BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23542_g1_i4 len=534 path=[5023:0-251 6743:252-252 5348:253-320
5415:321-386 4936:387-443 5536:444-533]

Length=534
                                                                      Score     E

ref|XP_009768583.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    131   1e-32   
ref|XP_010326622.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    127   3e-31   
ref|XP_009615945.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    127   3e-31   
ref|XP_006358437.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    123   8e-30   
ref|XP_011090491.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    120   2e-28   
ref|XP_010102337.1|  tRNA-specific 2-thiouridylase mnmA                 119   6e-28   
ref|XP_004142116.1|  PREDICTED: tRNA-specific 2-thiouridylase Mnm...    115   7e-27   
ref|XP_002282827.2|  PREDICTED: mitochondrial tRNA-specific 2-thi...    115   9e-27   Vitis vinifera
ref|XP_008449720.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    114   2e-26   
emb|CDP04153.1|  unnamed protein product                                114   3e-26   
ref|XP_006470603.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    114   3e-26   
gb|KDO61266.1|  hypothetical protein CISIN_1g042717mg                   113   3e-26   
ref|XP_010045015.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    112   7e-26   
ref|XP_010045014.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    112   9e-26   
gb|KCW87153.1|  hypothetical protein EUGRSUZ_B03681                     111   1e-25   
ref|XP_008238179.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    111   3e-25   
gb|KHN25243.1|  GTPase Der                                              111   1e-24   
ref|XP_006420996.1|  hypothetical protein CICLE_v10006706mg             109   1e-24   
gb|EYU26175.1|  hypothetical protein MIMGU_mgv1a004622mg                109   1e-24   
ref|XP_002513510.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-m...    108   2e-24   Ricinus communis
ref|XP_007015042.1|  Transferases,tRNA-methyltransferases               109   5e-24   
ref|XP_008385559.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    107   9e-24   
ref|XP_007209892.1|  hypothetical protein PRUPE_ppa004048mg             107   1e-23   
ref|XP_006590965.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   1e-23   
gb|KDP22087.1|  hypothetical protein JCGZ_25918                         106   1e-23   
ref|XP_004507093.1|  PREDICTED: tRNA-specific 2-thiouridylase Mnm...    106   1e-23   
gb|KDO44892.1|  hypothetical protein CISIN_1g0484031mg                  103   1e-23   
ref|XP_003539065.2|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   2e-23   
gb|KHN21906.1|  tRNA-specific 2-thiouridylase mnmA                      105   2e-23   
ref|XP_011006202.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   3e-23   
ref|XP_011045440.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   3e-23   
ref|XP_008344848.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    106   3e-23   
ref|XP_009347315.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   4e-23   
gb|KHG00493.1|  tRNA-specific 2-thiouridylase mnmA                      104   5e-23   
ref|XP_007132016.1|  hypothetical protein PHAVU_011G059600g             103   5e-23   
ref|XP_009376883.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   5e-23   
ref|XP_009376884.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    105   5e-23   
ref|XP_004301461.1|  PREDICTED: tRNA-specific 2-thiouridylase Mnm...    104   6e-23   
ref|XP_007132017.1|  hypothetical protein PHAVU_011G059600g             103   8e-23   
ref|XP_002314072.1|  tRNA methyl transferase family protein           98.2    9e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008385561.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    103   1e-22   
ref|XP_002298404.2|  hypothetical protein POPTR_0001s26620g             103   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008385560.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    103   2e-22   
ref|XP_010673635.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    101   4e-22   
ref|XP_009375053.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    102   5e-22   
ref|XP_009107198.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    101   6e-22   
ref|XP_009375052.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    102   6e-22   
ref|XP_009375051.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    102   6e-22   
emb|CDY65470.1|  BnaA08g29550D                                          101   6e-22   
ref|XP_010257320.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    102   7e-22   
gb|KEH30214.1|  tRNA-specific 2-thiouridylase MnmA                      100   2e-21   
ref|XP_010673633.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...    100   2e-21   
ref|XP_002894309.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-m...  99.4    5e-21   
ref|XP_010461957.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  99.0    8e-21   
gb|AAD30642.1|AC006085_15  Unknown protein                            97.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144914.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  97.8    1e-20   
ref|NP_175542.2|  tRNA (5-methylaminomethyl-2-thiouridylate)-meth...  97.8    2e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95081.1|  hypothetical protein                                 97.4    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393065.1|  hypothetical protein EUTSA_v10011432mg           97.4    2e-20   
emb|CDY03630.1|  BnaC03g68890D                                        97.4    2e-20   
ref|XP_010479591.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  97.4    3e-20   
ref|XP_006307321.1|  hypothetical protein CARUB_v10008942mg           97.1    3e-20   
gb|KFK35862.1|  hypothetical protein AALP_AA4G046600                  97.1    3e-20   
ref|XP_006280360.1|  hypothetical protein CARUB_v10026287mg           97.1    3e-20   
ref|XP_010500699.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  96.7    4e-20   
emb|CDY35562.1|  BnaC05g27190D                                        95.5    8e-20   
emb|CDY29626.1|  BnaA05g15440D                                        95.1    2e-19   
ref|XP_006850208.1|  hypothetical protein AMTR_s00022p00251260        94.0    6e-19   
ref|XP_002468413.1|  hypothetical protein SORBIDRAFT_01g045520        90.9    4e-18   Sorghum bicolor [broomcorn]
tpg|DAA43648.1|  TPA: hypothetical protein ZEAMMB73_761275            88.2    5e-18   
gb|EPS68247.1|  hypothetical protein M569_06524                       86.7    6e-18   
gb|ACN25178.1|  unknown                                               89.0    6e-18   Zea mays [maize]
ref|XP_006649485.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  89.4    2e-17   
dbj|BAK01046.1|  predicted protein                                    89.4    2e-17   
gb|ACG45558.1|  tRNA methyltransferase                                89.4    2e-17   Zea mays [maize]
ref|NP_001131207.1|  uncharacterized protein LOC100192515             89.0    2e-17   Zea mays [maize]
ref|XP_004985520.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  88.6    3e-17   
gb|EMT11416.1|  tRNA-specific 2-thiouridylase mnmA                    88.6    4e-17   
gb|EEC74610.1|  hypothetical protein OsI_10221                        88.2    4e-17   Oryza sativa Indica Group [Indian rice]
gb|ADE77257.1|  unknown                                               86.3    5e-17   
ref|XP_003558694.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  87.4    6e-17   
ref|NP_001049129.1|  Os03g0174600                                     87.4    8e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407701.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  86.3    1e-16   
ref|XP_009407675.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  86.7    1e-16   
ref|XP_008801937.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  86.7    2e-16   
ref|XP_010519263.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  84.0    1e-15   
ref|XP_010906767.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  83.6    2e-15   
ref|XP_010906766.1|  PREDICTED: mitochondrial tRNA-specific 2-thi...  83.6    2e-15   
ref|XP_010270932.1|  PREDICTED: uncharacterized protein LOC104607...  76.3    7e-14   
ref|XP_002991299.1|  hypothetical protein SELMODRAFT_44688            64.7    3e-09   
ref|XP_002987902.1|  hypothetical protein SELMODRAFT_44690            63.9    6e-09   
ref|XP_001770315.1|  predicted protein                                60.8    5e-08   
ref|XP_002509048.1|  predicted protein                                61.2    6e-08   Micromonas commoda
ref|XP_003061478.1|  predicted protein                                59.3    2e-07   
ref|XP_003082000.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-m...  56.6    2e-06   
ref|XP_001420484.1|  predicted protein                                56.2    2e-06   Ostreococcus lucimarinus CCE9901
ref|XP_001692691.1|  predicted protein                                53.1    2e-05   Chlamydomonas reinhardtii
ref|WP_014561596.1|  tRNA (5-methylaminomethyl-2-thiouridylate)-m...  52.8    3e-05   
ref|XP_005650227.1|  5-methylaminomethyl-2-thiouridylate-methyltr...  50.4    2e-04   
gb|EKD23339.1|  hypothetical protein ACD_82C00111G0003                46.6    2e-04   
ref|XP_005843929.1|  hypothetical protein CHLNCDRAFT_139672           48.5    8e-04   



