BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23536_g1_i2 len=1063 path=[759:0-223 300:224-365 442:366-396
1141:397-549 54:550-657 1400:658-1062]

Length=1063
                                                                      Score     E

ref|XP_009798739.1|  PREDICTED: uncharacterized protein LOC104244919    361   3e-118   
ref|XP_009607038.1|  PREDICTED: uncharacterized protein LOC104101296    356   3e-116   
ref|XP_006341545.1|  PREDICTED: uncharacterized protein LOC102602557    336   3e-108   
ref|XP_004235800.1|  PREDICTED: uncharacterized protein LOC101252862    335   4e-108   
emb|CDO98401.1|  unnamed protein product                                334   7e-108   
ref|XP_006442575.1|  hypothetical protein CICLE_v10020201mg             333   1e-107   
ref|XP_006477770.1|  PREDICTED: uncharacterized protein LOC102629761    333   3e-107   
ref|XP_004299569.1|  PREDICTED: UDP-N-acetylglucosamine--N-acetyl...    332   6e-107   
ref|XP_008240221.1|  PREDICTED: uncharacterized protein LOC103338...    329   1e-105   
ref|XP_007209147.1|  hypothetical protein PRUPE_ppa005855mg             329   1e-105   
emb|CBI15500.3|  unnamed protein product                                321   1e-102   
ref|XP_010663641.1|  PREDICTED: uncharacterized protein LOC100242239    321   2e-102   
ref|XP_002524882.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    320   2e-102   Ricinus communis
ref|XP_009360125.1|  PREDICTED: uncharacterized protein LOC103950621    314   9e-100   
ref|XP_008374787.1|  PREDICTED: uncharacterized protein LOC103438028    313   1e-99    
ref|XP_009347547.1|  PREDICTED: uncharacterized protein LOC103939212    313   2e-99    
ref|XP_007036629.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    310   7e-98    
ref|XP_010268482.1|  PREDICTED: uncharacterized protein LOC104605180    308   9e-98    
ref|XP_008352203.1|  PREDICTED: uncharacterized protein LOC103415676    308   3e-97    
ref|XP_011004084.1|  PREDICTED: uncharacterized protein LOC105110...    306   8e-97    
gb|KCW48565.1|  hypothetical protein EUGRSUZ_K02237                     301   7e-96    
ref|XP_002317900.2|  glycosyl transferase family 28 family protein      304   8e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010039006.1|  PREDICTED: uncharacterized protein LOC104427642    300   8e-94    
ref|XP_004167534.1|  PREDICTED: UDP-N-acetylglucosamine--N-acetyl...    297   4e-93    
ref|XP_010540005.1|  PREDICTED: uncharacterized protein LOC104813907    296   5e-93    
ref|XP_008461957.1|  PREDICTED: uncharacterized protein LOC103500410    295   1e-92    
ref|XP_003524354.2|  PREDICTED: uncharacterized protein LOC100808...    294   1e-92    
ref|XP_004137489.1|  PREDICTED: UDP-N-acetylglucosamine--N-acetyl...    294   4e-92    
gb|KDP35168.1|  hypothetical protein JCGZ_10702                         291   5e-91    
ref|XP_007160477.1|  hypothetical protein PHAVU_002G325300g             280   1e-86    
ref|XP_006843780.1|  hypothetical protein AMTR_s00007p00245790          279   4e-86    
ref|XP_010695645.1|  PREDICTED: uncharacterized protein LOC104908248    273   6e-84    
ref|XP_009403920.1|  PREDICTED: uncharacterized protein LOC103987357    269   2e-82    
gb|KHG16752.1|  UDP-N-acetylglucosamine--N-acetylmuramyl- (pentap...    269   8e-82    
ref|XP_008809180.1|  PREDICTED: uncharacterized protein LOC103720974    263   4e-80    
ref|XP_011004085.1|  PREDICTED: uncharacterized protein LOC105110...    261   5e-80    
ref|XP_006390518.1|  hypothetical protein EUTSA_v10018574mg             262   1e-79    
ref|XP_006390519.1|  hypothetical protein EUTSA_v10018574mg             262   1e-79    
ref|XP_010428310.1|  PREDICTED: uncharacterized protein LOC104712992    259   6e-79    
gb|KDO49789.1|  hypothetical protein CISIN_1g031484mg                   249   1e-78    
ref|XP_010916467.1|  PREDICTED: uncharacterized protein LOC105041272    258   2e-78    
ref|XP_002887503.1|  glycosyl transferase family 28 protein             258   2e-78    
gb|KFK41815.1|  hypothetical protein AALP_AA2G175000                    258   3e-78    
ref|XP_010416193.1|  PREDICTED: uncharacterized protein LOC104702077    258   4e-78    
emb|CDY60139.1|  BnaA07g39040D                                          257   4e-78    
ref|XP_010471441.1|  PREDICTED: uncharacterized protein LOC104751230    257   1e-77    
ref|XP_008792827.1|  PREDICTED: uncharacterized protein LOC103709...    253   2e-77    
emb|CDX73010.1|  BnaC06g34580D                                          254   1e-76    
ref|XP_009106033.1|  PREDICTED: uncharacterized protein LOC103831850    253   3e-76    
ref|XP_006301831.1|  hypothetical protein CARUB_v10022300mg             259   6e-76    
ref|XP_008792826.1|  PREDICTED: uncharacterized protein LOC103709...    253   7e-76    
ref|XP_010906977.1|  PREDICTED: uncharacterized protein LOC105033764    252   1e-75    
ref|XP_006645942.1|  PREDICTED: uncharacterized protein LOC102703743    246   2e-75    
gb|KFK41817.1|  hypothetical protein AALP_AA2G175000                    256   1e-73    
gb|EEE54689.1|  hypothetical protein OsJ_01999                          244   7e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EAY74292.1|  hypothetical protein OsI_02179                          243   1e-72    Oryza sativa Indica Group [Indian rice]
dbj|BAD73572.1|  putative murG                                          243   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|NP_177515.1|  UDP-Glycosyltransferase superfamily protein           243   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968841.1|  PREDICTED: uncharacterized protein LOC101768...    240   2e-71    
ref|NP_001149881.1|  glycosyltransferase family 28 C-terminal dom...    240   3e-71    Zea mays [maize]
ref|XP_002457846.1|  hypothetical protein SORBIDRAFT_03g015470          236   7e-70    Sorghum bicolor [broomcorn]
ref|XP_003565791.1|  PREDICTED: uncharacterized protein LOC100839...    223   8e-65    
ref|XP_008240222.1|  PREDICTED: uncharacterized protein LOC103338...    214   4e-62    
emb|CDM83086.1|  unnamed protein product                                199   5e-56    
gb|EMT06710.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape...    199   1e-55    
gb|KHN16503.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape...    189   3e-55    
ref|XP_006580417.1|  PREDICTED: uncharacterized protein LOC100808...    194   4e-55    
ref|XP_006580416.1|  PREDICTED: uncharacterized protein LOC100808...    195   5e-55    
ref|XP_010416194.1|  PREDICTED: uncharacterized protein LOC104702078    168   2e-47    
ref|XP_001756202.1|  predicted protein                                  168   1e-44    
ref|XP_010230929.1|  PREDICTED: uncharacterized protein LOC100839...    167   2e-44    
dbj|BAH23791.1|  MurG transferase                                       168   3e-44    Physcomitrella patens
ref|XP_002984744.1|  glycosyltransferase CAZy family GT28               158   1e-40    
ref|XP_010110095.1|  Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNA...    145   5e-39    
gb|EYU18998.1|  hypothetical protein MIMGU_mgv1a010416mg                146   5e-37    
gb|KGN64152.1|  hypothetical protein Csa_1G042620                       144   6e-36    
ref|WP_022835666.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    143   2e-35    
gb|ABZ08297.1|  putative glycosyltransferase family 28 C-terminal...    140   2e-34    uncultured marine microorganism HF4000_APKG2M17
ref|WP_022826746.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    138   1e-33    
ref|WP_026977053.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    132   2e-31    
ref|XP_010110096.1|  Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNA...    130   4e-31    
ref|WP_022587308.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    129   2e-30    
ref|WP_026704042.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    129   2e-30    
ref|WP_021327569.1|  hypothetical protein                               129   3e-30    
ref|WP_020402704.1|  hypothetical protein                               128   5e-30    
ref|WP_009611121.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    127   7e-30    
ref|WP_027420795.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    124   8e-29    
ref|WP_035670162.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    124   1e-28    
ref|WP_007810670.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    124   1e-28    
ref|WP_028295546.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    124   2e-28    
ref|WP_008908632.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    124   2e-28    
ref|WP_026724218.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    123   2e-28    
gb|AIS52707.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape...    123   2e-28    
ref|WP_037388798.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    123   2e-28    
ref|WP_029933213.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    123   2e-28    
ref|WP_039108926.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    123   2e-28    
ref|WP_008467147.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    123   3e-28    
ref|XP_003061400.1|  glycosyltransferase family 28 protein              123   3e-28    
ref|WP_014068150.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    123   3e-28    
ref|WP_012845182.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    122   5e-28    
ref|WP_017497016.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    122   5e-28    
ref|WP_026730570.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    122   5e-28    
ref|WP_009052546.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    122   5e-28    
ref|WP_008990932.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    122   5e-28    
ref|WP_003867928.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    122   8e-28    
ref|WP_014063048.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    122   8e-28    
ref|WP_026985674.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    121   8e-28    
ref|WP_034098851.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    121   1e-27    
ref|WP_011964156.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    121   1e-27    
ref|WP_035685387.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    121   1e-27    
gb|AIJ37228.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape...    121   1e-27    
ref|WP_004402388.1|  MULTISPECIES: undecaprenyldiphospho-muramoyl...    120   2e-27    
ref|WP_006570250.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    120   2e-27    
ref|WP_024741340.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    120   2e-27    
ref|WP_026711948.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    120   2e-27    
ref|WP_038112870.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   3e-27    
ref|WP_035651765.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    120   3e-27    
ref|WP_004344270.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    120   3e-27    
ref|WP_007411263.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    120   4e-27    
gb|KHO62810.1|  UDP-N-acetylglucosamine-N-acetylmuramylpentapepti...    119   4e-27    
ref|WP_036787551.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   4e-27    
ref|WP_012023886.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    119   5e-27    
ref|WP_037319361.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   5e-27    
ref|WP_013433140.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    119   5e-27    
ref|WP_029229119.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    119   6e-27    
ref|WP_003871206.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    119   6e-27    
ref|WP_029688544.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   6e-27    
ref|WP_026474839.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   6e-27    
ref|WP_004341565.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    119   7e-27    
ref|WP_026038635.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   7e-27    
ref|WP_028890210.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    119   9e-27    
ref|WP_016989692.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    119   9e-27    
ref|WP_013290022.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    119   1e-26    
dbj|GAK97971.1|  UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape...    118   1e-26    
ref|WP_023152770.1|  undecaprenyldiphospho-muramoylpentapeptide b...    118   1e-26    
ref|WP_022083241.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    118   2e-26    
ref|WP_010228690.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    118   2e-26    
ref|WP_028891248.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    118   2e-26    
ref|WP_027308722.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    117   2e-26    
ref|WP_029273294.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    117   2e-26    
ref|WP_014042652.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    117   2e-26    
ref|WP_026933606.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    117   2e-26    
ref|WP_013663384.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    117   2e-26    
dbj|GAK93720.1|  UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape...    117   2e-26    
ref|WP_015907331.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    117   3e-26    
gb|EDM43764.1|  N-acetylglucosaminyl transferase                        116   3e-26    unidentified eubacterium SCB49
ref|WP_009437154.1|  undecaprenyldiphospho-muramoylpentapeptide b...    117   4e-26    
ref|WP_027310401.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    117   4e-26    
ref|WP_018280332.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    117   4e-26    
ref|WP_035660677.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    116   5e-26    
emb|CCF99919.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap...    116   6e-26    
ref|WP_023575430.1|  undecaprenyldiphospho-muramoylpentapeptide b...    116   6e-26    
ref|WP_038011451.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    116   6e-26    
ref|WP_028992143.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    116   7e-26    
ref|WP_036826533.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    116   7e-26    
ref|WP_013073198.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    116   7e-26    
ref|WP_013150475.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    116   7e-26    
ref|WP_013403773.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    116   8e-26    
ref|WP_012995473.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    115   9e-26    
ref|WP_013430801.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    115   9e-26    
ref|WP_013411601.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    115   9e-26    
ref|WP_021826728.1|  undecaprenyldiphospho-muramoylpentapeptide b...    115   1e-25    
ref|WP_007095047.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    115   1e-25    
ref|WP_025741088.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    115   1e-25    
ref|WP_034924258.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    115   1e-25    
ref|WP_039765285.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    115   1e-25    
ref|WP_013998222.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    115   1e-25    
ref|WP_023578468.1|  undecaprenyldiphospho-muramoylpentapeptide b...    115   1e-25    
ref|WP_020213740.1|  hypothetical protein                               115   1e-25    
ref|WP_007572733.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    115   2e-25    
dbj|BAO76166.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap...    114   2e-25    
ref|WP_031454592.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    114   2e-25    
ref|WP_013787839.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   2e-25    
ref|WP_007134684.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   2e-25    
ref|WP_013778209.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   2e-25    
ref|WP_021895901.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    114   3e-25    
ref|WP_011403336.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    114   3e-25    
ref|WP_013174977.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    114   3e-25    
ref|WP_013445014.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   3e-25    
ref|WP_014158597.1|  N-acetylglucosaminyl transferase                   114   4e-25    
ref|WP_013187061.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   4e-25    
ref|WP_010663110.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   4e-25    
ref|WP_035480005.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    114   4e-25    
ref|WP_023573469.1|  Undecaprenyldiphospho-muramoylpentapeptide b...    114   5e-25    
ref|WP_026979554.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    114   5e-25    
ref|WP_035123384.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    114   5e-25    
ref|WP_031480773.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    114   5e-25    
ref|WP_023570716.1|  undecaprenyldiphospho-muramoylpentapeptide b...    114   5e-25    
ref|WP_014799085.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    114   5e-25    
ref|WP_014758446.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    113   5e-25    
ref|WP_015025374.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    113   5e-25    
ref|WP_028872419.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    113   6e-25    
ref|WP_037981802.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    113   6e-25    
ref|WP_014726569.1|  N-acetylglucosaminyl transferase                   113   6e-25    
ref|WP_010751486.1|  undecaprenyldiphospho-muramoylpentapeptide b...    113   7e-25    
ref|WP_012821411.1|  N-acetylglucosaminyl transferase                   113   8e-25    
ref|WP_013298229.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    113   8e-25    
ref|WP_027189051.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    113   8e-25    
ref|WP_018127246.1|  hypothetical protein                               113   8e-25    
ref|WP_026707713.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    113   9e-25    
ref|WP_025071878.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    113   9e-25    
ref|WP_022565187.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    112   1e-24    
ref|WP_026452569.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   1e-24    
ref|WP_033960078.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   1e-24    
ref|WP_027137179.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   1e-24    
ref|WP_006988472.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    112   1e-24    
ref|WP_011916485.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    112   1e-24    
ref|WP_038132751.1|  hypothetical protein                               112   1e-24    
ref|WP_019723320.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    112   1e-24    
ref|WP_022054659.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    112   1e-24    
ref|WP_026712323.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   1e-24    
ref|WP_021930834.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    112   1e-24    
ref|WP_029282987.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   1e-24    
ref|WP_014389343.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    112   1e-24    
ref|WP_007483446.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    112   2e-24    
ref|WP_027884333.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   2e-24    
ref|WP_035134946.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   2e-24    
ref|WP_028912111.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    112   2e-24    
ref|WP_022130251.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    112   2e-24    
ref|WP_039114487.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   2e-24    
ref|WP_026775448.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   2e-24    
ref|WP_007559923.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    112   2e-24    
ref|WP_039118458.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   2e-24    
ref|WP_008612391.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    111   3e-24    
ref|WP_037986583.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   3e-24    
ref|WP_025762875.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   3e-24    
ref|WP_035627630.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   3e-24    
ref|WP_014782610.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    111   3e-24    
ref|WP_022390265.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    111   3e-24    
ref|WP_028903018.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    111   3e-24    
gb|ERM88085.1|  UDP-diphospho-muramoylpentapeptide beta-N- acetyl...    111   4e-24    
ref|WP_031258943.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   4e-24    
ref|WP_036910570.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   4e-24    
ref|WP_039751574.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    111   4e-24    
ref|WP_022327220.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    111   4e-24    
ref|WP_009318117.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    111   4e-24    
ref|WP_026839564.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   4e-24    
ref|WP_015481049.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   4e-24    
ref|WP_025607080.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   5e-24    
ref|WP_015691270.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   5e-24    
ref|WP_015370753.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    110   5e-24    
ref|WP_002659887.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   5e-24    
ref|WP_010135604.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   5e-24    
gb|KHM49051.1|  UDP-diphospho-muramoylpentapeptide beta-N-acetylg...    110   6e-24    
ref|WP_013275756.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   6e-24    
ref|WP_027726132.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   6e-24    
gb|KHN21638.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape...    105   7e-24    
ref|WP_035636773.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   7e-24    
ref|WP_028905650.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   7e-24    
ref|WP_028576506.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   8e-24    
ref|WP_010601593.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   8e-24    
ref|WP_004369342.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   8e-24    
ref|WP_027452470.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   8e-24    
ref|WP_002987698.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    110   9e-24    
ref|WP_014708969.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   9e-24    
ref|WP_023519353.1|  UDP-N-acetylglucosamine/LPS N-acetylglucosam...    110   9e-24    
ref|WP_009354205.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   9e-24    
ref|WP_018462708.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    110   1e-23    
ref|WP_028727176.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    110   1e-23    
ref|WP_018661350.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    109   1e-23    
ref|WP_005927213.1|  MULTISPECIES: undecaprenyldiphospho-muramoyl...    110   1e-23    
ref|WP_008123851.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    109   1e-23    
ref|WP_026903804.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    109   1e-23    
ref|WP_007479196.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    109   1e-23    
ref|WP_024833940.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    109   1e-23    
dbj|BAJ84856.1|  predicted protein                                      103   1e-23    
ref|WP_007648310.1|  N-acetylglucosamine transferase                    109   1e-23    
ref|WP_013763606.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    109   1e-23    
dbj|GAL74665.1|  UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape...    109   2e-23    
ref|WP_034821706.1|  hypothetical protein [                             109   2e-23    
ref|WP_019599355.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    109   2e-23    
ref|WP_027201026.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    109   2e-23    
ref|WP_028377571.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    109   2e-23    
ref|WP_033564847.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    109   2e-23    
ref|WP_012467384.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    108   2e-23    
ref|WP_023984316.1|  undecaprenyldiphospho-muramoylpentapeptide b...    108   2e-23    
ref|WP_034132055.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   2e-23    
ref|WP_036927517.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   2e-23    
ref|WP_004621093.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   2e-23    
ref|WP_008237219.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   2e-23    
ref|WP_039449045.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   2e-23    
ref|WP_015429871.1|  undecaprenyldiphospho-muramoylpentapeptide         108   2e-23    
ref|WP_012573730.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   2e-23    
ref|WP_009161210.1|  undecaprenyldiphospho-muramoylpentapeptide b...    108   3e-23    
ref|WP_011710625.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   3e-23    
ref|WP_004568913.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   3e-23    
ref|WP_034241166.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   3e-23    
ref|WP_015028679.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   3e-23    
ref|WP_010735980.1|  undecaprenyldiphospho-muramoylpentapeptide b...    108   3e-23    
ref|WP_036580078.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   3e-23    
ref|WP_024825852.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   3e-23    
dbj|GAL01135.1|  UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape...    108   3e-23    
ref|WP_012840910.1|  N-acetylglucosaminyl transferase                   108   3e-23    
ref|WP_015546991.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    108   4e-23    
ref|WP_026808452.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   4e-23    
ref|WP_018336888.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    108   4e-23    
ref|WP_026463785.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   4e-23    
ref|WP_036121187.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   4e-23    
ref|WP_028257401.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    108   4e-23    
ref|WP_038151057.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   4e-23    
ref|WP_025144494.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   4e-23    
ref|WP_009643150.1|  MULTISPECIES: undecaprenyldiphospho-muramoyl...    107   5e-23    
ref|WP_014854994.1|  N-acetylglucosaminyl transferase                   107   5e-23    
ref|WP_009347723.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   5e-23    
ref|WP_034689851.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   5e-23    
ref|WP_022837097.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    107   5e-23    
ref|WP_020081021.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   5e-23    
ref|WP_017843237.1|  hypothetical protein                               107   5e-23    
ref|WP_036657865.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   5e-23    
ref|WP_025665059.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   5e-23    
ref|WP_022061687.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    107   6e-23    
dbj|GAK76425.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap...    107   6e-23    
ref|WP_029156954.1|  MULTISPECIES: hypothetical protein                 107   6e-23    
ref|WP_008823656.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   6e-23    
gb|EKJ90341.1|  undecaprenyldiphospho-muramoylpentapeptide beta-N...    107   6e-23    
ref|WP_002842293.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    107   6e-23    
ref|WP_012290522.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    107   6e-23    
ref|WP_029425928.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   6e-23    
ref|WP_020531374.1|  hypothetical protein                               107   7e-23    
ref|WP_002558775.1|  undecaprenyldiphospho-muramoylpentapeptide b...    107   7e-23    
ref|WP_028289088.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    107   7e-23    
ref|WP_021950864.1|  undecaprenyldiphospho-muramoylpentapeptide b...    107   7e-23    
ref|WP_022063467.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    107   8e-23    
ref|WP_036886168.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   8e-23    
gb|ETK13342.1|  UDP-diphospho-muramoylpentapeptide beta-N- acetyl...    106   8e-23    
ref|WP_018975674.1|  hypothetical protein                               107   8e-23    
ref|WP_019036357.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   8e-23    
ref|WP_037995081.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   8e-23    
ref|WP_038531919.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   8e-23    
gb|KHF33095.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape...    106   8e-23    
ref|WP_035471610.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   8e-23    
ref|WP_007046988.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   9e-23    
ref|WP_014083300.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   9e-23    
gb|KGN83197.1|  UDP-diphospho-muramoylpentapeptide beta-N-acetylg...    107   9e-23    
ref|WP_008564484.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   1e-22    
ref|WP_034889447.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   1e-22    
ref|WP_008447063.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    107   1e-22    
ref|WP_026718299.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   1e-22    
ref|WP_036853718.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   1e-22    
ref|WP_029425214.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    107   1e-22    
gb|KGE86822.1|  UDP-diphospho-muramoylpentapeptide beta-N-acetylg...    106   1e-22    
ref|WP_008767642.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_007756521.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_006841459.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_019967727.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_022301425.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   1e-22    
ref|WP_022041986.1|  undecaprenyldiphospho-muramoylpentapeptide b...    106   1e-22    
ref|WP_022276263.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   1e-22    
ref|WP_038558555.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   1e-22    
ref|WP_005682299.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_011108837.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_022483533.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   1e-22    
ref|WP_020816966.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_015414879.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   1e-22    
ref|WP_026625480.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   1e-22    
ref|WP_036871249.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   1e-22    
gb|KGO00963.1|  UDP-diphospho-muramoylpentapeptide beta-N-acetylg...    106   1e-22    
ref|WP_013064084.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   1e-22    
ref|WP_022853408.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   1e-22    
ref|WP_018247699.1|  hypothetical protein                               106   1e-22    
ref|WP_015961232.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   1e-22    
ref|WP_025863001.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   1e-22    
ref|WP_025000616.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   1e-22    
ref|WP_036829821.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   2e-22    
ref|WP_027444731.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   2e-22    
dbj|GAL68138.1|  UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape...    106   2e-22    
ref|WP_021588693.1|  undecaprenyldiphospho-muramoylpentapeptide b...    106   2e-22    
ref|WP_004348979.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   2e-22    
dbj|BAO54325.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap...    106   2e-22    
ref|WP_036874049.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   2e-22    
ref|WP_034041401.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   2e-22    
ref|WP_026755007.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   2e-22    
ref|WP_004373545.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    106   2e-22    
ref|WP_022114220.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    106   2e-22    
ref|WP_016316155.1|  undecaprenyldiphospho-muramoylpentapeptide b...    106   2e-22    
ref|WP_028906592.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    106   2e-22    
ref|WP_003442412.1|  undecaprenyldiphospho-muramoylpentapeptide b...    105   2e-22    
ref|WP_018362967.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   2e-22    
ref|WP_011877050.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   2e-22    
ref|WP_032855517.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   2e-22    
ref|WP_019242399.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   2e-22    
gb|EDM19391.1|  undecaprenyldiphospho-muramoylpentapeptide beta-N...    105   2e-22    
ref|WP_015756656.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   2e-22    
ref|WP_035399486.1|  hypothetical protein                               105   2e-22    
ref|WP_028909360.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   2e-22    
ref|WP_012634927.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   3e-22    
ref|WP_020895771.1|  UDP-N-acetylglucosamine--N-acetylmuramyl- (p...    105   3e-22    
ref|WP_013621589.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   3e-22    
ref|WP_026915208.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   3e-22    
ref|WP_004292025.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    105   3e-22    
ref|WP_004336842.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   3e-22    
ref|WP_002838321.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    105   3e-22    
ref|WP_031442640.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   3e-22    
ref|WP_009237085.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   3e-22    
ref|WP_016269376.1|  undecaprenyldiphospho-muramoylpentapeptide b...    105   3e-22    
ref|WP_022191817.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    105   3e-22    
ref|WP_005866971.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    105   3e-22    
ref|WP_022471626.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    105   3e-22    
ref|WP_008773833.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    105   3e-22    
gb|AIZ65073.1|  UDP-diphospho-muramoylpentapeptide beta-N-acetylg...    105   3e-22    
ref|WP_022044368.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   3e-22    
ref|WP_005861373.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   3e-22    
ref|WP_008505534.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   4e-22    
ref|WP_010800796.1|  MULTISPECIES: undecaprenyldiphospho-muramoyl...    105   4e-22    
ref|WP_038656058.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   4e-22    
ref|WP_027339302.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   4e-22    
ref|WP_007129468.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    105   4e-22    
ref|WP_013304590.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   4e-22    
ref|WP_022354665.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    105   4e-22    
ref|WP_035379717.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   4e-22    
ref|WP_034614840.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   4e-22    
ref|WP_002839367.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    105   4e-22    
ref|WP_006952655.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   4e-22    
ref|WP_008763711.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   4e-22    
ref|WP_015565452.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    105   4e-22    
ref|WP_034261212.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   4e-22    
ref|WP_009183407.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    105   4e-22    
ref|WP_028072325.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    105   5e-22    
ref|WP_029035164.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    104   5e-22    
ref|WP_008141830.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    105   5e-22    
ref|WP_022150768.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    104   5e-22    
ref|WP_029748273.1|  hypothetical protein                               104   5e-22    
gb|EEV30485.1|  N-acetylglucosaminyl transferase                        103   5e-22    
ref|WP_028284284.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    104   6e-22    
emb|CBX28048.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap...    104   6e-22    
ref|WP_006281599.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   6e-22    
ref|WP_007175066.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   6e-22    
ref|WP_023058078.1|  MULTISPECIES: undecaprenyldiphospho-muramoyl...    104   6e-22    
ref|WP_025077869.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    104   6e-22    
ref|WP_014313092.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   7e-22    
ref|WP_009859912.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   7e-22    
ref|WP_009620983.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   7e-22    
ref|WP_015361422.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    104   7e-22    
ref|WP_033150714.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    104   7e-22    
ref|WP_012370831.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   7e-22    
gb|ETZ23216.1|  UDP-diphospho-muramoylpentapeptide beta-N- acetyl...    104   7e-22    
ref|WP_009016204.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    104   7e-22    
ref|WP_016275188.1|  MULTISPECIES: undecaprenyldiphospho-muramoyl...    104   8e-22    
ref|WP_021964137.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    104   8e-22    
ref|WP_004293224.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    104   8e-22    
ref|WP_035295231.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   9e-22    
ref|WP_009791183.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    103   9e-22    
ref|WP_022142766.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   9e-22    
ref|WP_029546071.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   9e-22    
ref|WP_038505990.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   9e-22    
ref|WP_011890983.1|  UDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   1e-21    
ref|WP_021584934.1|  undecaprenyldiphospho-muramoylpentapeptide b...    103   1e-21    
ref|WP_022237668.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   1e-21    
ref|WP_022480462.1|  undecaprenyldiphospho-muramoylpentapeptide b...    103   1e-21    
ref|WP_026135677.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_028979606.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
gb|EKE11271.1|  undecaprenyldiphospho-muramoylpentapeptide beta-N...    102   1e-21    
ref|WP_029099952.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_039429376.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_034877759.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_034642985.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_029142133.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_036855343.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_005237281.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    103   1e-21    
ref|WP_005231867.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   1e-21    
ref|WP_009597591.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    103   1e-21    
ref|WP_013858976.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   1e-21    
ref|WP_033396917.1|  hypothetical protein                               103   1e-21    
ref|WP_008156590.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    103   1e-21    
ref|WP_038060779.1|  hypothetical protein                               103   1e-21    
ref|WP_022157633.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   1e-21    
ref|WP_014790406.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   1e-21    
ref|WP_022454537.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   1e-21    
ref|WP_003416073.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   1e-21    
ref|WP_031427376.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_025069487.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   1e-21    
ref|WP_039473406.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   2e-21    
ref|NP_001043195.2|  Os01g0516700                                       102   2e-21    
ref|WP_021385369.1|  undecaprenyldiphospho-muramoylpentapeptide b...    103   2e-21    
ref|WP_007660756.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    103   2e-21    
ref|WP_034577465.1|  hypothetical protein                               103   2e-21    
ref|WP_022218280.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   2e-21    
ref|WP_020967394.1|  undecaprenyldiphospho-muramoylpentapeptide b...    103   2e-21    
ref|WP_003395089.1|  undecaprenyldiphospho-muramoylpentapeptide b...    103   2e-21    
ref|WP_008863194.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   2e-21    
ref|WP_010749767.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   2e-21    
ref|WP_023925875.1|  undecaprenyldiphospho-muramoylpentapeptide b...    103   2e-21    
ref|WP_003426993.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   2e-21    
ref|WP_018910770.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   2e-21    
ref|WP_021848821.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   2e-21    
ref|WP_032101537.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   2e-21    
ref|WP_017553745.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   2e-21    
ref|WP_007216894.1|  MULTISPECIES: UDP-diphospho-muramoylpentapep...    103   2e-21    
ref|WP_036621401.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    103   2e-21    
ref|WP_013869180.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    103   2e-21    
ref|WP_022081575.1|  uDP-N-acetylglucosamine--N-acetylmuramyl-(pe...    103   2e-21    
gb|AHF07716.1|  UDP-diphospho-muramoylpentapeptide beta-N- acetyl...    103   2e-21    
ref|WP_025875038.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    102   2e-21    
ref|WP_019909319.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    102   2e-21    
ref|WP_035253881.1|  hypothetical protein                               102   2e-21    
ref|WP_027472409.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    102   2e-21    
dbj|GAF02656.1|  UDP-N-acetylglucosamine-N-acetylmuramyl-(pentape...    102   2e-21    
gb|EFS31413.2|  undecaprenyldiphospho-muramoylpentapeptide beta-N...    102   2e-21    
ref|WP_027881026.1|  UDP-diphospho-muramoylpentapeptide beta-N-ac...    102   3e-21    
ref|WP_007553853.1|  UDP-diphospho-muramoylpentapeptide beta-N- a...    102   3e-21    



>ref|XP_009798739.1| PREDICTED: uncharacterized protein LOC104244919 [Nicotiana sylvestris]
Length=437

 Score =   361 bits (927),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/280 (68%), Positives = 225/280 (80%), Gaps = 15/280 (5%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L A L G+K  + EQN+VP +ANRVLS                FADK+F AF+SS++C
Sbjct  169  ICLAAGLKGIKLAIQEQNSVPGVANRVLSL---------------FADKVFAAFNSSVDC  213

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            FWQK KCVVCGNPVR SL++  SK +AR+HFF +    +G+GKVVL+LGGSLGANA+NV 
Sbjct  214  FWQKNKCVVCGNPVRLSLRQYASKAVARRHFFSKAVVGKGDGKVVLILGGSLGANALNVA  273

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +L+LYS +LDERKDLFLIWQTGV AF E+ESLVK HPRL +TPFLH+MDLAY+AADLI+S
Sbjct  274  ILHLYSEMLDERKDLFLIWQTGVLAFDEMESLVKFHPRLYITPFLHSMDLAYSAADLIVS  333

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GAM C EILA GKPCILIPSPNVAEGHQ  NACLMA +AG+RVITE+ELDS  L+SA 
Sbjct  334  RAGAMICSEILAAGKPCILIPSPNVAEGHQFHNACLMADVAGSRVITEDELDSLTLKSAI  393

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            EEIL +E LM +MS+RALKAAK DAS EI+KHILSLVNFS
Sbjct  394  EEILDNEGLMTEMSERALKAAKPDASVEIAKHILSLVNFS  433



>ref|XP_009607038.1| PREDICTED: uncharacterized protein LOC104101296 [Nicotiana tomentosiformis]
Length=437

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 224/280 (80%), Gaps = 15/280 (5%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L A L G+K  + EQN+VP +ANRVLS                FADK+F AF+S+++C
Sbjct  169  ICLAAGLRGIKLAIQEQNSVPGVANRVLSL---------------FADKVFAAFNSTVDC  213

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            FWQK KCVVCGNPVR SL++  SK +AR+HFF +    +G+GKVVL+LGGSLGANA+NV 
Sbjct  214  FWQKNKCVVCGNPVRLSLRQYASKAVARRHFFSKAVVGKGDGKVVLILGGSLGANALNVA  273

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +L+LYS +LDERKDLFLIWQTGV AF E+ESLVK HPRL +TPFLH+MDLAY+AADLI+S
Sbjct  274  ILHLYSEMLDERKDLFLIWQTGVLAFDEMESLVKFHPRLYITPFLHSMDLAYSAADLIVS  333

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GAM C EILA GKPCILIPSPNVAEGHQ  NACLMA +AG+RVITE+ELDS  L+SA 
Sbjct  334  RAGAMICSEILAAGKPCILIPSPNVAEGHQFHNACLMADVAGSRVITEDELDSLTLKSAI  393

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            EEIL +E  M +MS+RALKAAK DAS EI+KH+LSLVNFS
Sbjct  394  EEILDNEGSMTEMSERALKAAKPDASVEIAKHLLSLVNFS  433



>ref|XP_006341545.1| PREDICTED: uncharacterized protein LOC102602557 [Solanum tuberosum]
Length=443

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 179/281 (64%), Positives = 218/281 (78%), Gaps = 15/281 (5%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L A+L G+K  + EQN+VP IANRVLS                FA  +F+AF+SS++C
Sbjct  176  ICLAASLRGIKLAIQEQNSVPGIANRVLSL---------------FAYNVFVAFNSSVDC  220

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            FWQK KCVVCGNPVR SL++  SK + R+HFF      +G+GKVVL+LGGSLGANA+NV 
Sbjct  221  FWQKNKCVVCGNPVRLSLRQYASKAVGRRHFFSNAVVGKGDGKVVLILGGSLGANALNVA  280

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +L+LYS +L ERKDLFLIWQTGV A+ E+ESLVK HPRL +TPFLH+MDLAYAAADL++S
Sbjct  281  ILHLYSEMLKERKDLFLIWQTGVLAYDEMESLVKFHPRLYITPFLHSMDLAYAAADLVVS  340

