BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23570_g1_i3 len=899 path=[1:0-48 1549:49-161 50:162-348 237:349-667
2160:668-898]

Length=899
                                                                      Score     E

ref|XP_009778807.1|  PREDICTED: synaptonemal complex protein 1-like     265   2e-79   
ref|XP_006364852.1|  PREDICTED: synaptonemal complex protein 1-like     266   3e-78   
ref|XP_004238527.1|  PREDICTED: synaptonemal complex protein 1-like     259   7e-76   
ref|XP_009614522.1|  PREDICTED: synaptonemal complex protein 1-li...    249   3e-72   
ref|XP_009614523.1|  PREDICTED: synaptonemal complex protein 1-li...    249   3e-72   
ref|XP_007018780.1|  Myosin heavy chain-related protein                 246   5e-71   
ref|XP_010664327.1|  PREDICTED: synaptonemal complex protein 1-li...    243   1e-69   
ref|XP_010664328.1|  PREDICTED: synaptonemal complex protein 1-li...    242   1e-69   
ref|XP_003634472.1|  PREDICTED: synaptonemal complex protein 2-li...    242   1e-69   
emb|CDP01053.1|  unnamed protein product                                231   1e-65   
ref|XP_010059999.1|  PREDICTED: synaptonemal complex protein 1-like     226   1e-63   
ref|XP_008219423.1|  PREDICTED: LOW QUALITY PROTEIN: synaptonemal...    223   1e-62   
ref|XP_010269266.1|  PREDICTED: synaptonemal complex protein 1-like     221   3e-62   
ref|XP_007224064.1|  hypothetical protein PRUPE_ppa015312mg             220   1e-61   
ref|XP_002513917.1|  Ribosome-binding protein, putative                 219   3e-61   Ricinus communis
ref|XP_008362597.1|  PREDICTED: synaptonemal complex protein 1-like     219   3e-61   
ref|XP_009348104.1|  PREDICTED: synaptonemal complex protein 1-like     219   3e-61   
ref|XP_009368440.1|  PREDICTED: synaptonemal complex protein 1-like     219   3e-61   
gb|EYU22923.1|  hypothetical protein MIMGU_mgv1a001163mg                214   1e-59   
ref|XP_011097760.1|  PREDICTED: synaptonemal complex protein 1-like     214   1e-59   
ref|XP_006433993.1|  hypothetical protein CICLE_v10000237mg             211   1e-58   
gb|KHN21841.1|  Synaptonemal complex protein 2                          211   2e-58   
ref|XP_011016418.1|  PREDICTED: synaptonemal complex protein 1-li...    210   3e-58   
ref|XP_011016410.1|  PREDICTED: synaptonemal complex protein 1-li...    210   3e-58   
ref|XP_004305869.1|  PREDICTED: synaptonemal complex protein 2-like     210   4e-58   
ref|XP_007141174.1|  hypothetical protein PHAVU_008G173500g             209   6e-58   
ref|XP_007141178.1|  hypothetical protein PHAVU_008G173500g             209   6e-58   
ref|XP_007141175.1|  hypothetical protein PHAVU_008G173500g             209   7e-58   
ref|XP_007141177.1|  hypothetical protein PHAVU_008G173500g             209   7e-58   
ref|XP_007141176.1|  hypothetical protein PHAVU_008G173500g             209   7e-58   
ref|XP_006390012.1|  hypothetical protein EUTSA_v10018107mg             209   1e-57   
ref|XP_006472608.1|  PREDICTED: synaptonemal complex protein 1-li...    208   2e-57   
ref|XP_004301312.1|  PREDICTED: synaptonemal complex protein 2-like     206   5e-57   
gb|KDO80956.1|  hypothetical protein CISIN_1g002878mg                   206   7e-57   
ref|NP_173645.3|  synaptonemal complex protein ZYP1a                    204   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937455.1|  PREDICTED: synaptonemal complex protein 2-like     204   3e-56   
ref|XP_010477488.1|  PREDICTED: synaptonemal complex protein 1-li...    204   4e-56   
ref|XP_010477487.1|  PREDICTED: synaptonemal complex protein 1-li...    204   4e-56   
gb|KFK42204.1|  hypothetical protein AALP_AA2G225000                    204   5e-56   
ref|XP_010535529.1|  PREDICTED: synaptonemal complex protein 1-li...    202   2e-55   
ref|XP_010676591.1|  PREDICTED: synaptonemal complex protein 1-li...    201   5e-55   
ref|XP_002302294.2|  hypothetical protein POPTR_0002s09680g             201   5e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010676582.1|  PREDICTED: synaptonemal complex protein 1-li...    201   5e-55   
ref|XP_010676574.1|  PREDICTED: synaptonemal complex protein 1-li...    201   5e-55   
gb|KDP41376.1|  hypothetical protein JCGZ_15783                         201   8e-55   
ref|NP_564164.1|  synaptonemal complex protein 2                        199   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890507.1|  hypothetical protein ARALYDRAFT_889731             199   2e-54   
ref|XP_010459969.1|  PREDICTED: synaptonemal complex protein 1 is...    198   5e-54   
ref|XP_010459968.1|  PREDICTED: synaptonemal complex protein 1 is...    198   5e-54   
emb|CDX79250.1|  BnaC06g20530D                                          198   7e-54   
ref|XP_009104585.1|  PREDICTED: synaptonemal complex protein 1-li...    197   1e-53   
ref|XP_004163196.1|  PREDICTED: LOW QUALITY PROTEIN: synaptonemal...    197   1e-53   
ref|XP_010498691.1|  PREDICTED: synaptonemal complex protein 1-li...    196   1e-53   
gb|KGN60335.1|  hypothetical protein Csa_3G895810                       197   2e-53   
ref|XP_004136213.1|  PREDICTED: synaptonemal complex protein 1-like     197   2e-53   
ref|XP_010498690.1|  PREDICTED: synaptonemal complex protein 1-li...    196   2e-53   
ref|XP_010498695.1|  PREDICTED: synaptonemal complex protein 1-li...    196   2e-53   
ref|XP_010498689.1|  PREDICTED: synaptonemal complex protein 1-li...    196   3e-53   
ref|XP_008466037.1|  PREDICTED: synaptonemal complex protein 1-like     196   3e-53   
ref|XP_006305922.1|  hypothetical protein CARUB_v10011139mg             195   6e-53   
ref|XP_008802213.1|  PREDICTED: synaptonemal complex protein 2-like     195   8e-53   
ref|XP_010459973.1|  PREDICTED: synaptonemal complex protein 1-li...    194   1e-52   
ref|XP_006853153.1|  hypothetical protein AMTR_s00038p00178460          192   8e-52   
gb|AAF87264.1|AC068562_11  EST gb|F14399 comes from this gene           191   7e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304762.1|  hypothetical protein CARUB_v10012227mg             189   7e-51   
gb|ABO69625.1|  synaptonemal complex protein ZYP1                       184   6e-49   Brassica oleracea
ref|XP_009106521.1|  PREDICTED: synaptonemal complex protein 1-li...    183   1e-48   
emb|CDX88425.1|  BnaC06g38690D                                          184   1e-48   
gb|KFK34376.1|  hypothetical protein AALP_AA5G137200                    181   8e-48   
emb|CDX68027.1|  BnaA07g20670D                                          181   1e-47   
ref|XP_004490374.1|  PREDICTED: LOW QUALITY PROTEIN: synaptonemal...    181   3e-47   
gb|AES98059.2|  myosin heavy chain-like protein                         180   3e-47   
ref|XP_003615101.1|  Synaptonemal complex protein                       179   8e-47   
ref|XP_009417578.1|  PREDICTED: synaptonemal complex protein 2-like     178   9e-47   
emb|CDX87468.1|  BnaA07g34050D                                          169   3e-43   
ref|XP_008662278.1|  PREDICTED: ZYP1 protein isoform X1                 167   9e-43   
ref|NP_001182397.1|  ZYP1 protein                                       167   1e-42   
gb|AFW58457.1|  hypothetical protein ZEAMMB73_907541                    167   1e-42   
ref|XP_010091768.1|  hypothetical protein L484_000765                   154   2e-42   
ref|XP_004975811.1|  PREDICTED: synaptonemal complex protein 1-like     166   3e-42   
ref|XP_010664330.1|  PREDICTED: synaptonemal complex protein 1-li...    163   1e-41   
ref|XP_010097775.1|  hypothetical protein L484_004189                   161   6e-41   
ref|XP_010239979.1|  PREDICTED: synaptonemal complex protein 2-like     160   2e-40   
gb|EPS72075.1|  hypothetical protein M569_02689                         158   2e-40   
gb|ADD69817.1|  transverse filament                                     156   5e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56540.1|  hypothetical protein OsJ_05847                          156   5e-39   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04367.1|  OSJNBa0027G07.1                                        156   5e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77379.1|  hypothetical protein OsI_16115                          156   6e-39   Oryza sativa Indica Group [Indian rice]
emb|CAH66985.1|  H0505F09.1                                             156   6e-39   Oryza sativa [red rice]
gb|AHH02622.1|  synaptonemal complex protein 1                          156   7e-39   
gb|AFP73614.1|  synaptonemal complex protein ZYP1                       156   7e-39   
gb|EMS64817.1|  hypothetical protein TRIUR3_29217                       156   7e-39   
gb|AFD04131.1|  molecular zipper 1-like protein ZYP1                    155   8e-39   
gb|EMT00814.1|  hypothetical protein F775_00822                         155   9e-39   
emb|CDX85007.1|  BnaC05g20480D                                          153   1e-37   
ref|XP_006652351.1|  PREDICTED: synaptonemal complex protein 1-like     152   1e-37   
ref|XP_004301472.1|  PREDICTED: synaptonemal complex protein 2-like     151   3e-37   
ref|XP_004301313.1|  PREDICTED: synaptonemal complex protein 2-like     150   6e-37   
gb|AFW58456.1|  hypothetical protein ZEAMMB73_907541                    146   2e-36   
ref|XP_010477489.1|  PREDICTED: synaptonemal complex protein 1-li...    147   1e-35   
ref|XP_010535536.1|  PREDICTED: synaptonemal complex protein 1-li...    143   1e-34   
ref|NP_001052952.2|  Os04g0452500                                       140   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010459975.1|  PREDICTED: synaptonemal complex protein 1-li...    137   2e-32   
ref|XP_010459970.1|  PREDICTED: synaptonemal complex protein 1 is...    136   3e-32   
ref|XP_009106522.1|  PREDICTED: synaptonemal complex protein 1-li...    134   3e-31   
emb|CAE75876.1|  OSJNBa0086B14.27                                       125   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104586.1|  PREDICTED: synaptonemal complex protein 1-li...    112   8e-24   
gb|KHF99250.1|  Synaptonemal complex 1 -like protein                    108   8e-23   
ref|XP_002987715.1|  hypothetical protein SELMODRAFT_426465             102   4e-21   
ref|XP_002983174.1|  hypothetical protein SELMODRAFT_422485           99.4    5e-20   
emb|CDY35024.1|  BnaC06g13620D                                        79.7    2e-13   
ref|XP_010091769.1|  hypothetical protein L484_000766                 69.3    1e-11   
ref|XP_010097774.1|  hypothetical protein L484_004188                 69.3    1e-11   
ref|XP_006472610.1|  PREDICTED: synaptonemal complex protein 1-li...  66.2    8e-09   
ref|XP_004301922.1|  PREDICTED: synaptonemal complex protein 1-like   56.2    2e-05   



>ref|XP_009778807.1| PREDICTED: synaptonemal complex protein 1-like [Nicotiana sylvestris]
Length=639

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL  S  G   ++ I  R+S+D VS+GSF NLKLTAEKLVKEQASA+TDLQLA SK
Sbjct  14   DHFKSLAGSGLGAGKAMPITTRMSADMVSSGSFANLKLTAEKLVKEQASAKTDLQLANSK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKKL EDI +LEEKLQNAYNENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  74   LKKLIEDIHILEEKLQNAYNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ AEK+KA FED+ SA+SV + NL D MKALSLR++S EET+RNC KEL E+ +EK
Sbjct  134  AGVVQNAEKDKASFEDRRSATSVVIDNLQDNMKALSLRLESSEETVRNCKKELNEIRIEK  193

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            EKME YFR E +K+  +I EKD   
Sbjct  194  EKMENYFRVEQSKSISVIEEKDAMI  218



>ref|XP_006364852.1| PREDICTED: synaptonemal complex protein 1-like [Solanum tuberosum]
Length=868

 Score =   266 bits (679),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL+ S  G A ++SIP R+SSD VS GSF NLKLTAEKLVKEQASA+TDLQLA SK
Sbjct  14   DHFKSLSGSGVGAAKTMSIPTRMSSDMVSTGSFANLKLTAEKLVKEQASAKTDLQLASSK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKKLTE++ +LEEKL+NAYNENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  74   LKKLTEEVHMLEEKLKNAYNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+KAFFED+ SA+SV + NL D +K+LSLR++S EET+RNC +EL ELG+EK
Sbjct  134  AGVVQDAEKDKAFFEDRQSATSVVVDNLQDDLKSLSLRLESSEETVRNCKRELNELGIEK  193

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            EKM+  F  E +K T +I EKD   
Sbjct  194  EKMKNCFMVEQSKCTSVIGEKDAMI  218



>ref|XP_004238527.1| PREDICTED: synaptonemal complex protein 1-like [Solanum lycopersicum]
Length=868

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL+ S  G A ++SIP R+SSD VS GSF NLKLTAEKLVKEQASA+TDLQLA SK
Sbjct  14   DHFKSLSGSGVGAAKTMSIPTRMSSDMVSTGSFANLKLTAEKLVKEQASAKTDLQLASSK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKKLTE++ VLEEKL+NAYNENAKLKVK KEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  74   LKKLTEEVHVLEEKLKNAYNENAKLKVKHKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+KA FED+ SA SV + NL D +K+LSLR++S EET+RNC +EL ELG+EK
Sbjct  134  AGVVQDAEKDKASFEDRQSAISVVVDNLQDDLKSLSLRLESSEETVRNCKRELNELGIEK  193

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            EKM+  F  E +K T +I EKD   
Sbjct  194  EKMKNCFMVEQSKCTSVIEEKDAMI  218



>ref|XP_009614522.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=876

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL  +  G A ++ I  R+S+D VS+GSF NLKLTAEKLVKEQASA+TDLQLA SK
Sbjct  14   DHFKSLAGAGLGAAKAMPITTRMSADMVSSGSFANLKLTAEKLVKEQASAKTDLQLANSK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKKL EDI +LEEKLQNAYNENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  74   LKKLIEDIHMLEEKLQNAYNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+KA FED+ SA+SV + NL D +KALSLR++S EET+RNC +EL ELG+EK
Sbjct  134  AGVVQDAEKDKASFEDRRSATSVVIDNLQDNIKALSLRLESSEETVRNCKRELNELGIEK  193

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            EKME  FR E +K+  +I EKD
Sbjct  194  EKMENSFRVEQSKSISVIEEKD  215



>ref|XP_009614523.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=868

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL  +  G A ++ I  R+S+D VS+GSF NLKLTAEKLVKEQASA+TDLQLA SK
Sbjct  14   DHFKSLAGAGLGAAKAMPITTRMSADMVSSGSFANLKLTAEKLVKEQASAKTDLQLANSK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKKL EDI +LEEKLQNAYNENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  74   LKKLIEDIHMLEEKLQNAYNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+KA FED+ SA+SV + NL D +KALSLR++S EET+RNC +EL ELG+EK
Sbjct  134  AGVVQDAEKDKASFEDRRSATSVVIDNLQDNIKALSLRLESSEETVRNCKRELNELGIEK  193