>ref|XP_009768583.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Nicotiana 
sylvestris]
Length=488

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FYNCSLAMEVD++GQE+AVV  +EDDQGLA GQFAAFY+GR CIGSGVILESWD
Sbjct  390  VRHGPGFYNCSLAMEVDEHGQEVAVVRISEDDQGLAAGQFAAFYNGRTCIGSGVILESWD  449

Query  285  DQGYPVCERALD  250
            DQGYP+CERAL+
Sbjct  450  DQGYPICERALE  461



>ref|XP_010326622.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Solanum 
lycopersicum]
Length=484

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FYNCSL MEVD +GQE+AVV  + DDQGLA GQFAAFYDGR CIGSG+ILESWD
Sbjct  386  VRHGPGFYNCSLVMEVDQHGQEVAVVRLSGDDQGLAAGQFAAFYDGRTCIGSGIILESWD  445

Query  285  DQGYPVCERALD  250
            DQGYP+CERAL+
Sbjct  446  DQGYPICERALE  457



>ref|XP_009615945.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009615946.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FYNCSL +EVD++GQE+AVV  +EDDQGLA GQFAAFYDGR CIGSGVILESWD
Sbjct  390  VRHGPGFYNCSLVIEVDEHGQEVAVVRISEDDQGLAAGQFAAFYDGRTCIGSGVILESWD  449

Query  285  DQGYPVCERALD  250
            DQGYP+C RAL+
Sbjct  450  DQGYPICARALE  461



>ref|XP_006358437.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Solanum tuberosum]
Length=488

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P+FY+CSL MEVD +GQE+AVV  + DDQGLA GQFAAFY+GR CIGSG+ILESWD
Sbjct  390  VRHGPSFYDCSLVMEVDQHGQEVAVVRLSGDDQGLAAGQFAAFYNGRTCIGSGIILESWD  449

Query  285  DQGYPVCERALD  250
            DQGYP+CE+AL+
Sbjct  450  DQGYPICEKALE  461



>ref|XP_011090491.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Sesamum 
indicum]
Length=604

 Score =   120 bits (302),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FYNC +A+EV+ NG EIAVV  +EDDQGLA GQFAAFY    CIGSGVILESWD
Sbjct  399  VRHGPGFYNCDVAIEVNGNGHEIAVVKLSEDDQGLAAGQFAAFYQESTCIGSGVILESWD  458

Query  285  DQGYPVCERALD  250
            DQG+PVC RAL+
Sbjct  459  DQGFPVCARALE  470



>ref|XP_010102337.1| tRNA-specific 2-thiouridylase mnmA [Morus notabilis]
 gb|EXB93298.1| tRNA-specific 2-thiouridylase mnmA [Morus notabilis]
Length=580

 Score =   119 bits (298),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDN-GQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNCS  ME  +N G+++AVV  +EDDQGLA GQFAAFY G++C+GSG+ILESW
Sbjct  436  VRHGPGFYNCSFTMESGENSGEDVAVVQLSEDDQGLAVGQFAAFYQGKSCLGSGIILESW  495

Query  288  DDQGYPVCERALD  250
            DDQG+PVCE+AL+
Sbjct  496  DDQGFPVCEKALE  508



>ref|XP_004142116.1| PREDICTED: tRNA-specific 2-thiouridylase MnmA-like [Cucumis sativus]
 ref|XP_004169433.1| PREDICTED: tRNA-specific 2-thiouridylase MnmA-like [Cucumis sativus]
 gb|KGN54175.1| hypothetical protein Csa_4G291390 [Cucumis sativus]
Length=538

 Score =   115 bits (289),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 63/73 (86%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P+FY+C+L ME  ++G E +AVV  +EDDQGLA GQFAAFY GR+CIGSGVILESW
Sbjct  388  VRHGPSFYSCNLTMEHSEDGHEDVAVVHLSEDDQGLAAGQFAAFYKGRSCIGSGVILESW  447

Query  288  DDQGYPVCERALD  250
            DDQG+PVC++A++
Sbjct  448  DDQGFPVCQKAIE  460



>ref|XP_002282827.2| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Vitis 
vinifera]
 emb|CBI16383.3| unnamed protein product [Vitis vinifera]
Length=544

 Score =   115 bits (288),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNCS  ME  ++G E +AVV  +EDDQGLA GQF AFY GR+CIGSGVILESW
Sbjct  394  VRHGPGFYNCSFTMEPGEDGHEDVAVVQLSEDDQGLAAGQFTAFYQGRSCIGSGVILESW  453

Query  288  DDQGYPVCERALD  250
            DDQG+PVC +AL+
Sbjct  454  DDQGFPVCAKALE  466



>ref|XP_008449720.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Cucumis 
melo]
Length=539

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+C+L ME + +G E +AVV  +EDDQGLA GQFAAFY GR+CIGSGVILESW
Sbjct  389  VRHGPGFYSCNLTMEHNKDGHEDVAVVHLSEDDQGLAAGQFAAFYKGRSCIGSGVILESW  448

Query  288  DDQGYPVCERALD  250
            DDQG+PVC++A++
Sbjct  449  DDQGFPVCQKAIE  461



>emb|CDP04153.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P+ Y+CSL ME D+ G  +AVV  +EDDQGLA GQ+AAFYDGR CIGSGVILESWD
Sbjct  408  VRHGPSIYDCSLKMEADERGDIVAVVRLSEDDQGLAAGQYAAFYDGRICIGSGVILESWD  467

Query  285  DQGYPVCERALD  250
            DQG+PVC +AL+
Sbjct  468  DQGFPVCAKALE  479



>ref|XP_006470603.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Citrus sinensis]
Length=525

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAME-VDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNC+L +E V+D G+ IAVV  +EDDQGLA GQFAAFY G  CIGSGVILESW
Sbjct  376  VRHGPGFYNCNLMIEHVEDGGENIAVVQLSEDDQGLAAGQFAAFYQGTRCIGSGVILESW  435

Query  288  DDQGYPVCERALD  250
            DDQG+PVCE+AL+
Sbjct  436  DDQGFPVCEKALE  448



>gb|KDO61266.1| hypothetical protein CISIN_1g042717mg, partial [Citrus sinensis]
Length=474

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAME-VDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNC+L +E V+D G+ IAVV  +EDDQGLA GQFAAFY G  CIGSGVILESW
Sbjct  325  VRHGPGFYNCNLMIEHVEDGGENIAVVQLSEDDQGLAAGQFAAFYQGTRCIGSGVILESW  384