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GAM C EIL  GKP ILIPSPNVAEGHQ  NACLMA L G+RVITE+ELDS  L+S+ 
Sbjct  341  RAGAMICTEILTAGKPSILIPSPNVAEGHQFHNACLMADLVGSRVITEDELDSLTLKSSI  400

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            EEIL +E LM +MS+RALK AK +AS EI++H+LSLVN S+
Sbjct  401  EEILDNERLMTEMSERALKTAKPNASIEIARHLLSLVNSSM  441



>ref|XP_004235800.1| PREDICTED: uncharacterized protein LOC101252862 [Solanum lycopersicum]
Length=443

 Score =   335 bits (860),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 178/281 (63%), Positives = 218/281 (78%), Gaps = 15/281 (5%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L A+L G+K  + EQN+VP IANRVLS                FA  +F+AF+SS++ 
Sbjct  176  ICLAASLKGIKLAIQEQNSVPGIANRVLSL---------------FAYNVFVAFNSSVDW  220

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            FWQK KCVVCGNPVR SL++  SK + R+HFF      +G+GKVVL+LGGSLGANA+NV 
Sbjct  221  FWQKNKCVVCGNPVRLSLRQYASKAVGRRHFFSNAVVGKGDGKVVLILGGSLGANALNVA  280

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +L+LYS +L+ERKDLFLIWQTGV A+ E+ESLVK HPRL +TPFLH+MDLAYAAADL++S
Sbjct  281  ILHLYSEMLNERKDLFLIWQTGVLAYDEMESLVKFHPRLYITPFLHSMDLAYAAADLVVS  340

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GAM C EIL  GKP +LIPSPNVAEGHQ  NACLMA L G+RVITE+ELDS  L+S+ 
Sbjct  341  RAGAMICTEILTAGKPSVLIPSPNVAEGHQFHNACLMADLVGSRVITEDELDSLTLKSSI  400

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            EEIL DE LM +MS+RALK AK +AS EI+KH+L+LVN S+
Sbjct  401  EEILDDERLMTEMSERALKTAKPNASVEIAKHLLTLVNSSI  441



>emb|CDO98401.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   334 bits (856),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 183/282 (65%), Positives = 226/282 (80%), Gaps = 17/282 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L AA+ G+K V+ EQN+VP IAN VLS                FA+K+F+AF+SS++C
Sbjct  151  ICLAAAMKGLKLVIQEQNSVPGIANWVLSL---------------FAEKVFVAFNSSVDC  195

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelg--dlegegkvvlvlggslgANAIN  416
            FWQ+ KC+VCGNPVR SL +NV K  AR+HFFP+      +G+GKVVLVLGGSLGA+AIN
Sbjct  196  FWQRNKCIVCGNPVRFSLSKNVVKADARKHFFPKAVEGTGKGQGKVVLVLGGSLGASAIN  255

Query  417  VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLI  596
            + LLN Y  +L++R+DLF+IWQTGVE+F E+ESLVK HPRL+L  FLH+M LAYAAADLI
Sbjct  256  IALLNSYFEMLNQREDLFIIWQTGVESFDEMESLVKNHPRLILKSFLHSMHLAYAAADLI  315

Query  597  ISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRS  776
            ISR+GAMTC EILATGKPCILIPSPNV EGHQLKNA LMA LAG+ VITE+ELDS  LR+
Sbjct  316  ISRAGAMTCSEILATGKPCILIPSPNVDEGHQLKNAFLMADLAGSTVITEDELDSTTLRT  375

Query  777  ATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            A EEIL +ESLM +MS+RAL+AAK +AS+EI+++ILS+V+ S
Sbjct  376  AVEEILDNESLMVEMSQRALQAAKPNASSEIAQYILSVVSSS  417



>ref|XP_006442575.1| hypothetical protein CICLE_v10020201mg [Citrus clementina]
 gb|ESR55815.1| hypothetical protein CICLE_v10020201mg [Citrus clementina]
Length=435

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/278 (66%), Positives = 220/278 (79%), Gaps = 16/278 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L AAL  +K V+ EQN+VP IAN VLS                FA K+F+AFDS+IEC
Sbjct  171  ICLSAALQRIKLVIQEQNSVPGIANWVLSF---------------FAHKVFVAFDSTIEC  215

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdl-egegkvvlvlggslgANAINV  419
            F +K KCV CGNPVR SL+  VSK +AR +FFP L    E   +VVLVLGGSLGANA+N+
Sbjct  216  FPRKDKCVACGNPVRLSLRTYVSKVVARLNFFPRLKKEDEANARVVLVLGGSLGANAVNI  275

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             +LNLY  +L E+ +LF+IWQTGVEAF+E+ESLV+ HPRL+LTPFLH+MDLAYAAADLI+
Sbjct  276  AMLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIV  335

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTCYEILATGKP ILIPSPNVAEGHQ KNA LMAKLA +R+ITE+ELDS  L + 
Sbjct  336  SRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETT  395

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             EEILG+E+LMA+MS+RALKAAK  ASA+I++HILSLV
Sbjct  396  IEEILGNEALMAEMSERALKAAKPGASADIAQHILSLV  433



>ref|XP_006477770.1| PREDICTED: uncharacterized protein LOC102629761 [Citrus sinensis]
Length=435

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 184/278 (66%), Positives = 220/278 (79%), Gaps = 16/278 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L AAL  +K V+ EQN+VP IAN VLS                FA K+F+AFDS+IEC
Sbjct  171  ICLSAALQRIKLVIQEQNSVPGIANWVLSF---------------FAHKVFVAFDSTIEC  215

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdl-egegkvvlvlggslgANAINV  419
            F +K +CV CGNPVR SL+  VSK +AR +FFP L    E   +VVLVLGGSLGANA+N+
Sbjct  216  FPRKDECVACGNPVRLSLRTYVSKVVARLNFFPRLKKEDEANARVVLVLGGSLGANAVNI  275

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             +LNLY  +L E+ +LF+IWQTGVEAF+E+ESLV+ HPRL+LTPFLH+MDLAYAAADLI+
Sbjct  276  AMLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIV  335

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTCYEILATGKP ILIPSPNVAEGHQ KNA LMAKLA +RVITE+ELDS  L + 
Sbjct  336  SRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRVITEDELDSITLETT  395

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             EEILG+E+LMA+MS+RALKAAK  ASA+I++HILSLV
Sbjct  396  IEEILGNEALMAEMSERALKAAKPGASADIAQHILSLV  433



>ref|XP_004299569.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like 
[Fragaria vesca subsp. vesca]
Length=428

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 182/282 (65%), Positives = 220/282 (78%), Gaps = 17/282 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL GVK V+ EQNAVP IAN +LS                 A+ +F+AF+S+I+C
Sbjct  158  VGIAAALRGVKLVIQEQNAVPGIANWLLSF---------------LAEVVFVAFNSTIDC  202

Query  243  F--WQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN  416
            F     KKCVVCGNPVR SL++NVSKE AR  FFP+ G    + KV+LVLGGSLGANAIN
Sbjct  203  FPSASGKKCVVCGNPVRLSLRKNVSKEAARGRFFPKCGKEVEDVKVLLVLGGSLGANAIN  262

Query  417  VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLI  596
            + LLNLY  +L E++DLF+IWQTGVEA++E+ESLVK HPRL+L PF+H MDLAYAAADL+
Sbjct  263  IALLNLYYQMLLEKEDLFIIWQTGVEAYNEMESLVKNHPRLLLKPFMHKMDLAYAAADLV  322

Query  597  ISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRS  776
            +SR+GAMTCYEILATGKP ILIPSP+  EGHQ KNA LMA LAGARVITE+ELDS  L +
Sbjct  323  VSRAGAMTCYEILATGKPSILIPSPDADEGHQFKNASLMADLAGARVITEDELDSTTLGN  382

Query  777  ATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            A EEI+GDES MADMS+RALKAA ++AS EI+ H+LSLV+ S
Sbjct  383  AIEEIVGDESKMADMSERALKAANVNASEEIAHHVLSLVSLS  424



>ref|XP_008240221.1| PREDICTED: uncharacterized protein LOC103338756 isoform X1 [Prunus 
mume]
Length=440

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 215/285 (75%), Gaps = 18/285 (6%)
 Frame = +3

Query  60   AIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIE  239
            AI L A L G K V+ EQNAVP IAN VLS                 AD +F+AFDS+I+
Sbjct  167  AIGLAAKLKGAKLVIQEQNAVPGIANWVLSF---------------LADAVFVAFDSTID  211

Query  240  CFWQ-KKKCVVCGNPVRSSLKRNVSKEMARQHFFPel--gdlegegkvvlvlggslgANA  410
            CF + K KCVVCGNPVR SLK+ VSK +AR  FFP         + KV+LVLGGSLGANA
Sbjct  212  CFPRGKTKCVVCGNPVRLSLKKQVSKAVARGRFFPRSCEIGKLEKAKVLLVLGGSLGANA  271

Query  411  INVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAAD  590
            IN+ +LNLY  +L E ++LF+IWQTGVEA +E+ESLVK HP L+LTPF+H+MD AYAAAD
Sbjct  272  INIAVLNLYYQMLLENENLFIIWQTGVEAHNEMESLVKNHPHLLLTPFMHSMDSAYAAAD  331

Query  591  LIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFAL  770
            L++SR+GAMTCYEILATGKP ILIPSPNVAEGHQ KNA LMA LAGARVITE+ELDS  L
Sbjct  332  LVVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMADLAGARVITEDELDSTTL  391

Query  771  RSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             SA EEILGDES MA++S+RALK +   AS EI++HILSLVN S 
Sbjct  392  GSAIEEILGDESKMAELSERALKTSNSSASVEIAQHILSLVNLST  436



>ref|XP_007209147.1| hypothetical protein PRUPE_ppa005855mg [Prunus persica]
 gb|EMJ10346.1| hypothetical protein PRUPE_ppa005855mg [Prunus persica]
Length=440

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 214/285 (75%), Gaps = 18/285 (6%)
 Frame = +3

Query  60   AIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIE  239
            AI L A L G K V+ EQNAVP IAN VLS                 AD +F+AFDS+I+
Sbjct  167  AIGLAAKLKGAKLVIQEQNAVPGIANWVLSI---------------LADAVFVAFDSTID  211

Query  240  CFWQ-KKKCVVCGNPVRSSLKRNVSKEMARQHFFPel--gdlegegkvvlvlggslgANA  410
            CF + K KCVVCGNPVR SLK+ VSK +AR  FFP         + KV+LVLGGSLGANA
Sbjct  212  CFPRGKTKCVVCGNPVRLSLKKQVSKAVARGRFFPSSCEIGELEKAKVLLVLGGSLGANA  271

Query  411  INVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAAD  590
            IN+ +LNLY  +L E ++LF+IWQTGVEA +E+ESLVK HP L+LTPF+H+MD AYAAAD
Sbjct  272  INIAVLNLYYQMLLENENLFIIWQTGVEAHNEMESLVKNHPHLLLTPFMHSMDTAYAAAD  331

Query  591  LIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFAL  770
            L++SR+GAMTCYEILATGKP ILIPSPNVAEGHQ KNA LMA LAGA VITE+ELDS  L
Sbjct  332  LVVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMADLAGASVITEDELDSTTL  391

Query  771  RSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             SA EEILGDES MA++S+RALK A   AS EI++HILSLVN S 
Sbjct  392  GSAIEEILGDESKMAELSERALKTANSSASVEIAQHILSLVNLST  436



>emb|CBI15500.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 214/281 (76%), Gaps = 17/281 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L AAL G+K V+ EQN+VP IAN VLS                FAD++F+AF+SSI+ 
Sbjct  168  VCLAAALKGLKLVIQEQNSVPGIANWVLSW---------------FADQVFVAFNSSID-  211

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINV  419
            ++ K KC+V GNPVR S++R VSK  AR HFFP   +    E KVVLVLGGSLGANAIN+
Sbjct  212  YFPKHKCIVSGNPVRLSVRRYVSKAAARLHFFPSYVNSGNLEAKVVLVLGGSLGANAINI  271

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             +LNLY  +L E K+LF+IWQTGVEAF E+ESLVK HP LVL+PFLH MDLAYAAADL++
Sbjct  272  AMLNLYYQMLLEHKNLFIIWQTGVEAFDEMESLVKNHPHLVLSPFLHNMDLAYAAADLVV  331

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTC EILATGKP ILIPSPNVAEGHQ KNA LMA LAG+RVITE+ELDS  LR A
Sbjct  332  SRAGAMTCTEILATGKPSILIPSPNVAEGHQFKNAILMADLAGSRVITEDELDSTTLRIA  391

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
             EEIL D SLMADM +RALK AK  ASAEI+ HI+SLV  S
Sbjct  392  IEEILDDPSLMADMCERALKVAKPHASAEIAHHIISLVKMS  432



>ref|XP_010663641.1| PREDICTED: uncharacterized protein LOC100242239 [Vitis vinifera]
Length=447

 Score =   321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 214/281 (76%), Gaps = 17/281 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L AAL G+K V+ EQN+VP IAN VLS                FAD++F+AF+SSI+ 
Sbjct  179  VCLAAALKGLKLVIQEQNSVPGIANWVLSW---------------FADQVFVAFNSSID-  222

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINV  419
            ++ K KC+V GNPVR S++R VSK  AR HFFP   +    E KVVLVLGGSLGANAIN+
Sbjct  223  YFPKHKCIVSGNPVRLSVRRYVSKAAARLHFFPSYVNSGNLEAKVVLVLGGSLGANAINI  282

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             +LNLY  +L E K+LF+IWQTGVEAF E+ESLVK HP LVL+PFLH MDLAYAAADL++
Sbjct  283  AMLNLYYQMLLEHKNLFIIWQTGVEAFDEMESLVKNHPHLVLSPFLHNMDLAYAAADLVV  342

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTC EILATGKP ILIPSPNVAEGHQ KNA LMA LAG+RVITE+ELDS  LR A
Sbjct  343  SRAGAMTCTEILATGKPSILIPSPNVAEGHQFKNAILMADLAGSRVITEDELDSTTLRIA  402

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
             EEIL D SLMADM +RALK AK  ASAEI+ HI+SLV  S
Sbjct  403  IEEILDDPSLMADMCERALKVAKPHASAEIAHHIISLVKMS  443



>ref|XP_002524882.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase, putative 
[Ricinus communis]
 gb|EEF37506.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase, putative 
[Ricinus communis]
Length=437

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 207/275 (75%), Gaps = 16/275 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G+K V+ EQN+VP IAN +LSS               F++ +F+A++S++ECF 
Sbjct  172  LAALLRGIKIVIQEQNSVPGIANSILSS---------------FSEVVFVAYNSTVECFS  216

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
            +K KCVV GNPVR SL+++VS+E+AR+ FFP          ++++ G    AN IN+ LL
Sbjct  217  KKHKCVVSGNPVRLSLRQSVSQEVARKEFFPRSSGKGEAKVILVLGGSFG-ANTINIALL  275

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N+YS +L + K+  +IWQTGVEAF+E+ESLV+ HP LVLTPFLH+MDLAYAAADL++SR+
Sbjct  276  NVYSQLLLQHKNWLIIWQTGVEAFNEMESLVRNHPHLVLTPFLHSMDLAYAAADLVVSRA  335

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EILATGKP ILIPSP   EGHQ +NA LMA +AG+R+ITE+ELDS  L +  EE
Sbjct  336  GAMTCSEILATGKPAILIPSPYAEEGHQFRNASLMADVAGSRIITEDELDSTTLGTTIEE  395

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            ILGDE++MADMS+RA KAAK DASAEI+ HILSLV
Sbjct  396  ILGDETVMADMSERARKAAKPDASAEIAGHILSLV  430



>ref|XP_009360125.1| PREDICTED: uncharacterized protein LOC103950621 [Pyrus x bretschneideri]
Length=439

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 209/282 (74%), Gaps = 18/282 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECF-  245
            L A L G K V+ EQN VP IAN VLS                FAD +F+ F+ +I+ F 
Sbjct  169  LAAKLIGAKLVIQEQNRVPGIANWVLSF---------------FADIVFVVFNCTIDSFP  213

Query  246  WQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdl--egegkvvlvlggslgANAINV  419
              + KCVVCGNPVR SLK+ V K  AR  FFP+ G +    + +V+LVLGGSLGANAIN+
Sbjct  214  TGRTKCVVCGNPVRLSLKKQVPKAAARGRFFPKGGGVEELEKARVLLVLGGSLGANAINI  273

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             LLNLY  +L E +DLF+IWQTGVEA +E+ESLVK H RL+LTPFLH+M+LAYAAADLI+
Sbjct  274  ALLNLYYQMLLENEDLFIIWQTGVEAHNEMESLVKNHRRLLLTPFLHSMELAYAAADLIV  333

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTCYEIL TGKP ILIPSPNVAEGHQ KNA LMA LAG RVITE+ELDS  L S 
Sbjct  334  SRAGAMTCYEILVTGKPSILIPSPNVAEGHQFKNASLMADLAGTRVITEDELDSTTLGST  393

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             EEILGDES MA++SKRALKAA  +AS EI +H+LSLVN S 
Sbjct  394  IEEILGDESKMAELSKRALKAANSNASVEIVQHVLSLVNLST  435



>ref|XP_008374787.1| PREDICTED: uncharacterized protein LOC103438028 [Malus domestica]
Length=442

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/282 (63%), Positives = 209/282 (74%), Gaps = 18/282 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G K V+ EQN VP IAN VLS                FAD +F+A++ +I+CF 
Sbjct  172  LAAKLIGAKLVIQEQNGVPGIANWVLSF---------------FADVVFVAYNCTIDCFP  216

Query  249  Q-KKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdleg--egkvvlvlggslgANAINV  419
              + KCVVCGNPVR SLK+ V K  A   FFP+ G +    + KV+LVLGGSLGANAIN+
Sbjct  217  SGRTKCVVCGNPVRLSLKKQVPKAAATGRFFPKAGGVGELEKAKVLLVLGGSLGANAINI  276

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             LLNLY  +L E  +LF+IWQTGVE  +E+ESLVK HP L+LTPFLH+MDLAYAAADLI+
Sbjct  277  ALLNLYYQMLLENDNLFIIWQTGVEVHNEMESLVKNHPHLLLTPFLHSMDLAYAAADLIV  336

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTCYEILATGKP ILIPSPNVAEGHQ +NA LMA LAG RVITE+ELDS  L SA
Sbjct  337  SRAGAMTCYEILATGKPSILIPSPNVAEGHQFRNASLMADLAGTRVITEDELDSTTLWSA  396

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             EEILGDES MA++S+RALKAA  +AS EI + +LSLVN S 
Sbjct  397  IEEILGDESKMAELSERALKAANSNASTEIVQRVLSLVNLST  438



>ref|XP_009347547.1| PREDICTED: uncharacterized protein LOC103939212 [Pyrus x bretschneideri]
Length=436

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/285 (62%), Positives = 212/285 (74%), Gaps = 18/285 (6%)
 Frame = +3

Query  60   AIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIE  239
            ++ L A L G K V+ EQN VP IAN VLS                FAD +F+A++ +I+
Sbjct  163  SLGLAAKLIGAKLVIQEQNGVPGIANWVLSF---------------FADVVFVAYNCTID  207

Query  240  CFWQ-KKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdleg--egkvvlvlggslgANA  410
            CF   + KCVVCGNPVR SLK+ V K +A   FFP+ G +    + KV+LVLGGSLGANA
Sbjct  208  CFPSGRTKCVVCGNPVRLSLKKQVPKAVATGRFFPKAGGVGELEKAKVLLVLGGSLGANA  267

Query  411  INVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAAD  590
            IN+ LLNLY  +L E  +LF+IWQTGVE  +E+ESLVK HP L+LTPFLH++DLAYAAAD
Sbjct  268  INIALLNLYYQMLLENDNLFIIWQTGVEVHNEMESLVKNHPHLLLTPFLHSVDLAYAAAD  327

Query  591  LIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFAL  770
            LI+SR+GAMTCYEILATGKP ILIPSPNVAEGHQ +NA LMA LAG RVITE+ELDS  L
Sbjct  328  LIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFRNASLMADLAGTRVITEDELDSTTL  387

Query  771  RSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             SA EEILGDES MA++S+RALKAA  +AS EI + +LSLVN S 
Sbjct  388  GSAIEEILGDESKMAELSERALKAANSNASTEIVQRVLSLVNLST  432



>ref|XP_007036629.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase, putative 
[Theobroma cacao]
 gb|EOY21130.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase, putative 
[Theobroma cacao]
Length=469

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 219/310 (71%), Gaps = 43/310 (14%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L A L   K V+ EQN+VP IAN VLS                FAD +F+AF+S++EC
Sbjct  171  VCLAALLQRTKLVIQEQNSVPGIANWVLSF---------------FADLVFVAFNSTVEC  215

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlgg---slgANAI  413
            F +K+KCVVCGNPVR SLK   SK ++R HFFPEL  +EG  + V V+     SLGANA+
Sbjct  216  FPRKEKCVVCGNPVRLSLKGLASKAVSRLHFFPELAKMEGSSEEVKVILVLGGSLGANAV  275

Query  414  NVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTP--------------  551
            N+ LLN+YS +L E K+ F+IWQTGVE+F+E+ESLV+ H +L+LTP              
Sbjct  276  NIALLNVYSQLLLEHKNWFIIWQTGVESFNEMESLVRNHRQLLLTPKIGYKDDVEKTMRR  335

Query  552  -----------FLHAMDLAYAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLK  698
                       FLH+M+LAYAAADLIISR+GAMTC EILATGKP ILIPSPNVAEGHQ +
Sbjct  336  NMCYFMSHKDMFLHSMELAYAAADLIISRAGAMTCSEILATGKPSILIPSPNVAEGHQFR  395

Query  699  NACLMAKLAGARVITENELDSFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKH  878
            NA LMA +AG+ VITE+ELDS  L +A  EILGDE+L+ +MS+RALKAAKLDASAEI+KH
Sbjct  396  NASLMADVAGSMVITEDELDSTTLGTAISEILGDENLLTEMSERALKAAKLDASAEIAKH  455

Query  879  ILSLVNFSVI  908
            ILSLVN S +
Sbjct  456  ILSLVNLSAV  465



>ref|XP_010268482.1| PREDICTED: uncharacterized protein LOC104605180 [Nelumbo nucifera]
Length=433

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 213/281 (76%), Gaps = 17/281 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L AAL G+K V+ EQN++P IANRVLS                FAD IF+ F+SS+  
Sbjct  167  VCLTAALQGLKVVIQEQNSMPGIANRVLSR---------------FADLIFVVFNSSL-V  210

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdl-egegkvvlvlggslgANAINV  419
            ++ K KCVVCGNPVRSSL+R VSK +AR HFFP+     + E KV+LVLGGS GANAIN+
Sbjct  211  YFPKDKCVVCGNPVRSSLRRYVSKAVARTHFFPKAAKTWDPEAKVILVLGGSFGANAINI  270

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             +LNLY  +L E  ++F+IWQTGVE F+E++SLVK HPRL+L PFLH MD AYAAADL++
Sbjct  271  AILNLYYQMLAENDNIFIIWQTGVETFNEMDSLVKNHPRLLLRPFLHKMDWAYAAADLVV  330

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTC EI+ATGKP ILIPSPNVAEGHQ KNA +MA LAG++VITE+ELDS  LR A
Sbjct  331  SRAGAMTCSEIVATGKPSILIPSPNVAEGHQTKNAFIMADLAGSKVITEDELDSTTLRIA  390

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
             EEILG+ S M +MS++A+K A+ +A+ EI++ ILSLV  S
Sbjct  391  IEEILGNASQMVEMSEKAMKIARPEAAVEIAQRILSLVKLS  431



>ref|XP_008352203.1| PREDICTED: uncharacterized protein LOC103415676 [Malus domestica]
Length=462

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 206/282 (73%), Gaps = 18/282 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G K V+ EQN VP IAN VLS                FAD +F+ F+ +I+ F 
Sbjct  192  LAAKLIGAKLVIQEQNRVPGIANWVLSF---------------FADIVFVVFNCTIDSFP  236

Query  249  Q-KKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvl--vlggslgANAINV  419
              + KCVVCGNP+R SLK+ V K  AR  FFP+ G +E   K  +  VLGGSLGANAIN+
Sbjct  237  SGRTKCVVCGNPLRLSLKKXVPKAAARGRFFPKAGGVEELEKAKVLLVLGGSLGANAINI  296

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             LLNLY  +L E +DLF+IWQTGVEA +E+ESLVK H RL+LTPFLH+M+LAYAAADLI+
Sbjct  297  ALLNLYYQMLLENEDLFIIWQTGVEAHNEMESLVKNHRRLLLTPFLHSMELAYAAADLIV  356

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTCYEILATGKP ILIPSPNVAEGHQ KNA LMA LAG RVITE+ELDS  L S 
Sbjct  357  SRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMADLAGTRVITEDELDSTTLGST  416

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             EE+L DES MA +S+RALKAA  +AS EI +H+LSLVN S 
Sbjct  417  IEEMLADESKMAXLSERALKAANXNASVEIVQHVLSLVNLST  458



>ref|XP_011004084.1| PREDICTED: uncharacterized protein LOC105110678 isoform X1 [Populus 
euphratica]
Length=439

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 163/279 (58%), Positives = 204/279 (73%), Gaps = 18/279 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L   K V+HEQN+VP IAN +LS                F+  +FL+++S+IECF 
Sbjct  176  LAALLQRTKIVIHEQNSVPGIANYILSY---------------FSHLVFLSYNSTIECFP  220

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
            +K  CVV GNPVR SL++ VSK +AR  FFP  G+      V+    G   ANAIN+ LL
Sbjct  221  KKHNCVVTGNPVRLSLRQFVSKAVARLEFFPMAGEEAKVILVLGGSLG---ANAINIALL  277

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N+YS +L E KD ++IWQTGVE+++E+ESLV+ H  LVL PFLH+MDLAYAAADLI+SR+
Sbjct  278  NVYSQMLLEHKDWYIIWQTGVESYNEMESLVRNHSNLVLKPFLHSMDLAYAAADLIVSRA  337

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EILATGK  ILIPSP+VAEGHQ KNA LMA +AG RVITE+ELDS  L +A EE
Sbjct  338  GAMTCSEILATGKSAILIPSPDVAEGHQFKNASLMADVAGTRVITEDELDSTTLGTAIEE  397

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            ILGD++L A+MS+RAL+AAK DAS++I++HILSLV  S 
Sbjct  398  ILGDDALRAEMSERALRAAKPDASSQIAQHILSLVESST  436



>gb|KCW48565.1| hypothetical protein EUGRSUZ_K02237 [Eucalyptus grandis]
Length=352

 Score =   301 bits (770),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 167/279 (60%), Positives = 212/279 (76%), Gaps = 17/279 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G++ V+ EQNA+P +AN +L+                 AD +F+AF+S+++ F 
Sbjct  84   LAAVLKGIRLVIQEQNALPGLANWILAH---------------LADVVFVAFNSTVDSF-  127

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKL  425
             K KCVVCGNPVR ++K++VS+  AR HFFP++  +     KVVLVLGGSLGA  IN+ L
Sbjct  128  PKHKCVVCGNPVRLAMKKSVSQVEARLHFFPKVESVGDSGVKVVLVLGGSLGAYTINIAL  187

Query  426  LNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
            LNLY  +L E ++LF+IWQTGVE+F+E+ESLV+ HP L++ PFL +MD+AYAA+DLI+SR
Sbjct  188  LNLYYQMLMESENLFIIWQTGVESFNEMESLVRNHPHLMMRPFLRSMDMAYAASDLIVSR  247

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GAMTC EILATGKP ILIPSPNVAEGHQ KNA LMA LAG R+I E+ELDS  L+ A E
Sbjct  248  AGAMTCSEILATGKPSILIPSPNVAEGHQFKNAALMADLAGTRIINEDELDSTTLKVAIE  307

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            E+LGDE+ +A MS+RALKAAK +ASAEISK ILSLVN S
Sbjct  308  EMLGDENQLAVMSERALKAAKPEASAEISKRILSLVNSS  346



>ref|XP_002317900.2| glycosyl transferase family 28 family protein [Populus trichocarpa]
 gb|EEE96120.2| glycosyl transferase family 28 family protein [Populus trichocarpa]
Length=442

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 163/279 (58%), Positives = 203/279 (73%), Gaps = 18/279 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L   K V+HEQN+VP IAN VLS                F+  +FL+++S+IECF 
Sbjct  179  LAALLQRTKIVIHEQNSVPGIANYVLSY---------------FSHLVFLSYNSTIECFP  223

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
            +K  CVV GNPVR SL++ VS+ +AR  FFP  G+      V+    G   ANAIN+ LL
Sbjct  224  KKHNCVVTGNPVRVSLRQFVSRAVARLEFFPMAGEEAKVILVLGGSLG---ANAINIALL  280

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N+YS +L E KD ++IWQTGVE+++E+ESLV+ H  LVL PFLH+MDLAYAAADLI+SR+
Sbjct  281  NVYSQMLLEHKDWYIIWQTGVESYNEMESLVRNHSNLVLKPFLHSMDLAYAAADLIVSRA  340

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EILATGK  ILIPSP+VAEGHQ KNA LMA +AG RVITE+ELDS  L +A EE
Sbjct  341  GAMTCSEILATGKSAILIPSPDVAEGHQFKNASLMADVAGTRVITEDELDSTTLGTAIEE  400

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            IL D++L A+MS+RAL+AAK DASA+I++HILSLV  S 
Sbjct  401  ILDDDALRAEMSERALRAAKPDASAQIAQHILSLVESST  439



>ref|XP_010039006.1| PREDICTED: uncharacterized protein LOC104427642 [Eucalyptus grandis]
Length=486

 Score =   300 bits (768),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 167/281 (59%), Positives = 213/281 (76%), Gaps = 17/281 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L A L G++ V+ EQNA+P +AN +L+                 AD +F+AF+S+++ 
Sbjct  216  VCLAAVLKGIRLVIQEQNALPGLANWILAH---------------LADVVFVAFNSTVDS  260

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINV  419
            F  K KCVVCGNPVR ++K++VS+  AR HFFP++  +     KVVLVLGGSLGA  IN+
Sbjct  261  F-PKHKCVVCGNPVRLAMKKSVSQVEARLHFFPKVESVGDSGVKVVLVLGGSLGAYTINI  319

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             LLNLY  +L E ++LF+IWQTGVE+F+E+ESLV+ HP L++ PFL +MD+AYAA+DLI+
Sbjct  320  ALLNLYYQMLMESENLFIIWQTGVESFNEMESLVRNHPHLMMRPFLRSMDMAYAASDLIV  379

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GAMTC EILATGKP ILIPSPNVAEGHQ KNA LMA LAG R+I E+ELDS  L+ A
Sbjct  380  SRAGAMTCSEILATGKPSILIPSPNVAEGHQFKNAALMADLAGTRIINEDELDSTTLKVA  439

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
             EE+LGDE+ +A MS+RALKAAK +ASAEISK ILSLVN S
Sbjct  440  IEEMLGDENQLAVMSERALKAAKPEASAEISKRILSLVNSS  480



>ref|XP_004167534.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like 
[Cucumis sativus]
Length=443

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 206/276 (75%), Gaps = 16/276 (6%)
 Frame = +3

Query  81   LGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKK  260
            + GVK  + EQN+VP  AN VLS                FAD +F+  +S++ECF +KKK
Sbjct  177  INGVKLAIQEQNSVPGFANWVLSH---------------FADIVFVVLNSTVECFPRKKK  221

Query  261  CVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKLLNLY  437
            C+VCGNPVR +LK++V K +AR HFFP     E  E KV+L+LGGSLGANAIN+ +LNLY
Sbjct  222  CLVCGNPVRLTLKQHVPKSVARLHFFPRSRKGEDLEAKVLLILGGSLGANAINIAMLNLY  281

Query  438  SNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
              +L E K+L++IWQTGV+ F E++SLVK HPRL LTPF+H++ LAYAAADL++SR+GAM
Sbjct  282  YQMLLENKNLYIIWQTGVKTFDEMDSLVKNHPRLHLTPFMHSLHLAYAAADLVVSRAGAM  341

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            TC EILATGKP ILIPSP+  EGHQ +NA +MA +AG+ VI E+ELDS  L SA +EILG
Sbjct  342  TCSEILATGKPSILIPSPHEDEGHQFRNASIMADMAGSTVINEDELDSTTLASAIQEILG  401

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            DE+ MAD+S+RAL+ +K +AS EI +HI SL++ S 
Sbjct  402  DETKMADLSERALRVSKPNASTEIVQHIGSLIDLST  437



>ref|XP_010540005.1| PREDICTED: uncharacterized protein LOC104813907 [Tarenaya hassleriana]
Length=441

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 206/277 (74%), Gaps = 17/277 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A + G+K V+ EQN+VP IAN VLS                FADKIF AF+S++  F 
Sbjct  178  LAAVVLGIKLVIQEQNSVPGIANWVLSF---------------FADKIFTAFNSAVNSFP  222

Query  249  QKK--KCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            ++   KCVVCGNP+R +L+R +SK  AR ++F +      E KVVLVL GSLGAN++N+ 
Sbjct  223  KRSAAKCVVCGNPIRQALRRYISKAAARVNYFGQWAGAMAEAKVVLVLSGSLGANSVNIA  282

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            LLN YS VL E ++ F IWQTGVEAF E++SLV++HPRL L PFL ++D+AYAA+DL++S
Sbjct  283  LLNCYSQVLSEHENWFFIWQTGVEAFDEMDSLVRSHPRLFLAPFLKSIDMAYAASDLVVS  342

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GAMTC EILA GKP ILIPSP   EGHQL+NA LMA + GA+VI+E ELDS ALR+A 
Sbjct  343  RAGAMTCSEILALGKPSILIPSPKNEEGHQLRNASLMADIVGAKVISEEELDSIALRTAM  402

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            EE+LGDE  MA+MS+RALKAAK DA++ I++HILSLV
Sbjct  403  EEVLGDEERMAEMSERALKAAKPDAASVIAQHILSLV  439



>ref|XP_008461957.1| PREDICTED: uncharacterized protein LOC103500410 [Cucumis melo]
Length=443

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 207/276 (75%), Gaps = 16/276 (6%)
 Frame = +3

Query  81   LGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKK  260
            + GVK  + EQN+VP  AN VLS                FAD +F+  +S++ECF +KKK
Sbjct  177  INGVKLAIQEQNSVPGFANWVLSH---------------FADMVFVVLNSTVECFPRKKK  221

Query  261  CVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKLLNLY  437
            C+VCGNPVR +LK++V K +AR HFFP  G  E  E KV+L+LGGSLGANAIN+ +LNLY
Sbjct  222  CLVCGNPVRLTLKQHVPKAVARLHFFPRSGKGEDLEAKVLLILGGSLGANAINIAMLNLY  281

Query  438  SNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
              +L E K+L++IWQTGV+ F E++SLVK HPRL LTPF+H++ LAYAAADL++SR+ AM
Sbjct  282  YQMLLENKNLYIIWQTGVKTFDEMDSLVKNHPRLHLTPFMHSLHLAYAAADLVVSRARAM  341

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            TC EILATGKP ILIPSP+  EGHQL+NA +MA +AG+ VI E+ELDS  L SA +EILG
Sbjct  342  TCSEILATGKPSILIPSPHDDEGHQLRNASIMADMAGSTVIDEDELDSTTLASAIQEILG  401