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            EKME  FR E +K+  +I EKD
Sbjct  194  EKMENSFRVEQSKSISVIEEKD  215



>ref|XP_007018780.1| Myosin heavy chain-related protein [Theobroma cacao]
 gb|EOY16005.1| Myosin heavy chain-related protein [Theobroma cacao]
Length=875

 Score =   246 bits (628),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL+ S S  A + S+P+R S+DSVS GSF NLKLTAEKLVKEQAS RTDL++A SK
Sbjct  13   DHFKSLSGSGSRAARTFSVPSRPSTDSVSLGSFANLKLTAEKLVKEQASVRTDLEMANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I VLEEKLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  73   LKKSMEHIRVLEEKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ AEK+  FFE KLS SS  + +L++ M  LSL++ S EETIRNCGKE++EL  EK
Sbjct  133  ASQVQNAEKDTEFFEGKLSESSKVIESLNEHMNGLSLKLSSAEETIRNCGKEIEELKFEK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+   +++DE  K+  +I EKD    +
Sbjct  193  EENGRFYKDEQCKSANLIEEKDALIKK  219



>ref|XP_010664327.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Vitis 
vinifera]
 emb|CBI19158.3| unnamed protein product [Vitis vinifera]
Length=876

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S  G A + S+P R SSDS++ GSF NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  13   DQFKSLSGSIPGTAKTFSVPGRPSSDSITLGSFANLKLTAEKLVKEQASVKTDLEMANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  EDI +LEEKLQ A NENAKLKVKQKEDEKLW GL+SKF STKTLC+QLTETLQHL
Sbjct  73   LKKSMEDIQILEEKLQYALNENAKLKVKQKEDEKLWTGLESKFFSTKTLCEQLTETLQHL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K  FEDKLSASSVA   L+DQM  LSL+++S EE+I+N  KELKEL +++
Sbjct  133  ACQVQDAEKDKELFEDKLSASSVAFDGLNDQMNGLSLKLESAEESIKNYEKELKELKIQQ  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E++ RDE  K   ++ EKD   
Sbjct  193  EEREQFHRDEQCKTANLLEEKDAMI  217



>ref|XP_010664328.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Vitis 
vinifera]
Length=864

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S  G A + S+P R SSDS++ GSF NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  13   DQFKSLSGSIPGTAKTFSVPGRPSSDSITLGSFANLKLTAEKLVKEQASVKTDLEMANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  EDI +LEEKLQ A NENAKLKVKQKEDEKLW GL+SKF STKTLC+QLTETLQHL
Sbjct  73   LKKSMEDIQILEEKLQYALNENAKLKVKQKEDEKLWTGLESKFFSTKTLCEQLTETLQHL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K  FEDKLSASSVA   L+DQM  LSL+++S EE+I+N  KELKEL +++
Sbjct  133  ACQVQDAEKDKELFEDKLSASSVAFDGLNDQMNGLSLKLESAEESIKNYEKELKELKIQQ  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E++ RDE  K   ++ EKD   
Sbjct  193  EEREQFHRDEQCKTANLLEEKDAMI  217



>ref|XP_003634472.1| PREDICTED: synaptonemal complex protein 2-like isoform X2 [Vitis 
vinifera]
Length=868

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S  G A + S+P R SSDS++ GSF NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  13   DQFKSLSGSIPGTAKTFSVPGRPSSDSITLGSFANLKLTAEKLVKEQASVKTDLEMANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  EDI +LEEKLQ A NENAKLKVKQKEDEKLW GL+SKF STKTLC+QLTETLQHL
Sbjct  73   LKKSMEDIQILEEKLQYALNENAKLKVKQKEDEKLWTGLESKFFSTKTLCEQLTETLQHL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K  FEDKLSASSVA   L+DQM  LSL+++S EE+I+N  KELKEL +++
Sbjct  133  ACQVQDAEKDKELFEDKLSASSVAFDGLNDQMNGLSLKLESAEESIKNYEKELKELKIQQ  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E++ RDE  K   ++ EKD   
Sbjct  193  EEREQFHRDEQCKTANLLEEKDAMI  217



>emb|CDP01053.1| unnamed protein product [Coffea canephora]
Length=878

 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  KSL  S S  A +LSI +R SSDSVS GSF NLKLTAEKLVKEQASA+TDL LA +K
Sbjct  14   DHFKSLAGSASAGAKTLSISSRASSDSVSLGSFANLKLTAEKLVKEQASAKTDLDLANAK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKKLTE I +LEEKLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  74   LKKLTEHIHILEEKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIR  779
            A QVQ+AEK+K +FEDKLSASSVAL NLH+QMK+LSLR++S EE +R
Sbjct  134  AAQVQDAEKDKVYFEDKLSASSVALDNLHEQMKSLSLRLESSEEAVR  180



>ref|XP_010059999.1| PREDICTED: synaptonemal complex protein 1-like [Eucalyptus grandis]
 gb|KCW66519.1| hypothetical protein EUGRSUZ_F00323 [Eucalyptus grandis]
Length=878

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 158/198 (80%), Gaps = 2/198 (1%)
 Frame = +3

Query  312  GVAHSLS-IPARVS-SDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIG  485
            G A + S   +R S +DS+S GSF NLKLTAEKLVKEQA+ +TDL++A +KLKK TE I 
Sbjct  26   GTAKAFSSFSSRPSATDSLSIGSFANLKLTAEKLVKEQAAVKTDLEMANTKLKKSTEHIR  85

Query  486  VLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEK  665
             LE+KLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHLAGQVQ AEK
Sbjct  86   ALEDKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHLAGQVQNAEK  145

Query  666  NKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFRD  845
            +K FFEDKLSASSVA+  L+ QM ALS++++S EETI+   KEL ELGVEKE+ E++ RD
Sbjct  146  DKEFFEDKLSASSVAIDGLNQQMAALSMKLESAEETIQRRDKELMELGVEKEEREKFHRD  205

Query  846  EHNKATGIIAEKDVYFSR  899
            E  +   +I EKD    +
Sbjct  206  EQYRTANLIGEKDALIKK  223



>ref|XP_008219423.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal complex protein 
1-like [Prunus mume]
Length=865

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG ++  +  +R   DS S+GSF NLKLTAEKLVKEQAS +TDL++A +K
Sbjct  13   DKFKSLSKSVSGTSNIFAYSSR-PPDSNSSGSFANLKLTAEKLVKEQASVKTDLEMANTK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLT+TLQ L
Sbjct  72   LKKSVEHIRALEEKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTDTLQLL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK++ +FE K+SAS++AL  L+ QM  LSL+++S E+ IRN  K+L+EL  +K
Sbjct  132  AGQVQDAEKDREYFEGKISASAIALDGLNKQMNGLSLKLESAEDIIRNREKQLEELKSDK  191

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E+ +RDE ++   +I EKD   
Sbjct  192  EEREKSYRDEQSRTANLIEEKDAMI  216



>ref|XP_010269266.1| PREDICTED: synaptonemal complex protein 1-like [Nelumbo nucifera]
Length=877

 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ +SL+ S SG A ++ I +R SSDS+S+G+F NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  14   DQFRSLSGSVSGSAKTVPIYSRSSSDSISSGNFSNLKLTAEKLVKEQASVKTDLEMANSK  73

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA NENAKLKVKQKED KLW GL+SKFSSTK LCDQLTETL+HL
Sbjct  74   LKKTEEHIHELEEKLQNAINENAKLKVKQKEDAKLWTGLESKFSSTKVLCDQLTETLKHL  133

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG+VQEAE++K FFEDKLSASS A  +LH QM  LS +++S EETIRN  +EL E  +E+
Sbjct  134  AGRVQEAEQDKRFFEDKLSASSEAFDSLHLQMNDLSAKLESAEETIRNMEQELTEAKIEE  193

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            EK E  +RDE+ K T +I +KD    R
Sbjct  194  EKRERTYRDENCKTTQLIKDKDALIER  220



>ref|XP_007224064.1| hypothetical protein PRUPE_ppa015312mg [Prunus persica]
 gb|EMJ25263.1| hypothetical protein PRUPE_ppa015312mg [Prunus persica]
Length=863

 Score =   220 bits (561),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG ++  S  +R   DS S+GSF NLKLTAEKLVKEQAS +TDL++A +K
Sbjct  13   DKFKSLSKSVSGTSNIFSYSSR-PPDSTSSGSFANLKLTAEKLVKEQASVKTDLEMANTK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTL DQLTETLQ L
Sbjct  72   LKKSVEHIRALEEKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLSDQLTETLQLL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK++  FE K+SAS++AL  L+ QM  LSL+++S E+ IRN  KEL+EL  +K
Sbjct  132  AGQVQDAEKDRESFEGKISASTIALDGLNQQMNGLSLKLESAEDIIRNREKELEELKSDK  191

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E+ +RDE ++   +I EKD   
Sbjct  192  EEGEKSYRDEQSRTANLIEEKDAMI  216



>ref|XP_002513917.1| Ribosome-binding protein, putative [Ricinus communis]
 gb|EEF48500.1| Ribosome-binding protein, putative [Ricinus communis]
Length=868

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSLT S  G A +L + +R   DS+S GSF NLKLTAEKL+KEQAS +TDL++A SK
Sbjct  13   DQYKSLTGSVPGSAKNLPLSSRPFPDSISHGSFTNLKLTAEKLIKEQASVKTDLEIANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK TE I  LEEKLQNA+NENAKLKV+Q EDEKLW GL+SKF STKTLCDQLTETLQHL
Sbjct  73   LKKSTEHITALEEKLQNAFNENAKLKVRQMEDEKLWKGLESKFCSTKTLCDQLTETLQHL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+KAFFE KLS SS A+ +L+ Q+  LSL++ S E T+R   KEL++L +EK
Sbjct  133  ACQVQDAEKDKAFFEIKLSESSNAIDSLNQQLNNLSLKLGSAEGTVRTREKELEDLKIEK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+  + + +E  +   +I EKD    +
Sbjct  193  EEKNKIYMEEQCRTANLIEEKDAMLKK  219



>ref|XP_008362597.1| PREDICTED: synaptonemal complex protein 1-like [Malus domestica]
Length=875

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG     S  +R   DS+++GSF NLKLTAEKLVKEQAS +TDL++A +K
Sbjct  13   DQFKSLSKSVSGAPXIFSYSSR-PPDSIASGSFANLKLTAEKLVKEQASVKTDLEMANNK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA+NENAKLKVKQKEDEK+W GL+SKFSSTKTLCDQLTETLQ L
Sbjct  72   LKKSVEHIXALEEKLQNAFNENAKLKVKQKEDEKMWKGLESKFSSTKTLCDQLTETLQLL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK+K  FE KLSASS AL  L+ QM  LSL+++S EE IRN  KEL+ L ++ 
Sbjct  132  AGQVQDAEKDKESFECKLSASSXALDGLNQQMDGLSLKLESAEELIRNREKELEXLKIDN  191

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ +  ++DE  +   +I EKD   
Sbjct  192  EERDRSYQDEXRRNXNLIEEKDAML  216



>ref|XP_009348104.1| PREDICTED: synaptonemal complex protein 1-like [Pyrus x bretschneideri]
Length=875

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 156/205 (76%), Gaps = 1/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG     S  +R   DS+++GSF NLKLTAEKLVKEQAS +TDL++A +K
Sbjct  13   DQFKSLSKSVSGAPKIFSYSSR-PPDSIASGSFANLKLTAEKLVKEQASVKTDLEMANNK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA+NENAKLKVKQKEDEK+W GL+SKFSSTKTLC+QLTETLQ L
Sbjct  72   LKKSVEHIRALEEKLQNAFNENAKLKVKQKEDEKMWKGLESKFSSTKTLCNQLTETLQLL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK+K  FE KLSASS+AL  L+ QM  LSL+++S EE IRN  KEL+EL ++ 
Sbjct  132  AGQVQDAEKDKESFECKLSASSIALDGLNQQMDGLSLKLESAEELIRNREKELEELKIDN  191

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ +  ++DE  +   +I EKD   
Sbjct  192  EERDRSYQDERRRNANLIDEKDAML  216



>ref|XP_009368440.1| PREDICTED: synaptonemal complex protein 1-like [Pyrus x bretschneideri]
Length=881

 Score =   219 bits (557),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG     S  +R   DS+++GSF NLKLTAEKLVKEQAS +TDL++A +K
Sbjct  13   DQFKSLSKSVSGAPKIFSYSSR-PPDSIASGSFANLKLTAEKLVKEQASVKTDLEMANNK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA+NENAKLKVKQKEDEK+W GL+SKFSSTKTLCDQLTETLQ L
Sbjct  72   LKKSVEHIRALEEKLQNAFNENAKLKVKQKEDEKMWKGLESKFSSTKTLCDQLTETLQLL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK+K  FE KLSASS+AL  L+ QM  LSL+++S EE IRN  KEL+E+ ++ 
Sbjct  132  AGQVQDAEKDKESFECKLSASSIALDGLNQQMDGLSLKLESAEELIRNREKELEEVKIDN  191

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ +   +DE  +   +I EKD   
Sbjct  192  EERDRSCQDERRRNANLIDEKDAML  216



>gb|EYU22923.1| hypothetical protein MIMGU_mgv1a001163mg [Erythranthe guttata]
Length=874

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 158/206 (77%), Gaps = 6/206 (3%)
 Frame = +3

Query  279  DRVKSLTASRSGVA----HSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQL  446
            ++ KSL+ S  G +    HS S  A      VS GSF NLKLTAEKLVKEQASA+ DL+L
Sbjct  14   EQFKSLSGSNMGASNAKMHSSSTVA--PPHPVSTGSFANLKLTAEKLVKEQASAKNDLEL  71

Query  447  AYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTET  626
            A SKL+KLTE I +LEEKL+NA+NENA+LKVKQKEDEKLW GL+SKFS TKTLCDQLTET
Sbjct  72   ANSKLRKLTEQISMLEEKLRNAFNENAQLKVKQKEDEKLWIGLESKFSFTKTLCDQLTET  131

Query  627  LQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkel  806
            L+ L  QVQ AEK+KAFFEDK+SA+S  L  LH+ MK++SL++ S EETI+   KEL EL
Sbjct  132  LEQLNVQVQLAEKDKAFFEDKISATSAVLDKLHEHMKSMSLKLDSSEETIKTREKELMEL  191

Query  807  gvekekmeeYFRDEHNKATGIIAEKD  884
            G+EK K+E  FR+E ++ T +I EKD
Sbjct  192  GLEKGKLETSFRNEQSRTTCLIEEKD  217



>ref|XP_011097760.1| PREDICTED: synaptonemal complex protein 1-like [Sesamum indicum]
Length=844

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +3

Query  363  SAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVK  542
            S GSF NL LTAEKL+KEQ SAR DL+LA SKL K+TE I VLEEKLQNA+NENAKLKVK
Sbjct  14   SYGSFANLTLTAEKLLKEQVSARNDLELANSKLTKMTEQIHVLEEKLQNAFNENAKLKVK  73