Query  288  DDQGYPVCERALD  250
            DDQG+PVCE+AL+
Sbjct  385  DDQGFPVCEKALE  397



>ref|XP_010045015.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X2 [Eucalyptus grandis]
Length=467

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNCSL++E+ +NGQE +AVV   EDDQGLA GQF AFY  R CIGSGVILESW
Sbjct  370  VRHGPGFYNCSLSLELGENGQEDVAVVQLPEDDQGLAAGQFTAFYQDRTCIGSGVILESW  429

Query  288  DDQGYPVCERALD  250
            +DQG+PVC++AL+
Sbjct  430  NDQGFPVCQKALE  442



>ref|XP_010045014.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X1 [Eucalyptus grandis]
Length=495

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNCSL++E+ +NGQE +AVV   EDDQGLA GQF AFY  R CIGSGVILESW
Sbjct  398  VRHGPGFYNCSLSLELGENGQEDVAVVQLPEDDQGLAAGQFTAFYQDRTCIGSGVILESW  457

Query  288  DDQGYPVCERALD  250
            +DQG+PVC++AL+
Sbjct  458  NDQGFPVCQKALE  470



>gb|KCW87153.1| hypothetical protein EUGRSUZ_B03681 [Eucalyptus grandis]
Length=408

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNCSL++E+ +NGQE +AVV   EDDQGLA GQF AFY  R CIGSGVILESW
Sbjct  311  VRHGPGFYNCSLSLELGENGQEDVAVVQLPEDDQGLAAGQFTAFYQDRTCIGSGVILESW  370

Query  288  DDQGYPVCERALD  250
            +DQG+PVC++AL+
Sbjct  371  NDQGFPVCQKALE  383



>ref|XP_008238179.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X1 [Prunus mume]
Length=537

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME    G E +AVV  +EDDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  387  VRHGPGFRNCSLIMEPGAYGHEDVAVVHLSEDDQGLAAGQFAAFYQGRTCLGSGVILESW  446

Query  288  DDQGYPVCERALD  250
            DDQG+PVC RAL+
Sbjct  447  DDQGFPVCARALE  459



>gb|KHN25243.1| GTPase Der [Glycine soja]
Length=957

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQ-EIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL MEV+ +GQ   AVV  +EDDQGLA GQFAAFY+GR CIGSGVILE W
Sbjct  259  VRHGPGFYDCSLQMEVEGDGQCRSAVVCISEDDQGLAAGQFAAFYEGRTCIGSGVILEFW  318

Query  288  DDQGYPVCERALD  250
            DDQ +PVC +AL+
Sbjct  319  DDQSFPVCTKALE  331



>ref|XP_006420996.1| hypothetical protein CICLE_v10006706mg, partial [Citrus clementina]
 gb|ESR34236.1| hypothetical protein CICLE_v10006706mg, partial [Citrus clementina]
Length=537

 Score =   109 bits (273),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  447  FYNCSLAME-VDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWDDQGYP  271
            FYNCSL +E  +D G++IAVV  +EDDQGLA GQFAAFY GR C+GSGVILE+WDDQG+P
Sbjct  374  FYNCSLTIEHCEDGGEDIAVVQLSEDDQGLAAGQFAAFYQGRRCLGSGVILEAWDDQGFP  433

Query  270  VCERALD  250
            VC++AL+
Sbjct  434  VCKKALE  440



>gb|EYU26175.1| hypothetical protein MIMGU_mgv1a004622mg [Erythranthe guttata]
Length=517

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P  YNC LA+E D NG EI VV  +EDDQGLA GQFAAFY    CIGSGVILESWD
Sbjct  399  VRHGPGLYNCDLAIEEDGNGDEIGVVKLSEDDQGLAAGQFAAFYQDSICIGSGVILESWD  458

Query  285  DQGYPVCERALD  250
            DQG+PVC +A++
Sbjct  459  DQGFPVCAKAIE  470



>ref|XP_002513510.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, 
putative [Ricinus communis]
 gb|EEF48913.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, 
putative [Ricinus communis]
Length=497

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 5/75 (7%)
 Frame = -1

Query  465  VRHCPNFYNCSLAME---VDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILE  295
            VRH P FYNCS+ +E   VDD  Q++A+V   EDDQGLA GQFAAFY GR CIGSGVILE
Sbjct  377  VRHGPGFYNCSVVIEPGEVDD--QDVAIVQLCEDDQGLAAGQFAAFYKGRTCIGSGVILE  434

Query  294  SWDDQGYPVCERALD  250
            SW+DQG+PVCERAL+
Sbjct  435  SWNDQGFPVCERALE  449



>ref|XP_007015042.1| Transferases,tRNA-methyltransferases [Theobroma cacao]
 gb|EOY32661.1| Transferases,tRNA-methyltransferases [Theobroma cacao]
Length=1075

 Score =   109 bits (273),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = -1

Query  471   F*VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILE  295
             F VRH P FYNCS  +   + G E +AVV   EDDQGLA GQFAAFY+G+ CIGSGVILE
Sbjct  959   FIVRHGPGFYNCSFELVSGEYGSEDVAVVCLHEDDQGLAAGQFAAFYEGQTCIGSGVILE  1018

Query  294   SWDDQGYPVCERALD  250
             SWDDQG+PVC +AL+
Sbjct  1019  SWDDQGFPVCAKALE  1033



>ref|XP_008385559.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X1 [Malus domestica]
Length=549

 Score =   107 bits (267),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME  ++G E +AVV  ++DDQGLA GQFAAFY G  C+GSGVILESW
Sbjct  389  VRHGPAFCNCSLIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGXTCLGSGVILESW  448

Query  288  DDQGYPVCERALD  250
            DDQG+PVC RA++
Sbjct  449  DDQGFPVCARAIE  461



>ref|XP_007209892.1| hypothetical protein PRUPE_ppa004048mg [Prunus persica]
 gb|EMJ11091.1| hypothetical protein PRUPE_ppa004048mg [Prunus persica]
Length=533

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME    G E +AVV  +EDDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  383  VRHGPGFRNCSLIMEPGAYGHEDVAVVHLSEDDQGLAAGQFAAFYQGRTCLGSGVILESW  442

Query  288  DDQGYPVCERALD  250
            DDQG+PVC RAL+
Sbjct  443  DDQGFPVCARALE  455



>ref|XP_006590965.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X2 [Glycine max]
Length=392

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQ-EIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL MEV+ +GQ   AVV  +EDDQGLA GQFAAFY+GR CIGSGVILE W
Sbjct  272  VRHGPGFYDCSLQMEVEADGQCHSAVVRISEDDQGLAAGQFAAFYEGRTCIGSGVILEFW  331

Query  288  DDQGYPVCERALD  250
            DDQ +PVC +AL+
Sbjct  332  DDQSFPVCTKALE  344



>gb|KDP22087.1| hypothetical protein JCGZ_25918 [Jatropha curcas]
Length=505

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDD-NGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+ +   +   +++AVV  TEDDQGLA GQFAAFY GR CIGSGVILESW
Sbjct  386  VRHGPGFYDCSVVINPGEVESEDVAVVRLTEDDQGLAAGQFAAFYQGRTCIGSGVILESW  445