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            DE+ MAD+S+RAL+ +K +AS EI +HI +L+N S 
Sbjct  402  DETKMADLSERALRVSKPNASTEIVQHIGTLINLST  437



>ref|XP_003524354.2| PREDICTED: uncharacterized protein LOC100808262 isoform X1 [Glycine 
max]
Length=407

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/279 (57%), Positives = 192/279 (69%), Gaps = 19/279 (7%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G   V+HE N+VP  AN +LS                FAD IF+AF+S+++ F 
Sbjct  139  LAAKLRGTNVVIHEPNSVPGFANSLLSF---------------FADAIFVAFNSTLDSF-  182

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             + KC VCGNPVR S++  VSK  A  HFFP          V+    G   ANA+N+ +L
Sbjct  183  PRNKCFVCGNPVRLSIRNLVSKVTAMSHFFPGSDSGSRILLVLAGSFG---ANAVNIAML  239

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            NLY  +L +   L++IWQTGVEAF E++SLVKTHPRL +TPF+H M LAYAAADLI+SR+
Sbjct  240  NLYYQMLRQDSGLYVIWQTGVEAFDEMDSLVKTHPRLYITPFMHCMGLAYAAADLIVSRA  299

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTCYEILATGKP ILIPSPN +EG+Q +NA LMA LAG  VITE+ELDS  L  A E+
Sbjct  300  GAMTCYEILATGKPSILIPSPNFSEGNQFRNASLMADLAGVTVITEDELDSSTLAIAIEK  359

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            IL D+  M DMS+RALKAA  +ASAEI+KHILSLVN S 
Sbjct  360  ILRDKKKMEDMSERALKAANPNASAEIAKHILSLVNLST  398



>ref|XP_004137489.1| PREDICTED: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase-like 
[Cucumis sativus]
Length=443

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 205/276 (74%), Gaps = 16/276 (6%)
 Frame = +3

Query  81   LGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKK  260
            + GVK  + EQN+VP  AN VLS                FAD +F+  +S++ECF +KKK
Sbjct  177  INGVKLAIQEQNSVPGFANWVLSH---------------FADIVFVVLNSTVECFPRKKK  221

Query  261  CVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKLLNLY  437
            C+VCGNPVR +LK++V K +AR HFFP     E  E KV+L+LGGSLGANAIN+ +LNLY
Sbjct  222  CLVCGNPVRLTLKQHVPKSVARLHFFPRSRKGEDLEAKVLLILGGSLGANAINIAMLNLY  281

Query  438  SNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
              +L E K+L++IWQTGV+ F E++SLVK HPRL LTPF+H++ LAYAAADL++SR+GAM
Sbjct  282  YQMLLENKNLYIIWQTGVKTFDEMDSLVKNHPRLHLTPFMHSLHLAYAAADLVVSRAGAM  341

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            TC EILATGKP ILIPSP+  EGHQ +NA +MA +AG+ VI E+ELDS  L SA +EILG
Sbjct  342  TCSEILATGKPSILIPSPHEDEGHQFRNASIMADMAGSTVINEDELDSTTLASAIQEILG  401

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            D + MAD+S+RAL+ +K +AS EI +HI SL++ S 
Sbjct  402  DGTKMADLSERALRVSKPNASTEIVQHIGSLIDLST  437



>gb|KDP35168.1| hypothetical protein JCGZ_10702 [Jatropha curcas]
Length=447

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 160/277 (58%), Positives = 207/277 (75%), Gaps = 16/277 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+K V+ EQN+VP IAN +LS                FA+ +F+A++S++ECF +K
Sbjct  184  ALIRGIKVVIQEQNSVPGIANYILSF---------------FAEIVFVAYNSTVECFSRK  228

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             KC+V GNP+R SL++++SK +AR+ FFP  G  E    ++++ G    AN IN+ LLNL
Sbjct  229  NKCLVSGNPIRLSLRKSLSKAVARKKFFPSSGGNEEAKVILVLGGSLG-ANTINIALLNL  287

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            YS +L E ++ F+IWQTGVEA++E+ESLV+ HP LVLT FLH+MDLAY AADL++SR+GA
Sbjct  288  YSQLLLEHENWFIIWQTGVEAYNEMESLVRNHPHLVLTQFLHSMDLAYTAADLVVSRAGA  347

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EILATGKP ILIPSP   EGHQLKNA LMA +AG+RVITE+ELDS  L +  EEIL
Sbjct  348  MTCSEILATGKPAILIPSPLAEEGHQLKNASLMADVAGSRVITEDELDSTTLGTTIEEIL  407

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            GDE+ MADMS+RALKAA+ DASAEI++ ILSLV  S 
Sbjct  408  GDETAMADMSERALKAARPDASAEIAQRILSLVEAST  444



>ref|XP_007160477.1| hypothetical protein PHAVU_002G325300g [Phaseolus vulgaris]
 gb|ESW32471.1| hypothetical protein PHAVU_002G325300g [Phaseolus vulgaris]
Length=418

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/279 (55%), Positives = 190/279 (68%), Gaps = 19/279 (7%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G   V+HE N+VP  +N +L+                 AD IF+AF+S++E F 
Sbjct  148  LAAKLSGTNVVIHEPNSVPCFSNTLLAP---------------LADAIFVAFNSTLESF-  191

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             + KC VCGNPVR S++  VSKE A  +FFP L        V+    G   AN++N+ +L
Sbjct  192  PRNKCFVCGNPVRFSVRNLVSKETAISNFFPGLDSGGRVLLVLAGSYG---ANSVNIAML  248

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            NLY  +L     L +IWQTG EAF E++SLVK+HPRL +TPF+H MDLAYAAADLI+SR+
Sbjct  249  NLYYQMLRRDSGLRIIWQTGFEAFDEMDSLVKSHPRLYMTPFMHCMDLAYAAADLIVSRA  308

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTCYEILATGKP ILIPSPN +EG+Q +NA LMA LAG  VITE+ELDS  L  A E+
Sbjct  309  GAMTCYEILATGKPSILIPSPNFSEGNQFRNASLMADLAGVTVITEDELDSSTLAIAIEK  368

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            IL D+  M DMS+RALKAA  +ASAEI+K ILS+VN S 
Sbjct  369  ILRDQKKMEDMSERALKAANPNASAEIAKRILSIVNEST  407



>ref|XP_006843780.1| hypothetical protein AMTR_s00007p00245790 [Amborella trichopoda]
 gb|ERN05455.1| hypothetical protein AMTR_s00007p00245790 [Amborella trichopoda]
Length=446

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/278 (54%), Positives = 200/278 (72%), Gaps = 16/278 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L AAL G K V+ EQN  P + NR+LS                FA  IF++F +S+  F+
Sbjct  179  LVAALRGFKVVIQEQNCQPGLTNRILSL---------------FATLIFVSFPASV-GFF  222

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             K KCV+ GNPVR SL+R VSK +AR HFFP+        ++VL+LGGSLGANAIN+ +L
Sbjct  223  PKSKCVITGNPVRPSLRRFVSKAVARSHFFPKAARSAASAQLVLILGGSLGANAINIAVL  282

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N Y  +L E K+ ++IWQTG++AF E+ESLV+ HPR+ L  ++H MD+AYAAADL++SR+
Sbjct  283  NFYLQMLSEHKNRYIIWQTGLDAFDEMESLVRGHPRVSLVSYMHRMDMAYAAADLVVSRA  342

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
             +MTC EILATGKP ILIPSPN AE HQ KNA +MA++AG++V+ E+ELDS  L +  EE
Sbjct  343  VSMTCTEILATGKPSILIPSPNAAEDHQTKNASIMAEIAGSKVLAEDELDSTTLANVIEE  402

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            ILG+E+LMA+MS++A KAA  DAS  I++ ILSLV+ S
Sbjct  403  ILGNETLMAEMSEKATKAAMPDASTRIAERILSLVDLS  440



>ref|XP_010695645.1| PREDICTED: uncharacterized protein LOC104908248 [Beta vulgaris 
subsp. vulgaris]
Length=432

 Score =   273 bits (697),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 206/285 (72%), Gaps = 17/285 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L A+L G K V+ EQ+++P +AN  LS                FAD +F+A++SS++ 
Sbjct  161  ICLIASLKGFKMVIQEQSSIPGLANWFLSL---------------FADLVFVAYNSSVDS  205

Query  243  F-WQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggsl-gANAIN  416
            F   KKK VV GNPVR SL++ VS+ +AR +FFP L  +     VVL++ G   GAN++N
Sbjct  206  FPTDKKKIVVTGNPVRLSLRKFVSEAVARAYFFPRLAKVSESEVVVLLVLGGSFGANSMN  265

Query  417  VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLI  596
            + L N+Y+ +L +R++L ++W+TGVE+F E+ESLV+ HPRLVL PFL +MD+AYAAADL+
Sbjct  266  IALFNIYNQMLVDRQNLHIVWETGVESFDEMESLVRNHPRLVLAPFLRSMDMAYAAADLV  325

Query  597  ISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRS  776
            +SR+GAMTC E+L TGKP ILIPSP  AEGHQ +NA LMA LAG+R+ITE+ELDS  LR+
Sbjct  326  VSRAGAMTCSELLVTGKPAILIPSPIDAEGHQFQNASLMADLAGSRIITEDELDSTTLRN  385

Query  777  ATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSVIS  911
            A  +IL +E LM  MS+RAL+AAK +A AEI++ +++LV+ S + 
Sbjct  386  AITDILDNELLMKTMSERALQAAKPNAGAEIAERVIALVDLSPVG  430



>ref|XP_009403920.1| PREDICTED: uncharacterized protein LOC103987357 [Musa acuminata 
subsp. malaccensis]
Length=433

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/282 (52%), Positives = 201/282 (71%), Gaps = 18/282 (6%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L AAL G+K V+ EQN+ P + NR+ +                 A+ IF+AF++ ++ 
Sbjct  165  VCLAAALSGIKIVIQEQNSHPGLVNRLAAP---------------CAETIFVAFNACVKH  209

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslg--ANAIN  416
            F  +KKC+V GNPVR +L+R VSK +AR HFFP+ G   GE K  +VL       A AIN
Sbjct  210  F-DRKKCLVYGNPVRVALRRYVSKAVARSHFFPKAGPKSGEDKAQVVLVLGGSCGAEAIN  268

Query  417  VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLI  596
            + +LN+Y  +L + K+  +IWQTG + F+E+ESLVK + RL LTPFLH MDLAYAAAD++
Sbjct  269  IAVLNMYYEMLLQHKNRLIIWQTGADGFNEMESLVKVNRRLHLTPFLHEMDLAYAAADVV  328

Query  597  ISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRS  776
            +SRSGAMTC EIL TGKP IL+P PN A+ HQ KNA +MA +AG++V+TE+ELDS +L  
Sbjct  329  VSRSGAMTCTEILTTGKPSILVPLPNAADDHQTKNAYIMADIAGSKVLTEDELDSSSLEE  388

Query  777  ATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            A +++LG+ESLMA+MS+RAL AA+ DA+++I++ ILSLVN S
Sbjct  389  AIDDVLGNESLMAEMSERALSAARPDAASDIAQCILSLVNPS  430



>gb|KHG16752.1| UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Gossypium 
arboreum]
Length=488

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 215/334 (64%), Gaps = 74/334 (22%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G+K V+ EQN+VP IANR LS                FAD +F+AF+S+++ F 
Sbjct  166  LAALLKGIKVVIQEQNSVPGIANRFLSL---------------FADLVFVAFNSTVQSFP  210

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFP---elgdlegegkvvlvlggslgANAINV  419
            +K+KCVVCGNPVR SLK +VSK ++R HFFP   ++     E KV+LVLGGSLGANA+N+
Sbjct  211  RKEKCVVCGNPVRLSLKNSVSKALSRLHFFPWLEKMEGSSEEIKVILVLGGSLGANAVNI  270

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
             LLN+YS +L E ++ F+IWQTGVE+F+E+ESLV++HPRL+L PFLH+M++AYAAADL++
Sbjct  271  ALLNVYSQLLLEHENWFIIWQTGVESFNEMESLVRSHPRLLLAPFLHSMNMAYAAADLVV  330

Query  600  SRSGAMTCYEILATGKPCI----LIPSPNVAE--------------------GHQLK---  698
            SR+GAMTC EILATGKP I    L+PSP+  +                     H+L+   
Sbjct  331  SRAGAMTCSEILATGKPSILVPLLVPSPHQKQFPVYKFLQQLISCNNLFTRLFHKLRLNI  390

Query  699  ---NACLMAKLA--------------------------GARVITENELDSFALRSATEEI  791
               N+ L   L                           G+RVITE+ELDS  L SA  EI
Sbjct  391  LKLNSLLFNSLGDATKVPSPNVAEGHQHKNAFLMADVAGSRVITEDELDSTTLGSAISEI  450

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            LGDE L+A+MS+RAL AAK DASAEI+KHILSLV
Sbjct  451  LGDERLLAEMSQRALNAAKPDASAEIAKHILSLV  484



>ref|XP_008809180.1| PREDICTED: uncharacterized protein LOC103720974 [Phoenix dactylifera]
Length=421

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 188/276 (68%), Gaps = 18/276 (7%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AAL G+K V+ EQN  P I NR L+                +A+KIFLAF++ ++ ++  
Sbjct  154  AALAGLKLVIQEQNCYPGITNRALAP---------------YAEKIFLAFNACLK-YFPT  197

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +KC+V GNP+R S+    SK  AR HFFPE GD   +  +VL       ANA+NV  L  
Sbjct  198  EKCIVAGNPIRLSIGHGASKAKARSHFFPEAGDGRAQVVLVLGGSTG--ANALNVVFLET  255

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            Y  +L E +D ++IWQTG E + E ++LVK H RL+L PFL AMDLAYAA+D+++SR+GA
Sbjct  256  YYKMLVEHEDWYIIWQTGAELYDETKTLVKNHSRLLLAPFLDAMDLAYAASDVVVSRAGA  315

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EIL TGKP ILIPSP  AE HQ KNA +MA LAG++V+TE ELDS  L     E+L
Sbjct  316  MTCTEILTTGKPSILIPSPTSAEDHQTKNAYMMADLAGSKVLTEEELDSNLLEDTINEVL  375

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            GDESLMA+MS++A++AA+ +AS++I+K ILSLV  S
Sbjct  376  GDESLMAEMSEKAMRAARPNASSDIAKCILSLVEQS  411



>ref|XP_011004085.1| PREDICTED: uncharacterized protein LOC105110678 isoform X2 [Populus 
euphratica]
Length=405

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/242 (58%), Positives = 172/242 (71%), Gaps = 18/242 (7%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L   K V+HEQN+VP IAN +LS                F+  +FL+++S+IECF 
Sbjct  176  LAALLQRTKIVIHEQNSVPGIANYILSY---------------FSHLVFLSYNSTIECFP  220

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
            +K  CVV GNPVR SL++ VSK +AR  FFP  G+      V+    G   ANAIN+ LL
Sbjct  221  KKHNCVVTGNPVRLSLRQFVSKAVARLEFFPMAGEEAKVILVLGGSLG---ANAINIALL  277

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N+YS +L E KD ++IWQTGVE+++E+ESLV+ H  LVL PFLH+MDLAYAAADLI+SR+
Sbjct  278  NVYSQMLLEHKDWYIIWQTGVESYNEMESLVRNHSNLVLKPFLHSMDLAYAAADLIVSRA  337

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EILATGK  ILIPSP+VAEGHQ KNA LMA +AG RVITE+ELDS  L +A EE
Sbjct  338  GAMTCSEILATGKSAILIPSPDVAEGHQFKNASLMADVAGTRVITEDELDSTTLGTAIEE  397

Query  789  IL  794
            IL
Sbjct  398  IL  399



>ref|XP_006390518.1| hypothetical protein EUTSA_v10018574mg [Eutrema salsugineum]
 gb|ESQ27804.1| hypothetical protein EUTSA_v10018574mg [Eutrema salsugineum]
Length=436

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 193/271 (71%), Gaps = 17/271 (6%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKK--KC  263
            +K V+ EQ+++P   N +LS                FAD IF  F+ ++    ++   KC
Sbjct  177  LKLVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCTVTNLPKRAAAKC  221

Query  264  VVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            VV GNP+R +L+R  SK  AR  FF +      E KVVLVLGGSLGANAIN+ LLN YS 
Sbjct  222  VVYGNPIRQALRRYASKGAARVSFFGQWAGAVSEAKVVLVLGGSLGANAINIALLNCYSQ  281

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL  + +AYAAADL+ISR+GAMTC
Sbjct  282  MLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRTIGVAYAAADLVISRAGAMTC  341

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EI+A GKP ILIPSP+  EG Q++NA LMA + G+++ITE ELDS  LR+A E+I+G+E
Sbjct  342  SEIMALGKPSILIPSPHSDEGDQVRNASLMADIVGSKLITEEELDSITLRAAVEDIIGNE  401

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVN  896
             LM +MS+RA KAA+ DA+++++KHI+S+VN
Sbjct  402  ELMTEMSERAFKAARPDAASDVAKHIISIVN  432



>ref|XP_006390519.1| hypothetical protein EUTSA_v10018574mg [Eutrema salsugineum]
 gb|ESQ27805.1| hypothetical protein EUTSA_v10018574mg [Eutrema salsugineum]
Length=436

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 193/271 (71%), Gaps = 17/271 (6%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKK--KC  263
            +K V+ EQ+++P   N +LS                FAD IF  F+ ++    ++   KC
Sbjct  177  LKLVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCTVTNLPKRAAAKC  221

Query  264  VVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            VV GNP+R +L+R  SK  AR  FF +      E KVVLVLGGSLGANAIN+ LLN YS 
Sbjct  222  VVYGNPIRQALRRYASKGAARVSFFGQWAGAVSEAKVVLVLGGSLGANAINIALLNCYSQ  281

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL  + +AYAAADL+ISR+GAMTC
Sbjct  282  MLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRTIGVAYAAADLVISRAGAMTC  341

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EI+A GKP ILIPSP+  EG Q++NA LMA + G+++ITE ELDS  LR+A E+I+G+E
Sbjct  342  SEIMALGKPSILIPSPHSDEGDQVRNASLMADIVGSKLITEEELDSITLRAAVEDIIGNE  401

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVN  896
             LM +MS+RA KAA+ DA+++++KHI+S+VN
Sbjct  402  ELMTEMSERAFKAARPDAASDVAKHIISIVN  432



>ref|XP_010428310.1| PREDICTED: uncharacterized protein LOC104712992 [Camelina sativa]
Length=431

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 194/276 (70%), Gaps = 17/276 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A +   KFV+ EQ+++P   N +LS                FAD IF  F+ ++    ++
Sbjct  167  AVISRTKFVIQEQDSIPGTTNWILSY---------------FADTIFAPFNCTVTNLPKR  211

Query  255  --KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R  SK  AR  FF +      + KVVL+LGGSLGANAIN+ LL
Sbjct  212  VAAKCVVYGNPIRQALRRYSSKGAARVSFFGQWAGAVSDAKVVLLLGGSLGANAINIALL  271

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N YS +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL ++ +AYAAADL+ISR+
Sbjct  272  NCYSQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRA  331

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q+++A LMA   G+++ITE ELDS  LR+A E+
Sbjct  332  GAMTCSEIMALGKPSILIPSPHSDEGDQIRHASLMADSVGSKLITEEELDSITLRAAMED  391

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            ILG+E LM +MS+RA K AK DA+++++KHI+S++N
Sbjct  392  ILGNEELMTEMSERAFKCAKPDAASDVAKHIISIIN  427



>gb|KDO49789.1| hypothetical protein CISIN_1g031484mg [Citrus sinensis]
Length=159

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +LNLY  +L E+ +LF+IWQTGVEAF+E+ESLV+ HPRL+LTPFLH+MDLAYAAADLI+S
Sbjct  1    MLNLYYQMLMEKHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVS  60

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GAMTCYEILATGKP ILIPSPNVAEGHQ KNA LMAKLA +R+ITE+ELDS  L +  
Sbjct  61   RAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDELDSITLETTI  120

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            EEILG+E+LMA+MS+RALKAAK  ASA+I++HILSLV
Sbjct  121  EEILGNEALMAEMSERALKAAKPGASADIAQHILSLV  157



>ref|XP_010916467.1| PREDICTED: uncharacterized protein LOC105041272 [Elaeis guineensis]
Length=416

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/281 (50%), Positives = 188/281 (67%), Gaps = 18/281 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A L G+K V+ EQN  P I NR+L                 +A+KIF+AF+S ++ ++  
Sbjct  154  AVLAGLKLVIQEQNCYPGITNRILGP---------------YAEKIFIAFNSCLK-YFPT  197

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +KC+V GNP+R S+   VSK  AR  FFPE G+   +  +VL       ANA+NV  L  
Sbjct  198  EKCIVAGNPIRLSIGHGVSKAKARSRFFPESGEGRAQAVLVLGGSTG--ANALNVVFLET  255

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            Y  +L + +D ++IWQTG E ++E +SLVK+H RL+L PFL AMDLAYAAAD+++SR+GA
Sbjct  256  YHKMLVDHEDRYIIWQTGAEWYNETKSLVKSHSRLLLAPFLDAMDLAYAAADVVVSRAGA  315

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EIL TGKP +LIPSP  A+ HQ KNA +MA LAG++V+TE ELDS  L     E+L
Sbjct  316  MTCTEILTTGKPSVLIPSPTAADDHQTKNAYIMADLAGSKVLTEEELDSNLLEDTINEVL  375

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFSVISCE  917
            GDESLMA+MS++A +AA+ +AS+ I+K ILSLV  S    E
Sbjct  376  GDESLMAEMSEKARRAARPNASSYIAKCILSLVEQSSADLE  416



>ref|XP_002887503.1| glycosyl transferase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63762.1| glycosyl transferase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 193/275 (70%), Gaps = 17/275 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A +   K V+ EQ+++P   N +LS                FAD IF  F+ ++    ++
Sbjct  168  AVISRTKLVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCTVTNLPKR  212

Query  255  --KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R  SK  AR  FF +      E KVVL+LGGSLGANAIN+ LL
Sbjct  213  VAGKCVVYGNPIRQALRRYSSKGAARVSFFGQWAGAVSEAKVVLLLGGSLGANAINIALL  272

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N YS +L E +  F +WQTGVEAF E++SLV++HPRL L+PFL ++ +AYAAADL+ISR+
Sbjct  273  NCYSQLLSEHESWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRA  332

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q++NA LMA + G+++ITE ELD+  LR+A E+
Sbjct  333  GAMTCSEIMALGKPSILIPSPHSDEGDQVRNASLMADIVGSKLITEEELDTITLRAAMED  392

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            ILG+E LM +MS+RA KAAK DA+++++KHI+S++
Sbjct  393  ILGNEELMMEMSERAFKAAKPDAASDVAKHIISII  427



>gb|KFK41815.1| hypothetical protein AALP_AA2G175000 [Arabis alpina]
Length=426

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 188/270 (70%), Gaps = 17/270 (6%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK--KKC  263
            +  V+ EQ+++P   N +LS                FAD IF  F+ ++    Q+   KC
Sbjct  167  LNLVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCTVTNLPQRVASKC  211

Query  264  VVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            VV GNP+R  L+R VSK  AR  FF +      + KVVLVLGGSLGANAIN+ LLN YS 
Sbjct  212  VVYGNPIRQVLRRFVSKGAARVGFFGQWSGAVVDAKVVLVLGGSLGANAINIALLNCYSE  271

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            VL E ++ F +WQTGVEAF E++SLVK+HPRL L+PFL ++ +AYAAADL+ISR+GAMTC
Sbjct  272  VLCEHENWFFVWQTGVEAFDEMDSLVKSHPRLFLSPFLRSVGVAYAAADLVISRAGAMTC  331

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EILA GKP ILIPSP+  EG Q++NA LMA + G+++ITE ELD+  LR+A EEILG+E
Sbjct  332  SEILALGKPSILIPSPHSDEGDQIRNASLMADIVGSKLITEEELDTITLRAAMEEILGNE  391

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLV  893
             LM +MS RA  AAK DA+ +++ HI+S+V
Sbjct  392  ELMTEMSARAFNAAKPDAALDVANHIISIV  421



>ref|XP_010416193.1| PREDICTED: uncharacterized protein LOC104702077 [Camelina sativa]
Length=434

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 193/276 (70%), Gaps = 17/276 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A +   KFV+ EQ+++P   N +LS                FAD IF  F+ ++    ++
Sbjct  170  AVISRTKFVIQEQDSIPGTTNWILSY---------------FADTIFAPFNCTVTNLPKR  214

Query  255  --KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
                CVV GNP+R +L+R  SK  AR  FF +      + KVVL+LGGSLGANAIN+ LL
Sbjct  215  VAANCVVYGNPIRQALRRYSSKGAARVSFFGQWAGAVSDAKVVLLLGGSLGANAINIALL  274

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N YS +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL ++ +AYAAADL+ISR+
Sbjct  275  NCYSQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRA  334

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q+++A LMA   G+++ITE ELDS  LR+A E+
Sbjct  335  GAMTCSEIMALGKPSILIPSPHSDEGDQIRHASLMADSVGSKLITEEELDSITLRAAIED  394

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            ILG+E LM +MS+RA K AK DA+++++KHI+S++N
Sbjct  395  ILGNEELMTEMSERAFKCAKPDAASDVAKHIISIIN  430



>emb|CDY60139.1| BnaA07g39040D [Brassica napus]
Length=404

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 192/275 (70%), Gaps = 17/275 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA+  +K V+ EQ+++P   N +LS                FAD IF  F+ ++    ++
Sbjct  140  AAIMRLKLVIQEQDSIPGTTNWILSL---------------FADTIFTPFNCTVSNLPKR  184

Query  255  K--KCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R VSK  AR  FF +      + +VVLVL GSLGANAIN+ LL
Sbjct  185  AAAKCVVYGNPIRQALRRYVSKGAARVSFFGQWAGAVSDARVVLVLSGSLGANAINIALL  244

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N Y  +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL  + +AYAAADL+ISR+
Sbjct  245  NCYLQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRNISVAYAAADLVISRA  304

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q ++A LMA + G++VITE ELD+  LR+A EE
Sbjct  305  GAMTCSEIMALGKPSILIPSPHTDEGDQERSASLMADIVGSKVITEEELDTITLRAAIEE  364

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            ILG+E LM +MS+RAL+A K DA+ +++KHI+S+V
Sbjct  365  ILGNEELMREMSERALRAGKPDAALDVAKHIISIV  399



>ref|XP_010471441.1| PREDICTED: uncharacterized protein LOC104751230 [Camelina sativa]
Length=436

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 193/276 (70%), Gaps = 17/276 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A +   KFV+ EQ+++P     VLS                FAD IF  F+ ++    ++
Sbjct  172  AVISRTKFVIQEQDSIPGTTYWVLSF---------------FADTIFAPFNCTVTNLPKR  216

Query  255  --KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R  SK  AR  FF +      + KVVL+LGGSLGANAIN+ LL
Sbjct  217  VAAKCVVYGNPIRQALRRYSSKGAARVSFFGQWAGAVSDAKVVLLLGGSLGANAINIALL  276

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N YS +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL ++ +AYAAADL+ISR+
Sbjct  277  NCYSQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRA  336

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q+++A LMA   G+++ITE ELDS  LR+A E+
Sbjct  337  GAMTCSEIMALGKPSILIPSPHSDEGDQIRHASLMADSVGSKLITEEELDSITLRAAMED  396

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            ILG+E LM +MS+RA K AK DA+++++KHI+S++N
Sbjct  397  ILGNEELMTEMSERAFKCAKPDAASDVAKHIISIIN  432



>ref|XP_008792827.1| PREDICTED: uncharacterized protein LOC103709313 isoform X2 [Phoenix 
dactylifera]
Length=334

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 199/276 (72%), Gaps = 18/276 (7%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A L G+K  + EQN+ P + NRVL+                +A+KIFLAF+  ++ F  K
Sbjct  71   AVLSGIKIAIQEQNSFPGLTNRVLAP---------------YAEKIFLAFNGCVKHF-PK  114

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            KKC+V GNPVR SL+R  SK +AR HFFP+ G  + +  +VL       A AINV +LN+
Sbjct  115  KKCLVYGNPVRLSLRRYTSKAVARSHFFPKAGSDKAQVVLVLGGSAG--AGAINVTVLNM  172

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            Y  +L E K+ ++IWQTG E + E+ESLVK + RL+LTPFLHAMD+AYAAAD+++SR+GA
Sbjct  173  YYEMLLEHKNRYIIWQTGAEGYREMESLVKNNRRLLLTPFLHAMDMAYAAADVVVSRAGA  232

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EILA+GKP ILIPSP  A+ HQ KNA +MA +AG++V+TE+ELD+ +L++A +EIL
Sbjct  233  MTCTEILASGKPSILIPSPFAADDHQTKNAYIMADIAGSKVLTEDELDASSLQTAIDEIL  292

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            G+E LMA+MS++ALK A+  A+A+I+K ILSLV  S
Sbjct  293  GNEHLMAEMSEKALKFARPSAAADIAKCILSLVVLS  328



>emb|CDX73010.1| BnaC06g34580D [Brassica napus]
Length=432

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 191/275 (69%), Gaps = 17/275 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA+  +K V+ EQ+++P   N +LS                FA  IF  F+ ++    ++
Sbjct  168  AAIMRLKLVIQEQDSIPGTTNWILSL---------------FAHTIFTPFNCTVSNLPKR  212

Query  255  K--KCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R VSK  AR  FF +      + +VVLVL GSLGANAIN+ LL
Sbjct  213  AAAKCVVYGNPIRQALRRYVSKGAARVSFFGQWAGAVSDARVVLVLSGSLGANAINIALL  272

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N Y  +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL  + +AYAAADL+ISR+
Sbjct  273  NCYLQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRNISVAYAAADLVISRA  332

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP +LIPSP+  EG Q ++A LMA + G++VITE ELD+  LR+A EE
Sbjct  333  GAMTCSEIMALGKPSVLIPSPHTDEGDQERSASLMADIVGSKVITEEELDTITLRAAIEE  392

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            ILG+E LM +MS+RALKA K DA+ +++KHI+S+V
Sbjct  393  ILGNEELMREMSERALKAGKPDAALDVAKHIISIV  427



>ref|XP_009106033.1| PREDICTED: uncharacterized protein LOC103831850 [Brassica rapa]
Length=432

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 139/275 (51%), Positives = 191/275 (69%), Gaps = 17/275 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA+  +K V+ EQ+++P   N +LS                FAD I   F+ ++    ++
Sbjct  168  AAIMRLKLVIQEQDSIPGTTNWILSL---------------FADTICTPFNCTVSNLPKR  212

Query  255  K--KCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R VSK  AR  FF +      + +VVLVL GSLGANAIN+ LL
Sbjct  213  AAAKCVVYGNPIRQALRRYVSKRAARVSFFGQWAGAVSDARVVLVLSGSLGANAINIALL  272

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N Y  +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL  + +AYAAADL+ISR+
Sbjct  273  NCYLQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRNISVAYAAADLVISRA  332

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP +LIPSP+  EG Q ++A LMA + G++VITE ELD+  LR+A EE
Sbjct  333  GAMTCSEIMALGKPSVLIPSPHTDEGDQERSASLMADIVGSKVITEEELDTITLRAAIEE  392

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            ILG+E LM +MS+RAL+A K DA+ +++KHI+S+V
Sbjct  393  ILGNEELMREMSERALRAGKPDAALDVAKHIISIV  427



>ref|XP_006301831.1| hypothetical protein CARUB_v10022300mg [Capsella rubella]
 gb|EOA34729.1| hypothetical protein CARUB_v10022300mg [Capsella rubella]
Length=709

 Score =   259 bits (661),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 194/276 (70%), Gaps = 17/276 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G  FV+ EQ+++P   N +LS                FAD IF  F+ ++    ++
Sbjct  174  AVILGTTFVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCAVTNLPKR  218

Query  255  --KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R  SK  AR  FF +      + KVVL+LGGSLGANAIN+ LL
Sbjct  219  VAAKCVVYGNPIRQALRRYSSKGAARVSFFGQWAGAVSDAKVVLLLGGSLGANAINIALL  278

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N YS +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL ++ +AYAAADL+ISR+
Sbjct  279  NCYSQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRA  338

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q++NA LMA   G+++ITE ELDS  LR+A E+
Sbjct  339  GAMTCSEIMALGKPSILIPSPHSDEGDQVRNASLMADSVGSKLITEEELDSITLRAAMED  398

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            ILG+E LM +MS+RA K AK +A+++++KHI+S++N
Sbjct  399  ILGNEELMTEMSERAFKCAKPEAASDVAKHIISIIN  434



>ref|XP_008792826.1| PREDICTED: uncharacterized protein LOC103709313 isoform X1 [Phoenix 
dactylifera]
Length=459

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 199/276 (72%), Gaps = 18/276 (7%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A L G+K  + EQN+ P + NRVL+                +A+KIFLAF+  ++ F  K
Sbjct  196  AVLSGIKIAIQEQNSFPGLTNRVLAP---------------YAEKIFLAFNGCVKHF-PK  239

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            KKC+V GNPVR SL+R  SK +AR HFFP+ G  + +  +VL       A AINV +LN+
Sbjct  240  KKCLVYGNPVRLSLRRYTSKAVARSHFFPKAGSDKAQVVLVLGGSAG--AGAINVTVLNM  297

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            Y  +L E K+ ++IWQTG E + E+ESLVK + RL+LTPFLHAMD+AYAAAD+++SR+GA
Sbjct  298  YYEMLLEHKNRYIIWQTGAEGYREMESLVKNNRRLLLTPFLHAMDMAYAAADVVVSRAGA  357

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EILA+GKP ILIPSP  A+ HQ KNA +MA +AG++V+TE+ELD+ +L++A +EIL
Sbjct  358  MTCTEILASGKPSILIPSPFAADDHQTKNAYIMADIAGSKVLTEDELDASSLQTAIDEIL  417

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            G+E LMA+MS++ALK A+  A+A+I+K ILSLV  S
Sbjct  418  GNEHLMAEMSEKALKFARPSAAADIAKCILSLVVLS  453



>ref|XP_010906977.1| PREDICTED: uncharacterized protein LOC105033764 [Elaeis guineensis]
Length=459

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 197/273 (72%), Gaps = 18/273 (7%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A L G+K  + EQN+ P + NR L+                +A+KIFLAF+  ++ F  K
Sbjct  197  AVLSGIKIAIQEQNSFPGLTNRALAP---------------YAEKIFLAFNGCVKHF-PK  240

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            KKC+V GNPVR SL+R  SK +AR HFFP+ G  + +  +VL       A AINV +LN+
Sbjct  241  KKCLVYGNPVRLSLRRYTSKVVARSHFFPKAGSDKAQVVLVLGGSAG--AGAINVTVLNM  298

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            Y  +L E K+ ++IWQTG E + E+ESLVK + RL+LTPFLHAMD+AYAAAD+++SR+GA
Sbjct  299  YYEMLLEHKNRYIIWQTGAEGYSEMESLVKNNKRLLLTPFLHAMDMAYAAADVVVSRAGA  358

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EILA GKP ILIPSP VA+ HQ KNA +MA +AG++V+TE+ELDS +L++A +EIL
Sbjct  359  MTCTEILAAGKPSILIPSPFVADDHQTKNAYIMADIAGSKVLTEDELDSSSLQTAIDEIL  418

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            G+E LMA+MS++ALK A+  A+A+++K ILSLV
Sbjct  419  GNEHLMAEMSEKALKFARPGAAADVAKCILSLV  451