Query  543  QKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNL  722
            QKEDEKLW GL+SKFSSTKTLC QLTETLQ L  QVQ AEK+KAFFEDK SA+S+AL  L
Sbjct  74   QKEDEKLWEGLESKFSSTKTLCGQLTETLQLLNVQVQHAEKDKAFFEDKFSATSIALDKL  133

Query  723  HDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEKDVYF  893
            H+ MK++SLR+ S EETI+    EL EL + KEKME  FR+E N+   +I EKD   
Sbjct  134  HEHMKSMSLRLDSSEETIKTREAELMELALAKEKMESCFRNEQNRTAHVIEEKDAMI  190



>ref|XP_006433993.1| hypothetical protein CICLE_v10000237mg [Citrus clementina]
 gb|ESR47233.1| hypothetical protein CICLE_v10000237mg [Citrus clementina]
Length=872

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 4/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL    SG A S S  +R S+DS+++GSF NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  13   DQFKSL----SGSAKSFSFSSRPSTDSLTSGSFANLKLTAEKLVKEQASVKTDLEMANSK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E + +LEEKLQNA NENAKLKVKQKEDEKLW GL+SKFSSTKTL DQLTETLQHL
Sbjct  69   LKKSMEHVRILEEKLQNAVNENAKLKVKQKEDEKLWKGLESKFSSTKTLSDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEKNK FFEDK+S+S  A+     QM  LSL++ S EE IR   KEL++L +E+
Sbjct  129  ASQVQDAEKNKEFFEDKISSSMNAVDFQKQQMDHLSLKLGSAEEIIRKREKELEDLKIER  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+ ++ +RDE  + + ++ + D    +
Sbjct  189  EERDKLYRDECCRTSNLMDKNDAMIKK  215



>gb|KHN21841.1| Synaptonemal complex protein 2 [Glycine soja]
Length=842

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 151/205 (74%), Gaps = 2/205 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL  S S     LS  +R S+DSVS+GSF NLKLTAEKLVKEQAS +TDL+ A SK
Sbjct  14   DQFKSLYGSISATPKPLS--SRPSADSVSSGSFANLKLTAEKLVKEQASVKTDLENANSK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA NENAKLKVKQKED+K+W GL+SKFSSTKTLCDQLTETLQ L
Sbjct  72   LKKSQEYVHALEEKLQNALNENAKLKVKQKEDKKMWKGLESKFSSTKTLCDQLTETLQQL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+K   E+KLSASS AL +L+ QM  LSL++ S +ETI     EL+++    
Sbjct  132  AGLVQDAEKDKETLENKLSASSEALDSLNKQMDGLSLKLDSAQETISTRDNELEKIKYAT  191

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E++ RDE  + T +I +KD   
Sbjct  192  EEREKFHRDEQCRVTNVIQDKDTMI  216



>ref|XP_011016418.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Populus 
euphratica]
Length=866

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 163/224 (73%), Gaps = 5/224 (2%)
 Frame = +3

Query  228  FDFEMsklvglsglsslDRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKL  407
             DFEM KL   S  +  D+ KSL    SG A + S  +R S+D   +GSF NLK+TAEKL
Sbjct  5    IDFEMQKLGLPSMKTL-DQFKSL----SGSAKNFSFNSRPSTDLTPSGSFANLKITAEKL  59

Query  408  VKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKF  587
            VKEQAS +TDL +A +KLKK  E I VLE+KLQNA+NENAKLKVKQKEDEKLW GL+SKF
Sbjct  60   VKEQASVKTDLDMANTKLKKSMEHIHVLEDKLQNAFNENAKLKVKQKEDEKLWKGLESKF  119

Query  588  SSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLE  767
            SSTKTLCDQLT++LQHLAGQVQ+AEK+K FFE KLSASS  +  L+ Q+  LS+++ S E
Sbjct  120  SSTKTLCDQLTDSLQHLAGQVQDAEKDKEFFEGKLSASSNGIDYLNQQLNDLSVKLGSAE  179

Query  768  ETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEKDVYFSR  899
             TIR   +EL+EL +EKE+  + + +E  + T +I EKD    +
Sbjct  180  LTIRTRERELQELEIEKEERNKIYIEELRQTTSLIEEKDAMLKK  223



>ref|XP_011016410.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Populus 
euphratica]
Length=883

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 163/224 (73%), Gaps = 5/224 (2%)
 Frame = +3

Query  228  FDFEMsklvglsglsslDRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKL  407
             DFEM KL   S  +  D+ KSL    SG A + S  +R S+D   +GSF NLK+TAEKL
Sbjct  5    IDFEMQKLGLPSMKTL-DQFKSL----SGSAKNFSFNSRPSTDLTPSGSFANLKITAEKL  59

Query  408  VKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKF  587
            VKEQAS +TDL +A +KLKK  E I VLE+KLQNA+NENAKLKVKQKEDEKLW GL+SKF
Sbjct  60   VKEQASVKTDLDMANTKLKKSMEHIHVLEDKLQNAFNENAKLKVKQKEDEKLWKGLESKF  119

Query  588  SSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLE  767
            SSTKTLCDQLT++LQHLAGQVQ+AEK+K FFE KLSASS  +  L+ Q+  LS+++ S E
Sbjct  120  SSTKTLCDQLTDSLQHLAGQVQDAEKDKEFFEGKLSASSNGIDYLNQQLNDLSVKLGSAE  179

Query  768  ETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEKDVYFSR  899
             TIR   +EL+EL +EKE+  + + +E  + T +I EKD    +
Sbjct  180  LTIRTRERELQELEIEKEERNKIYIEELRQTTSLIEEKDAMLKK  223



>ref|XP_004305869.1| PREDICTED: synaptonemal complex protein 2-like [Fragaria vesca 
subsp. vesca]
Length=869

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 154/210 (73%), Gaps = 10/210 (5%)
 Frame = +3

Query  279  DRVKSLTASRSG-----VAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQ  443
            D+ KSL+ S SG      A+S   P     +S S+GS  NLKLTAEKLVKEQAS +TDL+
Sbjct  13   DQFKSLSKSASGGPPKTFAYSWRPP-----ESTSSGSLANLKLTAEKLVKEQASVKTDLE  67

Query  444  LAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTE  623
            +A +KLKK  E I  LEEKLQNA+NENAK KVKQKEDEKLW GL+SKFSSTKTLCDQLTE
Sbjct  68   MANTKLKKSMEHIRALEEKLQNAFNENAKFKVKQKEDEKLWKGLESKFSSTKTLCDQLTE  127

Query  624  TLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelke  803
            TLQ LAGQVQ+AEK+K  FE KLSAS+VAL+ L  QM  LS++++S EETIR   KEL++
Sbjct  128  TLQLLAGQVQDAEKDKEAFEGKLSASAVALNGLSQQMNDLSIKLESAEETIRTREKELEQ  187

Query  804  lgvekekmeeYFRDEHNKATGIIAEKDVYF  893
               EKE+ ++ +++E  +   +I EKD   
Sbjct  188  HRFEKEETDKLYKNEQCRTANLIEEKDAMI  217



>ref|XP_007141174.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
 gb|ESW13168.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
Length=868

 Score =   209 bits (533),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL  S SG +  LS  AR S DS+S+GSF NLKLTAEKLVKEQAS +TDL+ A +K
Sbjct  14   DQFKSLYGSISGTSKPLS--ARPSVDSISSGSFANLKLTAEKLVKEQASVKTDLENANAK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA NENAKLKVKQKE+EKLW GL+SKFSSTKT CDQLTETLQ L
Sbjct  72   LKKSQECMNTLEEKLQNALNENAKLKVKQKEEEKLWKGLESKFSSTKTFCDQLTETLQKL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+K   E+KLSASS AL +L+ QM  LSL++ S +ETIR    EL++L +  
Sbjct  132  AGLVQDAEKDKETLENKLSASSEALDSLNKQMDGLSLKLDSAQETIRTRDNELEKLKLAS  191

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            E+ E++ RD+  +   ++ EKD
Sbjct  192  EEKEKFHRDDLCRVANVVQEKD  213



>ref|XP_007141178.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
 gb|ESW13172.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
Length=792

 Score =   209 bits (532),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL  S SG +  LS  AR S DS+S+GSF NLKLTAEKLVKEQAS +TDL+ A +K
Sbjct  14   DQFKSLYGSISGTSKPLS--ARPSVDSISSGSFANLKLTAEKLVKEQASVKTDLENANAK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA NENAKLKVKQKE+EKLW GL+SKFSSTKT CDQLTETLQ L
Sbjct  72   LKKSQECMNTLEEKLQNALNENAKLKVKQKEEEKLWKGLESKFSSTKTFCDQLTETLQKL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+K   E+KLSASS AL +L+ QM  LSL++ S +ETIR    EL++L +  
Sbjct  132  AGLVQDAEKDKETLENKLSASSEALDSLNKQMDGLSLKLDSAQETIRTRDNELEKLKLAS  191

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            E+ E++ RD+  +   ++ EKD
Sbjct  192  EEKEKFHRDDLCRVANVVQEKD  213



>ref|XP_007141175.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
 gb|ESW13169.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
Length=865

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL  S SG +  LS  AR S DS+S+GSF NLKLTAEKLVKEQAS +TDL+ A +K
Sbjct  14   DQFKSLYGSISGTSKPLS--ARPSVDSISSGSFANLKLTAEKLVKEQASVKTDLENANAK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA NENAKLKVKQKE+EKLW GL+SKFSSTKT CDQLTETLQ L
Sbjct  72   LKKSQECMNTLEEKLQNALNENAKLKVKQKEEEKLWKGLESKFSSTKTFCDQLTETLQKL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+K   E+KLSASS AL +L+ QM  LSL++ S +ETIR    EL++L +  
Sbjct  132  AGLVQDAEKDKETLENKLSASSEALDSLNKQMDGLSLKLDSAQETIRTRDNELEKLKLAS  191

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            E+ E++ RD+  +   ++ EKD
Sbjct  192  EEKEKFHRDDLCRVANVVQEKD  213



>ref|XP_007141177.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
 gb|ESW13171.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
Length=866

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL  S SG +  LS  AR S DS+S+GSF NLKLTAEKLVKEQAS +TDL+ A +K
Sbjct  14   DQFKSLYGSISGTSKPLS--ARPSVDSISSGSFANLKLTAEKLVKEQASVKTDLENANAK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA NENAKLKVKQKE+EKLW GL+SKFSSTKT CDQLTETLQ L
Sbjct  72   LKKSQECMNTLEEKLQNALNENAKLKVKQKEEEKLWKGLESKFSSTKTFCDQLTETLQKL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+K   E+KLSASS AL +L+ QM  LSL++ S +ETIR    EL++L +  
Sbjct  132  AGLVQDAEKDKETLENKLSASSEALDSLNKQMDGLSLKLDSAQETIRTRDNELEKLKLAS  191

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            E+ E++ RD+  +   ++ EKD
Sbjct  192  EEKEKFHRDDLCRVANVVQEKD  213



>ref|XP_007141176.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
 gb|ESW13170.1| hypothetical protein PHAVU_008G173500g [Phaseolus vulgaris]
Length=867

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL  S SG +  LS  AR S DS+S+GSF NLKLTAEKLVKEQAS +TDL+ A +K
Sbjct  14   DQFKSLYGSISGTSKPLS--ARPSVDSISSGSFANLKLTAEKLVKEQASVKTDLENANAK  71

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA NENAKLKVKQKE+EKLW GL+SKFSSTKT CDQLTETLQ L
Sbjct  72   LKKSQECMNTLEEKLQNALNENAKLKVKQKEEEKLWKGLESKFSSTKTFCDQLTETLQKL  131

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AG VQ+AEK+K   E+KLSASS AL +L+ QM  LSL++ S +ETIR    EL++L +  
Sbjct  132  AGLVQDAEKDKETLENKLSASSEALDSLNKQMDGLSLKLDSAQETIRTRDNELEKLKLAS  191

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            E+ E++ RD+  +   ++ EKD
Sbjct  192  EEKEKFHRDDLCRVANVVQEKD  213



>ref|XP_006390012.1| hypothetical protein EUTSA_v10018107mg [Eutrema salsugineum]
 gb|ESQ27298.1| hypothetical protein EUTSA_v10018107mg [Eutrema salsugineum]
Length=874

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 154/205 (75%), Gaps = 4/205 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+++SL    +G A + S  +R   DSVS+G+F NLK TAEKLVKEQAS ++DL+LA SK
Sbjct  13   DQIRSL----AGSAKNFSFSSRQPQDSVSSGNFSNLKFTAEKLVKEQASMKSDLELANSK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQHL
Sbjct  69   LKKSMDHIAALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQEAEK+K FFE K S S+ A+ +L  QM+ LSLR+ + EE I++  KELKEL +EK
Sbjct  129  ASQVQEAEKDKEFFESKFSTSAEAIDSLKQQMQDLSLRLGAAEEDIKSREKELKELNLEK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E  + +E  +   ++ EKDV  
Sbjct  189  EQRENSYLNEQCRTADLLKEKDVII  213



>ref|XP_006472608.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472609.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Citrus 
sinensis]
Length=872

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (75%), Gaps = 4/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S    A S S  +R S+DS+++GSF NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  13   DQFKSLSRS----AKSFSFSSRPSTDSLTSGSFANLKLTAEKLVKEQASVKTDLEMANSK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E + +LEEKLQNA NENAKLKVKQKEDEKLW GL+SKFSSTKTL DQLTETLQHL
Sbjct  69   LKKSMEHVRILEEKLQNAVNENAKLKVKQKEDEKLWKGLESKFSSTKTLSDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEKNK FFEDK+S+S  A+     QM  LSL++ S EE I    KEL++L +E+
Sbjct  129  ASQVQDAEKNKEFFEDKISSSMNAVDCQKQQMDHLSLKLGSAEEIITKREKELEDLKIER  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+ ++ +RDE  +   ++ +KD    +
Sbjct  189  EERDKLYRDECCRTANLMDKKDAMIKK  215



>ref|XP_004301312.1| PREDICTED: synaptonemal complex protein 2-like [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   206 bits (524),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KS++ S SG        +    +S S+GSF NLKLTAEKLVKEQAS +TDL++A +K
Sbjct  13   DQFKSISKSASGGPPKTFAYSSRRPESTSSGSFANLKLTAEKLVKEQASVKTDLEMANTK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA+NENAK KVK+KEDEKLW GL+SKFSSTKTLCDQLTETLQ L
Sbjct  73   LKKSMEHIRALEEKLQNAFNENAKFKVKRKEDEKLWKGLESKFSSTKTLCDQLTETLQLL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK+K  FE KLSAS++A   L  QM  LS+++++ EETIR   KEL+E  +EK
Sbjct  133  AGQVQDAEKDKEAFEGKLSASALAFDGLSQQMNDLSIKLETAEETIRTREKELEECRLEK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ ++ +R+E  +   +I EKD   
Sbjct  193  EETDKLYRNEQCRTANLIEEKDAMI  217



>gb|KDO80956.1| hypothetical protein CISIN_1g002878mg [Citrus sinensis]
Length=872