Query  288  DDQGYPVCERALD  250
            DDQG+P+CERAL+
Sbjct  446  DDQGFPICERALE  458



>ref|XP_004507093.1| PREDICTED: tRNA-specific 2-thiouridylase MnmA-like [Cicer arietinum]
Length=484

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVD-DNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL ME++ +N  + AVV  +EDDQGLA GQF AFY+GR CIGSGVILESW
Sbjct  375  VRHGPGFYDCSLQMELEGENPIDSAVVRISEDDQGLAAGQFTAFYEGRTCIGSGVILESW  434

Query  288  DDQGYPVCERALD  250
            DDQG+PVC +AL+
Sbjct  435  DDQGFPVCTKALE  447



>gb|KDO44892.1| hypothetical protein CISIN_1g0484031mg, partial [Citrus sinensis]
Length=235

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 1/67 (1%)
 Frame = -1

Query  447  FYNCSLAME-VDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWDDQGYP  271
            FYNCSL +E  +D G++IAVV  +EDDQGLA GQFAAFY GR C+GSGVILE+WDDQG+P
Sbjct  89   FYNCSLTIEHCEDGGEDIAVVQLSEDDQGLAAGQFAAFYQGRRCLGSGVILEAWDDQGFP  148

Query  270  VCERALD  250
            VC++AL+
Sbjct  149  VCKKALE  155



>ref|XP_003539065.2| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X1 [Glycine max]
Length=502

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQ-EIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL MEV+ +GQ   AVV  +EDDQGLA GQFAAFY+GR CIGSGVILE W
Sbjct  382  VRHGPGFYDCSLQMEVEADGQCHSAVVRISEDDQGLAAGQFAAFYEGRTCIGSGVILEFW  441

Query  288  DDQGYPVCERALD  250
            DDQ +PVC +AL+
Sbjct  442  DDQSFPVCTKALE  454



>gb|KHN21906.1| tRNA-specific 2-thiouridylase mnmA [Glycine soja]
Length=501

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQ-EIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL MEV+ +GQ   AVV  +EDDQGLA GQFAAFY+GR CIGSGVILE W
Sbjct  381  VRHGPGFYDCSLQMEVEADGQCHSAVVRISEDDQGLAAGQFAAFYEGRTCIGSGVILEFW  440

Query  288  DDQGYPVCERALD  250
            DDQ +PVC +AL+
Sbjct  441  DDQSFPVCTKALE  453



>ref|XP_011006202.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Populus 
euphratica]
Length=512

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEV-DDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+ +E+ +D+ +E+ VV   EDDQGLA GQF AFY GR CIGSGVILESW
Sbjct  392  VRHGPTFYDCSVKIELGEDSPEEVVVVHLCEDDQGLAAGQFTAFYQGRTCIGSGVILESW  451

Query  288  DDQGYPVCERALD  250
            DD+G+PVC++AL+
Sbjct  452  DDKGFPVCQKALE  464



>ref|XP_011045440.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Populus euphratica]
Length=512

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEV-DDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+ +E+ +D+ +E+ VV   EDDQGLA GQF AFY GR CIGSGVILESW
Sbjct  392  VRHGPTFYDCSVKIELGEDSPEEVVVVHLCEDDQGLAAGQFTAFYQGRTCIGSGVILESW  451

Query  288  DDQGYPVCERALD  250
            DD+G+PVC++AL+
Sbjct  452  DDKGFPVCQKALE  464



>ref|XP_008344848.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Malus domestica]
Length=581

 Score =   106 bits (264),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F  CS  ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  458  VRHGPAFCKCSFIMEXGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGRTCLGSGVILESW  517

Query  288  DDQGYPVCERA  256
            DDQG+PVC RA
Sbjct  518  DDQGFPVCARA  528



>ref|XP_009347315.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Pyrus x bretschneideri]
 ref|XP_009347316.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Pyrus x bretschneideri]
Length=588

 Score =   105 bits (263),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F  CS  ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  391  VRHGPAFCKCSFIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGRTCLGSGVILESW  450

Query  288  DDQGYPVCERA  256
            DDQG+PVC RA
Sbjct  451  DDQGFPVCARA  461



>gb|KHG00493.1| tRNA-specific 2-thiouridylase mnmA [Gossypium arboreum]
Length=490

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FYNC+  ME  ++G + IAVV   EDDQGLA GQFAAFY+G+ CIGSGVILESW
Sbjct  394  VRHGPGFYNCNFKMEHGEDGNDDIAVVQLYEDDQGLAAGQFAAFYEGQTCIGSGVILESW  453

Query  288  DDQGYPVCERALD  250
            DD+G+PVC +AL+
Sbjct  454  DDRGFPVCAKALE  466



>ref|XP_007132016.1| hypothetical protein PHAVU_011G059600g [Phaseolus vulgaris]
 gb|ESW04010.1| hypothetical protein PHAVU_011G059600g [Phaseolus vulgaris]
Length=380

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQ-EIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL MEV+ +GQ   AVV  +EDDQGLA GQFAAFY+GR C+GSGVILE W
Sbjct  272  VRHGPGFYDCSLQMEVEGDGQGHSAVVRISEDDQGLAAGQFAAFYEGRTCLGSGVILEFW  331

Query  288  DDQGYPVCERALD  250
            D+Q +PVC +AL+
Sbjct  332  DEQSFPVCTKALE  344



>ref|XP_009376883.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X1 [Pyrus x bretschneideri]
Length=579

 Score =   105 bits (262),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F  CS  ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  452  VRHGPAFCKCSFIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGRTCLGSGVILESW  511

Query  288  DDQGYPVCERA  256
            DDQG+PVC RA
Sbjct  512  DDQGFPVCARA  522



>ref|XP_009376884.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X2 [Pyrus x bretschneideri]
Length=578

 Score =   105 bits (262),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F  CS  ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  451  VRHGPAFCKCSFIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGRTCLGSGVILESW  510

Query  288  DDQGYPVCERA  256
            DDQG+PVC RA
Sbjct  511  DDQGFPVCARA  521



>ref|XP_004301461.1| PREDICTED: tRNA-specific 2-thiouridylase MnmA-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NC++ +E  ++G E +AVV  +EDDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  380  VRHGPRFCNCTVKIEHGEDGNEDVAVVSLSEDDQGLAAGQFAAFYQGRTCLGSGVILESW  439

Query  288  DDQGYPVCERALD  250
            DDQG+PVC +AL+
Sbjct  440  DDQGFPVCTKALE  452



>ref|XP_007132017.1| hypothetical protein PHAVU_011G059600g [Phaseolus vulgaris]
 gb|ESW04011.1| hypothetical protein PHAVU_011G059600g [Phaseolus vulgaris]
Length=488

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQ-EIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL MEV+ +GQ   AVV  +EDDQGLA GQFAAFY+GR C+GSGVILE W
Sbjct  380  VRHGPGFYDCSLQMEVEGDGQGHSAVVRISEDDQGLAAGQFAAFYEGRTCLGSGVILEFW  439

Query  288  DDQGYPVCERALD  250
            D+Q +PVC +AL+
Sbjct  440  DEQSFPVCTKALE  452



>ref|XP_002314072.1| tRNA methyl transferase family protein [Populus trichocarpa]
 gb|EEE88027.1| tRNA methyl transferase family protein [Populus trichocarpa]
Length=111