>ref|XP_006645942.1| PREDICTED: uncharacterized protein LOC102703743, partial [Oryza 
brachyantha]
Length=278

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/283 (47%), Positives = 190/283 (67%), Gaps = 18/283 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G+ FV+ +Q+A P  A R+L+                 A +IFL F++ +    
Sbjct  12   LAAVLLGLPFVIQDQDAGPAPATRLLAP---------------LARRIFLGFNAPVR-LL  55

Query  249  QKKKCVVCGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVK  422
             K+KC V GNPVR S+++  +SK  A   FFP +G +  +G  VL++ G    +  INV 
Sbjct  56   PKRKCAVYGNPVRMSIRKCRISKADAITSFFPRMGAVGEQGVEVLLVLGGTEGSPEINVS  115

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            LLN+Y  +L ERK+ ++IWQTG + F E+ESLVK+H RL+LTPFLH +D AYAAAD+++S
Sbjct  116  LLNMYKEMLRERKNRYIIWQTGPDGFCEMESLVKSHRRLLLTPFLHELDKAYAAADVVVS  175

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+G+M+C E+L TGKP ILIP P + + HQ KNA +MA + GA+VITE+ELDS +LR+  
Sbjct  176  RAGSMSCTEVLVTGKPSILIPLPTIVDDHQTKNAYIMADVMGAKVITEDELDSTSLRAVI  235

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSVIS  911
            +E+ GDE LM+DMS++AL A++ +AS +I +HI SLV  S  +
Sbjct  236  DEVFGDEKLMSDMSQKALSASRPNASTDIIRHICSLVGLSCTT  278



>gb|KFK41817.1| hypothetical protein AALP_AA2G175000 [Arabis alpina]
Length=926

 Score =   256 bits (655),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 188/270 (70%), Gaps = 17/270 (6%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK--KKC  263
            +  V+ EQ+++P   N +LS                FAD IF  F+ ++    Q+   KC
Sbjct  167  LNLVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCTVTNLPQRVASKC  211

Query  264  VVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            VV GNP+R  L+R VSK  AR  FF +      + KVVLVLGGSLGANAIN+ LLN YS 
Sbjct  212  VVYGNPIRQVLRRFVSKGAARVGFFGQWSGAVVDAKVVLVLGGSLGANAINIALLNCYSE  271

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            VL E ++ F +WQTGVEAF E++SLVK+HPRL L+PFL ++ +AYAAADL+ISR+GAMTC
Sbjct  272  VLCEHENWFFVWQTGVEAFDEMDSLVKSHPRLFLSPFLRSVGVAYAAADLVISRAGAMTC  331

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EILA GKP ILIPSP+  EG Q++NA LMA + G+++ITE ELD+  LR+A EEILG+E
Sbjct  332  SEILALGKPSILIPSPHSDEGDQIRNASLMADIVGSKLITEEELDTITLRAAMEEILGNE  391

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLV  893
             LM +MS RA  AAK DA+ +++ HI+S+V
Sbjct  392  ELMTEMSARAFNAAKPDAALDVANHIISIV  421



>gb|EEE54689.1| hypothetical protein OsJ_01999 [Oryza sativa Japonica Group]
Length=433

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/277 (48%), Positives = 187/277 (68%), Gaps = 18/277 (6%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV FV+ +Q+A P  A R+L+                 A +IFL F++ +     K+KC 
Sbjct  173  GVPFVIQDQDAGPAPATRLLAP---------------LARRIFLGFNAPVR-LLPKRKCA  216

Query  267  VCGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYS  440
            V GNPVR S+++  +SK  A   FFP +G +  EG  VL++ G    +  INV LLN+Y 
Sbjct  217  VYGNPVRMSIRKCRISKADAMASFFPRIGTVGEEGVEVLLVLGGTEGSPEINVALLNMYY  276

Query  441  NVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMT  620
             +L ER++ ++IWQTG E F E+ESLV++H RL+LTPFLH +D AYAAAD+++SR+G+M+
Sbjct  277  EMLRERRNRYIIWQTGPEGFCEMESLVRSHRRLLLTPFLHELDKAYAAADVVVSRAGSMS  336

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
            C E+L TGKP ILIP P + + HQ KNA +MA + GA+VITE+ELDS +LRS  +E+ GD
Sbjct  337  CTEVLVTGKPSILIPLPTMVDDHQTKNAYIMADVMGAKVITEDELDSSSLRSIIDEVFGD  396

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSLVNFSVIS  911
            E LM+DMS++AL AA+ +AS +I +HI SLV  S  +
Sbjct  397  EKLMSDMSQKALSAARPNASTDIIRHICSLVGSSCTT  433



>gb|EAY74292.1| hypothetical protein OsI_02179 [Oryza sativa Indica Group]
Length=433

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/277 (48%), Positives = 187/277 (68%), Gaps = 18/277 (6%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV FV+ +Q+A P  A R+L+                 A +IFL F++ +     K+KC 
Sbjct  173  GVPFVIQDQDAGPAPATRLLAP---------------LARRIFLGFNAPVR-LLPKRKCA  216

Query  267  VCGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYS  440
            V GNPVR S+++  +SK  A   FFP +G +  EG  VL++ G    +  INV LLN+Y 
Sbjct  217  VYGNPVRMSIRKCRISKADAMASFFPRIGTVGEEGVEVLLVLGGTEGSPEINVALLNMYY  276

Query  441  NVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMT  620
             +L ER++ ++IWQTG E F E+ESLV++H RL+LTPFLH +D AYAAAD+++SR+G+M+
Sbjct  277  EMLRERRNRYIIWQTGPEGFCEMESLVRSHRRLLLTPFLHELDKAYAAADVVVSRAGSMS  336

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
            C E+L TGKP ILIP P + + HQ KNA +MA + GA+VITE+ELDS +LRS  +E+ GD
Sbjct  337  CTEVLVTGKPSILIPLPTMVDDHQTKNAYIMADVMGAKVITEDELDSSSLRSIIDEVFGD  396

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSLVNFSVIS  911
            E LM+DMS++AL AA+ +AS +I +HI SLV  S  +
Sbjct  397  EKLMSDMSQKALSAARPNASTDIIRHICSLVGSSCTT  433



>dbj|BAD73572.1| putative murG [Oryza sativa Japonica Group]
Length=433

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/277 (48%), Positives = 187/277 (68%), Gaps = 18/277 (6%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV FV+ +Q+A P  A R+L+                 A +IFL F++ +     K+KC 
Sbjct  173  GVPFVIQDQDAGPAPATRLLAP---------------LARRIFLGFNAPVR-LLPKRKCA  216

Query  267  VCGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYS  440
            V GNPVR S+++  +SK  A   FFP +G +  EG  VL++ G    +  INV LLN+Y 
Sbjct  217  VYGNPVRMSIRKCRISKADAMASFFPRIGTVGEEGVEVLLVLGGTEGSPEINVALLNMYY  276

Query  441  NVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMT  620
             +L ER++ ++IWQTG E F E+ESLV++H RL+LTPFLH +D AYAAAD+++SR+G+M+
Sbjct  277  EMLRERRNRYIIWQTGPEGFCEMESLVRSHRRLLLTPFLHELDKAYAAADVVVSRAGSMS  336

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
            C E+L TGKP ILIP P + + HQ KNA +MA + GA+VITE+ELDS +LRS  +E+ GD
Sbjct  337  CTEVLVTGKPSILIPLPTMVDDHQTKNAYIMADVMGAKVITEDELDSSSLRSIIDEVFGD  396

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSLVNFSVIS  911
            E LM+DMS++AL AA+ +AS +I +HI SLV  S  +
Sbjct  397  EKLMSDMSQKALSAARPNASTDIIRHICSLVGSSCTT  433



>ref|NP_177515.1| UDP-Glycosyltransferase superfamily protein [Arabidopsis thaliana]
 gb|AAG52070.1|AC012679_8 putative UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)-pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase; 
62395-63952 [Arabidopsis thaliana]
 gb|AAL24308.1| putative UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)- 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 
[Arabidopsis thaliana]
 gb|AAL47353.1| putative UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)- 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 
[Arabidopsis thaliana]
 gb|AEE35503.1| UDP-Glycosyltransferase superfamily protein [Arabidopsis thaliana]
 gb|AHL38879.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=431

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 195/275 (71%), Gaps = 17/275 (6%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A +   KFV+ EQ+++P   N +LS                FAD IF  F+ ++    ++
Sbjct  167  AVISRTKFVIQEQDSIPGTTNWILSF---------------FADTIFAPFNCTVTNLPKR  211

Query  255  --KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               KCVV GNP+R +L+R  SK  AR  FF +      E KVVL+LGGSLGANAIN+ LL
Sbjct  212  VAAKCVVYGNPIRQTLRRYSSKGAARVSFFGQWAGAVSEPKVVLLLGGSLGANAINIALL  271

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            N YS +L E ++ F +WQTGVEAF E++SLV++HPRL L+PFL ++ +AYAAADL+ISR+
Sbjct  272  NCYSQLLSEHENWFFVWQTGVEAFDEMDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRA  331

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GAMTC EI+A GKP ILIPSP+  EG Q++NA LMA + G+++ITE ELD+  LR+A E+
Sbjct  332  GAMTCSEIMALGKPSILIPSPHSDEGDQVRNASLMADIVGSKLITEEELDTITLRAAMED  391

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            ILG+E LM +MS+RA KAAK DA+++++KHI+S++
Sbjct  392  ILGNEELMMEMSERAFKAAKADAASDVAKHIISII  426



>ref|XP_004968841.1| PREDICTED: uncharacterized protein LOC101768411 isoform X1 [Setaria 
italica]
Length=437

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 178/270 (66%), Gaps = 19/270 (7%)
 Frame = +3

Query  96   FVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCG  275
            FV+ +Q+A P  A R+L+                FA ++FLAF++ +     K+KC V G
Sbjct  179  FVIQDQDASPAPATRLLAP---------------FALRVFLAFNAPVR-LLPKRKCAVYG  222

Query  276  NPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANA--INVKLLNLYSNV  446
            NPVR S LK   SK  A   FFP    L GE    +VL       +  INV +LN+Y  +
Sbjct  223  NPVRMSILKCQASKAEALARFFPREEGLLGEQDAQVVLVLGGAEGSPEINVAVLNVYYEM  282

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
            L +RKD ++IWQTG E F E+ESLV+ H RL LTPFLH +++AYAA+D++ISR+GAMTC 
Sbjct  283  LRKRKDRYIIWQTGTETFCEMESLVRGHRRLFLTPFLHELEMAYAASDVVISRAGAMTCT  342

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            EIL TGKP ILIP P + + HQ +NA +MA + GA+VITE+ELDS +L SA  EI GDE 
Sbjct  343  EILVTGKPSILIPLPTILDHHQTRNAYIMADVMGAKVITEDELDSSSLTSAVHEIFGDEK  402

Query  807  LMADMSKRALKAAKLDASAEISKHILSLVN  896
            LMADMS++AL AA+ +ASA+I +HI SL+ 
Sbjct  403  LMADMSQKALTAARPNASADIIRHICSLIG  432



>ref|NP_001149881.1| glycosyltransferase family 28 C-terminal domain containing protein 
[Zea mays]
 gb|ACG37089.1| glycosyltransferase family 28 C-terminal domain containing protein 
[Zea mays]
 gb|ACN26152.1| unknown [Zea mays]
 tpg|DAA54623.1| TPA: glycosyltransferase family 28 domain containing protein 
[Zea mays]
Length=444

 Score =   240 bits (612),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/276 (49%), Positives = 180/276 (65%), Gaps = 18/276 (7%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            + FV+ +Q+A P  A R+L+                FA +IFLAF++ +     K++C V
Sbjct  185  LPFVIQDQDASPAPATRLLAP---------------FARRIFLAFNAPVR-LLPKRRCAV  228

Query  270  CGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYSN  443
             GNP+R S LK   SK  A   FFP  G L      V+++ G    +  INV +LN+Y  
Sbjct  229  YGNPIRMSILKCRASKTEALARFFPRAGLLGEHEAQVVLVLGGAEGSPEINVAVLNVYYE  288

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L   KD ++IWQTG E F E+ESLVK H RL LTPFLH +++AYAA D++ISR+GAMTC
Sbjct  289  LLRRNKDRYIIWQTGTETFCEMESLVKGHRRLFLTPFLHELEMAYAACDVVISRAGAMTC  348

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EILATGKP ILIP P + + HQ +NA +MA + GA VITE+ELDS +L SA +EI GDE
Sbjct  349  TEILATGKPSILIPLPTILDHHQTRNAYIMADIMGAMVITEDELDSSSLTSAVDEIFGDE  408

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVNFSVIS  911
             LMADMS++AL AA+ +ASA+I +HI SL+  +  S
Sbjct  409  KLMADMSQKALTAARPNASADIIRHICSLIGSTYPS  444



>ref|XP_002457846.1| hypothetical protein SORBIDRAFT_03g015470 [Sorghum bicolor]
 gb|EES02966.1| hypothetical protein SORBIDRAFT_03g015470 [Sorghum bicolor]
Length=439

 Score =   236 bits (603),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 181/271 (67%), Gaps = 19/271 (7%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            + FV+ +Q+A P  A R+L+                FA ++FLAF++ +     K++C V
Sbjct  181  LPFVIQDQDASPAPATRLLAP---------------FARRVFLAFNAPVR-LLPKRRCAV  224

Query  270  CGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYSN  443
             GNP+R S LK + SK  A   FFP  G L      V+++ G    +  INV +LN+Y  
Sbjct  225  YGNPIRMSILKCSASKIEALARFFPRAGLLGEHDAQVVLVLGGAEGSPEINVAVLNVYYE  284

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L   KD ++IWQTG E F E+ESLV+ H RL LTPFLH +++AYAA+D++ISR+GAMTC
Sbjct  285  IL-RSKDRYIIWQTGTETFCEMESLVRGHRRLFLTPFLHELEMAYAASDVVISRAGAMTC  343

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EILATGKP ILIP P + + HQ +NA +MA + GA+VITE+ELDS +L SA +EI GDE
Sbjct  344  TEILATGKPSILIPLPTILDHHQTRNAYIMADIMGAKVITEDELDSSSLTSAVDEIFGDE  403

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVN  896
             LMADMS++AL AA+ +ASA+I +HI SL+ 
Sbjct  404  KLMADMSQKALTAARPNASADIIRHICSLIG  434



>ref|XP_003565791.1| PREDICTED: uncharacterized protein LOC100839498 isoform X1 [Brachypodium 
distachyon]
Length=435

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 176/271 (65%), Gaps = 18/271 (7%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            + FV+ +Q+A P  A R+L+                 A +IFLAF++ +     K+KC V
Sbjct  176  LPFVIQDQDAGPAPATRLLAP---------------LAQRIFLAFNAPVR-LLPKRKCAV  219

Query  270  CGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYSN  443
             GNPVR S++   V K  A   FFP  G +  EG  VL++ G    +  INV +LN+Y  
Sbjct  220  YGNPVRMSIRDCQVPKAAAMARFFPGAGLVGEEGAEVLLVLGGTVGSPQINVAVLNMYYE  279

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L  +K+ ++IWQTG E F E+ESLV+ H RL LTPFL  MD+ YAA D+++SR+G+++C
Sbjct  280  MLTTKKNRYIIWQTGPEDFCEMESLVRGHRRLFLTPFLREMDITYAATDVVVSRAGSVSC  339

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EIL TGKP ILIP P + + HQ KNA +MA + GA+VITE+ELDS +L    +E+ G+E
Sbjct  340  TEILVTGKPAILIPLPTIVDDHQTKNAYIMADVMGAKVITEDELDSSSLTYTIDEVFGNE  399

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVN  896
             LMA+MS++AL AA+ +ASA+I +HI SL+ 
Sbjct  400  KLMAEMSQKALYAARPNASADIIRHICSLIG  430



>ref|XP_008240222.1| PREDICTED: uncharacterized protein LOC103338756 isoform X2 [Prunus 
mume]
Length=355

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 148/203 (73%), Gaps = 18/203 (9%)
 Frame = +3

Query  60   AIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIE  239
            AI L A L G K V+ EQNAVP IAN VLS                 AD +F+AFDS+I+
Sbjct  167  AIGLAAKLKGAKLVIQEQNAVPGIANWVLSF---------------LADAVFVAFDSTID  211

Query  240  CFWQ-KKKCVVCGNPVRSSLKRNVSKEMARQHFFPel--gdlegegkvvlvlggslgANA  410
            CF + K KCVVCGNPVR SLK+ VSK +AR  FFP         + KV+LVLGGSLGANA
Sbjct  212  CFPRGKTKCVVCGNPVRLSLKKQVSKAVARGRFFPRSCEIGKLEKAKVLLVLGGSLGANA  271

Query  411  INVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAAD  590
            IN+ +LNLY  +L E ++LF+IWQTGVEA +E+ESLVK HP L+LTPF+H+MD AYAAAD
Sbjct  272  INIAVLNLYYQMLLENENLFIIWQTGVEAHNEMESLVKNHPHLLLTPFMHSMDSAYAAAD  331

Query  591  LIISRSGAMTCYEILATGKPCIL  659
            L++SR+GAMTCYEILATGKP IL
Sbjct  332  LVVSRAGAMTCYEILATGKPSIL  354



>emb|CDM83086.1| unnamed protein product [Triticum aestivum]
Length=384

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 156/245 (64%), Gaps = 18/245 (7%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G+ FV+ +Q+A P  A R+L+                 + ++FLAF++ +    
Sbjct  155  LAALLLGLPFVIQDQDAGPAPATRLLAP---------------LSRRVFLAFNAPVR-LL  198

Query  249  QKKKCVVCGNPVRSSLK-RNVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVK  422
             K+KC V GNPVR S++ R +SK  A   FFP  G +E EG  V+++      +  INV 
Sbjct  199  PKRKCAVYGNPVRMSIRNRRMSKAAAMARFFPRAGLVEAEGMEVVLVLAGTVGSPQINVA  258

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +LN+Y  +L  RK+ ++IWQTG + F E+ESLV+ H RL LTPFLH MD+ YAA D+++S
Sbjct  259  VLNMYYEMLSRRKNRYIIWQTGPDDFCEMESLVRAHRRLFLTPFLHEMDMTYAATDVVVS  318

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+G++ C EIL TGKP ILIP P + + HQ KNA +MA + GARVITE+ELDS +L    
Sbjct  319  RAGSVACTEILVTGKPAILIPLPTIVDDHQTKNAYIMADVMGARVITEDELDSSSLTCII  378

Query  783  EEILG  797
            +EI+G
Sbjct  379  DEIVG  383



>gb|EMT06710.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Aegilops 
tauschii]
Length=445

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 156/245 (64%), Gaps = 18/245 (7%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G+ FV+ +Q+A P  A R+L+                 + ++FLAF++ +    
Sbjct  155  LAALLLGLPFVIQDQDAGPAPATRLLAP---------------LSRRVFLAFNAPVR-LL  198

Query  249  QKKKCVVCGNPVRSSLK-RNVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVK  422
             K+KC V GNPVR S++ R +SK  A   FFP  G +E EG  V+++      +  INV 
Sbjct  199  PKRKCAVYGNPVRMSIRNRRMSKAAAMARFFPRAGLVEAEGMEVVLVLAGTVGSPQINVA  258

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +LN+Y  +L  RK+ ++IWQTG E F E+ESLV+ H RL LTPFLH MD+ YAA D+++S
Sbjct  259  VLNMYYEMLSRRKNRYIIWQTGPEDFCEMESLVRAHRRLFLTPFLHEMDMTYAATDVVVS  318

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+G++ C EIL TGKP ILIP P + + HQ KNA +MA + GARVITE+ELDS +L    
Sbjct  319  RAGSVACTEILVTGKPAILIPLPTIVDDHQTKNAYIMADVMGARVITEDELDSSSLTCII  378

Query  783  EEILG  797
            +EI+G
Sbjct  379  DEIVG  383



>gb|KHN16503.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Glycine 
soja]
Length=138

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L +   L++IWQTGVEAF E++SLVKTHPRL +TPF+H MDLAYAAADLI+SR+GAMTC
Sbjct  1    MLRQDSGLYVIWQTGVEAFDEMDSLVKTHPRLYITPFMHCMDLAYAAADLIVSRAGAMTC  60

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
            YEI ATGKP ILIPSPN +EG+Q +NA LMA +AG  VITE+ELDS  L  A E+I GD+
Sbjct  61   YEISATGKPSILIPSPNFSEGNQFRNASLMADVAGVTVITEDELDSSTLAIAIEKI-GDK  119

Query  804  SLMADMSKRALKAAKLDAS  860
              M DMS+RALKAA  +AS
Sbjct  120  K-MEDMSERALKAANPNAS  137



>ref|XP_006580417.1| PREDICTED: uncharacterized protein LOC100808262 isoform X3 [Glycine 
max]
Length=329

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 129/197 (65%), Gaps = 19/197 (10%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G   V+HE N+VP  AN +LS                FAD IF+AF+S+++ F 
Sbjct  139  LAAKLRGTNVVIHEPNSVPGFANSLLSF---------------FADAIFVAFNSTLDSF-  182

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             + KC VCGNPVR S++  VSK  A  HFFP          V+    G   ANA+N+ +L
Sbjct  183  PRNKCFVCGNPVRLSIRNLVSKVTAMSHFFPGSDSGSRILLVLAGSFG---ANAVNIAML  239

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            NLY  +L +   L++IWQTGVEAF E++SLVKTHPRL +TPF+H M LAYAAADLI+SR+
Sbjct  240  NLYYQMLRQDSGLYVIWQTGVEAFDEMDSLVKTHPRLYITPFMHCMGLAYAAADLIVSRA  299

Query  609  GAMTCYEILATGKPCIL  659
            GAMTCYEILATGKP IL
Sbjct  300  GAMTCYEILATGKPSIL  316



>ref|XP_006580416.1| PREDICTED: uncharacterized protein LOC100808262 isoform X2 [Glycine 
max]
Length=347

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 129/197 (65%), Gaps = 19/197 (10%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G   V+HE N+VP  AN +LS                FAD IF+AF+S+++ F 
Sbjct  139  LAAKLRGTNVVIHEPNSVPGFANSLLSF---------------FADAIFVAFNSTLDSF-  182

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             + KC VCGNPVR S++  VSK  A  HFFP          V+    G   ANA+N+ +L
Sbjct  183  PRNKCFVCGNPVRLSIRNLVSKVTAMSHFFPGSDSGSRILLVLAGSFG---ANAVNIAML  239

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
            NLY  +L +   L++IWQTGVEAF E++SLVKTHPRL +TPF+H M LAYAAADLI+SR+
Sbjct  240  NLYYQMLRQDSGLYVIWQTGVEAFDEMDSLVKTHPRLYITPFMHCMGLAYAAADLIVSRA  299

Query  609  GAMTCYEILATGKPCIL  659
            GAMTCYEILATGKP IL
Sbjct  300  GAMTCYEILATGKPSIL  316



>ref|XP_010416194.1| PREDICTED: uncharacterized protein LOC104702078 [Camelina sativa]
Length=134

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +3

Query  507  IESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEG  686
            ++SLV++HPRL L+PFL ++ +AYAAADL+ISR+GAMTC EI+A GKP ILIPSP+  EG
Sbjct  1    MDSLVRSHPRLFLSPFLRSIGVAYAAADLVISRAGAMTCSEIMALGKPSILIPSPHSDEG  60

Query  687  HQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMADMSKRALKAAKLDASAE  866
             Q+++A LMA   G+++ITE ELDS  LR+A E+ILG+E LM +MS+RA K AK DA+++
Sbjct  61   DQIRHASLMADSVGSKLITEEELDSITLRAAIEDILGNEELMTEMSERAFKCAKPDAASD  120

Query  867  ISKHILSLVN  896
            ++KHI+S++N
Sbjct  121  VAKHIISIIN  130



>ref|XP_001756202.1| predicted protein [Physcomitrella patens]
 gb|EDQ79068.1| predicted protein [Physcomitrella patens]
Length=367

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 163/277 (59%), Gaps = 17/277 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L AAL G    + EQNA   + NR+L                  A  IF+AF ++   F 
Sbjct  107  LMAALAGTAVAIQEQNAYAGVTNRILGR---------------VAKVIFIAFAAATSYF-  150

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKL  425
             K+KCV  GNP R  L++ + +  A ++FF +L      + +VV+V+GGSLGA  IN  +
Sbjct  151  PKQKCVFIGNPTRRVLQQRIDRLSALRYFFGDLNVDGHEDLEVVVVMGGSLGARIINETM  210

Query  426  LNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
              + S++L++++  ++IWQTG   +      V +HPRL L P++ AM++ YAAAD++++R
Sbjct  211  AEIASSLLEQKRGRYIIWQTGTINYDSTMRRVGSHPRLALLPYVDAMEMMYAAADIVVAR  270

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA+TC E+L T  P ILIP+ +VAE HQ+KNA  MA+   A ++ E +L +  L +   
Sbjct  271  AGAITCSELLVTATPAILIPATSVAEDHQMKNARAMAEGGAATILPERDLVAERLATVIL  330

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             ILGD +    M   AL+ A  DA+ +++KH+LSL +
Sbjct  331  NILGDNAEQRRMQNAALRMAAPDAAQQLAKHVLSLAS  367



>ref|XP_010230929.1| PREDICTED: uncharacterized protein LOC100839498 isoform X2 [Brachypodium 
distachyon]
Length=380

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 136/219 (62%), Gaps = 18/219 (8%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            + FV+ +Q+A P  A R+L+                 A +IFLAF++ +     K+KC V
Sbjct  176  LPFVIQDQDAGPAPATRLLAP---------------LAQRIFLAFNAPVR-LLPKRKCAV  219

Query  270  CGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANA-INVKLLNLYSN  443
             GNPVR S++   V K  A   FFP  G +  EG  VL++ G    +  INV +LN+Y  
Sbjct  220  YGNPVRMSIRDCQVPKAAAMARFFPGAGLVGEEGAEVLLVLGGTVGSPQINVAVLNMYYE  279

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L  +K+ ++IWQTG E F E+ESLV+ H RL LTPFL  MD+ YAA D+++SR+G+++C
Sbjct  280  MLTTKKNRYIIWQTGPEDFCEMESLVRGHRRLFLTPFLREMDITYAATDVVVSRAGSVSC  339

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVI  740
             EIL TGKP ILIP P + + HQ KNA +MA + GA+V+
Sbjct  340  TEILVTGKPAILIPLPTIVDDHQTKNAYIMADVMGAKVM  378



>dbj|BAH23791.1| MurG transferase [Physcomitrella patens]
Length=400

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 163/277 (59%), Gaps = 17/277 (6%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L AAL G    + EQNA   + NR+L                  A  IF+AF ++   F 
Sbjct  140  LMAALAGTAVAIQEQNAYAGVTNRILGR---------------VAKVIFIAFAAATSYF-  183

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKL  425
             K+KCV  GNP R  L++ + +  A ++FF +L      + +VV+V+GGSLGA  IN  +
Sbjct  184  PKQKCVFIGNPTRRVLQQRIDRLSALRYFFGDLNVDGHEDLEVVVVMGGSLGARIINETM  243

Query  426  LNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
              + S++L++++  ++IWQTG   +      V +HPRL L P++ AM++ YAAAD++++R
Sbjct  244  AEIASSLLEQKRGRYIIWQTGTINYDSTMRRVGSHPRLALLPYVDAMEMMYAAADIVVAR  303

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA+TC E+L T  P ILIP+ +VAE HQ+KNA  MA+   A ++ E +L +  L +   
Sbjct  304  AGAITCSELLVTATPAILIPATSVAEDHQMKNARAMAEGGAATILPERDLVAERLATVIL  363

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             ILGD +    M   AL+ A  DA+ +++KH+LSL +
Sbjct  364  NILGDNAEQRRMQNAALRMAAPDAAQQLAKHVLSLAS  400



>ref|XP_002984744.1| glycosyltransferase CAZy family GT28 [Selaginella moellendorffii]
 gb|EFJ13994.1| glycosyltransferase CAZy family GT28 [Selaginella moellendorffii]
Length=403

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/279 (39%), Positives = 160/279 (57%), Gaps = 19/279 (7%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L AAL  +  V+ EQN+ P + N++L                 FA ++     +     +
Sbjct  138  LAAALRRIPLVLQEQNSQPGLTNKILGR---------------FA-RVVFVAFAGAAAHF  181

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             + +C+V GNP R    R VS  +AR+ FFPE      + +VVLVLGGSLGA ++N+ L 
Sbjct  182  SRDRCLVSGNPTRLGFNRYVSSLVARRLFFPEDESCATKKEVVLVLGGSLGAKSVNMALS  241

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEI-ESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
            +     L      ++IWQTG + + ++ ES+   H RL +  F+ +M+ AYAAADL+++R
Sbjct  242  SFVLESLGRNCRRYIIWQTGSQYYKQVLESVGSGHSRLAIHGFIESMETAYAAADLVVAR  301

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA--LRSA  779
            +GA+TC EIL  GKP ILIPSPNV + HQ KNA  + +   ARV+ ++ L S    L  A
Sbjct  302  AGAITCSEILVAGKPSILIPSPNVTDDHQTKNARSLEEAGVARVLADSSLQSSPRILADA  361

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             +E+LGD   +  M+ +AL  A  DA+A I++ IL +VN
Sbjct  362  IDELLGDRQRLDKMAMKALDLAIPDAAARIAQRILDIVN  400



>ref|XP_010110095.1| Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase 
[Morus notabilis]
 gb|EXC25182.1| Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase 
[Morus notabilis]
Length=102

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            MTC EILA GKP ILIPSPNVAEGHQ KNA LMA LA AR+ITE+ELDS  L++A EE+L
Sbjct  1    MTCSEILAHGKPSILIPSPNVAEGHQFKNASLMADLADARIITEDELDSTTLKTAIEELL  60

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
            GDE  MADMS+RALKAAK +ASAEI +HILSLV+ S 
Sbjct  61   GDEKKMADMSERALKAAKPNASAEIVQHILSLVDLST  97



>gb|EYU18998.1| hypothetical protein MIMGU_mgv1a010416mg [Erythranthe guttata]
Length=313

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 106/157 (68%), Gaps = 17/157 (11%)
 Frame = +3

Query  84   GGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKC  263
            GG K ++ EQN+VP IAN VLS                FADK+ +AF+S++ECFWQK KC
Sbjct  159  GGGKLLIQEQNSVPGIANLVLSL---------------FADKVCVAFNSTLECFWQKYKC  203

Query  264  VVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYS  440
            VVCGNPVR SL K+  +K  AR+HFFP    +  E  V+++ G    A  IN+ L N+Y 
Sbjct  204  VVCGNPVRFSLTKQTCTKSAARRHFFPNAAVIGKEKVVLVLGGSLG-ATTINIALSNVYC  262

Query  441  NVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTP  551
            ++L+E +DLF++WQTG++AF EIES V+ HPRL+L+P
Sbjct  263  SMLNENEDLFVVWQTGLKAFREIESRVRNHPRLLLSP  299



>gb|KGN64152.1| hypothetical protein Csa_1G042620 [Cucumis sativus]
Length=325

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 16/158 (10%)
 Frame = +3

Query  81   LGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKK  260
            + GVK  + EQN+VP  AN VLS                FAD +F+  +S++ECF +KKK
Sbjct  177  INGVKLAIQEQNSVPGFANWVLSH---------------FADIVFVVLNSTVECFPRKKK  221

Query  261  CVVCGNPVRSSLKRNVSKEMARQHFFPelgdle-gegkvvlvlggslgANAINVKLLNLY  437
            C+VCGNPVR +LK++V K +AR HFFP     E  E KV+L+LGGSLGANAIN+ +LNLY
Sbjct  222  CLVCGNPVRLTLKQHVPKSVARLHFFPRSRKGEDLEAKVLLILGGSLGANAINIAMLNLY  281

Query  438  SNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTP  551
              +L E K+L++IWQTGV+ F E++SLVK HPRL LTP
Sbjct  282  YQMLLENKNLYIIWQTGVKTFDEMDSLVKNHPRLHLTP  319



>ref|WP_022835666.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Salisaeta longa]
Length=374

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 148/276 (54%), Gaps = 24/276 (9%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L A L G   VV EQNA P + NR+L                  + ++ +AF  + E 
Sbjct  111  VLLAARLQGCPIVVQEQNAYPGVTNRLLGY---------------LSTRVHVAFPEA-EA  154

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            ++      V GNP R  L++    E  R H       +  +  ++ VLGGSLG+ A+N  
Sbjct  155  YFPTADVRVTGNPTRQQLQQTTRAE-GRAHI-----GMPEDATLLTVLGGSLGSAALNDA  208

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            L      +LD R + +++WQTG   +  + + + +HPRL + P+L  MD AYAA D+ + 
Sbjct  209  LEASLGALLD-RPNTYILWQTGTRYYEALHARIPSHPRLRMAPYLDRMDAAYAATDVALC  267

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA+TC E+L TG P +L+PSPNV   HQ KNA  MA    ARV+ E  L S  L +A 
Sbjct  268  RAGALTCSELLVTGTPAVLVPSPNVVADHQTKNAESMAAAGAARVLPEPRLSS-ELVAAV  326

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
              +L D S  A M++ A + A+ +A+A I++ I S+
Sbjct  327  TALLDDASARAAMTRAAQQLARPEAAAVIARDICSI  362



>gb|ABZ08297.1| putative glycosyltransferase family 28 C-terminal domain protein 
[uncultured marine microorganism HF4000_APKG2M17]
Length=401

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/266 (38%), Positives = 148/266 (56%), Gaps = 24/266 (9%)
 Frame = +3

Query  93   KFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVC  272
            +  + EQNA   + NR+ S                FAD+I++AFD +     +     + 
Sbjct  154  RTAIQEQNAFMGLTNRIASR---------------FADQIYIAFDEAAPKS-KGSTTRIT  197

Query  273  GNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLD  452
            GNPVR +L  +  K+ A  +F     +     +VV + GGS+G+ A+N  +  +  ++L 
Sbjct  198  GNPVRQNLAES-HKQEALDYF-----EFSDVRQVVFMTGGSIGSQAMNEAMATIVRSLLS  251

Query  453  ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEI  632
            +R  + +IWQTG   F   ++ V  HPRL L  ++  MD+AY+AADL+I RSGA TC E+
Sbjct  252  KR-GIGVIWQTGERYFERFQTSVPDHPRLRLKAYVDRMDMAYSAADLMICRSGASTCSEL  310

Query  633  LATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLM  812
            + TG P ILIPSPNV+E HQ KNA  +   AGA  + E       L  AT+++L D + +
Sbjct  311  MLTGTPAILIPSPNVSEDHQTKNALSLVS-AGAATLLEETRMHHELLDATKDLLIDTARL  369

Query  813  ADMSKRALKAAKLDASAEISKHILSL  890
              MS  ALK AK +A+ EI++ IL L
Sbjct  370  DRMSANALKLAKPNAAREIAEDILDL  395



>ref|WP_022826746.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium antarcticum]
Length=364

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 139/273 (51%), Gaps = 24/273 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+  V+ EQN+ P I N+ LS +               A KI +A+++ +E F+ +
Sbjct  114  AGIAGIPTVLQEQNSFPGITNKWLSKK---------------ASKICVAYEN-LEKFFPR  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L     K      FF      +    +   LG       I  +L N 
Sbjct  158  NKIVLTGNPVRQDLVDFKQKRQEGIEFFKLDATKKTILVLGGSLGARRINQLIAKELFNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ L+WQ G + + E  S     P + + PF+  MDLAYAAAD+IISR+GA
Sbjct  218  NS------QNVQLLWQCG-KLYQEEYSQFNDEPNVQVLPFIDRMDLAYAAADVIISRAGA  270

