
Sbjct  216  LNGQTLSFQVTTSDGKTLTSYNVVPANWQFGQTFEGGQF  254



>ref|XP_011011315.1| PREDICTED: expansin-A8-like [Populus euphratica]
Length=254

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 194/233 (83%), Gaps = 2/233 (1%)
 Frame = +1

Query  190  VHLAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLAC  369
            +H  +GDYGGWQ  HATFYGGSDASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+C
Sbjct  22   LHGIYGDYGGWQVGHATFYGGSDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSC  81

Query  370  GSCYELMCTG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIG  543
            G+C+++ C     +C  G++T+TAT+FCPPN  L NDNGGWCNPP  HFD+A+PA+LQI 
Sbjct  82   GACFQIRCNNSPKWCHSGTITVTATNFCPPNYALSNDNGGWCNPPLQHFDLAQPAFLQIA  141

Query  544  VYRAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQ  723
             YRAGIVPV +RRVPC KKGGIRFTINGH +FNLVL+TNV G GDVHAV+IKGSRTGWQ 
Sbjct  142  QYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQT  201

Query  724  MSRNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            MSRNWGQNWQSNS LNGQ LSF+VTT DG+TVT +N  P  WQFGQT+ G Q 
Sbjct  202  MSRNWGQNWQSNSYLNGQGLSFRVTTSDGKTVTCYNVVPPYWQFGQTFAGGQL  254



>ref|XP_006305472.1| hypothetical protein CARUB_v10009909mg, partial [Capsella rubella]
 gb|EOA38370.1| hypothetical protein CARUB_v10009909mg, partial [Capsella rubella]
Length=290

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/223 (74%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = +1

Query  220  WQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCT-  396
            W  AHATFYGG DASGTMGGACGYGNLY  GYGT+ AALSTALFNNGL+CGSC+E+ C  
Sbjct  67   WVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRCEN  126

Query  397  -GPYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVN  573
             G +CLPGS+ +TAT+FCPPN  L N+NGGWCNPP  HFD+A+P + +I  YRAGIVPV+
Sbjct  127  DGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLQHFDLAQPVFQRIAQYRAGIVPVS  186

Query  574  YRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQ  753
            YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVH+ AIKGSRTGWQ MSRNWGQNWQ
Sbjct  187  YRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSAAIKGSRTGWQTMSRNWGQNWQ  246

Query  754  SNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            SNS LNGQ+LSF+VTT DGRTV S+NAAP+ W +GQT+ G QF
Sbjct  247  SNSYLNGQALSFKVTTSDGRTVVSYNAAPAGWSYGQTFAGGQF  289



>dbj|BAD00015.1| expansin [Malus domestica]
Length=220

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = +1

Query  232  HATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMCTGP--Y  405
            HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL+CGSCYE+MC     +
Sbjct  2    HATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMMCNNDPRW  61

Query  406  CLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVPVNYRRV  585
            C PGS+ +TAT+FCPPN    NDNGGWCNPP  HFD+AEPA+LQI  YRAGIVPV++RRV
Sbjct  62   CRPGSIIVTATNFCPPNFAESNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRV  121

Query  586  PCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQNWQSNSV  765
            PC KKGGIRFTINGH +FNLVL+TNV G GDVH+V+IKGSRTG Q MSRNWGQNWQSNS 
Sbjct  122  PCMKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSRTGRQPMSRNWGQNWQSNSY  181

Query  766  LNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            LNGQ+LSFQVTT DGRTVTS+N AP +WQFGQT+ G QF
Sbjct  182  LNGQALSFQVTTSDGRTVTSYNVAPGNWQFGQTFSGGQF  220



>gb|KDP41217.1| hypothetical protein JCGZ_15624 [Jatropha curcas]
Length=249

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = +1

Query  214  GGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYELMC  393
            GGW  AHATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFN+GL+CGSC+E+ C
Sbjct  24   GGWINAHATFYGGGDASGTMGGACGYGNLYSEGYGTNTAALSTALFNSGLSCGSCFEIRC  83