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 58/72 (81%), Gaps = 1/72 (1%)
 Frame = -1

Query  462  RHCPNFYNCSLAMEVDDNG-QEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            RH P FY+C + +E+  +G +E+AVV   EDDQGLA GQF AFY+GR C+ SGVILE+WD
Sbjct  32   RHGPAFYDCRVKVELGVHGHEEVAVVHLCEDDQGLAAGQFTAFYEGRTCLASGVILEAWD  91

Query  285  DQGYPVCERALD  250
            DQG+PVC++AL+
Sbjct  92   DQGFPVCQKALE  103



>ref|XP_008385561.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X3 [Malus domestica]
 ref|XP_008385563.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X3 [Malus domestica]
Length=439

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME  ++G E +AVV  ++DDQGLA GQFAAFY G  C+GSGVILESW
Sbjct  279  VRHGPAFCNCSLIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGXTCLGSGVILESW  338

Query  288  DDQGYPVCERALD  250
            DDQG+PVC RA++
Sbjct  339  DDQGFPVCARAIE  351



>ref|XP_002298404.2| hypothetical protein POPTR_0001s26620g [Populus trichocarpa]
 gb|EEE83209.2| hypothetical protein POPTR_0001s26620g [Populus trichocarpa]
Length=512

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEV-DDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+ +E+ +D+ +E+  V   EDDQGLA GQF AFY GR CIGSGVILESW
Sbjct  392  VRHGPTFYDCSVKIELGEDSPEEVVAVHLCEDDQGLAAGQFTAFYQGRTCIGSGVILESW  451

Query  288  DDQGYPVCERALD  250
            DD+G+PVC++AL+
Sbjct  452  DDKGFPVCQKALE  464



>ref|XP_008385560.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
isoform X2 [Malus domestica]
Length=522

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME  ++G E +AVV  ++DDQGLA GQFAAFY G  C+GSGVILESW
Sbjct  389  VRHGPAFCNCSLIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYQGXTCLGSGVILESW  448

Query  288  DDQGYPVCERALD  250
            DDQG+PVC RA++
Sbjct  449  DDQGFPVCARAIE  461



>ref|XP_010673635.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=378

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDN-GQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P+FY CSL + V +N   ++AVV  +EDDQGLA GQFAAFY G+ CIGSGVILE W
Sbjct  236  VRHGPSFYCCSLRIVVGENCDGDVAVVHLSEDDQGLAAGQFAAFYQGKMCIGSGVILEFW  295

Query  288  DDQGYPVCERALD  250
            DD+G+PVCE+AL+
Sbjct  296  DDEGFPVCEKALE  308



>ref|XP_009375053.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X3 [Pyrus x bretschneideri]
Length=512

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  379  VRHGPAFCNCSLIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYRGRTCLGSGVILESW  438

Query  288  DDQGYPVCERALD  250
            DDQG+P+C  AL+
Sbjct  439  DDQGFPMCAIALE  451



>ref|XP_009107198.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Brassica 
rapa]
Length=486

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME + +   +AVV   EDDQGLA GQFAAFY+G ACIGSGVILESWD
Sbjct  377  VRHGPGFYSCSFEMEAEGD---VAVVHLDEDDQGLAAGQFAAFYEGTACIGSGVILESWD  433

Query  285  DQGYPVCERAL  253
            DQ +PVCE+AL
Sbjct  434  DQCFPVCEKAL  444



>ref|XP_009375052.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X2 [Pyrus x bretschneideri]
Length=525

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  379  VRHGPAFCNCSLIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYRGRTCLGSGVILESW  438

Query  288  DDQGYPVCERALD  250
            DDQG+P+C  AL+
Sbjct  439  DDQGFPMCAIALE  451



>ref|XP_009375051.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X1 [Pyrus x bretschneideri]
Length=527

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQE-IAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P F NCSL ME  ++G E +AVV  ++DDQGLA GQFAAFY GR C+GSGVILESW
Sbjct  379  VRHGPAFCNCSLIMEPGEDGHEDVAVVHLSQDDQGLAAGQFAAFYRGRTCLGSGVILESW  438

Query  288  DDQGYPVCERALD  250
            DDQG+P+C  AL+
Sbjct  439  DDQGFPMCAIALE  451



>emb|CDY65470.1| BnaA08g29550D [Brassica napus]
Length=490

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME + +   +AVV   EDDQGLA GQFAAFY+G ACIGSGVILESWD
Sbjct  381  VRHGPGFYSCSFEMEAEGD---VAVVHLDEDDQGLAAGQFAAFYEGTACIGSGVILESWD  437

Query  285  DQGYPVCERAL  253
            DQ +PVCE+AL
Sbjct  438  DQCFPVCEKAL  448



>ref|XP_010257320.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Nelumbo nucifera]
Length=531

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEI-AVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL ME  ++G    AVV  +EDDQGLA GQFAAFY G+ CIGSGVILE W
Sbjct  385  VRHGPGFYDCSLIMETGEDGDRTSAVVHLSEDDQGLAAGQFAAFYQGKTCIGSGVILECW  444

Query  288  DDQGYPVCERAL  253
            D QG+PVC +AL
Sbjct  445  DSQGFPVCAKAL  456



>gb|KEH30214.1| tRNA-specific 2-thiouridylase MnmA [Medicago truncatula]
Length=484

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEV-DDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CSL ME+ +DN  + AVV  +EDDQGLA GQF AFY+GR CIGSGVILES 
Sbjct  375  VRHGPGFYDCSLQMELREDNSIDSAVVCISEDDQGLAAGQFTAFYEGRICIGSGVILESG  434

Query  288  DDQGYPVCERALD  250
            DDQ +PVC +AL+
Sbjct  435  DDQSFPVCAKALE  447



>ref|XP_010673633.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDN-GQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P+FY CSL + V +N   ++AVV  +EDDQGLA GQFAAFY G+ CIGSGVILE W
Sbjct  392  VRHGPSFYCCSLRIVVGENCDGDVAVVHLSEDDQGLAAGQFAAFYQGKMCIGSGVILEFW  451

Query  288  DDQGYPVCERALD  250
            DD+G+PVCE+AL+
Sbjct  452  DDEGFPVCEKALE  464



>ref|XP_002894309.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH70568.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P+FY+CS  ME D +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  391  VRHGPSFYSCSFEMEADGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  447

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  448  DQCFPVCAKAL  458



>ref|XP_010461957.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Camelina sativa]
Length=498

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME   N   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  388  VRHGPGFYSCSFEMEAKGN---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  444

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  445  DQCFPVCAKAL  455



>gb|AAD30642.1|AC006085_15 Unknown protein [Arabidopsis thaliana]
 gb|ABM06024.1| At1g51310 [Arabidopsis thaliana]
Length=421

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME D +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  312  VRHGPGFYSCSFEMEGDGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  368

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  369  DQCFPVCAKAL  379



>ref|XP_009144914.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Brassica rapa]
Length=476

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME D     +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  379  VRHGPGFYSCSFEMEGD-----VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  433

Query  285  DQGYPVCERALD  250
            DQ +PVC +AL+
Sbjct  434  DQCFPVCAKALE  445



>ref|NP_175542.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Arabidopsis thaliana]
 gb|AEE32649.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Arabidopsis thaliana]
Length=497