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+   GKP + IPSPNVAE HQ KNA  +    GA +I E+ELD+    +    +L
Sbjct  271  SSVSELCLVGKPTLFIPSPNVAEDHQTKNANAIVDKEGALLIKESELDT-QFTNTINSLL  329

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             DE L   +S+  L+ AK +A+ +I   I+ L+
Sbjct  330  NDEELQKKLSQNMLQLAKPNATKDIVDEIVKLI  362



>ref|WP_026977053.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium tegetincola]
Length=364

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 139/273 (51%), Gaps = 24/273 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N+ LS +               A KI +A+++ +E F+ K
Sbjct  114  AGFAGIPTVLQEQNSFPGITNKWLSKK---------------ASKICVAYEN-LEKFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L     K      F+    + +    +   LG       I  +L+N 
Sbjct  158  NKIVLTGNPVRQDLTGFKEKREEAIAFYKLNPNKKTVLVLGGSLGARRINQLIAKELVNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ LIWQ G + +H+  S       + +  F+  MDLAYAAAD+IISR+GA
Sbjct  218  SS------QNVQLIWQCG-KLYHDEYSHFNEKEDVQVLSFIERMDLAYAAADVIISRAGA  270

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+   GKP + IPSPNVAE HQ KNA  +    GA +I E+ELD+    +A   IL
Sbjct  271  SSVSELCLVGKPTLFIPSPNVAEDHQTKNANAIVDKEGALIIKESELDT-QFTTAINAIL  329

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             D+ L   +S+  LK AK +A+ +I   I  L+
Sbjct  330  NDDELQKKLSENMLKLAKPNATKDIVDEIEKLI  362



>ref|XP_010110096.1| Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase 
[Morus notabilis]
 gb|EXC25183.1| Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase 
[Morus notabilis]
Length=307

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 108/156 (69%), Gaps = 17/156 (11%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
             K V+ EQN+VP +AN V+S                F+D +F+AF+S+++CF + KKCVV
Sbjct  167  TKLVIQEQNSVPGVANWVISH---------------FSDAVFVAFNSTVDCFPRAKKCVV  211

Query  270  CGNPVRSSLKRN-VSKEMARQHFFPelgdlege-gkvvlvlggslgANAINVKLLNLYSN  443
             GNPVR SLK++ V K  AR   FP  G++  E  KVVLVLGGSLGANA+N+ +LN+YS 
Sbjct  212  SGNPVRLSLKKDDVLKAAARAKLFPRSGNVLREDAKVVLVLGGSLGANAVNIAMLNVYSQ  271

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTP  551
            +L E + LF+IWQTGVEAF E+ESLVK HP L LTP
Sbjct  272  MLMENERLFIIWQTGVEAFDEMESLVKNHPNLHLTP  307



>ref|WP_022587308.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Caldanaerobacter subterraneus]
 gb|ERM92807.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=364

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 143/274 (52%), Gaps = 29/274 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A +  +  ++HEQNA P + NR+LS                F D + ++F+ S++ 
Sbjct  107  VLMAAVIKRIPTLIHEQNAFPGLTNRLLSP---------------FVDIVAVSFEDSVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F + KK VV GNP+R  L R V KE  R+              +V+ +GGS GA  IN  
Sbjct  152  FKKAKKVVVTGNPIREELLR-VKKEEGREKL-----GFSMSKPLVVSVGGSRGAEKINST  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLV-----LTPFLHAMDLAYAAA  587
            ++ L    + +RK   LI  TG   + ++   VK    ++     + P+ H M   YAAA
Sbjct  206  MVELLK--IKDRKFQVLII-TGSSNYDKVLEKVKKENVVLDDSVKIVPYSHEMQYVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++I R+GA+T  EI A G P ILIPSP VA  HQ  NA L+ +   + VI E +LD+  
Sbjct  263  DIMICRAGAITLSEITAVGVPSILIPSPYVANNHQEYNARLLERQGASHVILEKDLDAKK  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEI  869
            L    E +L + SL+ +M ++A   ++ DAS +I
Sbjct  323  LYEKIEYLLSEPSLLNEMREKAKSMSRTDASYKI  356



>ref|WP_026704042.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium soli]
Length=363

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 140/273 (51%), Gaps = 24/273 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N+ LS +               A KI +A+++ +E F+ K
Sbjct  114  AGFAGIPTVIQEQNSFPGITNKWLSKK---------------ASKICVAYEN-LEQFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L    +K    + +F    D +    +   LG       I  +L+N 
Sbjct  158  NKIVLTGNPVRQDLIDIKNKRKEARAYFGLAEDKKVVLVLGGSLGARRVNQLIAKELVNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ +IWQ G   F E +         VL+ F+  MDL YAAAD++ISR+GA
Sbjct  218  TS------QNVQVIWQCGKLYFDEYQRYNDNENVQVLS-FIDRMDLVYAAADIVISRAGA  270

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+   GKP I IPSPNVAE HQ KNA  + +  GA ++ E ELD+    +    +L
Sbjct  271  SSVSELCIVGKPVIFIPSPNVAEDHQTKNANAIVEKNGALMVKEVELDT-KFTTTFNNLL  329

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             D++L   +S+   K AK++A+ +I   I+ L+
Sbjct  330  NDDNLQKSLSESIEKLAKVNATKDIVDEIVKLI  362



>ref|WP_021327569.1| hypothetical protein [candidate division ZIXI]
 gb|EQB62817.1| hypothetical protein RBG1_1C00001G0396 [candidate division ZIXI 
bacterium RBG-1]
Length=370

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 143/272 (53%), Gaps = 23/272 (8%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A+L  +   + EQN+ P I  R+LS                FA K+FLA+D S + FW
Sbjct  110  LAASLMRIPTFIQEQNSFPGITTRILSL---------------FAKKVFLAYDESQKYFW  154

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
             KKK  V GNPVR  + +   K  A + F     +LE + K VL+LGGS GA++IN  +L
Sbjct  155  VKKKLKVTGNPVRPEIFK-TDKTSAMKKF-----NLEQDKKTVLILGGSQGASSINNAVL  208

Query  429  NLYSNVLDERKDLFLIWQTGVEAFHEI-ESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
               ++   E     ++WQTG + + +I E+L  +   + +  F+  M  AYAA DL++SR
Sbjct  209  EDLNSSAQEL-GFQVLWQTGEKDYQKIKENLEDSKNPVQIFNFIEDMSSAYAACDLVVSR  267

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA+T  EI   GKP ILIP P    GHQ  NA ++ K   A VI E  L    L S T 
Sbjct  268  AGAITLSEITGCGKPAILIPYPYATAGHQKYNAQVLEKNGAAIVIEEKNLQQVTLLSKTS  327

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHI  881
            ++L DE  +  MS  + K  + +A  EI   I
Sbjct  328  DLLKDEQKLKQMSGNSKKLGRPNALTEILDEI  359



>ref|WP_020402704.1| hypothetical protein [Gracilimonas tropica]
Length=368

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 134/270 (50%), Gaps = 26/270 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  V+ EQN+ P + NR+L+                FA+KIF AF  + + F  K+K  
Sbjct  118  GIPIVIQEQNSFPGVTNRLLAK---------------FANKIFTAFKEA-DRFLPKEKTE  161

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            V GNP R++L     K+      F +   +               A   N++ L+     
Sbjct  162  VVGNPTRATLTDADHKKALASFGFSDDRPVLLVMGGSGGAKTINEAMKANIEQLH-----  216

Query  447  LDERKDLFLIWQTGVEAFHEIESLV--KTHPRLVLTPFLHAMDLAYAAADLIISRSGAMT  620
              +   L +IWQ G   + E+ + +  K    L LT +L  M  AYAAADL+ISR+GA +
Sbjct  217  --DEAGLQIIWQCGPRYYDELTTEINEKELKNLRLTAYLDNMAEAYAAADLVISRAGASS  274

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
            C E++ TG P IL+PSPNVA  HQ +NA  M   AGA  I E+      +    E+++ D
Sbjct  275  CSELMLTGTPSILVPSPNVAGDHQTQNAMAMVD-AGASKILEDSAMKETMTELVEQLIYD  333

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSL  890
            +  +  M++ AL  AK DA+  I+K IL +
Sbjct  334  QENLKRMNQAALNLAKPDAAKLIAKEILEI  363



>ref|WP_009611121.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Caldanaerobacter subterraneus]
 ref|NP_623243.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Caldanaerobacter subterraneus subsp. tengcongensis 
MB4]
 sp|Q8R9G6.1|MURG_THETN RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
 gb|AAM24847.1| UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
 gb|EEB75271.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Caldanaerobacter subterraneus subsp. pacificus 
DSM 12653]
Length=364

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 142/274 (52%), Gaps = 29/274 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A +  +  ++HEQNA P + NR+LS                F D + ++F+ S++ 
Sbjct  107  VLMAAVIKRIPTLIHEQNAFPGLTNRLLSP---------------FVDIVAVSFEDSVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F + KK VV GNP+R  L R V KE  R+              +V+ +GGS GA  IN  
Sbjct  152  FKKAKKVVVTGNPIREELLR-VKKEEGREKL-----GFSMSKPLVVSVGGSRGAEKINST  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLV-----LTPFLHAMDLAYAAA  587
            ++ L    + +RK   LI  TG   + ++   VK    ++     + P+ H M   YAAA
Sbjct  206  MVELLK--IKDRKFQVLII-TGSSNYDKVLEKVKKENVVLDDSVKIVPYSHEMQYVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++I R+GA+T  EI A G P ILIPSP VA  HQ  NA L+ +     VI E +LD+  
Sbjct  263  DIMICRAGAITLSEITAVGVPSILIPSPYVANNHQEYNARLLERQGAFHVILEKDLDAKK  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEI  869
            L    E +L + SL+ +M ++A   ++ DAS +I
Sbjct  323  LYEKIEYLLSEPSLLNEMREKAKSMSRTDASYKI  356



>ref|WP_027420795.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Crocinitomix catalasitica]
Length=367

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 102/277 (37%), Positives = 151/277 (55%), Gaps = 26/277 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA   V  ++ EQN+ P I N++L+ +               A+KI +A+D+ +E F+ K
Sbjct  114  AAKQKVPTLIQEQNSYPGITNKILAKK---------------ANKICVAYDN-LEAFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V  GNPVR+++   V  E  R   F     L+   K +LV+GGSLGA  +N  +   
Sbjct  158  DKIVKTGNPVRNNM---VEIEGKRAKAF-AHFSLDPNKKTILVIGGSLGARTLNQSIQKN  213

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVK---THPRLVLTPFLHAMDLAYAAADLIISR  605
             + ++D+  D+ +IWQTG   F +I+S +      P +  + F+  MDLAYAAAD+IISR
Sbjct  214  LNKIIDQ--DVQIIWQTGKFYFKQIQSDLAEGLKSPLVACSEFIFEMDLAYAAADIIISR  271

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA++  E+   GKP IL+PSPNVAE HQ KNA  +  +  A ++ ++E  S  +  A  
Sbjct  272  AGAISVSELCLIGKPSILVPSPNVAEDHQTKNAMALVNIDAAVLVKDSEAQSELIPQAL-  330

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             IL D    A++SK        DA+  I K I  LV 
Sbjct  331  AILKDTERQAELSKNIKTLGIPDAAQRILKEIEKLVG  367



>ref|WP_035670162.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. 83]
Length=362

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 140/274 (51%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+  V+ EQN+ P I N++LS +               A KI +A+++ +E F+ K
Sbjct  114  AGIAGIPTVIQEQNSYPGITNKLLSKK---------------ASKICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K ++ GNPVR  L    SK      +F      +    +   LG       I  +L N+
Sbjct  158  EKMILTGNPVRQDLIDIESKRKEAIQYFNLDSKKKTLLILGGSLGARRVNQLIEKELGNI  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ +IWQ G     + +   K + ++V   F+  MDL YAAAD+IISR+GA
Sbjct  218  LS------QNVQVIWQCGKLYLEDYKKYNKENVQVV--AFIERMDLVYAAADIIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELDS F L    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVNKKGALMLKESELDSQFGL--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L D+     +S+   + A  +A+ +I   I+ L+
Sbjct  328  LKDQGKQNQLSENVKQLAMPEATKQIVDEIVKLI  361



>ref|WP_007810670.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. CF136]
 gb|EJL60609.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. CF136]
Length=362

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 137/275 (50%), Gaps = 27/275 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+++ +E F+ K
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N 
Sbjct  158  EKIVLTGNPVRQDLIDIDSKRDEAIAFYGLDPNKKTLLVLGGSLGARRINQLIEKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F + +      P + +  F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQVIWQCGKLYFEDYKKY--NQPNVKVVDFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E EL+S F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLKETELESQFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            L DE     +S    + AK  A+ +I   I+ L+N
Sbjct  328  LKDEGKQKQLSTNIKRLAKPKATQDIVAEIIKLIN  362



>ref|WP_028295546.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Olivibacter sitiensis]
Length=367

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 136/269 (51%), Gaps = 25/269 (9%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            V +++ EQN+   I N+ L+++               A KI +AF+  ++ F+ K K V+
Sbjct  120  VPYLIQEQNSYAGITNKRLAAK---------------ASKICVAFEG-MDRFFPKGKIVI  163

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNPVR  +   V K+      F    +          LG     N +   L  L ++  
Sbjct  164  SGNPVRKDVVDIVGKKFEADELFGFDHEKRTLLVTGGSLGARTLNNCLLEGLAKLKAH--  221

Query  450  DERKDLFLIWQTGVEAFHEIESLVKTH--PRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
                D+ +IWQ G   +  +++ +K      + L PFL+ MDLAYA+ADLII+R+GA T 
Sbjct  222  ----DIQVIWQCGTYYYEVLKNELKGQLDDSVQLRPFLNRMDLAYASADLIIARAGAGTI  277

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             E+   GKPCIL+PSPNVAE HQ KNA  + +   A+++ + E     +  A   +L D+
Sbjct  278  AELSIVGKPCILVPSPNVAEDHQTKNAMALVERGAAKLVKDTEASEKLVDEAI-ALLSDK  336

Query  804  SLMADMSKRALKAAKLDASAEISKHILSL  890
             L   +S+   K AK DA   I++ +L L
Sbjct  337  VLQKKLSENIKKMAKEDADELIAQEVLKL  365



>ref|WP_008908632.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Caloramator australicus]
 emb|CCJ33362.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caloramator 
australicus RC3]
Length=368

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/282 (33%), Positives = 148/282 (52%), Gaps = 29/282 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L A+L G+  ++HEQNA+P + N++LS                F  KI + F  S E 
Sbjct  107  VVLAASLKGIPTIIHEQNAIPGLTNKILSY---------------FVSKIAITFSES-ER  150

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F+ K K V+ GNP+R ++ R +  E  ++ +      +  +   VL +GGS GA+ +N  
Sbjct  151  FFPKSKVVLTGNPIRENILRKIG-ESNKEKW-----GINKDKPTVLAVGGSRGASRLNDF  204

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEI-----ESLVKTHPRLVLTPFLHAMDLAYAAA  587
            ++N+   +++E+  + LI+ TG   +  +     E  +     +++ P+ + MD A  A 
Sbjct  205  VINIIPKLIEEK--IQLIFITGEREYERVIRTLKEKGINNLEGIIIIPYAYNMDDALTAC  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            DLIISR+GA    EI A G P ILIPSPNVA  HQ  NA  + +   A VI E+++    
Sbjct  263  DLIISRAGATIISEITALGIPSILIPSPNVANNHQEYNALSLEQNGAAIVIKESQISDDV  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
                   +  ++ L+  MS  A K AK+DA+ +I + IL LV
Sbjct  323  FSQQVISLAKNKDLLTKMSSNAKKFAKIDAADKICEIILELV  364



>ref|WP_026724218.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sasangense]
Length=362

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 145/283 (51%), Gaps = 31/283 (11%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++L+ +               A+KI +A+++ +
Sbjct  108  GAVLKVASMLGIPTVIQEQNSYPGITNKLLAKK---------------ANKICVAYEN-L  151

Query  237  ECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN  416
            E F+ K K ++ GNPVR  L    SK  A  +F                    +   ++ 
Sbjct  152  ERFFPKDKMILTGNPVRQDLINEASKSEAIAYF----------KLDANKKTLLVLGGSLG  201

Query  417  VKLLN-LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             + +N L    LD    +++ +IWQ G    ++  S       + +  F+  MDL YAAA
Sbjct  202  ARRINQLIEKELDFLLSQNIQIIWQCGKLYLNDY-SKYNEKENVQVVAFIDRMDLVYAAA  260

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  ++   GA +I E+EL++  
Sbjct  261  DVVISRSGASSVSELCIVGKPTIFIPSPNVAEDHQTKNAKAISDKNGAILIRESELET-Q  319

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
              +   +++  ES   ++S+   K AK +A+ +I + I+ L+N
Sbjct  320  FETVFSDLISSESKQVELSQNIKKLAKPNATKDIVEEIVKLIN  362



>gb|AIS52707.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase MurG 
[Thermoanaerobacter kivui]
Length=364

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 142/282 (50%), Gaps = 31/282 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N++LS                F   + ++F+ S++ 
Sbjct  107  VLMMAALRGITTLIHEQNAFPGLTNKILSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINV  419
            F  K+K VV GNP+R  L + +  + M R  F P+   +   G            N I V
Sbjct  152  FKNKEKVVVTGNPIRKELFETDRLEGMKRLGFSPDKPLVVSVGGSRGAEKI----NFIMV  207

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKT-----HPRLVLTPFLHAMDLAYAA  584
            KL+ +      + K+L ++  TG   + ++   +K         + + P+ H M+  YAA
Sbjct  208  KLIKM------KNKNLQVLMITGTNQYEKVLEKIKNDNLNLEESVKIIPYCHNMEDVYAA  261

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            AD+++ R+GA+T  EI A G   IL+PSP VA  HQ  NA ++ +   A VI E +L + 
Sbjct  262  ADIMVCRAGAITLAEITAKGVASILVPSPYVANNHQEYNARVLERAGAAYVILEKDLTAQ  321

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
             L      +L + S++  M + A K +K+DA+ +I K I S+
Sbjct  322  GLYDKINYLLNNSSVLLGMKENAKKISKIDAAEKIYKLIKSI  363



>ref|WP_037388798.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Smithella sp. SCADC]
 gb|KFO66653.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Smithella sp. SCADC]
Length=358

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 136/258 (53%), Gaps = 28/258 (11%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            V+ EQNA+P I N++L +               FADKIF+ + +    F+ + K +V GN
Sbjct  119  VIAEQNAIPGITNKILGN---------------FADKIFVTY-TQTRTFFPQIKVIVSGN  162

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR++L   V+K   R+         + + + +L+ GGS GA AIN  ++++   +   +
Sbjct  163  PVRAAL---VAKSGERKE--------KKDYRQLLIFGGSQGAEAINKSIMDMLPQLQGMK  211

Query  459  KDLFLIWQTGVEAFHEIESLVKTHP-RLVLTPFLHAMDLAYAAADLIISRSGAMTCYEIL  635
              + ++ QTGV    E++   +    R  +T F+  M  AYA ADLII R+GA +  EI 
Sbjct  212  DKVRILHQTGVRQLEEVKKAYEQFGIRAQVTSFIVDMAGAYADADLIICRAGATSLAEIT  271

Query  636  ATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMA  815
            A GK  ILIP P  A  HQLKNA  MA    A ++ E EL    L    E++L DE  + 
Sbjct  272  AAGKAAILIPYPWAANDHQLKNAQAMASEGAAILLPEKELSGGKLFGVIEDLLRDEQKLH  331

Query  816  DMSKRALKAAKLDASAEI  869
             M + +LK  K+DA+  I
Sbjct  332  QMEENSLKLGKVDAAKTI  349



>ref|WP_029933213.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Rhodothermus 
marinus]
Length=372

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 156/283 (55%), Gaps = 29/283 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A L G  FV+ EQNA P + NR+L                 +A ++++AF  + + 
Sbjct  105  VLVAARLLGCPFVLQEQNAFPGLTNRLLGR---------------WAARVYVAFPEA-QA  148

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            ++   +CV+ GNPVR+SL R VS+  AR+ F      L  E +V+ V GGSLG+  +N  
Sbjct  149  YFPAGRCVLSGNPVRASL-RAVSRLEARRRF-----GLPAEAQVLFVFGGSLGSMVLNDA  202

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAF----HEIESLVKT-HPRLVLTPFLHAMDLAYAAA  587
            LL +   +L+E + L L+WQTG   +      ++++ K  H R+ L P++  M  AYAAA
Sbjct  203  LLQVLPTLLEEPR-LHLLWQTGRAHYMAVRQRLDAMAKQLHHRIRLLPYIEDMAAAYAAA  261

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            DL++ R+GA+TC E++ TG P IL+P+  VA  HQ +NA  M +   AR + E  L    
Sbjct  262  DLVLCRAGALTCSELMVTGTPAILVPATRVAADHQTRNAESMERAGAARHVPEAVLTE-R  320

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            L      +L D    A MS+ A + A+ +A+A+I+  +L L  
Sbjct  321  LVQEVWTLLADAERRAAMSEAARRMARPEAAAQIAADVLQLAT  363



>ref|WP_039108926.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. AED]
 gb|KIA87441.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. AED]
Length=362

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 139/274 (51%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+  V+ EQN+ P I N++LS +               A KI +A+++ +E F+ K
Sbjct  114  AGIAGIPTVIQEQNSYPGITNKLLSKK---------------ASKICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K ++ GNPVR  L    SK      +F      +    +   LG       I  +L N+
Sbjct  158  GKMILTGNPVRQDLIDIDSKRAEAIQYFNLDSKKKTLLVLGGSLGARRVNQLIEKELENI  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ +IWQ G     + +   K + ++V   F+  MDL YAAAD+IISR+GA
Sbjct  218  LS------QNVQVIWQCGKLYLEDYKKYNKENVQVV--AFIERMDLVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELDS F L    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDKKGALILKESELDSQFGL--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L D+     +S+   + A  +A+ +I   I+ L+
Sbjct  328  LKDQGKQNQLSENIKQLAMPEATKQIVDEIVKLI  361



>ref|WP_008467147.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. F52]
 gb|EJG00389.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. F52]
Length=363

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 135/274 (49%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  VV EQN+ P I N++LS +               A+ I +A+  ++E F+ K
Sbjct  114  AGSAGIPTVVQEQNSYPGITNKLLSKK---------------ANAICVAY-QNLERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N 
Sbjct  158  EKIVLTGNPVRQDLIDIESKRDEAIAFYGLDPNKKTLLVLGGSLGARRINQLIEKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F E +      P + +  F+  MD  YAA+D+IISR+GA
Sbjct  218  LS------RDVQVIWQCGKLYFEEYKKY--NQPSVKVVDFIERMDFVYAASDVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELDS F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLKESELDSQFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L D      +S    K AK  A+ +I   I+ L+
Sbjct  328  LKDHGKQKQLSDNIKKLAKPKATQDIVAEIVKLI  361



>ref|XP_003061400.1| glycosyltransferase family 28 protein, partial [Micromonas pusilla 
CCMP1545]
 gb|EEH54030.1| glycosyltransferase family 28 protein, partial [Micromonas pusilla 
CCMP1545]
Length=383

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/288 (32%), Positives = 133/288 (46%), Gaps = 60/288 (21%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A L  V  V+ EQNAVP +AN +L+           +   +   K               
Sbjct  122  AVLKRVPLVIQEQNAVPGVANAILARAATTRCAAFASAADALGGK---------------  166

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
              CVV GNP R+SL R ++K +AR+                            N K+L +
Sbjct  167  --CVVRGNPTRASL-RVMTKTVARERL--------------------QRPGDENEKVLVV  203

Query  435  YSNVLDER-----------------KDLFLIWQTGVEAF---HEIESLVKTHPRLVLTPF  554
                L                     +L ++WQ G +A     E  + V +HPR++LTPF
Sbjct  204  LGGSLGAAAVNDAIAAAAPALLASFPNLRILWQCGEKALAGTREKHAEVTSHPRVLLTPF  263

Query  555  LHAMDLAYAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGAR  734
            +  +D+AYAAADL+++R+GA+TC E+LAT  P +LIPSPNVAE HQ  NA  M     A 
Sbjct  264  VRDVDVAYAAADLVVARAGAVTCAELLATRTPSVLIPSPNVAEDHQTANAVEMEANGAAT  323

Query  735  VITENELDS--FALRSATEEILGDESLMADMSKRALKAAKLDASAEIS  872
            V+ E EL        +AT+ +L D+  +  M + A +A   DA+  I+
Sbjct  324  VVREAELREGWIEFAAATKALLVDDERLGRMREAAGRADTPDAARRIA  371



>ref|WP_014068150.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Rhodothermus 
marinus]
 ref|YP_004826439.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Rhodothermus 
marinus SG0.5JP17-172]
 gb|AEN74602.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Rhodothermus 
marinus SG0.5JP17-172]
Length=396

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 156/283 (55%), Gaps = 29/283 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A L G  FV+ EQNA P + NR+L                 +A ++++AF  + + 
Sbjct  129  VLVAARLLGCPFVLQEQNAFPGLTNRLLGR---------------WAARVYVAFPEA-QA  172

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            ++   +CV+ GNPVR+SL R VS+  AR+ F      L  E +V+ V GGSLG+  +N  
Sbjct  173  YFPAGRCVLSGNPVRASL-RAVSRLEARRRF-----GLPAEAQVLFVFGGSLGSMVLNDA  226

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAF----HEIESLVKT-HPRLVLTPFLHAMDLAYAAA  587
            LL +   +L+E + L L+WQTG   +      ++++ K  H R+ L P++  M  AYAAA
Sbjct  227  LLQVLPTLLEEPR-LHLLWQTGRAHYMAVRQRLDAMAKQLHHRIRLLPYIEDMAAAYAAA  285

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            DL++ R+GA+TC E++ TG P IL+P+  VA  HQ +NA  M +   AR + E  L    
Sbjct  286  DLVLCRAGALTCSELMVTGTPAILVPATRVAADHQTRNAESMERAGAARHVPEAVLTE-R  344

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            L      +L D    A MS+ A + A+ +A+A+I+  +L L  
Sbjct  345  LVQEVWTLLADAERRAAMSEAARRMARPEAAAQIAADVLQLAT  387



>ref|WP_012845182.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Rhodothermus 
marinus]
 ref|YP_003291960.1| UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-UDP 
N- acetylglucosamine transferase [Rhodothermus 
marinus DSM 4252]
 gb|ACY49572.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Rhodothermus 
marinus DSM 4252]
Length=395

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 156/283 (55%), Gaps = 29/283 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A L G   V+ EQNA P + NR+L                 +A ++++AF  + + 
Sbjct  129  VLVAARLLGRPLVLQEQNAFPGLTNRLLGR---------------WAARVYVAFPEA-QA  172

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            ++   +CV+ GNPVR+SL R VS+  AR+ F      L  E +V+ V GGSLG+  +N  
Sbjct  173  YFPAGRCVLSGNPVRASL-RAVSRLEARRRF-----GLPAEAQVLFVFGGSLGSMVLNDA  226

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAF----HEIESLVKT-HPRLVLTPFLHAMDLAYAAA  587
            LL +   +L+E + L L+WQTG   +      ++++ K  H R+ L P++  M  AYAAA
Sbjct  227  LLQVLPTLLEEPR-LHLLWQTGRAHYMAVRQRLDAMAKQLHHRIRLLPYIEDMAAAYAAA  285

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            DL++ R+GA+TC E++ TG P IL+P+  VA  HQ +NA  M +   AR + E  L    
Sbjct  286  DLVLCRAGALTCSELMVTGTPAILVPATRVAADHQTRNAESMERAGAARHVPEAVLTE-R  344

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            L      +L D  L A MS+ A + A+ +A+A+I+  +L L  
Sbjct  345  LVQEVWTLLADAELRAAMSEAARRLARPEAAAQIAADVLQLAT  387



>ref|WP_017497016.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. WG21]
Length=361

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 138/274 (50%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+D  +E F+ +
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAYDH-LERFFPE  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N 
Sbjct  158  EKIVLTGNPVRQDLIDIDSKHEEAIAFYGLDPNKKTLLVLGGSLGARRINQLIEKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F E +   + + ++V   F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQIIWQCGKLYFEEYKKYNQQNVKVV--DFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELD+ F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLKESELDNEFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L DE     +S    K AK  A+ +I   I+ L+
Sbjct  328  LKDEGKQKQLSANIKKLAKPKATQDIVAEIVKLI  361



>ref|WP_026730570.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium denitrificans]
Length=362

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 135/275 (49%), Gaps = 27/275 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+D+ +E F+  
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAYDN-LERFFPA  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N 
Sbjct  158  DKIVLTGNPVRQDLIDIESKRNEAIAFYGLDPNKKTLLVLGGSLGARRINQLIEKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F + +      P + +  F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQIIWQCGKLYFEDYKKY--NQPNVRVVDFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL+S F++    E +
Sbjct  270  SSVSELSIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLRESELESQFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            L DE     +S    K AK  A+ +I   I+ L+ 
Sbjct  328  LKDEGKQKQLSDNIKKLAKPKATQDIVAEIVKLIQ  362



>ref|WP_009052546.1| MULTISPECIES: UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter]
 ref|YP_001664806.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter pseudethanolicus ATCC 
33223]
 ref|YP_001663617.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter sp. X514]
 ref|YP_003903844.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
sp. X513]
 ref|YP_004185806.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
brockii subsp. finnii Ako-1]
 sp|B0K8K7.1|MURG_THEP3 RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 sp|B0K3H0.1|MURG_THEPX RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Thermoanaerobacter sp. X514]
 gb|ABY93281.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
sp. X514]
 gb|ABY94470.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 gb|EFK84754.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
sp. X561]
 gb|ADN54553.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
sp. X513]
 gb|ADV79423.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
brockii subsp. finnii Ako-1]
Length=364

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 144/281 (51%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGLTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K+K VV GNP+R  L +   +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKEKVVVTGNPIRRELLKVTKEEGLKNLGF------YSDKPLIVSVGGSRGAEKINFT  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++        + K+L ++  TG   + ++   VKT        + + P+ H M   YAAA
Sbjct  206  MVEFLK---QKDKNLQVLIITGANQYEKVLEKVKTETIDIDETVKIIPYCHNMQDVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLTAEK  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLSKMRDNAQKISKIDAAEKIYKLIKSI  363



>ref|WP_008990932.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Galbibacter marinus]
 gb|EKF55942.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Galbibacter marinus]
Length=368

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 137/274 (50%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  VV EQN+ P I N+VL  ++                KIF+A+   +E ++ K
Sbjct  114  AASKGIPSVVQEQNSFPGITNKVLGKKV---------------QKIFVAY-QGLERYFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L  N+S+       F           ++    G+   N +  K LN 
Sbjct  158  EKIVITGNPVRQDL-LNLSEYQGADEGFFSNTTDRKTLFIMGGSLGARRINQLVEKQLNF  216

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLV-LTPFLHAMDLAYAAADLIISRSG  611
            +     ++ ++ LIWQ G   + E +   K H   V +  F++ M LAYA+ADLIISRSG
Sbjct  217  F-----KQHNVQLIWQCGKLYYPEYK---KYHSEYVKVYDFINDMKLAYASADLIISRSG  268

Query  612  AMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEI  791
            A++  E+   GKP   IPSPNVAE HQ KNA  +A    A +I EN LD+     +  ++
Sbjct  269  AISVSELALVGKPVFFIPSPNVAEDHQTKNAMAVADKQAAILIPENRLDA-EFEDSFLKV  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L  E L   + +     A  +A+ +I  H+  L+
Sbjct  328  LRSEDLQRSLGENFKTLALPNATKDIVDHLEQLL  361



>ref|WP_003867928.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter ethanolicus]
 gb|EEU62128.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
ethanolicus CCSD1]
Length=364

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 144/281 (51%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGLTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K+K VV GNP+R  L +   +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKEKVVVTGNPIRRELLKVTKEEGLKNLGF------YSDKPLIVSVGGSRGAEKINFT  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++        + K+L ++  TG   + ++   VKT        + + P+ H M   YAAA
Sbjct  206  MVEFLK---QKDKNLQVLIITGANQYEKVLEKVKTETINIDETVKIIPYCHNMQDVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLTAEE  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLSRMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_014063048.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter wiegelii]
 ref|YP_004820291.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Thermoanaerobacter 
wiegelii Rt8.B1]
 gb|AEM79007.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
wiegelii Rt8.B1]
Length=364

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 143/281 (51%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGLTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K K VV GNP+R  L +   +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKGKVVVTGNPIRRELLKVTKEEGLKNLGF------YSDKPLIVSVGGSRGAEKINFT  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++        + K+L ++  TG   + ++   VKT        + + P+ H M   YAAA
Sbjct  206  MVEFLKQ---KDKNLQVLIITGANQYEKVLEKVKTETINIDETVKIIPYCHNMQDVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLTAEK  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLSKMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_026985674.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. URHB0058]
Length=361

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 138/274 (50%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS                 A+ I +A+++ +E F+ K
Sbjct  114  AGQAGIPTVIQEQNSFPGITNKLLSKR---------------ANAICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L   VSK      F+    + +    +   LG       I  +L N+
Sbjct  158  EKIVLTGNPVRQDLIDIVSKRDEAITFYGLDPNKKTLLVLGGSLGARRVNQLIEKELHNM  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F + +   + H R+V   F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQIIWQCGKLYFEDYKKHQQQHVRVV--DFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELDS F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAILDAKGAILLRESELDSQFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            + D+     +S    K A  +A+  I   I  L+
Sbjct  328  MKDDGKQKQLSANIKKLAMPNATKVIVDEIKKLL  361



>ref|WP_034098851.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIN74190.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum FPG3]
Length=367

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 142/282 (50%), Gaps = 30/282 (11%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++LS +               A+KI +A+++ +
Sbjct  108  GAVLKVASILGIATVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-L  151

Query  237  ECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN  416
            E F+ K K ++ GNPVR  L     K      +F                   +   ++ 
Sbjct  152  EQFFPKDKMILTGNPVRQDLISVDGKRNEAIDYF---------KLDANKKTILILGGSLG  202

Query  417  VKLLN-LYSNVLDE--RKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             + +N L +  +D    +++ +IWQ G   F + +         VL+ F+  MDL YAAA
Sbjct  203  ARRINQLIAKEIDWLLSQNVQIIWQCGKLYFEDYKHFSGKENVQVLS-FIDRMDLVYAAA  261

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E++LDS  
Sbjct  262  DIVISRSGASSVSELAIVGKPVIFIPSPNVAEDHQTKNAQAIVNKQGAILLKESQLDS-E  320

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             +   E +L D++   D+SK   + A  +A+ +I   I+ LV
Sbjct  321  FKFVFESLLNDKAKQEDLSKNIKQLALPNATKDIVDEIIKLV  362



>ref|WP_011964156.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 ref|YP_001296921.1| Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum JIP02/86]
 sp|A6H195.1|MURG_FLAPJ RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Flavobacterium psychrophilum JIP02/86]
 emb|CAL44119.1| Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum JIP02/86]
 gb|AIG30802.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIG33075.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIG35232.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIG37596.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIG39861.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIG42126.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
 gb|AIN71085.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum FPG101]
 gb|AIT66231.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium psychrophilum]
Length=367