 Score =   206 bits (525),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 155/207 (75%), Gaps = 4/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S    A S S  +R S+DS+++GSF NLKLTAEKLVKEQAS +TDL++A SK
Sbjct  13   DQFKSLSRS----AKSFSFSSRPSTDSLTSGSFANLKLTAEKLVKEQASVKTDLEMANSK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E + +LEEKLQNA NENAKLKVKQKEDEKLW GL+SKFSSTKTL DQLTETLQHL
Sbjct  69   LKKSMEHVRILEEKLQNAVNENAKLKVKQKEDEKLWKGLESKFSSTKTLSDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEKNK FFEDK+S+S  A+     QM  LSL++ S EE I    KEL++L +E+
Sbjct  129  ASQVQDAEKNKEFFEDKISSSMNAVDCQKQQMDHLSLKLGSAEEIITKREKELEDLKIER  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+ ++ +RDE  + + ++ + D    +
Sbjct  189  EERDKLYRDECCRTSNLMDKNDAMIKK  215



>ref|NP_173645.3| synaptonemal complex protein ZYP1a [Arabidopsis thaliana]
 sp|Q9LME2.1|SYCP1_ARATH RecName: Full=Synaptonemal complex protein 1; AltName: Full=Synaptonemal 
complex central region protein ZYP1a [Arabidopsis 
thaliana]
 gb|AAF87265.1|AC068562_12 T16E15.12 [Arabidopsis thaliana]
 gb|AAY46119.1| synaptonemal complex central region protein ZYP1a [Arabidopsis 
thaliana]
 gb|AEE30217.1| synaptonemal complex protein ZYP1a [Arabidopsis thaliana]
Length=871

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 154/207 (74%), Gaps = 2/207 (1%)
 Frame = +3

Query  285  VKSLTASRS--GVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            +KSL   RS  G A+  S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA  K
Sbjct  9    MKSLDKPRSLSGSANMYSFSNRKPPDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANCK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQNA+NENAKL+V++KEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  69   LKKSMEHVYALEEKLQNAFNENAKLRVRKKEDEKLWRGLESKFSSTKTLCDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K FFE K S SS A+ +L+ QM+ +SLR+ + +E I +  KEL+EL +EK
Sbjct  129  ASQVQDAEKDKGFFETKFSTSSEAIDSLNQQMRDMSLRLDAAKEEITSRDKELEELKLEK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            ++ E +++ E      +I +KD   ++
Sbjct  189  QQKEMFYQTERCGTASLIEKKDAVITK  215



>ref|XP_010937455.1| PREDICTED: synaptonemal complex protein 2-like [Elaeis guineensis]
Length=876

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 151/204 (74%), Gaps = 1/204 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIP-ARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D ++S+  S +G A +  I   R+SSDS+S GSF NLKLTAE+LVKEQAS +TDL++A++
Sbjct  13   DHLRSVNGSLAGAAKTSQISNPRLSSDSISYGSFANLKLTAERLVKEQASVKTDLEMAHT  72

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            ++K+ TE I VLE KLQ A NENAKLKVKQ ED KLW GLDSKFSSTK LCDQLTETLQH
Sbjct  73   RIKRATEQIHVLEAKLQQAVNENAKLKVKQTEDTKLWKGLDSKFSSTKILCDQLTETLQH  132

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgve  815
            LAGQ   AE+NK FFE+KL+ SS A  +L+  +  LS++++    TI    +E+ EL  E
Sbjct  133  LAGQTHAAEENKNFFEEKLAHSSKAFDDLNCLLNDLSVKLECAGNTINAGKQEILELRRE  192

Query  816  kekmeeYFRDEHNKATGIIAEKDV  887
            KE+ME+YFRDE +    +I EKDV
Sbjct  193  KEEMEKYFRDERSATDNVIKEKDV  216



>ref|XP_010477488.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Camelina 
sativa]
Length=869

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 148/199 (74%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA SKLKK  E +
Sbjct  17   SMSGSAKTHSFSPRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANSKLKKSMEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + S+ A+ +L+ Q++ +SLR+   +  I +  KE +EL +EKEK E Y+ 
Sbjct  137  KDKDFFESKFNTSTEAIDSLNQQLQDMSLRLDDAKANITSRDKEFEELKLEKEKKEMYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II EKD   ++
Sbjct  197  NEQGRTASIIEEKDAMITK  215



>ref|XP_010477487.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Camelina 
sativa]
Length=878

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 148/199 (74%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA SKLKK  E +
Sbjct  17   SMSGSAKTHSFSPRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANSKLKKSMEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + S+ A+ +L+ Q++ +SLR+   +  I +  KE +EL +EKEK E Y+ 
Sbjct  137  KDKDFFESKFNTSTEAIDSLNQQLQDMSLRLDDAKANITSRDKEFEELKLEKEKKEMYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II EKD   ++
Sbjct  197  NEQGRTASIIEEKDAMITK  215



>gb|KFK42204.1| hypothetical protein AALP_AA2G225000 [Arabis alpina]
Length=872

 Score =   204 bits (519),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 153/207 (74%), Gaps = 5/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVS-AGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D+++SL    SG A + S  +R S DS S +G+F NLKLTAEKLVKEQAS ++DL+LA S
Sbjct  13   DQIRSL----SGSAKNFSFSSRQSQDSASTSGNFSNLKLTAEKLVKEQASMKSDLELANS  68

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KLKK  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQH
Sbjct  69   KLKKSMDHILALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQH  128

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgve  815
            LA QVQEAEK+K FFE K S+SS A+ NL  QM+ L L++ + EE I+   KEL+EL  E
Sbjct  129  LASQVQEAEKDKEFFEYKFSSSSEAIDNLKQQMQDLCLKLGTAEENIKIREKELEELKHE  188

Query  816  kekmeeYFRDEHNKATGIIAEKDVYFS  896
            KE+ E  + DE ++   +  EKD   +
Sbjct  189  KEQRENSYLDEQHRTASLFKEKDAMIT  215



>ref|XP_010535529.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Tarenaya 
hassleriana]
Length=874

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A++ S  +R   DS S+GSF NLKLTAEKLVKEQAS +TDL+LA SKLKK  + I
Sbjct  17   SASGSANTFSFSSRQPPDSTSSGSFANLKLTAEKLVKEQASMKTDLELANSKLKKSMDHI  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LEEKLQNA+NENAKL+V+QKEDEKLW GL+SKFS TKTLCDQLTETL HLA QVQ+AE
Sbjct  77   RALEEKLQNAFNENAKLRVRQKEDEKLWKGLESKFSPTKTLCDQLTETLHHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
             +K   E K+SASS A+ +L+ QM+ L LR+ + EE I++   EL+EL  EKE+M++ + 
Sbjct  137  MDKVRCESKISASSEAIDSLNRQMQELCLRLGAAEENIKSRDNELEELKTEKEQMKKCYL  196

Query  843  DEHNKATGIIAEKDVYF  893
            DE  +   +I EKD   
Sbjct  197  DEQCRTASLIEEKDAMI  213



>ref|XP_010676591.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=848

 Score =   201 bits (511),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KS T S SG A +LSI +R SSDS+++GSF NLK+TAEKLVKEQAS RTDL LA SK
Sbjct  13   DQFKSFTGSASGTAKTLSISSRSSSDSITSGSFANLKITAEKLVKEQASVRTDLDLANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I +LEEKLQ A NENAKLKVKQKEDEK+W GL+SKFSSTKT CDQLTETLQ L
Sbjct  73   LKKSLEHIHLLEEKLQTACNENAKLKVKQKEDEKIWQGLESKFSSTKTFCDQLTETLQFL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K   E KL+ + VAL N++D+MK LSL+++S EE I+   + L+EL  +K
Sbjct  133  ACQVQDAEKDKELIEGKLTENLVALDNINDEMKKLSLKLESAEENIKERDEALEELKRQK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E  + +E +K T ++AEKD + 
Sbjct  193  EEQEVLYENERSKTTKLMAEKDDFI  217



>ref|XP_002302294.2| hypothetical protein POPTR_0002s09680g [Populus trichocarpa]
 gb|EEE81567.2| hypothetical protein POPTR_0002s09680g [Populus trichocarpa]
Length=874

 Score =   201 bits (511),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 4/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL    SG A + S  +R S+DS ++GSF NLK+TAEKLVKEQAS +TDL +A +K
Sbjct  13   DQFKSL----SGSAKNFSFNSRSSTDSTTSGSFANLKITAEKLVKEQASVKTDLGMANTK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I VLE+KLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  69   LKKSMEHIHVLEDKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK+K FFE KLSASS  +  L+ Q+  LS+++ S EETIR   +EL+EL + K
Sbjct  129  AGQVQDAEKDKEFFEGKLSASSNGIDYLNQQLNDLSVKLGSAEETIRTRERELQELEINK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+  + + +E  + T +I EKD    +
Sbjct  189  EERNKIYIEELRQTTSLIEEKDAMLKK  215



>ref|XP_010676582.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=870

 Score =   201 bits (511),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KS T S SG A +LSI +R SSDS+++GSF NLK+TAEKLVKEQAS RTDL LA SK
Sbjct  13   DQFKSFTGSASGTAKTLSISSRSSSDSITSGSFANLKITAEKLVKEQASVRTDLDLANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I +LEEKLQ A NENAKLKVKQKEDEK+W GL+SKFSSTKT CDQLTETLQ L
Sbjct  73   LKKSLEHIHLLEEKLQTACNENAKLKVKQKEDEKIWQGLESKFSSTKTFCDQLTETLQFL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K   E KL+ + VAL N++D+MK LSL+++S EE I+   + L+EL  +K
Sbjct  133  ACQVQDAEKDKELIEGKLTENLVALDNINDEMKKLSLKLESAEENIKERDEALEELKRQK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E  + +E +K T ++AEKD + 
Sbjct  193  EEQEVLYENERSKTTKLMAEKDDFI  217



>ref|XP_010676574.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=880

 Score =   201 bits (512),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KS T S SG A +LSI +R SSDS+++GSF NLK+TAEKLVKEQAS RTDL LA SK
Sbjct  13   DQFKSFTGSASGTAKTLSISSRSSSDSITSGSFANLKITAEKLVKEQASVRTDLDLANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I +LEEKLQ A NENAKLKVKQKEDEK+W GL+SKFSSTKT CDQLTETLQ L
Sbjct  73   LKKSLEHIHLLEEKLQTACNENAKLKVKQKEDEKIWQGLESKFSSTKTFCDQLTETLQFL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K   E KL+ + VAL N++D+MK LSL+++S EE I+   + L+EL  +K
Sbjct  133  ACQVQDAEKDKELIEGKLTENLVALDNINDEMKKLSLKLESAEENIKERDEALEELKRQK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+ E  + +E +K T ++AEKD + 
Sbjct  193  EEQEVLYENERSKTTKLMAEKDDFI  217



>gb|KDP41376.1| hypothetical protein JCGZ_15783 [Jatropha curcas]
Length=864

 Score =   201 bits (510),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG A +LS  +R SSDS+S+GSFVNLKLTAEKL+K+QAS +TDL++A SK
Sbjct  13   DQFKSLSGSISGSAKNLSFSSRPSSDSISSGSFVNLKLTAEKLIKDQASVKTDLEIANSK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I  LEEKLQNA NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQ L
Sbjct  73   LKKSMELISALEEKLQNALNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQLL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QV +AEK+K FFE KLSASS A+ +L+ ++  LSL++ S EETIR   +EL+EL +EK
Sbjct  133  ACQVHDAEKDKEFFESKLSASSTAIDDLNQRLNGLSLKLDSAEETIRTHEQELEELKIEK  192

Query  819  ekmeeYFRDEHNKATGIIAEKDVYF  893
            E+  + + +E ++   +I EKD   
Sbjct  193  EERNKIYTEEQHRIAYLIDEKDAML  217



>ref|NP_564164.1| synaptonemal complex protein 2 [Arabidopsis thaliana]
 sp|P61430.1|SYCP2_ARATH RecName: Full=Synaptonemal complex protein 2; AltName: Full=Synaptonemal 
complex central region protein ZYP1b [Arabidopsis 
thaliana]
 gb|AAY46120.1| synaptonemal complex central region protein ZYP1b [Arabidopsis 
thaliana]
 gb|AEE30219.1| synaptonemal complex protein 2 [Arabidopsis thaliana]
Length=856

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+++SL     G A +     R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA  K
Sbjct  13   DQLRSL----PGSAKTYFFSTRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANCK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LEEKLQ+A+NENAKL+V+QKEDEKLW GL+SKFSSTKTLCDQLTETLQHL
Sbjct  69   LKKSMEHVYALEEKLQSAFNENAKLRVRQKEDEKLWRGLESKFSSTKTLCDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K FFE K + SS A+++L+ QM+ +SLR+ + +E I +  KEL+EL +EK
Sbjct  129  ASQVQDAEKDKGFFETKFNTSSEAINSLNQQMRDMSLRLDAAKEEITSRDKELEELKLEK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFS  896
            +  E +++ E      +I +KD   +
Sbjct  189  QHKEMFYQTERCGTASLIEKKDAVIT  214



>ref|XP_002890507.1| hypothetical protein ARALYDRAFT_889731 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66766.1| hypothetical protein ARALYDRAFT_889731 [Arabidopsis lyrata subsp. 
lyrata]
Length=871

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 2/207 (1%)
 Frame = +3

Query  285  VKSLTASRS--GVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            +KSL   RS  G A + S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA  K
Sbjct  9    MKSLDQLRSFSGSAKTYSFSTRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANCK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTKTL DQLTETLQHL
Sbjct  69   LKKSLEHVYALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKTLGDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K FFE K S SS A+ +L+ QM+ +SLR+ + +E I +  KEL+EL +EK
Sbjct  129  ASQVQDAEKDKVFFETKFSTSSEAIDSLNQQMRDMSLRLVTAKEEITSRDKELEELKLEK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            ++ E +++ E      +I +KD   ++
Sbjct  189  QQKEMFYQTERCGTASLIEKKDAVITK  215



>ref|XP_010459969.1| PREDICTED: synaptonemal complex protein 1 isoform X2 [Camelina 
sativa]
Length=870

 Score =   198 bits (504),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA  KLKK  E +
Sbjct  17   SMSGSAKTHSFSTRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANCKLKKSMEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            K K FFE K + SS A+ +L+ QM+ +SLR+ + +E I
Sbjct  137  KEKDFFESKFNTSSEAIDSLNQQMQDMSLRLDAAKENI  174



>ref|XP_010459968.1| PREDICTED: synaptonemal complex protein 1 isoform X1 [Camelina 
sativa]
Length=871

 Score =   198 bits (504),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA  KLKK  E +
Sbjct  17   SMSGSAKTHSFSTRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANCKLKKSMEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            K K FFE K + SS A+ +L+ QM+ +SLR+ + +E I
Sbjct  137  KEKDFFESKFNTSSEAIDSLNQQMQDMSLRLDAAKENI  174



>emb|CDX79250.1| BnaC06g20530D [Brassica napus]
Length=878

 Score =   198 bits (503),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 4/169 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLS-IPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D+++S+ A   G A +LS   +R   DSVS+G+F NLK TAEKLVKEQAS ++DL+LA S
Sbjct  13   DQIRSMAA---GSAKNLSSFSSRQPHDSVSSGNFSNLKFTAEKLVKEQASMKSDLELANS  69

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KLKK  + I  LEEKLQ+A+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQH
Sbjct  70   KLKKSKDHILALEEKLQSAFNENAKLRVMQKEDEKLWTGMESKFSSTKTLCDQLTETLQH  129

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRN  782
            LA QVQEAEK+K FFE K S S+  + +L  QM+ LS+R+ S EE I++
Sbjct  130  LASQVQEAEKDKEFFESKFSTSAETIDSLKQQMQDLSVRLSSAEENIKS  178



>ref|XP_009104585.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Brassica 
rapa]
Length=875