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME D +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  388  VRHGPGFYSCSFEMEGDGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  444

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  445  DQCFPVCAKAL  455



>dbj|BAD95081.1| hypothetical protein [Arabidopsis thaliana]
Length=497

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME D +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  388  VRHGPGFYSCSFEMEGDGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  444

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  445  DQCFPVCAKAL  455



>ref|XP_006393065.1| hypothetical protein EUTSA_v10011432mg [Eutrema salsugineum]
 gb|ESQ30351.1| hypothetical protein EUTSA_v10011432mg [Eutrema salsugineum]
Length=488

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME   +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  379  VRHGPGFYSCSFEMEAQGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  435

Query  285  DQGYPVCERALD  250
            DQ +PVC +AL+
Sbjct  436  DQCFPVCAKALE  447



>emb|CDY03630.1| BnaC03g68890D [Brassica napus]
Length=492

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME + +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  383  VRHGPGFYSCSFEMEAEGD---VAVVHLDEDDQGLAAGQFAAFYEGTICIGSGVILESWD  439

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  440  DQCFPVCAKAL  450



>ref|XP_010479591.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Camelina 
sativa]
Length=497

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME   +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  388  VRHGPGFYSCSFGMEAKGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  444

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  445  DQCFPVCAKAL  455



>ref|XP_006307321.1| hypothetical protein CARUB_v10008942mg [Capsella rubella]
 gb|EOA40219.1| hypothetical protein CARUB_v10008942mg [Capsella rubella]
Length=496

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME   +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  387  VRHGPGFYSCSFEMETKGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  443

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  444  DQCFPVCAKAL  454



>gb|KFK35862.1| hypothetical protein AALP_AA4G046600 [Arabis alpina]
Length=487

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME + +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  383  VRHGPGFYSCSFEMESEGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  439

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  440  DQCFPVCAKAL  450



>ref|XP_006280360.1| hypothetical protein CARUB_v10026287mg [Capsella rubella]
 gb|EOA13258.1| hypothetical protein CARUB_v10026287mg [Capsella rubella]
Length=494

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME   +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  385  VRHGPGFYSCSFEMEAKGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  441

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  442  DQCFPVCAKAL  452



>ref|XP_010500699.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Camelina sativa]
Length=498

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME   +   +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  389  VRHGPGFYSCSFEMEAKGD---VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  445

Query  285  DQGYPVCERAL  253
            DQ +PVC +AL
Sbjct  446  DQCFPVCAKAL  456



>emb|CDY35562.1| BnaC05g27190D [Brassica napus]
Length=457

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 5/72 (7%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME D     +AVV   EDDQGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  373  VRHGPGFYSCSFEMEGD-----VAVVHLDEDDQGLAAGQFAAFYEGTTCIGSGVILESWD  427

Query  285  DQGYPVCERALD  250
             Q +PVC +AL+
Sbjct  428  GQCFPVCAKALE  439



>emb|CDY29626.1| BnaA05g15440D [Brassica napus]
Length=512

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 5/72 (7%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+CS  ME D     +AVV   ED QGLA GQFAAFY+G  CIGSGVILESWD
Sbjct  415  VRHGPGFYSCSFEMEGD-----VAVVHLDEDAQGLAAGQFAAFYEGTTCIGSGVILESWD  469

Query  285  DQGYPVCERALD  250
            DQ +PVC +AL+
Sbjct  470  DQCFPVCAKALE  481



>ref|XP_006850208.1| hypothetical protein AMTR_s00022p00251260 [Amborella trichopoda]
 gb|ERN11789.1| hypothetical protein AMTR_s00022p00251260 [Amborella trichopoda]
Length=565

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVD-DNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+C+  +E   D  ++ A++  +EDDQGLA GQFAAFY    CIGSG+ILESW
Sbjct  430  VRHGPCFYDCTFKIESRCDEHEDSALIHISEDDQGLAAGQFAAFYRKNVCIGSGIILESW  489

Query  288  DDQGYPVCERALDR  247
            DDQ + VC +AL+R
Sbjct  490  DDQNFSVCSKALER  503



>ref|XP_002468413.1| hypothetical protein SORBIDRAFT_01g045520 [Sorghum bicolor]
 gb|EER95411.1| hypothetical protein SORBIDRAFT_01g045520 [Sorghum bicolor]
Length=489

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C+L  E  +  ++  VV  +EDDQGLA GQFAAFY   +C+GSG+IL+SWD
Sbjct  384  VRHSPEFHDCTLIKEHTEENEDALVVHLSEDDQGLAAGQFAAFYSEHSCLGSGIILDSWD  443

Query  285  DQGYPVCERALD  250
               +PVC RAL+
Sbjct  444  KMSFPVCSRALE  455



>tpg|DAA43648.1| TPA: hypothetical protein ZEAMMB73_761275 [Zea mays]
Length=226

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C+L  E  +   +  VV   EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  121  VRHSPEFHDCTLVKERSEENGDALVVHLAEDDQGLAAGQFAAFYSENVCLGSGIILDSWD  180

Query  285  DQGYPVCERALD  250
               +PVC RAL+
Sbjct  181  KMSFPVCSRALE  192



>gb|EPS68247.1| hypothetical protein M569_06524 [Genlisea aurea]
Length=151

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 8/99 (8%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY+C + +E      E AVV   EDDQGLA GQ+AAFY    C+GSGVI +SWD
Sbjct  59   VRHGPGFYDCDMNVE-----GETAVVKLVEDDQGLAAGQYAAFYHESTCLGSGVIFDSWD  113

Query  285  DQGYPVCERALDRHVHMMIPTACLYRGPQPAPSSSLEST  169
            D GYP+  +ALD  +  ++    +  G +P    ++E+T
Sbjct  114  DGGYPIAAKALD--IAKLLRDKKVKLG-KPVKIRNMETT  149



>gb|ACN25178.1| unknown [Zea mays]
 tpg|DAA43647.1| TPA: hypothetical protein ZEAMMB73_761275 [Zea mays]
Length=329

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C+L  E  +   +  VV   EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  224  VRHSPEFHDCTLVKERSEENGDALVVHLAEDDQGLAAGQFAAFYSENVCLGSGIILDSWD  283

Query  285  DQGYPVCERALD  250
               +PVC RAL+
Sbjct  284  KMSFPVCSRALE  295



>ref|XP_006649485.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Oryza brachyantha]
Length=489

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C++  E     + I VV  +EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  385  VRHSPEFHHCTVTQEQTSENRVILVVHLSEDDQGLAAGQFAAFYRDNLCLGSGIILDSWD  444

Query  285  DQGYPVCERALD  250
            +  +PVC RAL+
Sbjct  445  EMNFPVCARALE  456



>dbj|BAK01046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = -1

Query  465  VRHCPNFYNCSLAME------VDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGV  304
            VRH P+F+NC++  E      V+ N  ++  V  +EDDQGLA GQFAAFY   AC+GSG+
Sbjct  381  VRHSPDFHNCTVTREQTEELVVNSNNGDVLAVRLSEDDQGLAAGQFAAFYRDSACLGSGI  440