Query  394  TG--PYCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAGIVP  567
                 +CLPGS+ +TAT+FCPPN  LPN+ GGWCNPP  HFD+++P +  I  YRAGIVP
Sbjct  84   VNDRKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQHIAQYRAGIVP  143

Query  568  VNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMSRNWGQN  747
            V YRRVPCR++GGIRFTINGH +FNLVL+TNVGG GDVHAVAIKGSRTGWQ MSRNWGQN
Sbjct  144  VAYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQSMSRNWGQN  203

Query  748  WQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WQSN+ LNGQ+LSF+VTT DGR+V S+N AP  W FGQTY GAQF
Sbjct  204  WQSNNYLNGQALSFKVTTSDGRSVVSYNVAPPSWSFGQTYSGAQF  248



>gb|ABL09849.1| expansin 1 [Cunninghamia lanceolata]
Length=247

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 190/231 (82%), Gaps = 7/231 (3%)
 Frame = +1

Query  196  LAFGDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGS  375
            L  G YGGWQ+AHATFYGGSDASGTMGGACGYGNLY  GYGTN AALST LFNNGL CG+
Sbjct  22   LVHGQYGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTPLFNNGLTCGA  81

Query  376  CYELMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVY  549
            CYE+ C     +CLPG++T+TAT+FCPPN         WCNPP  HFD+AEPA+ QI  Y
Sbjct  82   CYEIKCNNDPQWCLPGTLTVTATNFCPPNSNGG-----WCNPPLQHFDLAEPAFQQIAKY  136

Query  550  RAGIVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTGWQQMS  729
            + G VP+ +RRVPC+KKGG+RF+INGH +FNLVLV+NVGG GDVHAV+IKGS TGWQ MS
Sbjct  137  KGGHVPILFRRVPCQKKGGVRFSINGHSYFNLVLVSNVGGAGDVHAVSIKGSNTGWQPMS  196

Query  730  RNWGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            +NWGQNWQSNS LNGQ+LSF+VTT DGRT  S+N APS+WQFGQT++G QF
Sbjct  197  QNWGQNWQSNSYLNGQALSFKVTTSDGRTTISYNVAPSNWQFGQTFQGTQF  247



>ref|XP_006411329.1| hypothetical protein EUTSA_v10017120mg [Eutrema salsugineum]
 gb|ESQ52782.1| hypothetical protein EUTSA_v10017120mg [Eutrema salsugineum]
Length=257

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 194/229 (85%), Gaps = 3/229 (1%)
 Frame = +1

Query  205  GDYGGWQTAHATFYGGSDASGTMGGACGYGNLYRTGYGTNIAALSTALFNNGLACGSCYE  384
            GD GGWQ  HATFYGG DASGTMGGACGYGNLY  GYGTN AALSTALFNNGL CG+CYE
Sbjct  29   GDDGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLTCGACYE  88

Query  385  LMCTGP--YCLPGSVTITATDFCppnpglpndnggWCNPPRPHFDMAEPAYLQIGVYRAG  558
            + C     +CL  ++T+TAT+FCPPN GL NDNGGWCNPP  HFD+AEPA+LQI  YRAG
Sbjct  89   MKCNDDPRWCLSSTITVTATNFCPPNLGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAG  148

Query  559  IVPVNYRRVPCRKKGGIRFTINGHIFFNLVLVTNVGGFGDVHAVAIKGSRTG-WQQMSRN  735
            IVPV++RRV C KKGGIRFTINGH +FNLVL++NVGG GDVHAV+IKGS+TG WQ MSRN
Sbjct  149  IVPVSFRRVACMKKGGIRFTINGHSYFNLVLISNVGGAGDVHAVSIKGSKTGSWQAMSRN  208

Query  736  WGQNWQSNSVLNGQSLSFQVTTGDGRTVTSFNAAPSDWQFGQTYEGAQF  882
            WGQNWQSNS LN QSLSFQVTT DGRTV S + APS+WQFGQT++G QF
Sbjct  209  WGQNWQSNSYLNDQSLSFQVTTSDGRTVVSNDVAPSNWQFGQTFQGGQF  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3488421182128