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 142/282 (50%), Gaps = 30/282 (11%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++LS +               A+KI +A+++ +
Sbjct  108  GAVLKVASILGIATVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-L  151

Query  237  ECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN  416
            E F+ K K ++ GNPVR  L     K      +F                   +   ++ 
Sbjct  152  EQFFPKDKMILTGNPVRQDLISVDGKRNEAIDYF---------KLDANKKTILILGGSLG  202

Query  417  VKLLN-LYSNVLDE--RKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             + +N L +  +D    +++ +IWQ G   F + +         +L+ F+  MDL YAAA
Sbjct  203  ARRINQLIAKEIDWLLSQNVQIIWQCGKLYFEDYKPFSGKENVQILS-FIDRMDLVYAAA  261

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E++LDS  
Sbjct  262  DIVISRSGASSVSELAIVGKPVIFIPSPNVAEDHQTKNAQAIVNKQGAILLKESQLDS-E  320

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             +   E +L D++   D+SK   + A  +A+ +I   I+ LV
Sbjct  321  FKFVFESLLNDKAKQEDLSKNIKQLALPNATKDIVDEIIKLV  362



>ref|WP_035685387.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium reichenbachii]
 gb|KFF06686.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium reichenbachii]
Length=361

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 140/274 (51%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+++ +  F+ K
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAYEN-LGRFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L    +K      F+    + +    +   LG       I  +L N 
Sbjct  158  EKIVLTGNPVRQDLIDIDTKRDEAIAFYGLDPNKKTLLVLGGSLGARRINQLIQKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F E ++  + H R+V   F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQIIWQCGKLYFEEYKTHNQQHVRVV--DFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL+S F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDEKGAILLKESELESQFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L DE     +S+   K A  +A+ +I   I+ L+
Sbjct  328  LKDEGKQEQLSQTIKKLAMPNATKDIVNEIIKLL  361



>gb|AIJ37228.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Flavobacterium 
psychrophilum]
Length=372

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 142/282 (50%), Gaps = 30/282 (11%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++LS +               A+KI +A+++ +
Sbjct  113  GAVLKVASILGIATVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-L  156

Query  237  ECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN  416
            E F+ K K ++ GNPVR  L     K      +F                   +   ++ 
Sbjct  157  EQFFPKDKMILTGNPVRQDLISVDGKRNEAIDYF---------KLDANKKTILILGGSLG  207

Query  417  VKLLN-LYSNVLDE--RKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             + +N L +  +D    +++ +IWQ G   F + +         +L+ F+  MDL YAAA
Sbjct  208  ARRINQLIAKEIDWLLSQNVQIIWQCGKLYFEDYKPFSGKENVQILS-FIDRMDLVYAAA  266

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E++LDS  
Sbjct  267  DIVISRSGASSVSELAIVGKPVIFIPSPNVAEDHQTKNAQAIVNKQGAILLKESQLDS-E  325

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             +   E +L D++   D+SK   + A  +A+ +I   I+ LV
Sbjct  326  FKFVFESLLNDKAKQEDLSKNIKQLALPNATKDIVDEIIKLV  367



>ref|WP_004402388.1| MULTISPECIES: undecaprenyldiphospho-muramoylpentapeptidebeta- 
N -acetylglucosaminyltransferase [Thermoanaerobacter]
 gb|EMT38372.1| undecaprenyldiphospho-muramoylpentapeptidebeta- N -acetylglucosaminyltransferase 
[Thermoanaerobacter thermohydrosulfuricus 
WC1]
Length=364

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 144/281 (51%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGLTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K+K VV GNP+R  L +   +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKEKVVVTGNPIRRELLKVTKEEGLKNLGF------YSDKPLIVSVGGSRGAEKINFT  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++        + K+L ++  TG   + ++   VKT        + + P+ H M   YAAA
Sbjct  206  MVEFLKQ---KDKNLQVLIITGANQYEKVLEKVKTETINIDETVKIIPYCHNMQDVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLIAEE  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLSRMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_006570250.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter siderophilus]
 gb|EIW00878.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Thermoanaerobacter siderophilus SR4]
Length=364

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 144/281 (51%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGLTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K+K VV GNP+R  L +   +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKEKIVVTGNPIRRELLKVTKEEGLKNLGF------YSDKPLIVSVGGSRGAEKINFT  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++        + K+L ++  TG   + ++   VKT        + + P+ H M   YAAA
Sbjct  206  MVEFLKQ---KDKNLQVLIITGANQYEKVLEKVKTETINIDETVKIIPYCHNMQDVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLIAEE  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLSRMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_024741340.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tenacibaculum maritimum]
Length=364

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 147/270 (54%), Gaps = 25/270 (9%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+ P I N++L  +               A KI +A+D+ +E F+ K K V
Sbjct  119  GIPTLIQEQNSYPGITNKLLGKK---------------AKKICVAYDN-LERFFGKGKIV  162

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
              GNPVR  L    +K+   + FF      + + K+ L+LGGSLGA  IN +L+      
Sbjct  163  KTGNPVRQDLLAVDTKKEEGKAFF----KFKKDQKIALILGGSLGARRIN-ELVEENLPF  217

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
              E+K + LIWQ G + + E          + + PFL+ MDLAYA+AD+IISR+GA +  
Sbjct  218  FKEQK-VVLIWQCG-KLYFETYKKYNDMEDVQVYPFLNRMDLAYASADVIISRAGASSVS  275

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            E+   GKP I IPSPNVAE HQ KNA  +A   GA +I E +L+SF +    E ++ D+ 
Sbjct  276  ELCIVGKPTIFIPSPNVAEDHQTKNAKFIADKHGAILIKEKDLESFPM--VFETLMNDKG  333

Query  807  LMADMSKRALKAAKLDASAEISKHILSLVN  896
                +S+   + A  +A++ I   +  L+N
Sbjct  334  KQKRLSENINELALPNATSSIVNEVEKLIN  363



>ref|WP_026711948.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium filum]
Length=363

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 135/276 (49%), Gaps = 31/276 (11%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA+  +  VV EQN+ P I N++LS +               A  I +A+++ +E F+ K
Sbjct  114  AAMMNIPIVVQEQNSYPGITNKILSKK---------------ASVICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-  431
             K  + GNPVR  L    SK+     +F                   +   ++  + +N 
Sbjct  158  DKIKITGNPVREDLISIESKKWDALTYF---------TLDATQKTLLVLGGSLGSRRINQ  208

Query  432  LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
            L +  +D    +++ +IWQ G   F E     +  P + +  F+  MDL YAAAD IISR
Sbjct  209  LIAKEIDFITSQNIQVIWQCGKLYFEEYIHFAR--PNVKVVSFIDRMDLVYAAADFIISR  266

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ ENELD     +   
Sbjct  267  AGASSVSELCLVGKPVIFIPSPNVAEDHQTKNAKAIEDKKGAVLLKENELDE-KFEAVFS  325

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             ++ DE    ++  + LK AK +A+ +I K I  L+
Sbjct  326  NLVNDEIKQNELGSQILKLAKPNATIDIVKEISKLL  361



>ref|WP_038112870.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tolypothrix bouteillei]
Length=321

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 91/270 (34%), Positives = 152/270 (56%), Gaps = 25/270 (9%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  V+ EQN+   I N++L+ +               A KI +A+   ++ F+ K+K V
Sbjct  74   GIPTVIQEQNSYAGITNKLLARK---------------AKKICVAY-PQMDKFFSKEKIV  117

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
              GNPVRS +     K+++  H F    +L+   K +LV+GGSLGA  IN  +      +
Sbjct  118  FTGNPVRSDILDISQKKLSALHHF----NLKENKKTLLVIGGSLGARTINESMKKWLDRI  173

Query  447  LDERKDLFLIWQTGVEAFHEIESLV--KTHPRLVLTPFLHAMDLAYAAADLIISRSGAMT  620
            LD   ++ LIWQTG   F   + LV  K   ++ +  F++ MDLAYAA+D++ISR+GA++
Sbjct  174  LDN--EVQLIWQTGKTFFETAQKLVIEKRSEQVKVFDFINTMDLAYAASDVVISRAGALS  231

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
              E+    KP IL+PSPNV+E HQ KNA ++ +   A ++ + + ++F +  A  ++L D
Sbjct  232  ISELCLAQKPSILVPSPNVSEDHQTKNAMVLVENNAALMVADKDAEAFLVGDAM-DLLND  290

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSL  890
            E++   +     K A+ +A+ EI + I+ +
Sbjct  291  EAMQNILKNNIKKFARPNAADEIVQEIVKI  320



>ref|WP_035651765.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. Fl]
Length=362

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 140/283 (49%), Gaps = 32/283 (11%)
 Frame = +3

Query  51   FQNAIFLDAALG-GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFD  227
            F +   L AA G G+  V+ EQN+ P I N++LS +               A+ I +A+ 
Sbjct  105  FASGPLLQAAGGAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAY-  148

Query  228  SSIECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgAN  407
             ++E F+   K V+ GNPVR  L    SK      F+    + +    +   LG      
Sbjct  149  KNLERFFPADKIVLTGNPVRQDLIDIESKRDEAITFYGLDPNKKTLLVLGGSLGARRINQ  208

Query  408  AINVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             I  +L N  S      +D+ +IWQ G   F + +      P + +  F+  MD  YAAA
Sbjct  209  LIEKELQNFLS------QDVQVIWQCGKLYFEDYKKY--NQPNVKVVDFIERMDFVYAAA  260

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-F  764
            D+IISR+GA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELD+ F
Sbjct  261  DVIISRAGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLKESELDNEF  320

Query  765  ALRSATEEILGDES----LMADMSKRALKAAKLDASAEISKHI  881
            ++    E +L DE     L +++ K A+  A  D  AEI K I
Sbjct  321  SI--VFEALLKDEGKQKQLSSNIKKLAMPKATQDIVAEIVKLI  361



>ref|WP_004344270.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Prevotella buccae]
 gb|EFU31641.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella buccae ATCC 33574]
Length=370

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 147/271 (54%), Gaps = 25/271 (9%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++L+ +               ADKI +A++  +E F+   K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLAKK---------------ADKICVAYEG-MERFFPADKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L+ ++SKE AR+ F      L+ + K +L++GGSLGA  IN  + N Y+ 
Sbjct  163  MTGNPVRQNVLETSISKEDARKGF-----GLDPDKKTILLVGGSLGARTINDSVKNAYTE  217

Query  444  VLDERKDLFLIWQTGVEAFHEI--ESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            ++ +  D+  IWQTG   + EI  E   KT P L    F+  M  AY AADL+ISR+GA 
Sbjct  218  LIGQNPDIQFIWQTGKYYYPEIQREFGQKTCPNLKFMDFISDMGAAYKAADLVISRAGAS  277

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + E     ++ A   +  
Sbjct  278  SISEFCIIGKPVILVPSPNVAEDHQTKNAMALVNKDAALYVKDAEAPGRLIQLAMATV-K  336

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            D++ +A +S+   K    D++  I+  ++ L
Sbjct  337  DDAKLASLSENIKKLGLKDSADIIADEVIKL  367



>ref|WP_007411263.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Prevotella sp. MSX73]
 gb|EJP31667.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella sp. MSX73]
Length=370

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 147/271 (54%), Gaps = 25/271 (9%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++L+ +               ADKI +A++  +E F+   K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLAKK---------------ADKICVAYEG-MERFFPADKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L+ ++SKE AR+ F      L+ + K +L++GGSLGA  IN  + N Y+ 
Sbjct  163  MTGNPVRQNVLETSISKEDARKGF-----GLDPDKKTILLVGGSLGARTINDSVKNAYTE  217

Query  444  VLDERKDLFLIWQTGVEAFHEI--ESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            ++ +  D+  IWQTG   + EI  E   KT P L    F+  M  AY AADL+ISR+GA 
Sbjct  218  LIGQNPDIQFIWQTGKYYYPEIQREFGQKTCPNLKFMDFISDMGAAYKAADLVISRAGAS  277

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + E     ++ A   +  
Sbjct  278  SISEFCIIGKPVILVPSPNVAEDHQTKNAMALVNKDAALYVKDAEAPERLIQLAVATV-K  336

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            D++ +A +S+   K    D++  I+  ++ L
Sbjct  337  DDAKLASLSENIKKLGLKDSADIIADEVIKL  367



>gb|KHO62810.1| UDP-N-acetylglucosamine-N-acetylmuramylpentapeptide N-acetylglucosamine 
transferase [Thermoanaerobacter sp. YS13]
Length=364

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 89/283 (31%), Positives = 139/283 (49%), Gaps = 33/283 (12%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P   N+VLS                F   + ++F+ S+E 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGFTNKVLSR---------------FVKVVAVSFEESVEY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQH--FFPelgdlegegkvvlvlggslgANAIN  416
            F  K K VV GNP+R  L   ++KE   ++  F+P+   +   G            N+  
Sbjct  152  FKNKGKVVVTGNPIRKEL-LEITKEEGLKNLGFYPDNPLIVSVGGSRGAEKI----NSTM  206

Query  417  VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYA  581
            V+ L L      + K+L ++  TG   + ++   VK         + + P+ H M   YA
Sbjct  207  VEFLKL------KDKNLQVLIITGTNQYEKVLENVKIETIDIDETVKIIPYCHNMQDVYA  260

Query  582  AADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS  761
            AAD+II R+GA+T  EI A G   ILIPSP V   HQ  NA ++ K   + VI E +L +
Sbjct  261  AADIIICRAGAITLSEITAKGVASILIPSPYVVNNHQEYNARVLEKAEASYVILEKDLTA  320

Query  762  FALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
              L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  321  EELYKKIKYLLDNPQVLSKMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_036787551.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Polaribacter sp. Hel1_33_49]
 gb|KGL61511.1| UDP-N-acetylglucosamine-N-acetylmuramyl- pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Polaribacter sp. Hel1_33_49]
Length=363

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 136/274 (50%), Gaps = 35/274 (13%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A+  G+  ++ EQN+ P I N++LS                 A KI +A+D  +E F+  
Sbjct  114  ASRKGIPTLIQEQNSFPGITNKLLSKR---------------ASKICVAYDH-LERFFPL  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V  GNPVR  L    SKE   + FF +L        V+    G+   N +    L  
Sbjct  158  DKMVKTGNPVRQDLLTIYSKEQEAKDFF-KLHKTNKTILVLGGSLGARKINQLVEGNLEF  216

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIE-----SLVKTHPRLVLTPFLHAMDLAYAAADLII  599
            + N     +++ +IWQ G   F E       S V+ H       F++ MDLAYAA D+II
Sbjct  217  FKN-----QEVQIIWQCGKLYFDEYNKYNDLSYVQVHE------FVNRMDLAYAATDIII  265

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GA +  E+   GKP I IPSPNVAE HQ KNA  +A   GA ++ E+EL++F +   
Sbjct  266  SRAGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKSIADKHGAILLKESELETFPIVFE  325

Query  780  T--EEILGDESLMADMSKRALKAAKLDASAEISK  875
            T  ++I   E L  ++ + AL  A  D   EI K
Sbjct  326  TLLKDIGKQEHLSENIKELALPGATTDIVNEIEK  359



>ref|WP_012023886.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium johnsoniae]
 ref|YP_001194161.1| UDPdiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium johnsoniae UW101]
 sp|A5FIY3.1|MURG_FLAJ1 RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Flavobacterium johnsoniae UW101]
 gb|ABQ04842.1| Candidate undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; 
Glycosyltransferase family 28 
[Flavobacterium johnsoniae UW101]
Length=361

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 140/274 (51%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  VV EQN+ P I N++LS +               A+ I +A+++ +E F+ K
Sbjct  114  AGSAGIPTVVQEQNSFPGITNKLLSKK---------------ANAICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L    +K      F+    + +    +   LG       I  +L N 
Sbjct  158  EKIVLTGNPVRQDLIDIDTKRDEAIAFYGLDPNKKTLLVLGGSLGARRINQLIEKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F + +   + + ++V   F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQIIWQCGKLYFEDYKKYNQQNVKVV--DFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  + +  GA ++ E+ELD+ F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVEAKGAILLKESELDNEFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L D+     +S    K A+ DA+  I + I  L+
Sbjct  328  LKDDGKQKQLSANIKKLARPDATKVIVEQIKKLL  361



>ref|WP_037319361.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Salegentibacter sp. Hel_I_6]
Length=363

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 92/279 (33%), Positives = 138/279 (49%), Gaps = 49/279 (18%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+ P I N++L+ E               +DKI  A++  ++ F+  +K +
Sbjct  119  GIPTLIQEQNSFPGITNKLLAKE---------------SDKICAAYEE-VKRFFPSEKTI  162

Query  267  VCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR  L K + ++E A  HF          G         +   ++  + +N    
Sbjct  163  ITGNPVRQDLLKIDENREKALAHF----------GLEKDKKVLLVLGGSLGARRINQLVE  212

Query  444  VLDER---KDLFLIWQTGVEAFHEIE----SLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
               ER   +++ LIWQTG   F E +     LV+TH       FL+ M+ AY AAD+IIS
Sbjct  213  TNLERFKKENIQLIWQTGKLYFEEYKKYNSGLVQTHL------FLNEMNFAYGAADVIIS  266

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS------F  764
            R+GA T  E+   GKP + +PSPNVAE HQ KNA  + K   A ++ ENELD       F
Sbjct  267  RAGAGTVSELSIVGKPVLFVPSPNVAEDHQAKNALAVVKKNAAMMLKENELDEKFETEFF  326

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHI  881
            AL ++ E+    + L  ++ K AL  A      E+ K I
Sbjct  327  ALMASEEK---QKELGENIKKLALPNATARIVDEVEKLI  362



>ref|WP_013433140.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
kristjanssonii]
 ref|YP_004027026.1| UDP-N-acetylglucosamine--n-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
n-acetylglucosamine transferase [Caldicellulosiruptor 
kristjanssonii I77R1B]
 gb|ADQ41413.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
kristjanssonii I77R1B]
Length=369

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/266 (31%), Positives = 138/266 (52%), Gaps = 26/266 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F DK+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCDKVLISFEESKKYFKRSKDVI  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N ++  A++               VL++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYNQSQAKREI------GADSKTTVLIVGGSRGAENLNRAAIRL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
             +  KD+  I  TG + F +++S    +     + L P++  M    AAAD++ISR GA+
Sbjct  217  FEGNKDVHFILSTGEKKFDDVKSYAEQLNAGTNISLYPYIKEMPKYLAAADVVISRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + K     V+ E+EL+   LR   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQEYNARALEKEGACFVVLESELEGDKLRILLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISK  875
            D+ L   M +++    + DA+ +I++
Sbjct  337  DKQLYTSMQRKSKNLGRPDATEKIAR  362



>ref|WP_029229119.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
acetigenus]
Length=369

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/266 (31%), Positives = 138/266 (52%), Gaps = 26/266 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F DK+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCDKVLISFEESKKYFKRSKDVI  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N ++  A++               VL++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYNQSQAKREI------GADSKTTVLIVGGSRGAENLNRAAIRL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
             +  KD+  I  TG + F +++S    +     + L P++  M    AAAD++ISR GA+
Sbjct  217  FEGNKDVHFILSTGEKKFDDVKSYAEQLNAGTNISLYPYIKEMPKYLAAADVVISRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + K     V+ E+EL+   LR   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQEYNARALEKEGACFVVLESELEGDKLRILLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISK  875
            D+ L   M +++    + DA+ +I++
Sbjct  337  DKQLYTSMQRKSKNLGRPDATEKIAR  362



>ref|WP_003871206.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter ethanolicus]
 gb|EGD50737.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
ethanolicus JW 200]
Length=364

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 143/281 (51%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGLTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K+K VV GNP+R  L +   +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKEKVVVTGNPIRRELLKITKEEGLKNLGF------YSDKPLIVSVGGSRGAEKINFT  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++        + K+L ++  TG   + ++   VKT        + + P+ H M   YAA 
Sbjct  206  MVEFLKQ---KDKNLQVLIITGANQYEKVLEKVKTETINIDETVKIIPYCHNMQDVYAAT  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLIAEE  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  +++ M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLSRMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_029688544.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Thermoanaerobacter sp. A7A]
Length=364

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 137/281 (49%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P   N+VLS                F   + ++F+ S++ 
Sbjct  107  VLMMAALKGIPTLIHEQNAFPGFTNKVLSR---------------FVKVVAVSFEESVKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K+K VV GNP+R  L +   +E  +   F            V    G+   N+  V+
Sbjct  152  FKNKEKVVVTGNPIRRELLKVTKEEGLKNLGF---YSDNPLIVSVGGSRGAEKINSTMVE  208

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
             L L      + K+L ++  TG   + ++   VKT        + + P+ H M   YAAA
Sbjct  209  FLKL------KDKNLQVLIITGANQYEKVLEKVKTETIDIDETVKIIPYCHNMQDVYAAA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L +  
Sbjct  263  DIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKAGASYVILEKDLIAEE  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L    + +L +  ++  M   A K +K+DA+ +I K I S+
Sbjct  323  LYKKIKYLLDNPQVLLKMRDNARKISKIDAAEKIYKLIKSI  363



>ref|WP_026474839.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Alkaliflexus imshenetskii]
Length=367

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 155/280 (55%), Gaps = 36/280 (13%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  V+ EQN+ P + N++L+ +               A  I +A+   +E F+  
Sbjct  116  AAAAGIPTVIQEQNSFPGVTNKILAKK---------------AAAICVAY-HGMERFFPA  159

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K ++ GNPVRS+L   V++  A  HF     +L  + K +LV+GGSLGA +IN  ++  
Sbjct  160  QKIILTGNPVRSNLLDTVNRTEAYAHF-----NLNPDYKTILVVGGSLGAGSINRGMIEC  214

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIES------LVKTHPRLVLTPFLHAMDLAYAAADLI  596
               + DE   + +IWQTG   F+++++      L   H      PF+  MDLAYA AD++
Sbjct  215  IGMLKDE--PIQVIWQTGKFYFYKLQAELAVMYLSNVH----AMPFIQRMDLAYAVADVV  268

Query  597  ISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF-ALR  773
            +SR+GA T  E+   GK  +L+PSPNV+E HQ KNA  +   AGA V+ ++  D+F  L 
Sbjct  269  VSRAGAGTISELALLGKASVLVPSPNVSEDHQTKNAMALVD-AGAAVLVKDA-DAFEKLL  326

Query  774  SATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             A  E+LGD   +  + +   + A+ +A A+I+  ++ L+
Sbjct  327  PAAVELLGDSHRIEMLQQNIKQFARPNADADIAHEVMRLL  366



>ref|WP_004341565.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Prevotella buccae]
 gb|EFC76089.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella buccae D17]
Length=370

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 146/264 (55%), Gaps = 26/264 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++L+ +               ADKI +A++  +E F+   K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLAKK---------------ADKICVAYEG-MERFFPADKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L+ ++SKE AR+ F      L+ + K +L++GGSLGA  IN  + N Y+ 
Sbjct  163  MTGNPVRQNVLETSISKEDARKGF-----GLDPDKKTILLVGGSLGARTINDSVKNAYTE  217

Query  444  VLDERKDLFLIWQTGVEAFHEIESLV--KTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            ++++  D+  IWQTG   + EI+     KT P L    F+  M  AY AADL+ISR+GA 
Sbjct  218  LIEQNPDIQFIWQTGKYYYPEIQREFGQKTCPNLKFMDFISDMGAAYKAADLVISRAGAS  277

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + E     ++ A   +  
Sbjct  278  SISEFCIIGKPVILVPSPNVAEDHQTKNAMALVNKDAALYVKDAEAPERLIQLAVATV-K  336

Query  798  DESLMADMSKRALKAAKLDASAEI  869
            D++ +A +S+  +K   L  SA+I
Sbjct  337  DDAKLASLSEN-IKKLGLKNSADI  359



>ref|WP_026038635.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Myroides injenensis]
Length=363

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 137/270 (51%), Gaps = 28/270 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  VV EQN+ P I NR L  +               A  I +A+D  +  F+  K  +
Sbjct  119  GLPTVVQEQNSYPGITNRFLGKK---------------AKCICVAYDE-VASFFPGKNVL  162

Query  267  VCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
              GNPVR  L      KE A Q+F   L   +    V+    G+   N +  K +  ++ 
Sbjct  163  KTGNPVRKDLLTVEDKKEEAFQYF--GLDRTKKVLLVLGGSLGARRINQLIEKEIPFFN-  219

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
                R  + ++WQ G   + E +    T   + + PF+  MDLAYA AD+IISRSGA + 
Sbjct  220  ----RMGIQILWQCGKLYYDEYKKSESTD--IKVAPFIDRMDLAYACADIIISRSGASSV  273

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             E+   GKP I IPSPNVAE HQ KNA  + K  GA +I ENELD F  R  ++ +L D 
Sbjct  274  SELAIIGKPVIFIPSPNVAEDHQTKNANSIVKHGGAVMIKENELDQFE-RIFSDLVL-DN  331

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLV  893
            + M ++ K+  K A  +A+ +I   I++L+
Sbjct  332  NKMIELGKQFKKLALPNATKDIVDQIIALI  361



>ref|WP_028890210.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tenacibaculum ovolyticum]
Length=363

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 90/269 (33%), Positives = 133/269 (49%), Gaps = 29/269 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  V+ EQN+ P I N++LS +               A KI +A+D+ +E F+ + K +
Sbjct  119  GIPTVIQEQNSYPGITNKLLSKK---------------ASKICVAYDN-LERFFPEDKII  162

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
              GNP+R  L    +K+     FF      +    +   LG       I   L       
Sbjct  163  KTGNPIRQDLLLVHAKKEEGAAFFELDKTKKTILVLGGSLGARKINQLIEANL------A  216

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
              + +++ LIWQ G   F E +   +    + +  FL+ MDLAYAA D ++SR+GA +  
Sbjct  217  FFKEQEVQLIWQCGKLYFEEYKKYNEVE-DVQVHQFLNRMDLAYAATDFVVSRAGASSVS  275

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD--  800
            E+   GKP I IPSPNVAE HQ KNA  +    GA ++ ENELD+F +    E +L D  
Sbjct  276  ELCVVGKPTIFIPSPNVAEDHQTKNAKSIVDKHGAILVKENELDTFPI--VIETLLKDKG  333

Query  801  --ESLMADMSKRALKAAKLDASAEISKHI  881
              +SL  ++++ AL  A  D   EI K I
Sbjct  334  KQQSLSENINELALPNATNDIVNEIEKLI  362



>ref|WP_016989692.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. ACAM 123]
Length=364

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 144/274 (53%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A++ G   V+ EQN+ P I N++LS +               AD I +A+++ +E F+ K
Sbjct  114  ASMMGFPTVIQEQNSYPGITNKLLSKK---------------ADIICVAYEN-LERFFSK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K VV GNPVR  L     K  A   +F   G+ +    +   LG       I  +L N+
Sbjct  158  EKMVVTGNPVRKDLIEIEDKREAAIDYFNLNGNKKTLLVLGGSLGARRINQLIEKELENI  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
                  + +++ +IWQ G   F + +       +++   F+  MDL YAA+D+IISR+GA
Sbjct  218  ------QNQNVQIIWQCGKLYFEDYKKYNSNAVQVI--AFIERMDLVYAASDIIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL++ F+L    E +
Sbjct  270  SSVSELAIVGKPVIFIPSPNVAEDHQTKNAKAIVDKKGALLMKESELETEFSL--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L D+   + +S+   + A  +A+ +I+  I+ L+
Sbjct  328  LKDKGKQSQLSENIKRLAMPEATQKIADEIVKLI  361



>ref|WP_013290022.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
obsidiansis]
 ref|YP_003840005.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Caldicellulosiruptor 
obsidiansis OB47]
 gb|ADL42019.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
obsidiansis OB47]
Length=369

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 137/268 (51%), Gaps = 26/268 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F DK+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCDKVLISFEESRKYFKKSKNII  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N ++  A++               VL++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYNQSQAKREI------GVEGKTTVLIVGGSRGAENLNRAAIRL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLV---LTPFLHAMDLAYAAADLIISRSGAM  617
             +  KD+  I  TG + F + ++  K    L    L P++  M    AAAD+++SR GA+
Sbjct  217  FEGNKDVHFILSTGEKKFDDAKNYAKQLNALTNISLYPYIMEMPKYLAAADIVVSRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + +     V+ ENEL+   L+   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQEYNARALERQGACFVVLENELEEDKLKIFLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISKHI  881
            D+ L   M K++    + DA+  I+K I
Sbjct  337  DKELYTSMQKKSKNLGRPDATENIAKII  364



>dbj|GAK97971.1| UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Nonlabens 
sediminis]
Length=362

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 132/275 (48%), Gaps = 36/275 (13%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+ P I N++LS ++         +RI  A K        +E F+ K K V
Sbjct  118  GIPTLIQEQNSFPGITNKLLSKKV---------KRICVASK-------GLERFFPKDKMV  161

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNPVR  L    SK+     FF         G         +   ++  + LN    +
Sbjct  162  MTGNPVRQDLLDITSKKQQAIEFF---------GLDENKKTLLVLGGSLGARRLN---QL  209

Query  447  LDER-----KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSG  611
            +DE      KD+ +IWQ G   F+      K   +L +  FL  MDLAYAAAD IISRSG
Sbjct  210  IDENSAQLLKDVQIIWQCG--KFYYETYKAKEQKQLQVKAFLERMDLAYAAADFIISRSG  267

Query  612  AMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEI  791
            A T  E+   GKP I IPSP+VAE HQ KNA  + +   A +I E++L+     +  + +
Sbjct  268  AGTISELCIVGKPVIFIPSPHVAEDHQTKNAQAIVQENAAVMIKESDLEQ-NFMTLWKGL  326

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            + D      +SK   K A   A++ I   I  L+N
Sbjct  327  IQDSKKQETLSKNIKKLALPQATSHIVNEIEQLLN  361



>ref|WP_023152770.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Eubacterium brachy]
 gb|ESE31178.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Eubacterium brachy ATCC 33089]
Length=365

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 139/272 (51%), Gaps = 27/272 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K  +HEQNA+P + N++L   +               + +FL F+ + + F QK+K +
Sbjct  115  GIKCYIHEQNAIPGMTNKMLEKVV---------------ENVFLGFEEAGKFFKQKEKHI  159

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNPVR    +   K++AR+        +  +  VVL  GGS GA  +N  ++ +    
Sbjct  160  LAGNPVRDEFFK-ARKDVARETL-----GISPDDFVVLSFGGSQGAAKLNKAMMTVVEE-  212

Query  447  LDERKDLFLIWQTGVEAFHEI-----ESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSG  611
             + R D+ + + TG   +  I     E  V     + + P++  M    AAADL+ISRSG
Sbjct  213  YNGRDDVKVFFGTGKRYYEPIVNELAEIGVDVQNNIKIMPYIDNMQNYIAAADLVISRSG  272

Query  612  AMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEI  791
            A+T  EI   G P ILIPSPNVA  HQ+ NA  +A   GA ++ E +L    L    + +
Sbjct  273  ALTVSEIAVCGTPSILIPSPNVAGNHQMFNAQAVAGKGGAVLLEEKDLSGEKLIDEIKRL  332

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILS  887
              DE L+ +M+K A   A LDAS  I   IL+
Sbjct  333  EKDEKLLNEMAKNARLCAPLDASDIIYYVILN  364



>ref|WP_022083241.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Bacteroides 
sp. CAG:144]
 emb|CDA21759.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Bacteroides 
sp. CAG:144]
Length=372

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 96/276 (35%), Positives = 162/276 (59%), Gaps = 27/276 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  GV  ++ EQN+   + N++L+S+               A KI +A+++ +E F+ K
Sbjct  115  AARRGVPTLIQEQNSYAGVTNKLLASK---------------AVKICVAYEN-MERFFPK  158

Query  255  KKCVVCGNPVRSSLKR-NVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
            ++ V+ GNPVR SL+  + ++E A   F      L+ + K VLV+GGSLGA  IN  +++
Sbjct  159  ERIVLTGNPVRQSLQGISCTREEAITFF-----GLDPKKKTVLVVGGSLGARTINQSVIS  213

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLV--KTHPRLVLTPFLHAMDLAYAAADLIISR  605
                +  +  ++ LIWQ+G      +++ +  K +  +V  PF+  MD+AY AADL+ISR
Sbjct  214  ALDRIPGD--EVQLIWQSGKYYEESVKAALAGKDYDYVVQMPFITRMDMAYKAADLVISR  271

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E+   GKP +L+PSPNVAE HQ KNA  +++   A +I ++E  +  + +A  
Sbjct  272  AGAGSISELCLLGKPALLVPSPNVAEDHQTKNAMALSEKGAALLIPDSEAVARLIDTAM-  330

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            +I+ ++ L+  M +R L  A+ D++A I+  IL +V
Sbjct  331  DIVRNDVLLEKMQQRILSLAQRDSAARIADIILEIV  366



>ref|WP_010228690.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Gillisia marina]
Length=368

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 124/223 (56%), Gaps = 32/223 (14%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I NR+L                  AD I  A+D+ +E ++   K V  GN
Sbjct  123  LIQEQNSYPGITNRLLGKN---------------ADAICTAYDN-LENYFPLAKTVKTGN  166

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  +    SK    Q FF     L+ E K +LVLGGSLGA  IN +L+  + ++  E+
Sbjct  167  PVRQDILDVASKREEAQEFF----KLKKERKTLLVLGGSLGARRIN-QLMEAFVDIF-EK  220

Query  459  KDLFLIWQTGVEAFHEIESL----VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
            +D+ LIWQTG   + E +      V+TH       FL  MDLAYAAAD+I+SR+GA++  
Sbjct  221  EDIQLIWQTGSLYYEEYKKFDNEFVQTHA------FLSRMDLAYAAADVIVSRAGAISVS  274

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENEL  755
            E+   GKP I IPSPNVAE HQ KNA  +A    A V+ E +L
Sbjct  275  ELCIVGKPVIFIPSPNVAENHQAKNALTVANEDAAYVLNEKDL  317



>ref|WP_028891248.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tenacibaculum sp. 47A_GOM-205m]
Length=363

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 138/276 (50%), Gaps = 37/276 (13%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+ P I N+ L                  A KI +A+D+ +E F+ + K +
Sbjct  119  GIPTLIQEQNSYPGITNKFLGKS---------------AQKICVAYDN-LERFFSEDKII  162

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
              GNPVR  L    +K    + FF      +    +   LG       I   L   + N 
Sbjct  163  KTGNPVRQDLLFIHTKIEEGKEFFELDASKKTLLVLGGSLGARKINQLIEANL-GFFKN-  220

Query  447  LDERKDLFLIWQTG------VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
                +++ LIWQ G       + ++EIE+ V+ H       FL+ MDLAYAAAD I+SR+
Sbjct  221  ----QNIQLIWQCGKLYFDEYKKYNEIEN-VQVHQ------FLNRMDLAYAAADFIVSRA  269

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GA +  E+   GKP I IPSPNVAE HQ KNA  +AK  GA V+ E+EL++F +    E 
Sbjct  270  GASSVSELCIVGKPTIFIPSPNVAEDHQTKNAKSIAKEHGAIVVKESELETFPV--VLET  327

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            +L D+     +S+   + A  +A++ I   I  L++
Sbjct  328  LLKDKGKQESLSENINELALPNATSHIVNEIEKLIS  363



>ref|WP_027308722.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Caloramator sp. ALD01]
Length=366