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 130/169 (77%), Gaps = 4/169 (2%)
 Frame = +3

Query  285  VKSLTASRS---GVAHSLSIPA-RVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAY  452
            +KSL   RS   G A +LS  + R   DSVS+G+F NLK TAEKLVKEQAS ++DL+LA 
Sbjct  9    MKSLDQIRSMALGSAKNLSFSSSRQPHDSVSSGNFSNLKFTAEKLVKEQASMKSDLELAN  68

Query  453  SKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQ  632
            SKLK+  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQ
Sbjct  69   SKLKRSKDHILALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQ  128

Query  633  HLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIR  779
            HLA QVQEAEK+K FFE K S S+  + +L  QM+ LS+R+ S EE I+
Sbjct  129  HLASQVQEAEKDKEFFESKFSTSAETIDSLKQQMQDLSVRLSSAEEDIK  177



>ref|XP_004163196.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal complex protein 
1-like [Cucumis sativus]
Length=869

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 146/203 (72%), Gaps = 0/203 (0%)
 Frame = +3

Query  291  SLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKL  470
             L+ S  G + + S  +R   DS S+G+FVNLK+ AEKL+KEQAS +TDL++A  KL+K 
Sbjct  18   PLSGSAQGTSKTFSFSSRSVPDSASSGNFVNLKIAAEKLMKEQASLKTDLEMANGKLRKS  77

Query  471  TEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQV  650
             E    LE+KLQNA NENAKL+VK KEDEKLW GL+SKFSS K+LCDQL ETLQ LA QV
Sbjct  78   LEHARALEDKLQNALNENAKLQVKHKEDEKLWKGLESKFSSAKSLCDQLNETLQRLASQV  137

Query  651  QEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekme  830
            Q+AEK+K   E KLSASS A+  L+ +M+ LS++V+S+EETIR+  KEL EL +EKE   
Sbjct  138  QDAEKDKEVLEAKLSASSTAIDGLNQKMQELSIKVESVEETIRDREKELAELKIEKEDNC  197

Query  831  eYFRDEHNKATGIIAEKDVYFSR  899
            + +R++  +   +I EKD    R
Sbjct  198  KLYREQQQRTADLIEEKDCMIKR  220



>ref|XP_010498691.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Camelina 
sativa]
Length=735

 Score =   196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSV +GSF NLKLTAEKLVK+QA+ RTDL+LA  KLKK  E +
Sbjct  17   SMSGSAKTHSFSTRPPQDSVVSGSFSNLKLTAEKLVKDQAAMRTDLELANCKLKKSVEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + SS A+ +L+ QM+ +SL + + +  I +  KE +EL +EKE+ + Y+ 
Sbjct  137  KDKDFFESKFNTSSEAIDSLNQQMQDMSLSLDAAKANITSRDKEFEELKLEKEQKDIYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II +KD   ++
Sbjct  197  NEQCRTASIIEKKDAEITK  215



>gb|KGN60335.1| hypothetical protein Csa_3G895810 [Cucumis sativus]
Length=875

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 146/203 (72%), Gaps = 0/203 (0%)
 Frame = +3

Query  291  SLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKL  470
             L+ S  G + + S  +R   DS S+G+FVNLK+ AEKL+KEQAS +TDL++A  KL+K 
Sbjct  18   PLSGSAQGTSKTFSFSSRSVPDSASSGNFVNLKIAAEKLMKEQASLKTDLEMANGKLRKS  77

Query  471  TEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQV  650
             E    LE+KLQNA NENAKL+VK KEDEKLW GL+SKFSS K+LCDQL ETLQ LA QV
Sbjct  78   LEHARALEDKLQNALNENAKLQVKHKEDEKLWKGLESKFSSAKSLCDQLNETLQRLASQV  137

Query  651  QEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekme  830
            Q+AEK+K   E KLSASS A+  L+ +M+ LS++V+S+EETIR+  KEL EL +EKE   
Sbjct  138  QDAEKDKEVLEAKLSASSTAIDGLNQKMQELSIKVESVEETIRDREKELAELKIEKEDNC  197

Query  831  eYFRDEHNKATGIIAEKDVYFSR  899
            + +R++  +   +I EKD    R
Sbjct  198  KLYREQQQRTADLIEEKDCMIKR  220



>ref|XP_004136213.1| PREDICTED: synaptonemal complex protein 1-like [Cucumis sativus]
Length=869

 Score =   197 bits (500),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 146/203 (72%), Gaps = 0/203 (0%)
 Frame = +3

Query  291  SLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKL  470
             L+ S  G + + S  +R   DS S+G+FVNLK+ AEKL+KEQAS +TDL++A  KL+K 
Sbjct  18   PLSGSAQGTSKTFSFSSRSVPDSASSGNFVNLKIAAEKLMKEQASLKTDLEMANGKLRKS  77

Query  471  TEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQV  650
             E    LE+KLQNA NENAKL+VK KEDEKLW GL+SKFSS K+LCDQL ETLQ LA QV
Sbjct  78   LEHARALEDKLQNALNENAKLQVKHKEDEKLWKGLESKFSSAKSLCDQLNETLQRLASQV  137

Query  651  QEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekme  830
            Q+AEK+K   E KLSASS A+  L+ +M+ LS++V+S+EETIR+  KEL EL +EKE   
Sbjct  138  QDAEKDKEVLEAKLSASSTAIDGLNQKMQELSIKVESVEETIRDREKELAELKIEKEDNC  197

Query  831  eYFRDEHNKATGIIAEKDVYFSR  899
            + +R++  +   +I EKD    R
Sbjct  198  KLYREQQQRTADLIEEKDCMIKR  220



>ref|XP_010498690.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Camelina 
sativa]
Length=841

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSV +GSF NLKLTAEKLVK+QA+ RTDL+LA  KLKK  E +
Sbjct  17   SMSGSAKTHSFSTRPPQDSVVSGSFSNLKLTAEKLVKDQAAMRTDLELANCKLKKSVEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + SS A+ +L+ QM+ +SL + + +  I +  KE +EL +EKE+ + Y+ 
Sbjct  137  KDKDFFESKFNTSSEAIDSLNQQMQDMSLSLDAAKANITSRDKEFEELKLEKEQKDIYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II +KD   ++
Sbjct  197  NEQCRTASIIEKKDAEITK  215



>ref|XP_010498695.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Camelina 
sativa]
Length=849

 Score =   196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSV +GSF NLKLTAEKLVK+QA+ RTDL+LA  KLKK  E +
Sbjct  17   SMSGSAKTHSFSTRPPQDSVVSGSFSNLKLTAEKLVKDQAAMRTDLELANCKLKKSVEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + SS A+ +L+ QM+ +SL + + +  I +  KE +EL +EKE+ + Y+ 
Sbjct  137  KDKDFFESKFNTSSEAIDSLNQQMQDMSLSLDAAKANITSRDKEFEELKLEKEQKDIYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II +KD   ++
Sbjct  197  NEQCRTASIIEKKDAEITK  215



>ref|XP_010498689.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Camelina 
sativa]
Length=870

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSV +GSF NLKLTAEKLVK+QA+ RTDL+LA  KLKK  E +
Sbjct  17   SMSGSAKTHSFSTRPPQDSVVSGSFSNLKLTAEKLVKDQAAMRTDLELANCKLKKSVEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + SS A+ +L+ QM+ +SL + + +  I +  KE +EL +EKE+ + Y+ 
Sbjct  137  KDKDFFESKFNTSSEAIDSLNQQMQDMSLSLDAAKANITSRDKEFEELKLEKEQKDIYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II +KD   ++
Sbjct  197  NEQCRTASIIEKKDAEITK  215



>ref|XP_008466037.1| PREDICTED: synaptonemal complex protein 1-like [Cucumis melo]
 ref|XP_008466038.1| PREDICTED: synaptonemal complex protein 1-like [Cucumis melo]
Length=875

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = +3

Query  291  SLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKL  470
             L+ S  G + +LS  +R   DS S+GSFVNLK+ AEKL+KEQAS +TDL++A  KL+K 
Sbjct  18   PLSGSAQGTSKTLSFSSRSVPDSASSGSFVNLKIAAEKLMKEQASLKTDLEIANGKLRKS  77

Query  471  TEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQV  650
             E    LE+KLQNA NENAKL+VK KEDEKLW GL+SKFSS K+LCDQL ETLQ LA QV
Sbjct  78   LEHTRALEDKLQNALNENAKLQVKHKEDEKLWEGLESKFSSAKSLCDQLNETLQRLASQV  137

Query  651  QEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekme  830
            Q+AEK+K   E KLSAS  A+  L+ +M+ LS++V+S EETIRN  KEL EL +EKE   
Sbjct  138  QDAEKDKEVLEAKLSASCTAIDGLNQKMQELSIKVESAEETIRNREKELAELKIEKEDNC  197

Query  831  eYFRDEHNKATGIIAEKDVYFSR  899
            + +R+E  +   +  EKD    R
Sbjct  198  KLYREEQQRTANLSEEKDYMTKR  220



>ref|XP_006305922.1| hypothetical protein CARUB_v10011139mg [Capsella rubella]
 gb|EOA38820.1| hypothetical protein CARUB_v10011139mg [Capsella rubella]
Length=870

 Score =   195 bits (496),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 152/207 (73%), Gaps = 4/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+++SL    SG A + S   R   DS S+GSF NLKLTAEKLVK+QA+ RTDL+LA  K
Sbjct  13   DQLRSL----SGSAKTHSFSTRPPQDSFSSGSFSNLKLTAEKLVKDQAAMRTDLELANCK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHL
Sbjct  69   LKKSMEHVYALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K+FFE K + SS A+ +L+ QM  +SL + + +E I +  KEL+EL +EK
Sbjct  129  ASQVQDAEKDKSFFESKFNTSSEAIDSLNQQMGDMSLTLNAAKENITSRDKELEELKLEK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFSR  899
            E+ E  F +E  +   +I +KD   ++
Sbjct  189  EQKEMLFLNEQCRTASLIEKKDDVITK  215



>ref|XP_008802213.1| PREDICTED: synaptonemal complex protein 2-like [Phoenix dactylifera]
Length=876

 Score =   195 bits (495),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 148/203 (73%), Gaps = 1/203 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIP-ARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D ++S+  S +G A +  I  +R+SSDS+S GSF NLKLTAE+LVKEQAS +TDL++A++
Sbjct  13   DHLRSVHGSLAGAAKTSQISNSRLSSDSISHGSFANLKLTAERLVKEQASVKTDLEMAHT  72

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            +LK+ TE I VLE KLQ A NENAKLKVKQ ED KLW GLDSKFSSTK LCDQLTETLQH
Sbjct  73   RLKRATEHIHVLEAKLQQAVNENAKLKVKQTEDTKLWKGLDSKFSSTKMLCDQLTETLQH  132

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgve  815
            L  Q Q+  +NK FFE+KL+ SS A  +L+     LS++++    TI    +E+ EL  E
Sbjct  133  LTCQTQQLTENKNFFEEKLAHSSKAFDDLNCLQNDLSVKLECAGNTINAGKQEILELRRE  192

Query  816  kekmeeYFRDEHNKATGIIAEKD  884
            KE+ME+YFRDE +    +I EKD
Sbjct  193  KEEMEKYFRDERSATDNVIKEKD  215



>ref|XP_010459973.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010459976.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Camelina 
sativa]
Length=869

 Score =   194 bits (494),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 145/199 (73%), Gaps = 0/199 (0%)
 Frame = +3

Query  303  SRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDI  482
            S SG A + S   R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA   LK   E +
Sbjct  17   SMSGSAKTHSYSTRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELANCNLKNSMEHV  76

Query  483  GVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAE  662
              LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ+AE
Sbjct  77   YALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQDAE  136

Query  663  KNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFR  842
            K+K FFE K + SS A+ +L+ QM+ +SL + + +  I +  KE +EL +EKE+ + Y+ 
Sbjct  137  KDKDFFESKFNTSSEAMDSLNQQMQDMSLSLDAAKANITSRDKEFEELKLEKEQKDIYYL  196

Query  843  DEHNKATGIIAEKDVYFSR  899
            +E  +   II +KD   ++
Sbjct  197  NEQCRTASIIEKKDAEITK  215



>ref|XP_006853153.1| hypothetical protein AMTR_s00038p00178460 [Amborella trichopoda]
 gb|ERN14620.1| hypothetical protein AMTR_s00038p00178460 [Amborella trichopoda]
Length=875

 Score =   192 bits (488),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = +3

Query  300  ASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTED  479
             S  G +   + P+R S +  S GSF NLKLTAEKLV +QA A+TDL+ A SKLKK  E 
Sbjct  17   TSLPGTSRFFNNPSRSSHEVASVGSFANLKLTAEKLVHDQACAKTDLEFANSKLKKFAEQ  76

Query  480  IGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEA  659
            I  LE KLQ+A NENAKLKVKQKED KLWNGLDSK SSTKTLCDQLTETLQHLAG V+ A
Sbjct  77   IHALEAKLQDASNENAKLKVKQKEDSKLWNGLDSKLSSTKTLCDQLTETLQHLAGLVRGA  136

Query  660  EKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRN  782
            E++K FFEDKL  +S A   LH Q+K  SL++ S EE IR+
Sbjct  137  EEDKKFFEDKLLENSKAFDGLHFQLKDFSLKLDSAEERIRH  177



>gb|AAF87264.1|AC068562_11 EST gb|F14399 comes from this gene [Arabidopsis thaliana]
Length=1025

 Score =   191 bits (485),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 152/216 (70%), Gaps = 14/216 (6%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAY--  452
            D+++SL     G A +     R   DSVS+GSF NLKLTAEKLVK+QA+ RTDL+LA   
Sbjct  145  DQLRSL----PGSAKTYFFSTRPPQDSVSSGSFSNLKLTAEKLVKDQAAMRTDLELAELK  200

Query  453  --------SKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLC  608
                     KLKK  E +  LEEKLQ+A+NENAKL+V+QKEDEKLW GL+SKFSSTKTLC
Sbjct  201  FDGCACENCKLKKSMEHVYALEEKLQSAFNENAKLRVRQKEDEKLWRGLESKFSSTKTLC  260

Query  609  DQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCg  788
            DQLTETLQHLA QVQ+AEK+K FFE K + SS A+++L+ QM+ +SLR+ + +E I +  
Sbjct  261  DQLTETLQHLASQVQDAEKDKGFFETKFNTSSEAINSLNQQMRDMSLRLDAAKEEITSRD  320

Query  789  kelkelgvekekmeeYFRDEHNKATGIIAEKDVYFS  896
            KEL+EL +EK+  E +++ E      +I +KD   +
Sbjct  321  KELEELKLEKQHKEMFYQTERCGTASLIEKKDAVIT  356



>ref|XP_006304762.1| hypothetical protein CARUB_v10012227mg [Capsella rubella]
 gb|EOA37660.1| hypothetical protein CARUB_v10012227mg [Capsella rubella]
Length=872

 Score =   189 bits (481),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 149/206 (72%), Gaps = 4/206 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+++SL    SG A + S   R   +S+S+GSF NLKLTAEKLVK+QA+ RTDL+LA  K
Sbjct  13   DQLRSL----SGSAKTHSFSTRPPQNSLSSGSFSNLKLTAEKLVKDQAAMRTDLELANCK  68

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E +  LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHL
Sbjct  69   LKKSMEHVYALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHL  128