Query  303  ILESWDDQGYPVCERALD  250
            IL+SWD+  +PVC +AL+
Sbjct  441  ILDSWDEMSFPVCAKALE  458



>gb|ACG45558.1| tRNA methyltransferase [Zea mays]
Length=486

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C+L  E  +   +  VV   EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  381  VRHSPEFHDCTLVKERSEENGDALVVHLAEDDQGLAAGQFAAFYSENVCLGSGIILDSWD  440

Query  285  DQGYPVCERALD  250
               +PVC RAL+
Sbjct  441  KMSFPVCSRALE  452



>ref|NP_001131207.1| uncharacterized protein LOC100192515 [Zea mays]
 gb|ACF79520.1| unknown [Zea mays]
 tpg|DAA43645.1| TPA: tRNA methyltransferase [Zea mays]
Length=486

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C+L  E  +   +  VV   EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  381  VRHSPEFHDCTLVKERSEENGDALVVHLAEDDQGLAAGQFAAFYSENVCLGSGIILDSWD  440

Query  285  DQGYPVCERALD  250
               +PVC RAL+
Sbjct  441  KMSFPVCSRALE  452



>ref|XP_004985520.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1-like 
[Setaria italica]
Length=488

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C++  E  +   ++ VV  +EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  384  VRHSPEFHDCTVTKEHTEENGDVLVVRLSEDDQGLAAGQFAAFYREDLCLGSGIILDSWD  443

Query  285  DQGYPVCERALD  250
            +  +PVC RAL+
Sbjct  444  EMSFPVCSRALE  455



>gb|EMT11416.1| tRNA-specific 2-thiouridylase mnmA [Aegilops tauschii]
Length=552

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P+F++C++  E  +   ++  V  +EDDQGLA GQFAAFY   AC+GSG+IL+SWD
Sbjct  381  VRHSPDFHDCTVTKEQTEENGDVLAVRLSEDDQGLAAGQFAAFYRDSACLGSGIILDSWD  440

Query  285  DQGYPVCERALD  250
            +  +PVC +AL+
Sbjct  441  EMSFPVCAKALE  452



>gb|EEC74610.1| hypothetical protein OsI_10221 [Oryza sativa Indica Group]
Length=488

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C++  E       I VV  +EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  384  VRHSPEFHDCTVTQEQTSENGVILVVRLSEDDQGLAAGQFAAFYRDNLCLGSGIILDSWD  443

Query  285  DQGYPVCERALD  250
            +  +PVC RAL+
Sbjct  444  EMNFPVCARALE  455



>gb|ADE77257.1| unknown [Picea sitchensis]
Length=323

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 12/84 (14%)
 Frame = -1

Query  465  VRHCPNFYNCSLAM------------EVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRA  322
            VRH P FYNC + +             + +  QEIA+V  +EDDQGLA GQ+ AFY G  
Sbjct  192  VRHGPKFYNCHMELVKGNLYKENEHQSLGETAQEIAIVRLSEDDQGLAAGQYVAFYKGNT  251

Query  321  CIGSGVILESWDDQGYPVCERALD  250
            C+GSG+I++SW D  +PV  +AL+
Sbjct  252  CLGSGIIIDSWGDNNFPVSSKALE  275



>ref|XP_003558694.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Brachypodium 
distachyon]
Length=481

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F+NC++  E  +   ++  V  +EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  377  VRHSPEFHNCTVTREQTEESGDVLAVHLSEDDQGLAAGQFAAFYRDNTCLGSGIILDSWD  436

Query  285  DQGYPVCERALD  250
            +  +PVC  AL+
Sbjct  437  EMSFPVCANALE  448



>ref|NP_001049129.1| Os03g0174600 [Oryza sativa Japonica Group]
 gb|ABF94253.1| tRNA methyl transferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11043.1| Os03g0174600 [Oryza sativa Japonica Group]
 dbj|BAG95989.1| unnamed protein product [Oryza sativa Japonica Group]
Length=488

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P F++C++  E       I VV  +EDDQGLA GQFAAFY    C+GSG+IL+SWD
Sbjct  384  VRHSPEFHDCTVTQEQTSEHGVILVVRLSEDDQGLAAGQFAAFYRDNLCLGSGIILDSWD  443

Query  285  DQGYPVCERALD  250
            +  +PVC RAL+
Sbjct  444  EMNFPVCARALE  455



>ref|XP_009407701.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=405

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCS-LAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS +A+   D  ++  VV  +EDDQGLA GQFAAFY G  CIGSGVI++SW
Sbjct  311  VRHGPGFYDCSIMAVPGIDGDEDNLVVHLSEDDQGLAAGQFAAFYHGDVCIGSGVIMDSW  370

Query  288  DDQGYPVCERALD  250
            D++ +P+C +AL+
Sbjct  371  DEKCFPICSKALE  383



>ref|XP_009407675.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=506

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCS-LAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS +A+   D  ++  VV  +EDDQGLA GQFAAFY G  CIGSGVI++SW
Sbjct  412  VRHGPGFYDCSIMAVPGIDGDEDNLVVHLSEDDQGLAAGQFAAFYHGDVCIGSGVIMDSW  471

Query  288  DDQGYPVCERALD  250
            D++ +P+C +AL+
Sbjct  472  DEKCFPICSKALE  484



>ref|XP_008801937.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Phoenix 
dactylifera]
Length=500

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNG-QEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+      +G +E+  V  +EDDQGLA GQFAAFY    C+GSGVIL+SW
Sbjct  406  VRHGPGFYDCSITEWSSKDGHEEVVEVHISEDDQGLAAGQFAAFYCNDICLGSGVILDSW  465

Query  288  DDQGYPVCERALD  250
            DD+ +P+C +AL+
Sbjct  466  DDKSFPICTKALE  478



>ref|XP_010519263.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 [Tarenaya 
hassleriana]
Length=512

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P FY C+  ME    G +  VV   EDDQGLA+GQF AFY G  CIG+GVI++  D
Sbjct  415  VRHGPGFYRCNFEMEA---GGDSGVVHLDEDDQGLASGQFTAFYMGTTCIGAGVIVDPCD  471

Query  285  DQGYPVCERALD  250
            DQG+PVC +AL+
Sbjct  472  DQGFPVCAKALE  483



>ref|XP_010906767.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X2 [Elaeis guineensis]
Length=455

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAV-V*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+A     NGQE  + V  +EDDQGLA GQFAAFY    C+GSGVIL+SW
Sbjct  361  VRHGPGFYDCSIAEWSSKNGQEDVIEVHISEDDQGLAAGQFAAFYCNDICLGSGVILDSW  420

Query  288  DDQGYPVCERALD  250
            DD+ + +  +AL+
Sbjct  421  DDKSFCISTKALE  433



>ref|XP_010906766.1| PREDICTED: mitochondrial tRNA-specific 2-thiouridylase 1 isoform 
X1 [Elaeis guineensis]
Length=495

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAV-V*FTEDDQGLATGQFAAFYDGRACIGSGVILESW  289
            VRH P FY+CS+A     NGQE  + V  +EDDQGLA GQFAAFY    C+GSGVIL+SW
Sbjct  401  VRHGPGFYDCSIAEWSSKNGQEDVIEVHISEDDQGLAAGQFAAFYCNDICLGSGVILDSW  460