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 146/275 (53%), Gaps = 30/275 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + N++LS                F D+I + F  S E 
Sbjct  107  VVMQAALKGIPTIIHEQNAFPGVTNKILSH---------------FVDRIAITFRES-EK  150

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            ++ K K V  GNP+R  +       MA +        LE    +VLV+GGS GA  IN+ 
Sbjct  151  YFPKNKVVYTGNPIRKQI------LMANKEQAISSMGLEKNKPIVLVVGGSRGAKNINIA  204

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRL------VLTPFLHAMDLAYAA  584
            ++++ + +   +  + LI+ TG   ++E+   VK+  ++       + P+++ M  A AA
Sbjct  205  VVDIINELY--KNGIQLIFITGENNYNEVIEKVKSKYQINNMKGIKILPYVYNMHDALAA  262

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            +DLIISR+GA    EI A GKP ILIPSP VA  HQ  NA  + +     VI E+EL + 
Sbjct  263  SDLIISRAGATIISEITALGKPSILIPSPYVANNHQEYNARALEEKGACIVIKESELKND  322

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEI  869
             L+     I+ ++ ++ +M+  + K +KLDA+  I
Sbjct  323  ILKEQVLNIVKNKEILLNMANASKKLSKLDAADNI  357



>ref|WP_029273294.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. KJJ]
Length=361

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 138/274 (50%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A L G+  V+ EQN+ P I N++LS +               A+ I +A+  ++E F+ K
Sbjct  114  AGLFGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAY-GNLERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K VV GNPVR  L    SK      F+    + +    +   LG       I  +L N 
Sbjct  158  EKIVVTGNPVRQDLIDIDSKRDEAIAFYGLDPNKKTLLVLGGSLGARRINQLIEKELHNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ +IWQ G   F + +   + + R+V   F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QDVQIIWQCGKLYFEDYKKHAQQNVRVV--DFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL+S F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLKESELESQFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L D+     +S    K A  +A+  I + I  L+
Sbjct  328  LKDDGKQKQLSANIKKLAMPNATKVIVEEIKKLL  361



>ref|WP_014042652.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
lactoaceticus]
 ref|YP_004798933.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Caldicellulosiruptor 
lactoaceticus 6A]
 gb|AEM73956.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
lactoaceticus 6A]
Length=369

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 137/266 (52%), Gaps = 26/266 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F DK+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCDKVLISFEESKKYFKRSKDVI  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N ++  A++               VL++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYNQSQAKREI------GADSKTTVLIVGGSRGAENLNRAAIRL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
             +  KD+  I  TG + F + +S    +     + L P++  M    AAAD++ISR GA+
Sbjct  217  FEGNKDVHFILSTGEKKFDDAKSYAEQLNAVANISLYPYIKEMPKYLAAADVVISRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + K     V+ E+EL+   LR   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQEYNARALEKEGACFVVLESELEGDKLRILLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISK  875
            D+ L   M K++    + DA+ +I++
Sbjct  337  DKQLYTSMQKKSKNLGRPDATEKIAR  362



>ref|WP_026933606.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Gramella echinicola]
Length=367

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 134/274 (49%), Gaps = 33/274 (12%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN++P I NR+L+                +AD I  A++   E F   ++ +
Sbjct  119  GIPTLIQEQNSLPGITNRILAK---------------YADTICAAYEKVKEVF-PAERTI  162

Query  267  VCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-LYS  440
            + GNPVR  L + N  +E A +HF                    +   ++  + +N L  
Sbjct  163  ITGNPVRQDLLEVNQLREQALEHF----------NLSKNKKTVLVLGGSLGARRINRLIE  212

Query  441  NVLDERKD--LFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            N L + KD  + LIWQ G   F E +     + R     F++ MDLAYAAAD+IISR+GA
Sbjct  213  NDLKKFKDENVQLIWQIGKLYFDEYKKYDSINVRA--KEFINRMDLAYAAADVIISRAGA  270

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+   GKP + IPSPNVAE HQ KNA  +     A +ITE+EL+          +L
Sbjct  271  GSVSELCIVGKPVLFIPSPNVAENHQAKNAMAVTDHDAALMITEDELNE-KFEPCFFSLL  329

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             DE  M   +    K A  +A+++I   +  L+N
Sbjct  330  EDERRMNRFAANIKKLALPNATSDIVDEVEKLIN  363



>ref|WP_013663384.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Sphingobacterium sp. 21]
 ref|YP_004315319.1| UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-UDP 
N- acetylglucosamine transferase [Sphingobacterium 
sp. 21]
 gb|ADZ76649.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Sphingobacterium 
sp. 21]
Length=371

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 144/273 (53%), Gaps = 25/273 (9%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            + +++ EQN+   I N+ L ++               A KI +AF+  ++ F+ K K ++
Sbjct  121  IPYLIQEQNSYAGITNKKLGAK---------------ASKICVAFEG-MDRFFPKDKLLI  164

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNP+R      V KE   +        L+ + K +L+ GGSLGA  +N  +LN    + 
Sbjct  165  TGNPIRRDAVDIVGKEFEAKELL----GLDHDKKTILLTGGSLGARTLNESILNGLKKM-  219

Query  450  DERKDLFLIWQTGVEAFHEIESLVKTHP--RLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
              + +L +IWQ G   + +++ ++K      + L PFLH MDLAYAAAD+I++R+GA T 
Sbjct  220  -RKANLQIIWQCGSYYYEKMQDVLKDDGLEDVCLKPFLHRMDLAYAAADVIVARAGAGTI  278

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             E+ A GKP IL+PSPNVAE HQ KNA  + K   A ++ E+      L      ++ D+
Sbjct  279  AELCAVGKPAILVPSPNVAEDHQTKNALALIK-KNAAIMVEDLKARETLMDEVIALIKDK  337

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
                 +S      AK+DA   I+K +L L+  +
Sbjct  338  EECKVLSANIKNLAKVDADEVIAKEVLELIKLN  370



>dbj|GAK93720.1| UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Nonlabens 
ulvanivorans]
Length=362

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 148/275 (54%), Gaps = 28/275 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A++ G+  ++ EQN+ P I N++LS ++ K  + S                + ++ F+ K
Sbjct  114  ASMKGIPSLIQEQNSYPGITNKLLSKKVQKICVAS----------------TGLDRFFPK  157

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
            +K V+ GNPVR  L   +  +E A QHF     +L+   K +L+LGGSLGA  IN  +  
Sbjct  158  EKIVLTGNPVRQDLLDIDSKREQALQHF-----NLDASKKTLLILGGSLGARRINQLIDA  212

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSG  611
               N+    KD+ +IWQ G   F+  +   KT   + +  F+  MDLAY+AAD IISR+G
Sbjct  213  QLENI---SKDVQVIWQCG--KFYYDQYKNKTTASVQVHAFISKMDLAYSAADFIISRAG  267

Query  612  AMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEI  791
            A T  E+   GKP I IPSPNV+E HQ KNA  + +     ++ E ++D     +  + +
Sbjct  268  AGTISELCIVGKPVIFIPSPNVSEDHQTKNALAVVEKGAGLLVKETDIDQ-NFNTIWKGL  326

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            + D+ L  ++S +  + A   A+ +I   + S++N
Sbjct  327  ITDDELQNNLSSQIKQLALPHATIDIVNQLESIIN  361



>ref|WP_015907331.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
bescii]
 ref|YP_002572666.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Caldicellulosiruptor 
bescii DSM 6725]
 gb|ACM59893.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
bescii DSM 6725]
Length=368

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/266 (31%), Positives = 135/266 (51%), Gaps = 26/266 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F DK+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCDKVLISFEESRKYFKKSKDII  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N  +  A++               +L++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYDQAQAKREI------GMDGKTTILIVGGSRGAENLNRAAIKL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
             +   D+  I  TG + F + +S    +     + L P++  M    AAAD++ISR GA+
Sbjct  217  FEGNNDVHFILSTGEKKFDDAKSYAEQLNAGANISLYPYIKEMPKYLAAADIVISRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + K     V+ E+ELD   LR   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQDYNARALEKEGACFVVLESELDGDKLRILLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISK  875
            D+ L   M K++    + DA+ +I++
Sbjct  337  DKQLYTSMQKKSRNLGRPDATEKIAR  362



>gb|EDM43764.1| N-acetylglucosaminyl transferase [unidentified eubacterium SCB49]
Length=320

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 137/285 (48%), Gaps = 32/285 (11%)
 Frame = +3

Query  51   FQNAIFLDAALGG-VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFD  227
            + +A  L  A G  +  ++ EQN    + N+ LS  +               D I +A+D
Sbjct  61   YASAPLLKVASGNNIPCLIQEQNGHAGVTNKWLSKTV---------------DTICVAYD  105

Query  228  SSIECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgAN  407
              +E F+ K K V+ GNPVR  L    +   A   FF                   +   
Sbjct  106  G-MEKFFPKSKLVLTGNPVREDLLDISTNRAAALKFF---------KLEETKKTVLVLGG  155

Query  408  AINVKLLN-LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAY  578
            ++  + +N L +N L   +  D+ LIWQ G    +E E    +  ++ ++ FL+ M+LAY
Sbjct  156  SLGARKVNQLVANALPFFKSNDVQLIWQCG--KLYEEEYKQHSKGQIQVSAFLNKMNLAY  213

Query  579  AAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD  758
            AAAD+IISR+GA++  E+   GKP I IPSPNVAE HQ KNA  ++    A V+ E + D
Sbjct  214  AAADIIISRAGAISVSELCLVGKPVIFIPSPNVAEDHQTKNAMSISSKGAAIVLKETDAD  273

Query  759  SFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
                 S    +L DE     +S+   K AK DA+ EI   ++ L+
Sbjct  274  Q-NFESELALLLKDEQKQKQLSENIKKLAKPDATNEIVAEVIKLL  317



>ref|WP_009437154.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella sp. oral taxon 473]
 gb|EKX91159.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella sp. oral taxon 473 str. F0040]
Length=372

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 153/277 (55%), Gaps = 27/277 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++L+                 A KI +A++  +E F+ K + V
Sbjct  118  GIPTLLQEQNSYAGVTNKLLAKR---------------AKKICVAYEG-MERFFPKDRIV  161

Query  267  VCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR +L   ++S + ARQ        L  + K +L++GGSLGA  +N  +LN + +
Sbjct  162  LTGNPVRQNLLHHSLSPQEARQQL-----GLRPDLKTILIIGGSLGARTLNESVLN-HLD  215

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVK--THPR-LVLTPFLHAMDLAYAAADLIISRSGA  614
             L +++D+ ++WQTG      I+  +   T P+ L +T F+  M  AYAAADL++SR+GA
Sbjct  216  WLTQQEDVQILWQTGKFYSGNIQERLSQTTQPQQLHVTEFVSDMSAAYAAADLVVSRAGA  275

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  EI   GKP IL+PSPNVAE HQ  NA  +     AR +T+ +  S  L  A   + 
Sbjct  276  SSISEICLLGKPSILVPSPNVAEDHQTHNALALVNKDAARYVTDADAPSALLELAVATVR  335

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
             DE  +  +S  ALK AK +A+ +I++  ++L    V
Sbjct  336  -DEPTLQQLSANALKLAKPNAARDIAEFAIALAQQKV  371



>ref|WP_027310401.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Bacteroidetes bacterium SCGC AAA027-N21]
Length=362

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 146/265 (55%), Gaps = 25/265 (9%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I N++LS +               A+KI +A+++ +E F+ K+K ++ GN
Sbjct  122  LIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-LERFFPKEKMILTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  L    SK      FF    +L+   K +L+LGGSLGA  +N  +     ++L++ 
Sbjct  166  PVRQDLIDIDSKRKEAIEFF----NLDSSKKTLLILGGSLGARRVNQLIEKEKESILNQ-  220

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILA  638
             ++ +IWQ G   F+  E        + +  FL  MDL YAAAD +I+R+GA +  E+  
Sbjct  221  -NVQIIWQCG--KFYLEEYKKYNSDSIQVFAFLDRMDLVYAAADFVITRAGASSVSELSI  277

Query  639  TGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMAD  818
             GKP + IPSPNVAE HQ KNA  +    GA +I E+ELD     S   +++ +E+L   
Sbjct  278  VGKPVLFIPSPNVAEDHQTKNAKSIVDRKGALMIKESELDK-NFNSVFSDLVANENLQKQ  336

Query  819  MSKRALKAAKLDASAEISKHILSLV  893
            +S    K AK++A+ +I   I+ L+
Sbjct  337  LSDTIKKLAKVNATKDIVDEIVKLI  361



>ref|WP_018280332.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Capnocytophaga cynodegmi]
Length=361

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 137/271 (51%), Gaps = 31/271 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N+ +  +               A+KI +A+D  +E F+ K+K V
Sbjct  116  GIPTIIQEQNSYAGVTNKWVCQK---------------AEKICVAYDD-MEKFFPKEKIV  159

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN--LYS  440
              GNPVR+ L     K    Q FF                   +   ++  + +N  + S
Sbjct  160  KTGNPVRADLLNISEKRKEAQTFF---------SLNPNKKTLLVLGGSLGARRINQLIES  210

Query  441  NV-LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            N+ L E+ D+ ++WQ G   F E +     + +++   F+  MD AYA+AD IISR+GA 
Sbjct  211  NLPLFEKLDIQVLWQCGKLYFEEYKKYNSENIKVL--QFIDRMDFAYASADAIISRAGAS  268

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E+   GKP I IPSPNVAE HQ KNA  +AK  G  +I E+ELDS    +   +++ 
Sbjct  269  SVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIAKKQGCVLIRESELDS-QFETIFSQLIL  327

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            DE+   ++S+   K A+ +A+ +I   I  L
Sbjct  328  DENQQKNLSENIKKLAQPNATKDIVDIIFKL  358



>ref|WP_035660677.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. EM1321]
 gb|KDN54502.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. EM1321]
Length=362

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 149/271 (55%), Gaps = 29/271 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  V+ EQN+ P I N++LS +               A+ I +A+++ +E F+ K+K +
Sbjct  118  GIPTVIQEQNSFPGITNKLLSKK---------------ANTICVAYEN-LERFFPKEKMI  161

Query  267  VCGNPVRSSLKRNVSKEM-ARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR  L    SK   A  HF      L+   K +LVLGGSLGA  IN  +     N
Sbjct  162  LTGNPVRQDLIAIESKRAEAIAHF-----KLDANKKTLLVLGGSLGARRINQLIEKELGN  216

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +L +  D+ +IWQ G   F + +     + ++V   F+  MD  YAAAD+IISR+GA + 
Sbjct  217  ILAQ--DVQIIWQCGKLYFEDYKKYNGDNVQVV--AFIEKMDFVYAAADVIISRAGASSV  272

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEILGD  800
             E+   GKP I IPSPNVAE HQ KNA  +    GA +I E++L++ F+L    E +L D
Sbjct  273  SELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKKGALLIKESDLNTEFSL--VFEALLKD  330

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSLV  893
            E     +S+   + A  +A+ +I+  I+ L+
Sbjct  331  EGKQKQLSENIKQLALPEATKQIADEIVKLI  361



>emb|CCF99919.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [uncultured 
Flavobacteriia bacterium]
Length=368

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 141/273 (52%), Gaps = 28/273 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  ++ EQN+ P I NR+L+S +               ++I +A++  +E ++ K+K V
Sbjct  118  GVPTLIQEQNSFPGITNRILASRV---------------NRICVAYEG-LERWFPKEKIV  161

Query  267  VCGNPVRSSLKRNVSK-EMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNP+RS +   + K E A  HF     DL+   K +L +GGSLGA +IN  +   Y  
Sbjct  162  MTGNPIRSDVIEIIGKRESANTHF-----DLDPSKKTILFVGGSLGARSINESVRKHYKE  216

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVK---THPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            +L       ++WQ G       E+L K   +   + L  F+  MDLAYAAAD I+SR+GA
Sbjct  217  ILA--AGYQILWQHGKAYSESAEALSKGLSSKEAIKLHVFIKKMDLAYAAADFIVSRAGA  274

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            M   E+    KP  L+PSPNVAE HQ KNA  +     AR+I + E+    L    E +L
Sbjct  275  MAVSELCHIDKPTFLVPSPNVAEDHQTKNAMALVNRGAARLIKDAEVRE-TLWEELEAVL  333

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             DE   A + +     A+ D+   I+  I+ + 
Sbjct  334  NDEQAQASLKRAIALMAQKDSDERIADEIIEIT  366



>ref|WP_023575430.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium saliperosum]
 gb|ESU27873.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium saliperosum S13]
Length=364

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 88/286 (31%), Positives = 139/286 (49%), Gaps = 38/286 (13%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++LS +               A+KI +A+++ +
Sbjct  109  GAVLKVASMMGIPTVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-L  152

Query  237  ECFWQKKKCVVCGNPVRSSLKRNVSKEM-ARQHFFPelgdlegegkvvlvlggslgANAI  413
            E F+ K+K ++ GNPVR  L     K   A  HF                    +   ++
Sbjct  153  ERFFPKEKMILTGNPVRQDLISVSDKRSEAIAHF----------NLDASKKTLLVLGGSL  202

Query  414  NVKLLNLYSNVLDERKDLFL------IWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLA  575
              + +N    +L++  D  L      IWQ G   F E +         VL+ F+  MDL 
Sbjct  203  GARRIN---QLLEKELDFLLSQNVQIIWQCGKLYFEEYKHFSDKENVQVLS-FIDRMDLV  258

Query  576  YAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENEL  755
            YAAAD++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL
Sbjct  259  YAAADVVISRSGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKNGALLLKESEL  318

Query  756  DSFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            D+    +  + ++ +E     +S    + A  +A+ +I   I+ L+
Sbjct  319  DT-QFETVFQHLITNEEQQKQLSTNIKQLALPNATKQIVDEIVKLI  363



>ref|WP_038011451.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tannerella sp. oral taxon BU063]
 gb|ETK01472.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Tannerella sp. oral taxon BU063 isolate Cell 2]
Length=381

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 89/280 (32%), Positives = 135/280 (48%), Gaps = 34/280 (12%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  GV  ++ EQN+   I N+ L+                 A +I +A+   +E F+  
Sbjct  114  AAAAGVPTLIQEQNSYAGITNKWLAKR---------------AARICVAY-PGMERFFPA  157

Query  255  KKCVVCGNPVRSSLKRNV-SKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
            +K VV GNPVR  L+  + S + A +HF          G         +   ++  + +N
Sbjct  158  EKIVVTGNPVRKDLEEAIHSHDEALKHF----------GLDPACKTLLVLGGSLGARTIN  207

Query  432  LYSNV-LDERKDLF--LIWQTGVEAFHEIESLV---KTHPRLVLTPFLHAMDLAYAAADL  593
                V L    DL   LIWQTG   +  I S V   +  P+  + PF+  MD AYAAADL
Sbjct  208  EAVEVALPTLADLGVQLIWQTGRSYYDAIRSRVADLEPEPKRWVGPFITRMDYAYAAADL  267

Query  594  IISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALR  773
            ++SR+GA +  E+   GKP IL+PSPNVAE HQ KNA  +A   GA +I + E+    L 
Sbjct  268  VVSRAGASSISELCLLGKPAILVPSPNVAEDHQTKNARSVADRGGAVMIADGEVRKL-LP  326

Query  774  SATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
                 + GD   +  +   + + A+ D+   I   +++L+
Sbjct  327  DTLRRLFGDREQLKTLGLHSGQLAERDSDERIVDELVALI  366



>ref|WP_028992143.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Thermoanaerobacter thermocopriae]
Length=364

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 145/284 (51%), Gaps = 35/284 (12%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + NRVLS                F   + ++F+ S+E 
Sbjct  107  VLMVAALKGIPTLIHEQNAFPGLTNRVLSR---------------FVKVVAVSFEESVEY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN--  416
            F  K K VV GNP+R  L     +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKDKVVVTGNPIRKELLEANREEGLKNLGF------SLDKPLIVSVGGSRGAEKINFT  205

Query  417  -VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLV-----LTPFLHAMDLAY  578
             V+LL L      + K+L ++  TG   + ++   VKT    +     + P+ H M   Y
Sbjct  206  MVELLKL------KDKNLQVLIITGTNQYEKVLEKVKTENIYIDKTVKIIPYCHNMQDVY  259

Query  579  AAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD  758
            AA D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L 
Sbjct  260  AATDIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKSGASYVILEKDLT  319

Query  759  SFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            +  L    + +L +  L++ M + A K +K++A+ +I K I S+
Sbjct  320  AEKLYKKLKYLLDNPHLLSKMRENAKKISKIEAAEKIYKLIKSI  363



>ref|WP_036826533.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Polaribacter sp. Hel1_85]
 gb|KGL58549.1| undecaprenyl-phosphate-N-acetylglucosamine-N- acetylmuramyl- 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 
[Polaribacter sp. Hel1_85]
Length=365

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 91/280 (33%), Positives = 142/280 (51%), Gaps = 47/280 (17%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A+  G+  ++ EQN+ P I N++LS +               A KI +A+D+ +E F+  
Sbjct  115  ASRKGIPTLIQEQNSYPGITNKLLSKK---------------AHKICVAYDN-LERFFPV  158

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-  431
             K V  GNPVR  L    SK    + FF                   +   ++  + +N 
Sbjct  159  DKIVKTGNPVRQDLLSIHSKTEEGKGFF---------KLDKKKKTILVLGGSLGARKINQ  209

Query  432  LYSNVLD--ERKDLFLIWQTG------VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
            L  + LD  + +++ +IWQ G       + ++E+E+ ++ H       FL+ MD AYAA+
Sbjct  210  LIEDNLDFFKTQEVQVIWQCGKLYFEDYKKYNELEN-IQVHQ------FLNRMDFAYAAS  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+IISR+GA +  E+   GKP I IPSPNVAE HQ KNA  +A   GA ++ E+ELD+F 
Sbjct  263  DIIISRAGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKSIADQHGAILLRESELDTFP  322

Query  768  LRSATEEILGD----ESLMADMSKRALKAAKLDASAEISK  875
            +    E ++ D    E L  ++++ AL  A  D   E+ K
Sbjct  323  I--VFETLIKDKGKQEYLSENINELALPGATTDIVNEVEK  360



>ref|WP_013073198.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Zunongwangia profunda]
 ref|YP_003586310.1| N-acetylglucosaminyl transferase [Zunongwangia profunda SM-A87]
 gb|ADF54114.1| N-acetylglucosaminyl transferase [Zunongwangia profunda SM-A87]
Length=366

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 148/265 (56%), Gaps = 25/265 (9%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I N++L+ +               A+ I  A+D  ++ F+ ++K    GN
Sbjct  123  LLQEQNSFPGITNKILAKK---------------ANIICAAYDE-VKRFFPQEKVKKTGN  166

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  L    +K    Q FF     L+ + K VLVLGGSLGA  +N +L+  Y++ L ++
Sbjct  167  PVRQDLLNIDTKREEAQQFF----KLDADKKTVLVLGGSLGARRVN-QLIAEYADKL-KK  220

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILA  638
            +D+ LIWQ G   + + +S   T   + +  FL+ MDLAYAAAD+IISR+GA +  E+  
Sbjct  221  EDIQLIWQCGKLYYEDYKSY--TEGTVQVHQFLNRMDLAYAAADVIISRAGAGSVSELCI  278

Query  639  TGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMAD  818
             GKP I IPSPNVAE HQ KNA  + K   A  I E +L+     SA  ++L ++S   +
Sbjct  279  VGKPVIFIPSPNVAEDHQTKNAMAVTKNEAAITIAETQLEE-KFESAFFDLLENQSKQKE  337

Query  819  MSKRALKAAKLDASAEISKHILSLV  893
            +S+   K A  +A++ I   I  L+
Sbjct  338  LSRNIKKMALPNATSSIVDEIEKLI  362



>ref|WP_013150475.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter mathranii]
 ref|YP_003677195.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
 gb|ADH61184.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
Length=364

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 145/284 (51%), Gaps = 35/284 (12%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + NRVLS                F   + ++F+ S+E 
Sbjct  107  VLMVAALKGIPTLIHEQNAFPGLTNRVLSR---------------FVKVVAVSFEESVEY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN--  416
            F  K K VV GNP+R  L     +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKDKVVVTGNPIRKELLEANREEGLKNLGF------SLDKPLIVSVGGSRGAEKINFT  205

Query  417  -VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLV-----LTPFLHAMDLAY  578
             V+LL L      + K+L ++  TG   + ++   VKT    +     + P+ H M   Y
Sbjct  206  MVELLKL------KDKNLQVLIITGTNQYEKVLEKVKTENIYIDKTVKIIPYCHNMQDVY  259

Query  579  AAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD  758
            AA D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L 
Sbjct  260  AATDIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKSGASYVILEKDLT  319

Query  759  SFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            +  L    + +L +  L++ M + A K +K++A+ +I K I S+
Sbjct  320  AEKLYKKLKYLLDNPHLLSKMRENAKKISKIEAAEKIYKLIKSI  363



>ref|WP_013403773.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
hydrothermalis]
 ref|YP_003992989.1| udp-n-acetylglucosamine--n-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
n-acetylglucosamine transferase [Caldicellulosiruptor 
hydrothermalis 108]
 gb|ADQ07620.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
hydrothermalis 108]
Length=369

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 136/266 (51%), Gaps = 26/266 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G++ ++HEQNA P +ANR++S                F DK+ ++F+ S   F + K  +
Sbjct  120  GIRIILHEQNAFPGLANRIISR---------------FCDKVLISFEESKRYFKRSKDVI  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N ++  A++               VL++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYNQSQAKREI------GADSKTTVLIVGGSRGAENLNRAAIRL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
             +  KD+  I  TG + F + +S    +     + L P++  M    AAAD++ISR GA+
Sbjct  217  FEGNKDVHFILSTGEKKFDDAKSYAEQLNAGANISLYPYIKEMPKYLAAADVVISRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + K     V+ E+EL+   LR   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQEYNARALEKEGACFVVLESELEGDKLRILLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISK  875
            D+ L   M +++    + DA+ +I++
Sbjct  337  DKQLYTSMQRKSKNLGRPDATEKIAR  362



>ref|WP_012995473.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacter italicus]
 ref|YP_003477300.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
italicus Ab9]
 gb|ADD02738.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacter 
italicus Ab9]
Length=364

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 145/284 (51%), Gaps = 35/284 (12%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL G+  ++HEQNA P + NRVLS                F   + ++F+ S+E 
Sbjct  107  VLMVAALKGIPTLIHEQNAFPGLTNRVLSR---------------FVKVVAVSFEESVEY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN--  416
            F  K K VV GNP+R  L     +E  +   F        +  +++ +GGS GA  IN  
Sbjct  152  FKNKDKVVVTGNPIRKELLEANREEGLKNLGF------SLDKPLIVSVGGSRGAEKINFT  205

Query  417  -VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLV-----LTPFLHAMDLAY  578
             V+LL L      + K+L ++  TG   + ++   VKT    +     + P+ H M   Y
Sbjct  206  MVELLRL------KDKNLQVLIITGTNQYEKVLEKVKTENIYIDKTVKIIPYCHNMQDVY  259

Query  579  AAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD  758
            AA D+II R+GA+T  EI A G   ILIPSP VA  HQ  NA ++ K   + VI E +L 
Sbjct  260  AATDIIICRAGAITLAEITAKGVASILIPSPYVANNHQEYNARVLEKSGASYVILEKDLT  319

Query  759  SFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            +  L    + +L +  L++ M + A K +K++A+ +I K I S+
Sbjct  320  AEKLYKKLKYLLDNPHLLSKMRENAKKISKIEAAEKIYKLIKSI  363



>ref|WP_013430801.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
kronotskyensis]
 ref|YP_004024538.1| UDP-N-acetylglucosamine--n-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
n-acetylglucosamine transferase [Caldicellulosiruptor 
kronotskyensis 2002]
 gb|ADQ46719.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
kronotskyensis 2002]
Length=368

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 135/266 (51%), Gaps = 26/266 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F DK+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCDKVLISFEESKKYFKKSKDII  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N  +  A++               +L++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYDQTQAKREI------GTDGKTTILIVGGSRGAENLNRAAIKL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
             +   D+  I  TG + F + +S    +     + L P++  M    AAAD++ISR GA+
Sbjct  217  FEGNNDVHFILSTGEKKFDDAKSYAEQLNAGANISLYPYIKEMPKYLAAADIVISRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + K     V+ E+EL+   LR   E+++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQDYNARALEKEGACFVVLESELEGDKLRILLEKLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISK  875
            D+ L   M K++    + DA+ +I++
Sbjct  337  DKQLYTSMQKKSRNLGRPDATEKIAR  362



>ref|WP_013411601.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
owensensis]
 ref|YP_004001999.1| udp-n-acetylglucosamine--n-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
n-acetylglucosamine transferase [Caldicellulosiruptor 
owensensis OL]
 gb|ADQ04199.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
owensensis OL]
Length=369

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 83/268 (31%), Positives = 136/268 (51%), Gaps = 26/268 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+K ++HEQNA P +ANR++S                F +K+ ++F+ S + F + K  +
Sbjct  120  GIKIILHEQNAFPGLANRIISR---------------FCEKVLISFEESEKYFKKGKDII  164

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  +  N ++  A++               VL++GGS GA  +N   + L +  
Sbjct  165  LTGNPIRLEI-LNYNQSQAKREI------GVEGKITVLIVGGSRGAENLNRAAIRL-AKS  216

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLV---LTPFLHAMDLAYAAADLIISRSGAM  617
             +  +D+  I  TG + F + +S  K    L    L P++  M    AAAD+++SR GA+
Sbjct  217  FEGNRDVHFILSTGEKKFDDAKSYAKQLNVLANISLYPYIMEMPKYLAAADIVVSRGGAI  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
               EI A GKP I++PSP V   HQ  NA  + +     V+ ENEL+   L+   E ++ 
Sbjct  277  AISEITALGKPSIIVPSPYVVNNHQEYNARALEREGACFVVLENELEEDKLKILVERLIY  336

Query  798  DESLMADMSKRALKAAKLDASAEISKHI  881
            D+ L   M K++    + DA+  I+K I
Sbjct  337  DKELYTSMQKKSKNLGRPDATENIAKII  364



>ref|WP_021826728.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella salivae]
 gb|ERJ98035.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella salivae F0493]
Length=368

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 147/271 (54%), Gaps = 27/271 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++LS +               ADKI +A++  +E F+   K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLSKK---------------ADKICVAYEG-MERFFPADKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L   ++ E AR+ F      L    K VL++GGSLGA  IN  +L  Y +
Sbjct  163  MTGNPVRQNVLDSKLTVEEARESF-----GLNPNMKTVLLVGGSLGAKTINDSMLQ-YLD  216

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTH--PRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            ++  + D+  IWQTG   +  I+  ++    P L +T F+  M  AY AADL+ISR+GA 
Sbjct  217  IIG-KTDVQFIWQTGKAYYEGIQQQLQNEELPNLKVTDFISDMGAAYKAADLVISRAGAS  275

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ KNA  +     A  + ++E  +  L++A + + G
Sbjct  276  SISEFCLIGKPVILVPSPNVAEDHQTKNAMALVNKNAAIYVKDSEAVNVLLKTAIQTV-G  334

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            + S +  + +  LK  K +++  I+  ++ L
Sbjct  335  NASTLESLKENILKLRKKNSADVIADQVIKL  365



>ref|WP_007095047.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Kordia algicida]
 gb|EDP98034.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Kordia algicida OT-1]
Length=366

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/269 (32%), Positives = 130/269 (48%), Gaps = 30/269 (11%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+   I N++L  ++                KI +A+D  +E F+ K K +  GN
Sbjct  124  LIQEQNSYAGITNKILGKQV---------------QKICVAYDH-MERFFPKGKIIKTGN  167

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-LYSNVLDE  455
            PVR  L    SK    + FF                   +   ++  + +N L    LD 
Sbjct  168  PVRQDLLEIKSKRAEAKTFF---------QLEEDKKTVLIIGGSLGARRINQLIEKELDF  218

Query  456  RKD--LFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYE  629
             KD  + +IWQ G + ++E          + +  F++ MDLAYAAAD+IISR+GA +  E
Sbjct  219  FKDQNVQVIWQCG-KFYYEQYKGYDALEHVQIRQFVNKMDLAYAAADVIISRAGASSVSE  277

Query  630  ILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESL  809
            +   GKP I IPSPNVAE HQ KNA  + +   A +I E +LD    +   EE++  E +
Sbjct  278  LCIVGKPVIFIPSPNVAEDHQTKNALAITEQKAAILIREKDLD-VEFKICFEELIKSEKM  336

Query  810  MADMSKRALKAAKLDASAEISKHILSLVN  896
             AD  +   K A  DA++ I   +  L+N
Sbjct  337  QADFGEAIKKLALPDATSRIVDEVEKLLN  365



>ref|WP_025741088.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Aquimarina sp. SW150]
Length=370

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 139/287 (48%), Gaps = 27/287 (9%)
 Frame = +3

Query  51   FQNAIFLDAA-LGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFD  227
            F +   L AA +  +  V+ EQN+ P I N+ LS                 ADKI +A+D
Sbjct  106  FASGPLLKAANMKKIPTVIQEQNSFPGITNKWLSKG---------------ADKICVAYD  150

Query  228  SSIECFWQKKKCVVCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgA  404
              ++ F+ K+K +  GNP+R   LK    +E A   F   L   +    ++    G+   
Sbjct  151  G-MQRFFPKEKIIKTGNPIRQDVLKIEGKREQAITKF--GLEADKKTILILGGSLGARRV  207

Query  405  NAINVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAA  584
            N +  K L+ +     + KD+ +IWQ G   + E     K    + +  FL  MDLAYAA
Sbjct  208  NQLIEKELSFF-----QEKDIQIIWQCGKLYYDEYAKYSK-QDYVQVHQFLDTMDLAYAA  261

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            AD+IISR+GA +  E+   GKP I IPSPNVAE HQ KNA  +A   GA +I EN+L+  
Sbjct  262  ADIIISRAGASSVSELCVIGKPTIFIPSPNVAEDHQTKNALSIADKHGAVLIKENQLEE-  320

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
                   +I+  E     +S      A  +A+A+I   I  LV   +
Sbjct  321  QFEDVVSKIIVSEEFRNKLSIGIKALALPNATADIVDEIEKLVKHKI  367



>ref|WP_034924258.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Gillisia sp. CAL575]
Length=368

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 125/223 (56%), Gaps = 32/223 (14%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I NR+L  +               AD I  A+D+ +E ++  +K +  GN
Sbjct  123  LIQEQNSYPGITNRLLGKK---------------ADAICTAYDN-LESYFPLEKTIKTGN  166

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  +     K    Q FF    +L+ E K +LVLGGSLGA  IN +L+  + +V  E+
Sbjct  167  PVRQDILNIKDKREEAQLFF----NLKKERKTLLVLGGSLGARRIN-QLMEAFVDVF-EK  220

Query  459  KDLFLIWQTGVEAFHEIESL----VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
             ++ LIWQTG   + E +      VKTH       FL  MDLAYAAAD+I+SR+GA++  
Sbjct  221  NEIQLIWQTGSLYYEEYKKYDNEYVKTHA------FLSRMDLAYAAADVIVSRAGAISVS  274

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENEL  755
            E+   GKP I IPSPNVAE HQ KNA  +A    A V+ E +L
Sbjct  275  ELCIVGKPVIFIPSPNVAENHQAKNALTVANEDAAYVLNEKDL  317



>ref|WP_039765285.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
sp. F32]
Length=370