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            A QVQ+AEK+K  F+ K + SS A+  L+ Q++ +SLR+   +E I+   KE ++L +EK
Sbjct  129  ASQVQDAEKDKDSFQSKFNTSSEAIDFLNQQLRDMSLRLDDAKENIKTRDKEFEKLKLEK  188

Query  819  ekmeeYFRDEHNKATGIIAEKDVYFS  896
            E+ E  + +E  +   +I +KD   +
Sbjct  189  EQKEMLYLNEQCRTASLIEKKDTVIT  214



>gb|ABO69625.1| synaptonemal complex protein ZYP1 [Brassica oleracea]
Length=876

 Score =   184 bits (467),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 124/168 (74%), Gaps = 3/168 (2%)
 Frame = +3

Query  285  VKSLTASRS--GVAHSLSIPARVSS-DSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            +KSL   RS  G   +L+  +R    DSVS+G+F NLK TAEKLVKEQAS ++DL+LA S
Sbjct  9    MKSLDQMRSMAGSGRNLAFSSRQQPHDSVSSGNFSNLKSTAEKLVKEQASMKSDLELANS  68

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KL+K  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQH
Sbjct  69   KLRKSMDHIVALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQH  128

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIR  779
            LA QVQEAEK++  FE K   S+  + +L  QM  LS R+   EE I+
Sbjct  129  LASQVQEAEKDRELFESKFFTSAEVIDSLKQQMGDLSSRLGVAEENIK  176



>ref|XP_009106521.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Brassica 
rapa]
Length=877

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (71%), Gaps = 4/206 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSS-DSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D+++S+  S      +L+  +R    D VS+G+F NLK TAEKLVKEQAS ++DL+LA S
Sbjct  13   DQMRSMAGS---AGRNLAFSSRQQPHDPVSSGNFSNLKSTAEKLVKEQASMKSDLELANS  69

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KL+K  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQH
Sbjct  70   KLRKSMDHILALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQH  129

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgve  815
            LA QVQEAEK+K  FE K   S+  + +L  QM+ LS R+ + EE I+   KEL+EL +E
Sbjct  130  LASQVQEAEKDKELFESKFFTSAEVIDSLKQQMEDLSSRLVAAEENIKRREKELEELKLE  189

Query  816  kekmeeYFRDEHNKATGIIAEKDVYF  893
            KE+ E  + +E  +   ++ EKD   
Sbjct  190  KEQTENSYLNEQCRTANLLKEKDAMI  215



>emb|CDX88425.1| BnaC06g38690D [Brassica napus]
Length=1031

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = +3

Query  285  VKSLTASRS--GVAHSLSIPARVSS-DSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            +KSL   RS  G   +L+  +R    DSVS+G+F NLK TAEKLVKEQAS ++DL+LA S
Sbjct  160  MKSLDQMRSMAGSGRNLAFSSRQQPHDSVSSGNFSNLKSTAEKLVKEQASMKSDLELANS  219

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KL+K  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQH
Sbjct  220  KLRKSMDHIVALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQH  279

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRN  782
            LA QVQEAEK+K  FE K   S+  + +L  QM  LS R+   EE I++
Sbjct  280  LASQVQEAEKDKELFESKFFTSAEVIDSLKQQMGDLSSRLGVAEENIKS  328



>gb|KFK34376.1| hypothetical protein AALP_AA5G137200 [Arabis alpina]
Length=872

 Score =   181 bits (459),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 153/207 (74%), Gaps = 5/207 (2%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVS-AGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D+++SL    +G A + S  +R S DSVS +G+F NLKLTAEKLVKEQAS ++DL+LA S
Sbjct  13   DQIRSL----AGSAKNFSFSSRQSQDSVSTSGNFSNLKLTAEKLVKEQASMKSDLELANS  68

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KLKK  + I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKF STKTLCDQLTETLQH
Sbjct  69   KLKKSMDHILALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFFSTKTLCDQLTETLQH  128

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgve  815
            LA QVQEAEK+K FFE K S+SS A+ NL  QM  + L++ + EE I+   KEL+EL +E
Sbjct  129  LASQVQEAEKDKEFFESKFSSSSEAIDNLKQQMHDICLKLGAAEENIKIREKELEELKLE  188

Query  816  kekmeeYFRDEHNKATGIIAEKDVYFS  896
            KE+ E  + DE  +   ++ EKD   +
Sbjct  189  KEQRETSYLDEQCRTASLLKEKDAMIT  215



>emb|CDX68027.1| BnaA07g20670D [Brassica napus]
Length=909

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 130/203 (64%), Gaps = 38/203 (19%)
 Frame = +3

Query  285  VKSLTASRS---GVAHSLSIPA-RVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAY  452
            +KSL   RS   G A +LS  + R   DSVS+G+F NLK TAEKLVKEQAS ++DL+LA 
Sbjct  9    MKSLDQIRSMALGSAKNLSFSSSRQPHDSVSSGNFSNLKFTAEKLVKEQASMKSDLELAP  68

Query  453  ----------------------------------SKLKKLTEDIGVLEEKLQNAYNENAK  530
                                              SKLKK  + I  LEEKLQNA+NENAK
Sbjct  69   RIVLLRFGSLLSFCVYTNLSLIDVLKSIVMYGGNSKLKKSKDHILALEEKLQNAFNENAK  128

Query  531  LKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVA  710
            L+V QKEDEKLW G++SKFSSTKTLCDQLTETLQHLA QVQEAEK+K FFE K S S+  
Sbjct  129  LRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQHLASQVQEAEKDKEFFESKFSTSAET  188

Query  711  LHNLHDQMKALSLRVKSLEETIR  779
            + +L  QM+ LS+R+ S EE I+
Sbjct  189  IDSLKQQMQDLSVRLSSAEENIK  211



>ref|XP_004490374.1| PREDICTED: LOW QUALITY PROTEIN: synaptonemal complex protein 
1-like [Cicer arietinum]
Length=988

 Score =   181 bits (458),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 153/244 (63%), Gaps = 39/244 (16%)
 Frame = +3

Query  279  DRVKSLTASRSG-VAHSLSIPARVSSDSVSAGSFVNLKLTA-------------------  398
            D+ KSL  S SG V    S+ +R S DSVS+GSF NLKLTA                   
Sbjct  13   DQFKSLYGSASGTVKPLSSLSSRPSPDSVSSGSFANLKLTAGFDTDFASISCFLFFXILI  72

Query  399  -------------------EKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNE  521
                               EKLVKEQAS +TDL++A +KLKK  E I  LEEKLQNA+NE
Sbjct  73   LIGSFDRNVAMHRLISSCAEKLVKEQASVKTDLEIANTKLKKSLEHIRALEEKLQNAFNE  132

Query  522  NAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSAS  701
            NAKLKVKQ+EDEKLW GL+SKFSSTKTLCDQLTETLQ LA  VQ+AEK+K   E+KLSAS
Sbjct  133  NAKLKVKQREDEKLWKGLESKFSSTKTLCDQLTETLQQLASLVQDAEKDKETLENKLSAS  192

Query  702  SVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEK  881
            S AL +L+ QM  LSL++ S +ETI+    EL++L    E+ E++  DE  KA  +I EK
Sbjct  193  SDALESLNKQMDDLSLKLDSAQETIKIRDNELEKLNFAAEEREKFHSDEKCKAANVIQEK  252

Query  882  DVYF  893
            D   
Sbjct  253  DTMI  256



>gb|AES98059.2| myosin heavy chain-like protein [Medicago truncatula]
Length=903

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 145/244 (59%), Gaps = 39/244 (16%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGS--FVNLKLTA------------------  398
            DR KSL  S SG A  LS        S S  S  F NLKLTA                  
Sbjct  14   DRFKSLYGSASGTAKPLSSSISARQSSDSVSSGSFANLKLTAGFDSDFTSIFVFFLLLLI  73

Query  399  -------------------EKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNE  521
                               EKLVK+QAS +TDL +A +KLKK  E I  LEEKLQNA+NE
Sbjct  74   VIGKFERNAVMRCLISSSAEKLVKDQASVKTDLDIANTKLKKSLEHIRALEEKLQNAFNE  133

Query  522  NAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSAS  701
            NAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETLQ LAG VQ+AEK+K   E KLSAS
Sbjct  134  NAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLQQLAGIVQDAEKDKEKLESKLSAS  193

Query  702  SVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEK  881
            S AL +L++QM  LSL++ S EETI+    EL +L    E+ E++  DE  +A  +I EK
Sbjct  194  SEALESLNEQMNGLSLKLDSTEETIKARDNELVKLKFAAEEREKFHSDEKCRAANVIEEK  253

Query  882  DVYF  893
            D   
Sbjct  254  DTMI  257



>ref|XP_003615101.1| Synaptonemal complex protein [Medicago truncatula]
Length=999

 Score =   179 bits (454),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  393  TAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNG  572
            +AEKLVK+QAS +TDL +A +KLKK  E I  LEEKLQNA+NENAKLKVKQKEDEKLW G
Sbjct  91   SAEKLVKDQASVKTDLDIANTKLKKSLEHIRALEEKLQNAFNENAKLKVKQKEDEKLWKG  150

Query  573  LDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLR  752
            L+SKFSSTKTLCDQLTETLQ LAG VQ+AEK+K   E KLSASS AL +L++QM  LSL+
Sbjct  151  LESKFSSTKTLCDQLTETLQQLAGIVQDAEKDKEKLESKLSASSEALESLNEQMNGLSLK  210

Query  753  VKSLEETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEKDVYF  893
            + S EETI+    EL +L    E+ E++  DE  +A  +I EKD   
Sbjct  211  LDSTEETIKARDNELVKLKFAAEEREKFHSDEKCRAANVIEEKDTMI  257



>ref|XP_009417578.1| PREDICTED: synaptonemal complex protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=869

 Score =   178 bits (451),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 119/169 (70%), Gaps = 1/169 (1%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIP-ARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS  455
            D +KSL+ S +G      +P ARVSSDS S GSFVNLKLTAEKLVKEQAS +TDL+LA +
Sbjct  7    DHLKSLSGSLAGPPRVAPLPVARVSSDSNSYGSFVNLKLTAEKLVKEQASLKTDLELAQT  66

Query  456  KLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQH  635
            KLKK TE I VLE KLQ A NE AKLKVKQ ED KLW GLDSK SSTKT+CDQLTETLQ 
Sbjct  67   KLKKATEHIQVLETKLQQAVNEKAKLKVKQTEDTKLWKGLDSKLSSTKTMCDQLTETLQR  126

Query  636  LAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRN  782
            LA Q   AE++K  FE+KL  +  AL         LS ++++   TI N
Sbjct  127  LADQTCAAEEDKKIFEEKLDNNLKALDQFELLFNDLSTKLENASNTINN  175



>emb|CDX87468.1| BnaA07g34050D [Brassica napus]
Length=921

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 148/229 (65%), Gaps = 28/229 (12%)
 Frame = +3

Query  285  VKSLTASRS--GVAHSLSIPARVSS-DSVSAGSFVNLKLTAEKLVKEQASARTDLQLA--  449
            +KSL   RS  G   +L+  +R    DSVS+G+F NLK TAEKLVKEQAS ++DL+LA  
Sbjct  29   MKSLDQMRSMAGSGRNLAFSSRQQPHDSVSSGNFSNLKSTAEKLVKEQASMKSDLELAVF  88

Query  450  ---------------------YSKLKKL--TEDIGVLEEKLQNAYNENAKLKVKQKEDEK  560
                                 Y  L+++   + I  LEEKLQNA+NENAKL+V QKEDEK
Sbjct  89   RMLSCFLLTNASERTDLGYFYYYILREIKSMDRILALEEKLQNAFNENAKLRVMQKEDEK  148

Query  561  LWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKA  740
            LW G++SKFSSTKTLCDQLTETLQHLA QVQEAEK+K  FE K   S+  + +L  QM+ 
Sbjct  149  LWRGMESKFSSTKTLCDQLTETLQHLASQVQEAEKDKELFESKFFTSAEVIDSLKQQMED  208

Query  741  LSLRVKSLEETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEKDV  887
            LS R+ + EE I++  KE++EL +EKE+ E  + +E  +   ++ EKD 
Sbjct  209  LSSRLGAAEENIKSREKEIEELKLEKEQTENSYLNEQCRTASLLKEKDA  257



>ref|XP_008662278.1| PREDICTED: ZYP1 protein isoform X1 [Zea mays]
Length=870

 Score =   167 bits (422),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 4/165 (2%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDS--VSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKL  461
            +SL  S S  A  ++ P R S D+  +S GSF NLK+TAEKLVKEQAS +TDL++A+ KL
Sbjct  14   RSLVGSTS-TAMKVANP-RPSPDTGGISYGSFANLKITAEKLVKEQASVKTDLEMAHVKL  71

Query  462  KKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLA  641
            ++ TE I ++E KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLCDQLTETLQ LA
Sbjct  72   RRATEQINIIEGKLQQALNENAKLKVKQTEDSKLWQGLDSKLSSTKTLCDQLTETLQQLA  131

Query  642  GQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             Q ++AE++K FFE+ L  +S AL   +  ++ LS +++  E+ I
Sbjct  132  SQTEQAEEDKKFFEEMLGKNSKALDEFNCLLRDLSTKLEYAEQKI  176



>ref|NP_001182397.1| ZYP1 protein [Zea mays]
 gb|ADM47598.1| ZYP1 protein [Zea mays]
Length=867

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 4/165 (2%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDS--VSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKL  461
            +SL  S S  A  ++ P R S D+  +S GSF NLK+TAEKLVKEQAS +TDL++A+ KL
Sbjct  14   RSLVGSTS-TAMKVANP-RPSPDTGGISYGSFANLKITAEKLVKEQASVKTDLEMAHVKL  71

Query  462  KKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLA  641
            ++ TE I ++E KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLCDQLTETLQ LA
Sbjct  72   RRATEQINIIEGKLQQALNENAKLKVKQTEDSKLWQGLDSKLSSTKTLCDQLTETLQQLA  131

Query  642  GQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             Q ++AE++K FFE+ L  +S AL   +  ++ LS +++  E+ I
Sbjct  132  SQTEQAEEDKKFFEEMLGKNSKALDEFNCLLRDLSTKLEYAEQKI  176



>gb|AFW58457.1| hypothetical protein ZEAMMB73_907541 [Zea mays]
Length=1065

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 4/165 (2%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDS--VSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKL  461
            +SL  S S  A  ++ P R S D+  +S GSF NLK+TAEKLVKEQAS +TDL++A+ KL
Sbjct  14   RSLVGSTS-TAMKVANP-RPSPDTGGISYGSFANLKITAEKLVKEQASVKTDLEMAHVKL  71

Query  462  KKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLA  641
            ++ TE I ++E KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLCDQLTETLQ LA
Sbjct  72   RRATEQINIIEGKLQQALNENAKLKVKQTEDSKLWQGLDSKLSSTKTLCDQLTETLQQLA  131

Query  642  GQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             Q ++AE++K FFE+ L  +S AL   +  ++ LS +++  E+ I
Sbjct  132  SQTEQAEEDKKFFEEMLGKNSKALDEFNCLLRDLSTKLEYAEQKI  176



>ref|XP_010091768.1| hypothetical protein L484_000765 [Morus notabilis]
 gb|EXC37076.1| hypothetical protein L484_000765 [Morus notabilis]
Length=154