Query  288  DDQGYPVCERALD  250
            DD+ + +  +AL+
Sbjct  461  DDKSFCISTKALE  473



>ref|XP_010270932.1| PREDICTED: uncharacterized protein LOC104607112 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270933.1| PREDICTED: uncharacterized protein LOC104607112 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270934.1| PREDICTED: uncharacterized protein LOC104607112 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270936.1| PREDICTED: uncharacterized protein LOC104607112 isoform X1 [Nelumbo 
nucifera]
Length=196

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEV-DDNGQEIAVV*FTEDDQGLATGQFAAFYDGRAC-IGSGVILES  292
            VRH P FY+CSL M+  +D G+  AVV  +EDDQ LA GQFAAF   +    GSG IL  
Sbjct  64   VRHGPGFYDCSLIMDTGEDGGRTTAVVHLSEDDQSLAVGQFAAFLPRKNLHRGSGTILAC  123

Query  291  WDDQGYPVCERALD  250
            W  QG+PVC +AL+
Sbjct  124  WYGQGFPVCAKALE  137



>ref|XP_002991299.1| hypothetical protein SELMODRAFT_44688, partial [Selaginella moellendorffii]
 gb|EFJ07597.1| hypothetical protein SELMODRAFT_44688, partial [Selaginella moellendorffii]
Length=375

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P+F++C L +E +  G  + ++    +DQ LA GQ+AAFY G  C+GSG+I ES D
Sbjct  306  VRHGPSFHDCELEVEREKQGARVKLL---HNDQALAAGQYAAFYAGETCLGSGMITESMD  362

Query  285  D-QGYPVCERALD  250
            D +   V  RAL+
Sbjct  363  DLESCTVSARALE  375



>ref|XP_002987902.1| hypothetical protein SELMODRAFT_44690, partial [Selaginella moellendorffii]
 gb|EFJ10976.1| hypothetical protein SELMODRAFT_44690, partial [Selaginella moellendorffii]
Length=375

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH P+F++C L  E +  G  + ++     DQ LA GQ+AAFY G  C+GSG+I ES D
Sbjct  306  VRHGPSFHDCELEFEREKQGARVKLL---HSDQALAAGQYAAFYAGETCLGSGMITESMD  362

Query  285  D-QGYPVCERALD  250
            D +   V  RAL+
Sbjct  363  DLESCTVSARALE  375



>ref|XP_001770315.1| predicted protein [Physcomitrella patens]
 gb|EDQ64805.1| predicted protein [Physcomitrella patens]
Length=376

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 38/68 (56%), Gaps = 10/68 (15%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEI----------AVV*FTEDDQGLATGQFAAFYDGRACI  316
            VRH P FY CSL ++ D    E           AVV   EDDQGLA GQ+AAFY    C+
Sbjct  309  VRHGPRFYTCSLDIQTDSTDSEAVTKESKSLTSAVVNLNEDDQGLAPGQYAAFYQNGVCL  368

Query  315  GSGVILES  292
            GS VI E+
Sbjct  369  GSAVITET  376



>ref|XP_002509048.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70306.1| predicted protein [Micromonas sp. RCC299]
Length=478

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 9/75 (12%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESWD  286
            VRH  N Y C+L  ++D +   + +     DDQGLA GQFA FYD R C+G GVILE   
Sbjct  393  VRHGENRYRCTLRFDIDGDAGTVVI---EADDQGLAAGQFAVFYDRRVCLGCGVILEQ--  447

Query  285  DQGYPVCERALDRHV  241
                PV E   +R V
Sbjct  448  ----PVREDLAERDV  458



>ref|XP_003061478.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54108.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILE  295
            VRH    Y C+L  + D  G  + +     +DQGLA GQFA FYDGR C+GSGVI E
Sbjct  301  VRHGERRYRCTLKFDPDGEGGRVVL---DANDQGLAAGQFAVFYDGRECLGSGVIAE  354



>ref|XP_003082000.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
(ISS) [Ostreococcus tauri]
 emb|CAL55803.1| Rossmann-like alpha/beta/alpha sandwich fold [Ostreococcus tauri]
Length=467

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILE  295
            VRH  N Y+CS   +  D G+    V   +DDQGLA GQ+A FYDG  C+G G ILE
Sbjct  392  VRHGENIYSCSFKFKEID-GERCGEVTINQDDQGLAPGQYAVFYDGPKCLGCGKILE  447



>ref|XP_001420484.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98777.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=394

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILE  295
            VRH  N Y CS   + D +G+    V   +DDQGLA GQ+A FYDG  C+G G ILE
Sbjct  315  VRHGENIYACSFQFK-DVDGERCGEVNIGQDDQGLAPGQYAVFYDGDTCLGCGKILE  370



>ref|XP_001692691.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03710.1| predicted protein [Chlamydomonas reinhardtii]
Length=365

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (55%), Gaps = 0/55 (0%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVI  301
            VRH PN Y C+L +           V    +DQGLA GQ+A FY G  C+GS VI
Sbjct  311  VRHGPNMYRCTLRLHDGSGAPLYGTVVLEANDQGLAPGQYAVFYQGGTCLGSAVI  365



>ref|WP_014561596.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 
[Ignavibacterium album]
 ref|YP_005847723.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase [Ignavibacterium 
album JCM 16511]
 gb|AFH50455.1| Putative tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase 
[Ignavibacterium album JCM 16511]
Length=349

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 5/57 (9%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILE  295
            +RH   FYNC L  E D+NG+ I     +++DQG+A GQFA FY    C+G  +I E
Sbjct  298  IRHGAKFYNCVLEYE-DNNGRVI----LSQEDQGIAPGQFAVFYKDDVCLGGSIISE  349



>ref|XP_005650227.1| 5-methylaminomethyl-2-thiouridylate-methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE25683.1| 5-methylaminomethyl-2-thiouridylate-methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=406

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 6/65 (9%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVILESW-  289
            VRH PN Y C+  ME    G+  A V    +DQGLA GQFA FY    C+GS VIL+   
Sbjct  345  VRHGPNMYRCT--MEELPGGE--ARVVLEGNDQGLAAGQFACFYQDGVCLGSAVILQGQC  400

Query  288  -DDQG  277
             DD+G
Sbjct  401  CDDRG  405



>gb|EKD23339.1| hypothetical protein ACD_82C00111G0003, partial [uncultured bacterium]
Length=54

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 4/55 (7%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVI  301
            +RH  N + C ++   + N      V     DQG+A+GQFA FY G  C+G GVI
Sbjct  1    MRHGKNIFKCEISFLENGN----VTVKLDNSDQGIASGQFAVFYYGDVCLGGGVI  51



>ref|XP_005843929.1| hypothetical protein CHLNCDRAFT_139672 [Chlorella variabilis]
 gb|EFN51827.1| hypothetical protein CHLNCDRAFT_139672 [Chlorella variabilis]
Length=417

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = -1

Query  465  VRHCPNFYNCSLAMEVDDNGQEIAVV*FTEDDQGLATGQFAAFYDGRACIGSGVI  301
            VRH P+ Y C L++E       + +     +DQGLA GQ+A FY   AC+GS VI
Sbjct  364  VRHGPHMYACQLSLEPGGGAGHVVL---GGNDQGLAAGQYAVFYQDGACLGSAVI  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510262503360