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +3

Query  474  EDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQ  653
            E I  LEEKLQNA+NENAKLKVKQKEDEKLWNGL+SKFSSTKTLCDQLTETLQ LA QV 
Sbjct  2    EHIRALEEKLQNAFNENAKLKVKQKEDEKLWNGLESKFSSTKTLCDQLTETLQQLASQVH  61

Query  654  EAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmee  833
            +AEK+K FF+ KLSAS++AL NL+ QM  LSL++ S  ETIR   KEL+EL ++KE+ ++
Sbjct  62   DAEKDKEFFQGKLSASAIALDNLNQQMNGLSLKLDSAGETIRKREKELEELKIKKEERDK  121

Query  834  YFRDEHNKATGIIAEK  881
              RDE  + T +I EK
Sbjct  122  CCRDEMCRTTVLIEEK  137



>ref|XP_004975811.1| PREDICTED: synaptonemal complex protein 1-like [Setaria italica]
Length=867

 Score =   166 bits (419),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 0/163 (0%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S    + +      +   S GSF NLK+TAEKLVKEQAS +TDL++A++KL++
Sbjct  14   RSLVGSTSTAMKAANPKPSSDAGGSSYGSFANLKITAEKLVKEQASVKTDLEMAHTKLRR  73

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLCDQLTETLQ LA Q
Sbjct  74   ATEQINLLEGKLQQAVNENAKLKVKQNEDSKLWQGLDSKISSTKTLCDQLTETLQQLASQ  133

Query  648  VQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             ++AE++K FFE+ L  +S AL   +  +  LS +++  E+ I
Sbjct  134  TEQAEEDKKFFEEMLGKNSKALDEFNCMLHDLSTKLECAEQKI  176



>ref|XP_010664330.1| PREDICTED: synaptonemal complex protein 1-like isoform X4 [Vitis 
vinifera]
Length=800

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +3

Query  474  EDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQ  653
            EDI +LEEKLQ A NENAKLKVKQKEDEKLW GL+SKF STKTLC+QLTETLQHLA QVQ
Sbjct  2    EDIQILEEKLQYALNENAKLKVKQKEDEKLWTGLESKFFSTKTLCEQLTETLQHLACQVQ  61

Query  654  EAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmee  833
            +AEK+K  FEDKLSASSVA   L+DQM  LSL+++S EE+I+N  KELKEL +++E+ E+
Sbjct  62   DAEKDKELFEDKLSASSVAFDGLNDQMNGLSLKLESAEESIKNYEKELKELKIQQEEREQ  121

Query  834  YFRDEHNKATGIIAEKDVYF  893
            + RDE  K   ++ EKD   
Sbjct  122  FHRDEQCKTANLLEEKDAMI  141



>ref|XP_010097775.1| hypothetical protein L484_004189 [Morus notabilis]
 gb|EXB71054.1| hypothetical protein L484_004189 [Morus notabilis]
Length=764

 Score =   161 bits (407),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  474  EDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQ  653
            E I  LEEKLQNA+NENAKLKVKQKEDEKLWNGL+SKFSSTKTLCDQLTETLQ LA QV 
Sbjct  2    EHIRALEEKLQNAFNENAKLKVKQKEDEKLWNGLESKFSSTKTLCDQLTETLQQLASQVH  61

Query  654  EAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmee  833
            +AEK+K FF+ KLSAS++AL NL+ QM  LSL++ S  ETIR   KEL+EL ++KE+ ++
Sbjct  62   DAEKDKEFFQGKLSASAIALDNLNQQMNGLSLKLDSAGETIRKREKELEELKIKKEERDK  121

Query  834  YFRDEHNKATGIIAEKDVYF  893
             +RDE  + T +I EKD   
Sbjct  122  CYRDEMCRTTVLIEEKDAMI  141



>ref|XP_010239979.1| PREDICTED: synaptonemal complex protein 2-like [Brachypodium 
distachyon]
 ref|XP_010239980.1| PREDICTED: synaptonemal complex protein 2-like [Brachypodium 
distachyon]
Length=861

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 8/171 (5%)
 Frame = +3

Query  285  VKSLTASRSGVAHSLSIPARVSSDSVSA-------GSFVNLKLTAEKLVKEQASARTDLQ  443
            ++SL   RS +A   S+ A+ ++   S+       GSF NLK+TAEKLVKEQAS +TDL+
Sbjct  9    LRSLEGFRS-LAGPTSMAAKATNPKPSSDAGGSTYGSFANLKITAEKLVKEQASVKTDLE  67

Query  444  LAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTE  623
            +A++KL++ TE I +LE KLQ A NEN KLKVKQ ED KLW GLDSK SSTKTLCDQLTE
Sbjct  68   MAHTKLRRATEQINLLEAKLQQAVNENVKLKVKQTEDSKLWQGLDSKVSSTKTLCDQLTE  127

Query  624  TLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            TLQ LA Q + AE++K FFE+ L  +S AL  L+  +   S++++  E  I
Sbjct  128  TLQQLASQAERAEEDKKFFEEMLGKNSKALDELNCLLHDSSIKLERAEANI  178



>gb|EPS72075.1| hypothetical protein M569_02689, partial [Genlisea aurea]
Length=517

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 124/169 (73%), Gaps = 0/169 (0%)
 Frame = +3

Query  375  FVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKED  554
            F NLK TAEKLV+EQAS++ DL +A SK+K+LTE I +LEEKLQ A+NEN+KLKVKQ ED
Sbjct  46   FANLKFTAEKLVREQASSKADLDIAKSKVKRLTEQIHILEEKLQVAFNENSKLKVKQNED  105

Query  555  EKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQM  734
            EKLW GL+SKFSSTK  CDQL ETL  L  QVQ+AEK+KAF EDKL ++S  L  L   +
Sbjct  106  EKLWKGLESKFSSTKKHCDQLIETLNQLNIQVQQAEKDKAFIEDKLHSTSEVLGGLQKHI  165

Query  735  KALSLRVKSLEETIRNCgkelkelgvekekmeeYFRDEHNKATGIIAEK  881
             +LS R++S E TI+   KEL ELG+ KEK   YF  E  KA  +I EK
Sbjct  166  NSLSSRLESSENTIKTRDKELVELGLAKEKAVAYFNGEQIKAVSLIEEK  214



>gb|ADD69817.1| transverse filament [Oryza sativa Japonica Group]
Length=869

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++ ++KL++
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTHTKLRR  75

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLC+QLTETLQ LA Q
Sbjct  76   ATEQINLLEAKLQQAVNENAKLKVKQTEDSKLWQGLDSKVSSTKTLCNQLTETLQQLASQ  135

Query  648  VQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             + AE++K FFE+ L  +S A    +  +   S++++  E+ I
Sbjct  136  TERAEEDKKFFEEILGKNSKAFEEFNCLLHDSSIKLECAEQMI  178



>gb|EEE56540.1| hypothetical protein OsJ_05847 [Oryza sativa Japonica Group]
Length=871

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++ ++KL++
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTHTKLRR  75

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLC+QLTETLQ LA Q
Sbjct  76   ATEQINLLEAKLQQAVNENAKLKVKQTEDSKLWQGLDSKVSSTKTLCNQLTETLQQLASQ  135

Query  648  VQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             + AE++K FFE+ L  +S A    +  +   S++++  E+ I
Sbjct  136  TERAEEDKKFFEEILGKNSKAFEEFNCLLHDSSIKLECAEQMI  178



>emb|CAE04367.1| OSJNBa0027G07.1 [Oryza sativa Japonica Group]
Length=894

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++ ++KL++
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTHTKLRR  75

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLC+QLTETLQ LA Q
Sbjct  76   ATEQINLLEAKLQQAVNENAKLKVKQTEDSKLWQGLDSKVSSTKTLCNQLTETLQQLASQ  135

Query  648  VQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             + AE++K FFE+ L  +S A    +  +   S++++  E+ I
Sbjct  136  TERAEEDKKFFEEILGKNSKAFEEFNCLLHDSSIKLECAEQMI  178



>gb|EEC77379.1| hypothetical protein OsI_16115 [Oryza sativa Indica Group]
Length=871

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++ ++KL++
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTHTKLRR  75

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLC+QLTETLQ LA Q
Sbjct  76   ATEQINLLEAKLQQAVNENAKLKVKQTEDSKLWQGLDSKVSSTKTLCNQLTETLQQLASQ  135

Query  648  VQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             + AE++K FFE+ L  +S A    +  +   S++++  E+ I
Sbjct  136  TERAEEDKKFFEEILGKNSKAFEEFNCLLHDSSIKLECAEQMI  178



>emb|CAH66985.1| H0505F09.1 [Oryza sativa Indica Group]
Length=902

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++ ++KL++
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTHTKLRR  75

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLC+QLTETLQ LA Q
Sbjct  76   ATEQINLLEAKLQQAVNENAKLKVKQTEDSKLWQGLDSKVSSTKTLCNQLTETLQQLASQ  135

Query  648  VQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
             + AE++K FFE+ L  +S A    +  +   S++++  E+ I
Sbjct  136  TERAEEDKKFFEEILGKNSKAFEEFNCLLHDSSIKLECAEQMI  178



>gb|AHH02622.1| synaptonemal complex protein 1 [Hordeum vulgare subsp. vulgare]
Length=863

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  +SL  + S    + +      +   + GSF NLK+TAEKLVKEQAS ++DL++A++K
Sbjct  13   DGFRSLAGATSAAGKATNPKPSSDAGGSTYGSFANLKMTAEKLVKEQASVKSDLEMAHTK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            L++ TE I +LE KLQ A NEN KLKVKQ ED KLW GLDSK SSTK LCDQLTETLQ L
Sbjct  73   LRRATEQINMLEAKLQQAVNENMKLKVKQTEDSKLWQGLDSKVSSTKMLCDQLTETLQQL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHN----LHD  728
            A Q + AE++K FFE  L  +S AL      LHD
Sbjct  133  ASQTERAEEDKKFFEGMLGKNSKALDEFNCLLHD  166



>gb|AFP73614.1| synaptonemal complex protein ZYP1 [Hordeum vulgare subsp. vulgare]
Length=863

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 104/154 (68%), Gaps = 4/154 (3%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  +SL  + S    + +      +   + GSF NLK+TAEKLVKEQAS ++DL++A++K
Sbjct  13   DGFRSLAGATSAAGKATNPKPSSDAGGSTYGSFANLKMTAEKLVKEQASVKSDLEMAHTK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            L++ TE I +LE KLQ A NEN KLKVKQ ED KLW GLDSK SSTK LCDQLTETLQ L
Sbjct  73   LRRATEQINMLEAKLQQAVNENMKLKVKQTEDSKLWQGLDSKVSSTKMLCDQLTETLQQL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHN----LHD  728
            A Q + AE++K FFE  L  +S AL      LHD
Sbjct  133  ASQTERAEEDKKFFEGMLGKNSKALDEFNCLLHD  166



>gb|EMS64817.1| hypothetical protein TRIUR3_29217 [Triticum urartu]
Length=892

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  +SL  + S    + +      +   + GSF NLK+TAEKLVKEQAS ++DL++A++K
Sbjct  31   DGFRSLAGATSTAGKATNPKPSSDAGGSTYGSFANLKITAEKLVKEQASVKSDLEMAHTK  90

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            L++ TE I +LE KLQ A NEN KLKVKQ ED KLW GLDSK SSTK LCDQLTETLQ L
Sbjct  91   LRRATEQINMLEAKLQQAVNENMKLKVKQTEDSKLWQGLDSKVSSTKMLCDQLTETLQQL  150

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            A Q + AE++K FFE  L  +S AL  L+  +   S +++  E++I
Sbjct  151  ASQAERAEEDKKFFEGMLGKNSKALDELNCLLHDSSAKLECAEQSI  196



>gb|AFD04131.1| molecular zipper 1-like protein ZYP1, partial [Triticum aestivum]
Length=863

 Score =   155 bits (393),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  +SL  + S    + +      +   + GSF NLK+TAEKLVKEQAS ++DL++A++K
Sbjct  13   DGFRSLAGATSTAGKATNPKPSSDAGGSTYGSFANLKITAEKLVKEQASVKSDLEMAHTK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            L++ TE I +LE KLQ A NEN KLKVKQ ED KLW GLDSK SSTK LCDQLTETLQ L
Sbjct  73   LRRATEQINMLEAKLQQAVNENMKLKVKQTEDSKLWQGLDSKVSSTKMLCDQLTETLQQL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            A Q + AE++K FFE  L  +S AL  L+  +   S +++  E++I
Sbjct  133  ASQAERAEEDKKFFEGMLGKNSKALDELNCLLHDSSAKLECAEQSI  178



>gb|EMT00814.1| hypothetical protein F775_00822 [Aegilops tauschii]
Length=864

 Score =   155 bits (393),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 0/166 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D  +SL  + S    + +      +   + GSF NLK+TAEKLVKEQAS ++DL++A++K
Sbjct  13   DGFRSLAGATSTAGKATNPKPSSDAGGSTYGSFANLKITAEKLVKEQASVKSDLEMAHTK  72

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            L++ TE I +LE KLQ A NEN KLKVKQ ED KLW GLDSK SSTK LCDQLTETLQ L
Sbjct  73   LRRATEQINMLEAKLQQAVNENMKLKVKQTEDSKLWQGLDSKVSSTKMLCDQLTETLQQL  132

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            A Q + AE++K FFE  L  +S AL  L+  +   S +++  E++I
Sbjct  133  ASQAERAEEDKKFFEGMLGKNSKALDELNCLLHDSSAKLECAEQSI  178



>emb|CDX85007.1| BnaC05g20480D [Brassica napus]
Length=1004

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 108/143 (76%), Gaps = 5/143 (3%)
 Frame = +3

Query  354  DSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKL  533
            DSVS+G+F NLK TAEKLVKE AS ++DL LA+SKLK+  + I  L+EKLQNA     KL
Sbjct  19   DSVSSGNFPNLKFTAEKLVKELASMKSDLHLAHSKLKRSMDQILALKEKLQNA-----KL  73

Query  534  KVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVAL  713
               QKEDEKL  G++SKF ST TLCDQLTETLQHLA Q+Q+AEK+K  FE K S S+ A+
Sbjct  74   MGMQKEDEKLRRGMESKFPSTNTLCDQLTETLQHLASQIQQAEKDKERFEFKFSTSAQAI  133

Query  714  HNLHDQMKALSLRVKSLEETIRN  782
            ++L  QMK LS+++ + EE I++
Sbjct  134  NSLKQQMKDLSVKLSASEENIKS  156



>ref|XP_006652351.1| PREDICTED: synaptonemal complex protein 1-like [Oryza brachyantha]
Length=870

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +3

Query  369  GSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLEEKLQNAYNENAKLKVKQK  548
            GSF NLK+TAEK+VKEQAS +TDL++ ++KL++ TE I +LE KLQ A NENAKLKVKQ 
Sbjct  43   GSFANLKITAEKMVKEQASVKTDLEMTHNKLRRATEQINLLESKLQQAINENAKLKVKQT  102

Query  549  EDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHN---  719
            ED KLW GLDSK SST TLC+QLTETLQ LA Q + AE++K  FE+ L  +S AL     
Sbjct  103  EDSKLWQGLDSKVSSTNTLCNQLTETLQQLASQTERAEEDKRLFEEILGKNSKALEEFNC  162

Query  720  -LHDQMKAL  743
             LHD  K L
Sbjct  163  LLHDSSKKL  171



>ref|XP_004301472.1| PREDICTED: synaptonemal complex protein 2-like [Fragaria vesca 
subsp. vesca]
Length=834

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 135/202 (67%), Gaps = 10/202 (5%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSK  458
            D+ KSL+ S SG        +    +S S+GS  NLKLTAEK +KEQAS +TDL++A +K
Sbjct  27   DQFKSLSKSASGGPPKTFAYSSRPPESSSSGSLANLKLTAEKFMKEQASVKTDLEMATTK  86

Query  459  LKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHL  638
            LKK  E I   EEKLQ+A+NENAK KVKQKEDEKLW GL+SKFSS          TLQ L
Sbjct  87   LKKSMEHICASEEKLQDAFNENAKFKVKQKEDEKLWKGLESKFSS----------TLQLL  136

Query  639  AGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvek  818
            AGQVQ+AEK+K  FE KLS S+VAL     QM  LS+ ++S E+TI N  KEL+E  +EK
Sbjct  137  AGQVQDAEKDKEAFEGKLSVSAVALDGKSQQMDDLSINLESAEQTIMNREKELEEHRLEK  196

Query  819  ekmeeYFRDEHNKATGIIAEKD  884
            E+ ++ +R+E  +   +I  KD
Sbjct  197  EETDKLYRNEQCRTANLIGGKD  218



>ref|XP_004301313.1| PREDICTED: synaptonemal complex protein 2-like [Fragaria vesca 
subsp. vesca]
Length=956

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 0/144 (0%)
 Frame = +3

Query  453  SKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQ  632
            +KLKK T  I  L EKLQNA+NENAK KVK KEDEKLW GL+SKFSSTKTLCDQLTETLQ
Sbjct  4    TKLKKSTGHIRALGEKLQNAFNENAKFKVKLKEDEKLWKGLESKFSSTKTLCDQLTETLQ  63

Query  633  HLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgv  812
              AGQVQ+AEK+K  FE KLSAS+VAL     QM  LS++++S EETIRN  KEL+E  +
Sbjct  64   LFAGQVQDAEKDKEAFEGKLSASTVALDGSTQQMNDLSIKLESAEETIRNREKELEERRL  123

Query  813  ekekmeeYFRDEHNKATGIIAEKD  884
            EKE+ ++ +R+E  +   +I EKD
Sbjct  124  EKEETDKLYRNEQCRTANLIEEKD  147



>gb|AFW58456.1| hypothetical protein ZEAMMB73_907541 [Zea mays]
Length=546

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 4/126 (3%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDS--VSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKL  461
            +SL  S S  A  ++ P R S D+  +S GSF NLK+TAEKLVKEQAS +TDL++A+ KL
Sbjct  14   RSLVGSTS-TAMKVANP-RPSPDTGGISYGSFANLKITAEKLVKEQASVKTDLEMAHVKL  71

Query  462  KKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLA  641
            ++ TE I ++E KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLCDQLTETLQ LA
Sbjct  72   RRATEQINIIEGKLQQALNENAKLKVKQTEDSKLWQGLDSKLSSTKTLCDQLTETLQQLA  131

Query  642  GQVQEA  659
             Q ++ 
Sbjct  132  SQTEQG  137



>ref|XP_010477489.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Camelina 
sativa]
Length=817

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 0/149 (0%)
 Frame = +3

Query  453  SKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQ  632
            SKLKK  E +  LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQ
Sbjct  6    SKLKKSMEHVYALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQ  65

Query  633  HLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgv  812
            HLA QVQ+AEK+K FFE K + S+ A+ +L+ Q++ +SLR+   +  I +  KE +EL +
Sbjct  66   HLASQVQDAEKDKDFFESKFNTSTEAIDSLNQQLQDMSLRLDDAKANITSRDKEFEELKL  125

Query  813  ekekmeeYFRDEHNKATGIIAEKDVYFSR  899
            EKEK E Y+ +E  +   II EKD   ++
Sbjct  126  EKEKKEMYYLNEQGRTASIIEEKDAMITK  154



>ref|XP_010535536.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=819

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  453  SKLKKLTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQ  632
            SKLKK  + I  LEEKLQNA+NENAKL+V+QKEDEKLW GL+SKFS TKTLCDQLTETL 
Sbjct  12   SKLKKSMDHIRALEEKLQNAFNENAKLRVRQKEDEKLWKGLESKFSPTKTLCDQLTETLH  71

Query  633  HLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgv  812
            HLA QVQ+AE +K   E K+SASS A+ +L+ QM+ L LR+ + EE I++   EL+EL  
Sbjct  72   HLASQVQDAEMDKVRCESKISASSEAIDSLNRQMQELCLRLGAAEENIKSRDNELEELKT  131

Query  813  ekekmeeYFRDEHNKATGIIAEKDVYF  893
            EKE+M++ + DE  +   +I EKD   
Sbjct  132  EKEQMKKCYLDEQCRTASLIEEKDAMI  158



>ref|NP_001052952.2| Os04g0452500 [Oryza sativa Japonica Group]
 dbj|BAF14866.2| Os04g0452500 [Oryza sativa Japonica Group]
Length=829

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 103/163 (63%), Gaps = 11/163 (7%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKK  467
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++ ++KL++
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTHTKLRR  75

Query  468  LTEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQ  647
             TE I +LE KLQ A NENAKLKVKQ ED KLW GLDSK SSTKTLC+QLTETLQ LA Q
Sbjct  76   ATEQINLLEAKLQQAVNENAKLKVKQTEDSKLWQGLDSKVSSTKTLCNQLTETLQQLASQ  135

Query  648  V-----------QEAEKNKAFFEDKLSASSVALHNLHDQMKAL  743
                        QE E+    ++++L AS   +   +  +K L
Sbjct  136  TERGKQEMLRIKQEKEEMDQSYKEQLYASDTTIREKNSLIKQL  178



>ref|XP_010459975.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Camelina 
sativa]
Length=797

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +3

Query  474  EDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQ  653
            E +  LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ
Sbjct  2    EHVYALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQ  61

Query  654  EAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmee  833
            +AEK+K FFE K + SS A+ +L+ QM+ +SL + + +  I +  KE +EL +EKE+ + 
Sbjct  62   DAEKDKDFFESKFNTSSEAMDSLNQQMQDMSLSLDAAKANITSRDKEFEELKLEKEQKDI  121

Query  834  YFRDEHNKATGIIAEKDVYFSR  899
            Y+ +E  +   II +KD   ++
Sbjct  122  YYLNEQCRTASIIEKKDAEITK  143



>ref|XP_010459970.1| PREDICTED: synaptonemal complex protein 1 isoform X3 [Camelina 
sativa]
Length=799

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +3

Query  474  EDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQ  653
            E +  LE+KLQNA+NENAKL+V+QKEDEKLW GL+SKFSSTK LCDQLTETLQHLA QVQ
Sbjct  2    EHVYALEDKLQNAFNENAKLRVRQKEDEKLWRGLESKFSSTKALCDQLTETLQHLASQVQ  61

Query  654  EAEKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETI  776
            +AEK K FFE K + SS A+ +L+ QM+ +SLR+ + +E I
Sbjct  62   DAEKEKDFFESKFNTSSEAIDSLNQQMQDMSLRLDAAKENI  102



>ref|XP_009106522.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Brassica 
rapa]
Length=803

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 100/138 (72%), Gaps = 0/138 (0%)
 Frame = +3

Query  480  IGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEA  659
            I  LEEKLQNA+NENAKL+V QKEDEKLW G++SKFSSTKTLCDQLTETLQHLA QVQEA
Sbjct  4    ILALEEKLQNAFNENAKLRVMQKEDEKLWRGMESKFSSTKTLCDQLTETLQHLASQVQEA  63

Query  660  EKNKAFFEDKLSASSVALHNLHDQMKALSLRVKSLEETIRNCgkelkelgvekekmeeYF  839
            EK+K  FE K   S+  + +L  QM+ LS R+ + EE I+   KEL+EL +EKE+ E  +
Sbjct  64   EKDKELFESKFFTSAEVIDSLKQQMEDLSSRLVAAEENIKRREKELEELKLEKEQTENSY  123

Query  840  RDEHNKATGIIAEKDVYF  893
             +E  +   ++ EKD   
Sbjct  124  LNEQCRTANLLKEKDAMI  141



>emb|CAE75876.1| OSJNBa0086B14.27 [Oryza sativa Japonica Group]
Length=920

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 105/189 (56%), Gaps = 26/189 (14%)
 Frame = +3

Query  288  KSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLA--YSKL  461
            +SL  S S  A + +          + GSF NLK+TAEKLVKEQAS +TDL++   +S  
Sbjct  16   RSLAGSTSTAAKAPNPKPSSDIGGSTYGSFANLKITAEKLVKEQASVKTDLEMTVYFSAF  75

Query  462  KKLTEDIG------------------------VLEEKLQNAYNENAKLKVKQKEDEKLWN  569
              +  +                          + E KLQ A NENAKLKVKQ ED KLW 
Sbjct  76   TIIYGNFTGWVYGNIIFTVVIFHGANVLVISWIKEAKLQQAVNENAKLKVKQTEDSKLWQ  135

Query  570  GLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNLHDQMKALSL  749
            GLDSK SSTKTLC+QLTETLQ LA Q + AE++K FFE+ L  +S A    +  +   S+
Sbjct  136  GLDSKVSSTKTLCNQLTETLQQLASQTERAEEDKKFFEEILGKNSKAFEEFNCLLHDSSI  195

Query  750  RVKSLEETI  776
            +++  E+ I
Sbjct  196  KLECAEQMI  204



>ref|XP_009104586.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Brassica 
rapa]
Length=778

 Score =   112 bits (279),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  543  QKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKAFFEDKLSASSVALHNL  722
            QKEDEKLW G++SKFSSTKTLCDQLTETLQHLA QVQEAEK+K FFE K S S+  + +L
Sbjct  2    QKEDEKLWRGMESKFSSTKTLCDQLTETLQHLASQVQEAEKDKEFFESKFSTSAETIDSL  61

Query  723  HDQMKALSLRVKSLEETIRN  782
              QM+ LS+R+ S EE I++
Sbjct  62   KQQMQDLSVRLSSAEEDIKS  81



>gb|KHF99250.1| Synaptonemal complex 1 -like protein [Gossypium arboreum]
 gb|KHG21251.1| Synaptonemal complex 1 -like protein [Gossypium arboreum]
Length=749

 Score =   108 bits (271),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +3

Query  474  EDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQ  653
            E I VLEEKLQNA+NENAKLKVKQKEDEKLW GL+SKFSSTKTLCDQLTETL HLA Q+Q
Sbjct  2    EHIRVLEEKLQNAFNENAKLKVKQKEDEKLWKGLESKFSSTKTLCDQLTETLHHLASQIQ  61



>ref|XP_002987715.1| hypothetical protein SELMODRAFT_426465 [Selaginella moellendorffii]
 gb|EFJ11290.1| hypothetical protein SELMODRAFT_426465 [Selaginella moellendorffii]
Length=496

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +3

Query  315  VAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLE  494
            V   +  P  +++  V   SF +LKLTAEK+++EQA  R+DL++A SKL K  E++  LE
Sbjct  35   VQQRIVRPPDIANPRV-GESFTHLKLTAEKMLQEQACVRSDLEIANSKLAKAEEELRALE  93

Query  495  EKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKA  674
             K Q   NENA LKVK  ED KLW  +++K SS     +Q+TETL  L  QVQ+AE  K 
Sbjct  94   AKNQEISNENAMLKVKHSEDTKLWTSVETKVSSASAFFEQITETLHALENQVQQAEATKK  153

Query  675  FFEDKL  692
              E++L
Sbjct  154  LVEERL  159



>ref|XP_002983174.1| hypothetical protein SELMODRAFT_422485 [Selaginella moellendorffii]
 gb|EFJ15516.1| hypothetical protein SELMODRAFT_422485 [Selaginella moellendorffii]
Length=496

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +3

Query  315  VAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYSKLKKLTEDIGVLE  494
            V   +  P  +++  V   SF +LKLTAEK+++EQA  ++DL++A SKL K  E++  LE
Sbjct  35   VQQRIVRPPDIANPRV-GESFTHLKLTAEKMLQEQACVKSDLEIANSKLAKAEEELRALE  93

Query  495  EKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQVQEAEKNKA  674
             K Q   NENA LKVK  ED KLW  +++K SS     +Q+TETL  L  QVQ+AE  K 
Sbjct  94   AKNQEISNENAMLKVKHSEDTKLWTSVEAKVSSASAFFEQITETLHALEIQVQQAEATKK  153

Query  675  FFEDKL  692
              E++L
Sbjct  154  LVEERL  159



>emb|CDY35024.1| BnaC06g13620D [Brassica napus]
Length=608

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  471  TEDIGVLEEKLQNAYNENAKLKVKQKEDEKLWNGLDSKFSSTKTLCDQLTETLQHLAGQV  650
            ++D    EEKLQNA NENAKL++ QKEDEKL   ++SKFS T+TL DQLTE LQHL  QV
Sbjct  33   SQDSFTAEEKLQNASNENAKLRLMQKEDEKLSRRMESKFSPTQTLADQLTENLQHLTSQV  92

Query  651  QE  656
            QE
Sbjct  93   QE  94



>ref|XP_010091769.1| hypothetical protein L484_000766 [Morus notabilis]
 gb|EXC37077.1| hypothetical protein L484_000766 [Morus notabilis]
Length=77

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLA  449
            D++K L  S SG A + S  +R   DSVS+GSF NLKLTAEKLVKEQAS +TDL++A
Sbjct  13   DQLKWLRGSVSGAAKTFSFSSRPPGDSVSSGSFANLKLTAEKLVKEQASVKTDLEMA  69



>ref|XP_010097774.1| hypothetical protein L484_004188 [Morus notabilis]
 gb|EXB71053.1| hypothetical protein L484_004188 [Morus notabilis]
Length=77

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLA  449
            D++KSL  S SG A + S  +    DSVS+GSF NLKLTAEKLVKEQAS +TDL++A
Sbjct  13   DQLKSLRGSVSGTAKTFSFSSHPPGDSVSSGSFANLKLTAEKLVKEQASVKTDLEMA  69



>ref|XP_006472610.1| PREDICTED: synaptonemal complex protein 1-like isoform X3 [Citrus 
sinensis]
Length=761

 Score = 66.2 bits (160),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 7/73 (10%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLAYS-  455
            D+ KSL+ S    A S S  +R S+DS+++GSF NLKLTAEKLVKEQAS +TDL++A   
Sbjct  13   DQFKSLSRS----AKSFSFSSRPSTDSLTSGSFANLKLTAEKLVKEQASVKTDLEMAVRR  68

Query  456  --KLKKLTEDIGV  488
              ++ KL E  G+
Sbjct  69   NWRISKLRERKGI  81



>ref|XP_004301922.1| PREDICTED: synaptonemal complex protein 1-like [Fragaria vesca 
subsp. vesca]
Length=766

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  279  DRVKSLTASRSGVAHSLSIPARVSSDSVSAGSFVNLKLTAEKLVKEQASARTDLQLA  449
            D+ KSL+ S SG        +    +S S+GSF NLKLTAEKLVKEQAS +TDL++A
Sbjct  13   DQFKSLSKSASGGPPKTFAYSSRPLESTSSGSFANLKLTAEKLVKEQASVKTDLEMA  69



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1838885864684