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 143/271 (53%), Gaps = 38/271 (14%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +K ++HEQNA P +AN+++S                F +KI ++F+ S   F    K V+
Sbjct  121  IKTILHEQNAYPGLANKIISR---------------FCEKILISFEESKRFFKNSNKVVL  165

Query  270  CGNPVR----SSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLY  437
             GNP+R    S   R     +  +              VVL +GGS GA  +N  ++ L 
Sbjct  166  TGNPIRLEIFSYDVRAAKSSLGLED-----------KIVVLAVGGSRGAENLNKAVIRL-  213

Query  438  SNVLDERKDLFLIWQTG----VEAFHEIESL-VKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            S   +  KD++ I  TG    +EA +   SL VK++ +++  P++  M    AAAD++IS
Sbjct  214  SKEFEGCKDVYFILSTGDTKYLEATNFANSLGVKSNIKIL--PYISDMPRYLAAADIVIS  271

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA+   EI A GKP I++PSP VA  HQ  NA  + K+    V+ ENEL+S  L+S+ 
Sbjct  272  RAGAIAISEITALGKPSIIVPSPYVANNHQEYNARALEKVGACFVVLENELESDNLKSSL  331

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISK  875
            E+++ D+ L   MS+ + K  K +A+  I K
Sbjct  332  EKLIYDKDLYKKMSENSKKMGKPEATQNIGK  362



>ref|WP_013998222.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Capnocytophaga canimorsus]
 ref|YP_004741350.1| Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase 
[Capnocytophaga canimorsus Cc5]
 gb|AEK24243.1| Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase 
[Capnocytophaga canimorsus Cc5]
Length=361

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 137/271 (51%), Gaps = 31/271 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N+ +  +               A+KI +A+D  +E F+ K+K V
Sbjct  116  GIPTIIQEQNSYAGVTNKWVCQK---------------AEKICVAYDD-MEKFFPKEKIV  159

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN--LYS  440
              GNPVR+ L     K    Q FF                   +   ++  + +N  + S
Sbjct  160  KTGNPVRADLLNISEKRKEAQMFF---------SLNPDKKTLLVLGGSLGARRINQLIES  210

Query  441  NV-LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            N+ L E+ D+ ++WQ G   F E +     + +++   F+  MD AYA+AD IISR+GA 
Sbjct  211  NLPLFEKLDIQVLWQCGKLYFEEYKKYDSENIKVL--QFIDQMDFAYASADAIISRAGAS  268

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E+   GKP I IPSPNVAE HQ KNA  +AK  G  +I E+ELDS    +   +++ 
Sbjct  269  SVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIAKKQGCVLIRESELDS-QFETILSQLIL  327

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            +E+   ++S+   K A+ +A+ +I   I  L
Sbjct  328  NENQQKNLSENIKKLAQPNATKDIVDIIFKL  358



>ref|WP_023578468.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium limnosediminis]
 gb|ESU29401.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium limnosediminis JC2902]
Length=364

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 138/286 (48%), Gaps = 38/286 (13%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++LS +                +KI +A+++ +
Sbjct  109  GAVLKVASMMGIPTVIQEQNSYPGITNKLLSKK---------------TNKICVAYEN-L  152

Query  237  ECFWQKKKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAI  413
            E F+ K+K ++ GNPVR  L      +  A  HF                    +   ++
Sbjct  153  ERFFPKEKMILTGNPVRQDLISVGEKRSEAIAHF----------NLDASKKTLLVLGGSL  202

Query  414  NVKLLNLYSNVLDERKDLFL------IWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLA  575
              + +N    +L++  D  L      IWQ G   F E +         VL+ F+  MDL 
Sbjct  203  GARRIN---QLLEKELDFLLLQNVQIIWQCGKLYFEEYKHFSDKENVQVLS-FIDRMDLV  258

Query  576  YAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENEL  755
            YAAAD++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL
Sbjct  259  YAAADVVISRSGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKNGALLLKESEL  318

Query  756  DSFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            D+    +  + ++ +E     +S    + A  +A+ +I   I+ L+
Sbjct  319  DT-QFETVFQNLISNEEQQKQLSTNIKQLALPNATKQIVDEIVKLI  363



>ref|WP_020213740.1| hypothetical protein [Flavobacterium rivuli]
 gb|KGO86393.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium rivuli WB 3.3-2 = DSM 21788]
Length=363

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 135/282 (48%), Gaps = 25/282 (9%)
 Frame = +3

Query  51   FQNAIFLDAALG-GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFD  227
            F +   L AA G GV  V+ EQN+ P I N+ L+ +               A+KI +A+D
Sbjct  105  FASGPLLKAAAGMGVPTVIQEQNSFPGITNKWLAKQ---------------ANKICVAYD  149

Query  228  SSIECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgAN  407
            + +E F+   K V  GNPVR  L           H F    D +    +   LG      
Sbjct  150  N-LERFFPASKIVFTGNPVRQDLLHTSDNREEAMHRFKLDPDKQTLLVLGGSLGARRINQ  208

Query  408  AINVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             I  +L  L      + +++ +IWQ G   F E +         VL+ F+  MDL YAAA
Sbjct  209  LIAKELTWL------QAQNVQVIWQCGKFYFEEYQHYGDKEGVQVLS-FIDRMDLVYAAA  261

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D++ISRSGA +  E+   GKP + IPSPNV+E HQ KNA  +    GA ++ E +LD+  
Sbjct  262  DVVISRSGASSVSELCIVGKPVVFIPSPNVSEDHQTKNAQAVVDKVGAILLKETQLDT-Q  320

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             +    ++L ++     +S    K AK  A+ +I   I+ L+
Sbjct  321  FQPVFADLLSNKEKQKSLSGNIKKLAKTHATQDIVDEIVKLL  362



>ref|WP_007572733.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Prevotella multisaccharivorax]
 gb|EGN55899.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Prevotella 
multisaccharivorax DSM 17128]
Length=370

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/276 (32%), Positives = 137/276 (50%), Gaps = 34/276 (12%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  ++ EQN+     N++L++++               +KI +A++  +E F+   K +
Sbjct  120  GVPCLIQEQNSYAGKTNKMLANKV---------------EKICVAYNG-MERFFPSDKII  163

Query  267  VCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR ++   ++SKE ARQ F          G         L   ++  + +N    
Sbjct  164  ITGNPVRQNVVNDSISKEEARQKF----------GLDPNKKTVLLVGGSLGARTINDSMR  213

Query  444  V-LDERK--DLFLIWQTGVEAFHEIESLVKTH---PRLVLTPFLHAMDLAYAAADLIISR  605
            + LDE K  D   IWQTG     E+   VKT+   P L +  F+  M  AY AADL+ISR
Sbjct  214  LHLDEVKNADAQFIWQTGKYYNQEMSEAVKTYGEIPNLKVLDFISDMGAAYKAADLVISR  273

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + E     L+ A  
Sbjct  274  AGASSISEFCLIGKPVILVPSPNVAEDHQTKNAMALVNKDAAIYVKDAEAPDMLLKRAL-  332

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            +I+ DE ++  +S+   K    +++  I+  +L LV
Sbjct  333  DIINDEEMLTSLSENIKKLGLPNSADIIADEVLKLV  368



>dbj|BAO76166.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Winogradskyella 
sp. PG-2]
Length=364

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 139/268 (52%), Gaps = 30/268 (11%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I N++LS ++               + I +A++  +E F+ K K  + GN
Sbjct  122  LIQEQNSYPGITNKLLSKKV---------------NTICVAYEG-LEKFFPKAKLRLTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-LYSNVLD-  452
            P+R  L    SK +  +  F           +       +   ++  + +N L  + L+ 
Sbjct  166  PIRKDLLEVKSKHIEGKDAF---------TLIHSKHTLLVLGGSLGARRINQLVESNLEY  216

Query  453  -ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYE  629
             E K++ LIWQ G   + + +S   T   + +  FL+ MD+AYAAAD+IISR+GA++  E
Sbjct  217  FEAKNVQLIWQCGKLYYDQYKSY-NTRKYVQVHAFLNNMDMAYAAADIIISRAGAISVSE  275

Query  630  ILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESL  809
            +   GKP I IPSPNVAE HQ KNA  +A    A +I E EL+S   R+   +++ DE+ 
Sbjct  276  LCIVGKPTIFIPSPNVAEDHQTKNAKAIADKNAALLIKEKELES-EFRNQFSDLISDENR  334

Query  810  MADMSKRALKAAKLDASAEISKHILSLV  893
              ++SK     A ++A+ +I   +  L+
Sbjct  335  RVELSKNIEALALVNATNDIVDEVEKLL  362



>ref|WP_031454592.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium chungangense]
Length=361

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/273 (32%), Positives = 136/273 (50%), Gaps = 25/273 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+++ +E F+ K
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAYEN-LERFFPK  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K V+ GNPVR  L    SK      ++    + +    +   LG       +  +L N 
Sbjct  158  EKIVLTGNPVRQDLIDIDSKREEAISYYGLDPNKKTLLVLGGSLGARRINQLVEKELQNF  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +D+ LIWQ G   F + +   +++ ++V   F+  MD  YAAAD+I+SR+GA
Sbjct  218  VS------QDIQLIWQCGKLYFEDYKKHNQSNVKVV--DFIERMDFVYAAADVIVSRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E EL++       E ++
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDAKGAILLKEAELET-QFNIVFEALI  328

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             D+     +S+   K AK +A+  I   I  L+
Sbjct  329  KDQGKQKQLSENIKKLAKPNATKIIVNEITKLL  361



>ref|WP_013787839.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacterium xylanolyticum]
 ref|YP_004470769.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Thermoanaerobacterium 
xylanolyticum LX-11]
 gb|AEF17097.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacterium 
xylanolyticum LX-11]
Length=364

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/281 (30%), Positives = 131/281 (47%), Gaps = 29/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL  +  ++HEQNA P + NR+LS                F D + +AFD S + 
Sbjct  107  VVMTAALMKIPTLIHEQNAYPGLTNRILSR---------------FVDIVAVAFDESKKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K K  V GNPVR  +     K+  R+    E   +               A  IN  
Sbjct  152  FRNKGKIFVTGNPVRMEILNGDRKKALRKWGLDETKKVVVSVGGSRG------AAKINEY  205

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAAA  587
            ++ +   +   R++  ++  TG   +  +  ++K +       + + P+ + M   Y+ A
Sbjct  206  MVEV---IKKAREEFQVLMITGKNQYDSVIKMIKDYDIRLGENIKIIPYCYEMGDIYSIA  262

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA  767
            D+I+ RSGA+T  E+LAT    ILIPSPNV   HQ  NA ++ K   A VI E +L+   
Sbjct  263  DVIVCRSGAITLAELLATSTASILIPSPNVTHNHQEYNARVLEKNGAALVILEKDLNGDV  322

Query  768  LRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            L      I+ D S +  M   A K +K+DA+ EI + +  L
Sbjct  323  LHKKILSIVNDSSKLKTMKANAKKLSKIDAANEIYRLVCKL  363



>ref|WP_007134684.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Prevotella salivae]
 gb|EFV04450.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella salivae DSM 15606]
Length=368

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 147/271 (54%), Gaps = 27/271 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++LS +               ADKI +A++  +E F+   K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLSKK---------------ADKICVAYEG-MERFFPADKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L   ++ E AR+ F      L    K VL++GGSLGA  IN  +L  + +
Sbjct  163  MTGNPVRQNVLDSKLTVEEARESF-----GLNPNMKTVLLVGGSLGAKTINDSMLQ-HLD  216

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTH--PRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            ++  + D+  IWQTG   +  I+  ++    P L +T F+  M  AY AADL+ISR+GA 
Sbjct  217  IIG-KTDIQFIWQTGKAYYEGIQQQLQNEELPNLKVTDFISDMGAAYKAADLVISRAGAS  275

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ KNA  +     A  + ++E  +  L++A + + G
Sbjct  276  SISEFCLIGKPVILVPSPNVAEDHQTKNAMALVNKNAAIYVKDSEAVNVLLKTAIQTV-G  334

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            + S +  + +  LK  K +++  I+  ++ L
Sbjct  335  NASTLESLKENILKLGKKNSADVIADQVIKL  365



>ref|WP_013778209.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Tepidanaerobacter acetatoxydans]
 ref|YP_004460593.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Tepidanaerobacter 
acetatoxydans Re1]
 ref|YP_007271948.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tepidanaerobacter 
acetatoxydans Re1]
 gb|AEE91286.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tepidanaerobacter 
acetatoxydans Re1]
 emb|CCP25972.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tepidanaerobacter 
acetatoxydans Re1]
Length=374

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 139/280 (50%), Gaps = 30/280 (11%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A+L GV   +HEQN  P I NR+LS                F +K+F++F  S++ ++ K
Sbjct  117  ASLMGVHTAIHEQNVTPGITNRILSK---------------FVEKVFISFPDSLK-YFPK  160

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR+ + +++  +  ++               VL  GGS GA  +N  +L +
Sbjct  161  NKTVLTGNPVRNEITKSIRSQALKKFGL------LLNIPTVLCFGGSQGAARLNDAILYI  214

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP-------RLVLTPFLHAMDLAYAAADL  593
             + + D ++   LI  TG+  + +   L+            +++ P++H M  AYA ADL
Sbjct  215  INEIKDTKR-FQLIHITGINHYEKTIDLLANKGIDLSKLGHIIIRPYIHEMQDAYAVADL  273

Query  594  IISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALR  773
            +ISR+GA++  E+ A GKP ILIP P  A  HQ  NA  M +   A VI+E  L    L 
Sbjct  274  VISRAGALSISELNACGKPAILIPLPTAANRHQDFNAKFMEENGAAIVISEASLSGEKLL  333

Query  774  SATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
                 I+ D+  +  M+  +   A+ DA  +I   I+ LV
Sbjct  334  DTISNIIFDQKRLHQMAAASKNLAREDALEKILAEIVKLV  373



>ref|WP_021895901.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase 1 [Prevotella 
sp. CAG:924]
 emb|CCY02913.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase 1 [Prevotella 
sp. CAG:924]
Length=376

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 92/272 (34%), Positives = 146/272 (54%), Gaps = 27/272 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++L+ +               A KI +A++  ++ F+   K V
Sbjct  124  GIPCLIQEQNSYAGVTNKLLAKK---------------AAKICVAYEG-MDRFFPADKIV  167

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L    +KE ARQ F      L+   K +L++GGSLGA  IN + +  + +
Sbjct  168  MTGNPVRQNVLNATCTKEEARQQF-----GLDPAKKTILLVGGSLGARTIN-ESMKQHLD  221

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTH---PRLVLTPFLHAMDLAYAAADLIISRSGA  614
            ++ E+KD+  IWQTG     E+ + VK     P L +  F+  M  AY AADL+ISR+GA
Sbjct  222  IIREQKDVQFIWQTGKYYNEEMNAAVKAFGELPNLKVLDFISDMGAAYRAADLVISRAGA  281

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + +     L+ A   I+
Sbjct  282  SSISEFCLIGKPVILVPSPNVAEDHQTKNAMALVNHDAAVYVKDADAADMLLKQAL-TIV  340

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSL  890
            GD+  +A +S+   K    D++  I++ ++ L
Sbjct  341  GDDQKLASLSENIKKLGLKDSADVIAREVVKL  372



>ref|WP_011403336.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Salinibacter 
ruber]
 ref|YP_444703.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Salinibacter ruber DSM 13855]
 sp|Q2S528.1|MURG_SALRD RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Salinibacter ruber DSM 13855]
 gb|ABC46252.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Salinibacter ruber DSM 13855]
Length=370

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/278 (31%), Positives = 136/278 (49%), Gaps = 24/278 (9%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A L G   ++ EQNA   + NRVL+                 A +I LAF  + + 
Sbjct  112  VLMAAWLRGRPLLIQEQNAYAGLTNRVLAR---------------LALRIHLAFPEAKDW  156

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
                +  VV GNP R SL+             PE G +       L       + AIN  
Sbjct  157  V-PAEHAVVSGNPTRQSLRDADPDAARAAFNVPEDGRVLLVMGGSLG------SAAINGA  209

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
            +  +   +L E  D+ ++WQTG   + ++   +  HPRL +  ++  M  AYAAADL + 
Sbjct  210  IQRILDPLLAE-GDVHVVWQTGTRYYDDLTEDLDEHPRLRVVEYIDQMGHAYAAADLAVC  268

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA+TC E+  TG P +L+PSPNV   HQ KNA  + +   A  + E +LD+  L +  
Sbjct  269  RAGALTCSELTVTGTPAVLVPSPNVTADHQTKNARSLERAGAAVWLDEADLDAH-LETVL  327

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             ++LG+    A M++ A   A+ DA+  I++ +L+L +
Sbjct  328  LDLLGNSDRRARMAEAARDRARPDAAETIARDVLALAD  365



>ref|WP_013174977.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Syntrophothermus 
lipocalidus]
 ref|YP_003702140.1| UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Syntrophothermus 
lipocalidus DSM 12680]
 gb|ADI01575.1| UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Syntrophothermus 
lipocalidus DSM 12680]
Length=372

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 135/281 (48%), Gaps = 30/281 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + A L G+K V+HEQNA P +ANR+L+                 AD + L+F+ +   
Sbjct  113  VVMAANLMGIKTVIHEQNAFPGLANRLLAKR---------------ADWVLLSFEEA-RK  156

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            + Q ++ VV G PVRS +     K+   Q  F            ++  GGSLGA +IN  
Sbjct  157  YLQARRVVVTGLPVRSEIMETTKKQGLEQFGF------SPSVFTLVAFGGSLGAASINSA  210

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLV------KTHPRLVLTPFLHAMDLAYAA  584
            +L +    + E+  +  +W TG   +  I+  +          RL L P+L  M+ A AA
Sbjct  211  MLQVVERYIMEKVQI--LWITGENGYQNIKDNIAPAVWESATLRLRLLPYLQQMEYALAA  268

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            ADL + R+GA T  E+   G P IL+P P  AE HQ KNA  +A    A VI +  LD  
Sbjct  269  ADLAVCRAGAATLSELAVVGLPAILVPYPYSAENHQEKNARSLAARGAAEVIIDEFLDGD  328

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILS  887
             L    EE+  +   + +MS +     K +A A+I   ++S
Sbjct  329  VLFKKIEELRNNPVRLKEMSAKMKAQGKPEALAQIVDIVVS  369



>ref|WP_013445014.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Paludibacter propionicigenes]
 ref|YP_004042630.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Paludibacter 
propionicigenes WB4]
 gb|ADQ79645.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Paludibacter 
propionicigenes WB4]
Length=366

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 95/274 (35%), Positives = 150/274 (55%), Gaps = 31/274 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  V+ EQN+   + N++L+ +               A +I +A+D  ++ F+ K+K +
Sbjct  117  GVPTVIQEQNSYAGVTNKLLAKK---------------AKRICVAYDG-MDRFFPKEKVI  160

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNPVR  L    SK      FF    + + + K +LV+GGSLGA  IN  ++     +
Sbjct  161  LTGNPVRQDLFSVGSKTEEAYKFF----NFDPKKKTILVVGGSLGARTINQSIIAGLDKL  216

Query  447  LDERKDLFLIWQTGV----EAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             +   D+ +IWQTG     +A    E  +   P L++T F+  MD+AY+ ADL++SR+GA
Sbjct  217  AET--DVQIIWQTGKFYIEDARKAAEPFI--SPNLLVTDFVSRMDMAYSIADLVVSRAGA  272

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFA-LRSATEEI  791
             +  E+    KP ILIPSPNVAE HQ +NA  + +   A +I +   DS A L     E+
Sbjct  273  SSISELCLLAKPVILIPSPNVAEDHQTQNALALVRKDAAIMIKDT--DSKAQLVDKMMEV  330

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            + DE+ +  +SK  L+ A+ D++  I++ IL LV
Sbjct  331  IEDEAQLNKLSKNILQLAEKDSADRIAEEILKLV  364



>ref|WP_014158597.1| N-acetylglucosaminyl transferase [Blattabacterium sp. (Mastotermes 
darwiniensis)]
 ref|YP_004928260.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Blattabacterium sp. (Mastotermes darwiniensis) 
str. MADAR]
 gb|AER40435.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Blattabacterium sp. (Mastotermes darwiniensis) 
str. MADAR]
Length=370

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 142/270 (53%), Gaps = 26/270 (10%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +   + EQN+ P   NR+ SS               +A K+ +AF+ S + ++ K+K ++
Sbjct  124  IPIFIQEQNSFPGFTNRIFSS---------------YAKKVCIAFEES-KKYFPKEKTII  167

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNPVRS + +  S+E A  +       L+ +  ++L +GGS G+N+IN   +N    ++
Sbjct  168  TGNPVRSEILQLPSREKACFYL-----GLKMDRPIILSMGGSQGSNSINNAWINGLKKLI  222

Query  450  DERKDLFLIWQTGVEAFHEIES--LVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
                D+ LIWQ G    H+I+    +  H   ++  F+  + + YAAAD+I+SR+GA+T 
Sbjct  223  --HFDIQLIWQVGRMDIHKIKRNHTLSYHKNFIVMEFIENIPICYAAADIIVSRAGALTI  280

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EI   GKP ILIP P  ++ HQ +NA ++     A +I   E+D   L   T ++L D 
Sbjct  281  SEICLIGKPYILIPLPWSSDDHQNRNAKILEDKEAAMIIKNEEIDK-KLVDTTIKLLNDP  339

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLV  893
            +    MS+  L+  K  A+ +I   IL ++
Sbjct  340  NRKKKMSRNILQLGKPKATNDIVNEILQII  369



>ref|WP_013187061.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Croceibacter atlanticus]
 ref|YP_003716063.1| N-acetylglucosaminyl transferase [Croceibacter atlanticus HTCC2559]
 gb|EAP88393.1| N-acetylglucosaminyl transferase [Croceibacter atlanticus HTCC2559]
Length=366

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 149/269 (55%), Gaps = 26/269 (10%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+   I N+ L+ +               A+KI +A+D  +E ++  +K +  GN
Sbjct  122  LIQEQNSYAGITNKWLADK---------------ANKICVAYDH-MEKYFPAEKIIKTGN  165

Query  279  PVRSSLKRNVSKEM-ARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDE  455
            PVR  +K   SK      HF     +L+   K VLVLGGSLGA  IN  + N   +   E
Sbjct  166  PVRQDIKDLDSKRAEGIDHF-----ELDETRKTVLVLGGSLGAKRINELIANHAKDF--E  218

Query  456  RKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEIL  635
               + +IWQTG + ++E    ++ + RL +  +++ MDLAY+ AD+IISR+GA +  E+ 
Sbjct  219  ETGVNVIWQTG-KLYYEQYKTLEENKRLQVKEYINRMDLAYSVADIIISRAGAGSVSELC  277

Query  636  ATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMA  815
              GKP ILIPSPNVAE HQ+KNA  +A      ++ E+E++    R     +L DE++ A
Sbjct  278  IVGKPVILIPSPNVAENHQMKNAMALAVEEACLIMKESEMEEQFKRQFI-NLLEDEAMQA  336

Query  816  DMSKRALKAAKLDASAEISKHILSLVNFS  902
             +S+   K A+ +A+ +I   I  L+N +
Sbjct  337  KLSENIKKLARPNATKDIVNEIEHLINHT  365



>ref|WP_010663110.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Marinilabilia salmonicolor]
Length=373

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 135/245 (55%), Gaps = 24/245 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A+  G+  ++ EQN+ P + N++L+ +               A +I +A+  ++E F+  
Sbjct  118  ASAAGIPTLLQEQNSYPGVTNKILAKK---------------AKRICVAY-PNMERFFPP  161

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             + V+ GNPVR +L RNV K  A + F      L+   K +L++GGSLGA +IN  +L+ 
Sbjct  162  SRIVLTGNPVRQNLLRNVDKASAYREF-----GLDNRKKTILIIGGSLGAGSINNGVLHA  216

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHP--RLVLTPFLHAMDLAYAAADLIISRS  608
              + L ++  + L+WQ G   + ++E  +  +    + L PF+  MD+AYA AD+++SR+
Sbjct  217  IDS-LKQQDQIQLLWQCGPYYYEKLEKEIGENAGDSIKLVPFISQMDMAYAMADVVVSRA  275

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GA T  E+   GK  ILIPSPNV+E HQ KNA  + K   A ++ + E     +  A E 
Sbjct  276  GAGTISELALLGKAAILIPSPNVSEDHQTKNAMSLVKEGAALMVADRETSEKLIPDALEL  335

Query  789  ILGDE  803
            +  DE
Sbjct  336  LKNDE  340



>ref|WP_035480005.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Gelidibacter mesophilus]
Length=378

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 138/279 (49%), Gaps = 34/279 (12%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+ P I N++L  ++               D+I +A+D  +E F+ K
Sbjct  117  AASKGIPSLIQEQNSFPGITNKLLGKKV---------------DRICVAYDG-LERFFPK  160

Query  255  KKCVVCGNPVRSSLKRNVSK-EMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             K +  GNP+R  L    +K E  +  F           +    L   +   ++  K +N
Sbjct  161  DKLIKTGNPIRQDLLEIDTKIEEGKSEF----------KQKKSKLTLLVLGGSLGSKRIN  210

Query  432  -LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
             L    L+  + +++ +IWQ G + +++      +   + +  FL+ MDLAYAAAD IIS
Sbjct  211  ELIEKELEFFQTQNVQVIWQCG-KLYYDTYKKYDSSDNVQVHAFLNTMDLAYAAADFIIS  269

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD-SFALRSA  779
            R+GA +  E+   GKP I IPSPNVAE HQ KNA  +     A +I E +LD  F  R A
Sbjct  270  RAGASSVSELCVVGKPVIFIPSPNVAEDHQTKNAMAIVDRDAALLIRETDLDVDFENRFA  329

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
              +++G       +SK   K A  +A+ +I   +  L+N
Sbjct  330  --QLVGSSEKQQQLSKNIKKLALTNATKDIVDEVEKLLN  366



>ref|WP_023573469.1| Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium enshiense]
 gb|ESU23310.1| Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium enshiense DK69]
 gb|KGO96456.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium enshiense DK69]
Length=364

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/284 (30%), Positives = 139/284 (49%), Gaps = 36/284 (13%)
 Frame = +3

Query  60   AIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIE  239
            A+   A++ G+  V+ EQN+ P I N++LS +               A+KI +A+++ +E
Sbjct  110  AVLKVASMMGIPTVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-LE  153

Query  240  CFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINV  419
             F+ K+  ++ GNPVR  L     K      +F                   +   ++  
Sbjct  154  RFFPKENMILTGNPVRQDLISVSEKRFEAIAYF---------NLDPSKKTLLVLGGSLGA  204

Query  420  KLLNLYSNVLDERKDLFL------IWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYA  581
            + +N    +L++  D  L      IWQ G   F E +         VL+ F+  MDL YA
Sbjct  205  RRIN---QLLEKELDFLLSQNVQIIWQCGKLYFEEYKRFSDKENVQVLS-FIDRMDLVYA  260

Query  582  AADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS  761
            AAD++ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL++
Sbjct  261  AADVVISRSGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKNGAILLKESELEN  320

Query  762  FALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
                +  ++++ +     ++SK   + A  +A+ +I   I+ L+
Sbjct  321  -QFETVFQDLISNGEKQNELSKNIKQLALPNATKDIVDEIVKLI  363



>ref|WP_026979554.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium suncheonense]
 gb|KGO88764.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium suncheonense GH29-5 = DSM 17707]
Length=364

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 138/278 (50%), Gaps = 24/278 (9%)
 Frame = +3

Query  60   AIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIE  239
            A+   A++ G   V+ EQN+ P I N++LS +               A+KI +A+++ +E
Sbjct  110  AVLKVASMMGTPTVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-LE  153

Query  240  CFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINV  419
             F+ K+  ++ GNPVR  L     K      +F      +    +   LG       I  
Sbjct  154  RFFPKENMILTGNPVRQDLISVGDKRNEAVDYFKLNPSKKTLLVLGGSLGARRINQLIAK  213

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
            +L  L S      +++ +IWQ G   F E +         VL+ F+  MDL YAAAD++I
Sbjct  214  ELDFLLS------QNVQVIWQCGKLYFEEYKHFNDKENVQVLS-FIDRMDLVYAAADVVI  266

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELD+    + 
Sbjct  267  SRSGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKNGALLLKESELDT-QFETV  325

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             ++++ +E     +S    + A  +A+ +I   I+ L+
Sbjct  326  FQDLISNEEKQNQLSANIKQLALPNATKDIVDEIVKLI  363



>ref|WP_035123384.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium aquatile]
 gb|KGD69309.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium aquatile LMG 4008]
Length=363

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/274 (31%), Positives = 135/274 (49%), Gaps = 42/274 (15%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            V+ EQN+ P I N++LS +               A+ I +A+++ +E F+ K K V  GN
Sbjct  122  VIQEQNSYPGITNKLLSKK---------------ANAICVAYEN-LEQFFPKNKIVFTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-LYSNVLD-  452
            PVR  +    SK      +F                   +   ++  + +N L +  +D 
Sbjct  166  PVRQDILDVDSKRSEALSYF---------NLDENKKTLLVIGGSLGARRINQLIAKEIDF  216

Query  453  -ERKDLFLIWQTG------VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSG  611
                +L +IWQ G       + F ++E++        +  F+  MDL YA+AD +ISR+G
Sbjct  217  LRNNNLQIIWQCGNLYMADYKQFSDVENVQ-------VVSFIDRMDLIYASADFVISRAG  269

Query  612  AMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEI  791
            A +  E+   GKP I IPSPNVAE HQ KNA  +    GA +I E++LD     S   ++
Sbjct  270  ASSVSELCLVGKPTIFIPSPNVAEDHQTKNAKAIVDKNGALLIKESDLDE-KFESVFNKL  328

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            + DE+L   +S+   K AK +A+ +I + I+ L+
Sbjct  329  IHDENLQKGLSENMKKLAKPNATKDIVEQIVKLI  362



>ref|WP_031480773.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Desulfovibrio frigidus]
Length=360

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 128/263 (49%), Gaps = 35/263 (13%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV   +HEQN++P I+NR+L   +                 +F +F+ + + F+   K  
Sbjct  114  GVPTAIHEQNSIPGISNRILGKVV---------------KTVFASFEDT-KGFFSPDKVD  157

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            V GNPVR  +    SK   R                +LV GGS GA AIN  ++      
Sbjct  158  VVGNPVRKEIIDFASKAKERS---------------ILVFGGSQGAQAINDAIIEALP--  200

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHP--RLVLTPFLHAMDLAYAAADLIISRSGAMT  620
            L + +D+ +  QTG   F  ++S  K      L ++PF++ M  AYA A L++ RSGA T
Sbjct  201  LLKMEDINMRHQTGKTDFERVKSEYKKASVNALAVSPFIYDMSAAYAEAQLVVCRSGAST  260

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
             +EI A GKP I IP P+    HQ  NA  + K+  A VI +NEL    L      +L D
Sbjct  261  VFEIAAAGKPAIFIPYPHATHDHQTGNAQHLEKIGAAIVIPQNELTGKKLAHQIMNLLRD  320

Query  801  ESLMADMSKRALKAAKLDASAEI  869
            E  +  M  +ALK A+ +A++ I
Sbjct  321  EDALDKMGNQALKFARPEAASAI  343



>ref|WP_023570716.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium cauense]
 gb|ESU20167.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium cauense R2A-7]
 gb|KGO83968.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium cauense R2A-7]
Length=364

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 142/283 (50%), Gaps = 32/283 (11%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++LS +               A+KI +A+++ +
Sbjct  109  GAVLKVASMMGIPTVIQEQNSYPGITNKLLSKK---------------ANKICVAYEN-L  152

Query  237  ECFWQKKKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAI  413
            E F+ K+  ++ GNPVR  L   +  +  A  HF                    +   ++
Sbjct  153  ERFFPKENMILTGNPVRQDLISVSEKRSEAIAHF----------KLDASKKTLLVLGGSL  202

Query  414  NVKLLN-LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAA  584
              + +N L +  LD    +++ +IWQ G   F E +   +     VL+ F+  MDL YAA
Sbjct  203  GARRINQLLAKELDFLLSQNIQIIWQCGKLYFEEYKHFSEKENVQVLS-FIDRMDLVYAA  261

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            AD +ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELD+ 
Sbjct  262  ADFVISRSGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKNGAILLKESELDA-  320

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
               +  ++++ +E     +S    + A  +A+ +I   I+ L+
Sbjct  321  RFETVFQQLIINEEHQKQLSTNIKQLALPNATKQIVDEIVKLI  363



>ref|WP_014799085.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flexibacter litoralis]
 ref|YP_006435450.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Flexibacter 
litoralis DSM 6794]
 gb|AFM05657.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Flexibacter 
litoralis DSM 6794]
Length=370

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/272 (32%), Positives = 142/272 (52%), Gaps = 28/272 (10%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  ++ EQN    + N++LS ++               D I +A+  ++E ++ K+K   
Sbjct  120  IPTLIQEQNGHAGLTNKILSRQV---------------DAICVAY-PNMESYFPKQKIQF  163

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNPVRS LK   +   +   +F    +L    K +LV+GGS GA  IN  +LN    +L
Sbjct  164  TGNPVRSDLKNLPNPVQSDFDYF----NLTQSKKTILVMGGSGGAKIINESILNGIETIL  219

Query  450  DERKDLFLIWQTG---VEAFHE--IESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            +   D  +IWQTG   +++  E   +  +  HP + ++ F+H M  AY  AD+++ R+GA
Sbjct  220  EN--DFQIIWQTGKFYIDSIKEKLAQKNLSNHPHIFVSDFIHDMKKAYQCADIVVGRAGA  277

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            +T  E+    KP ILIPSPNVAE HQ KNA  +AK   A +I +NE +   + +    +L
Sbjct  278  LTISELTLAEKPAILIPSPNVAEDHQTKNAMALAKEDAAMLIKDNEANERLIPTLI-YVL  336

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSL  890
             DE+    +       A  DA+ +I++ ++ L
Sbjct  337  NDENQQEKLKNNIKNFACPDAAKDIARRVMEL  368



>ref|WP_014758446.1| MULTISPECIES: UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacterium]
 ref|YP_006392175.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Thermoanaerobacterium 
saccharolyticum JW/SL-YS485]
 gb|AFK86576.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacterium 
saccharolyticum JW/SL-YS485]
 gb|ETO38410.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Thermoanaerobacterium 
aotearoense SCUT27]
Length=364

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/282 (30%), Positives = 133/282 (47%), Gaps = 31/282 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL  +  ++HEQNA P + NR+LS                F D + +AFD S + 
Sbjct  107  VVITAALMKIPTLIHEQNAYPGLTNRILSR---------------FVDIVAVAFDESRKY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F  K    V GNPVR  +     K+  ++  F E   +               A  IN  
Sbjct  152  FRNKGNVFVTGNPVRMEILNGDRKKALKKWDFDETKKIVVSVGGSRG------AAKINEY  205

Query  423  LLNLYSNVLDERKDLFLIWQ-TGVEAFHEIESLVKTHP-----RLVLTPFLHAMDLAYAA  584
            ++     V+ + K+ F I   TG   +  +  ++K +       + + P+ + M   Y+ 
Sbjct  206  MVE----VIKKSKEEFQILMITGKNQYDSVIKMIKDYDIRIGENIKIIPYCYEMGDIYSI  261

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            AD+++ RSGA+T  E+LAT    ILIPSPNV   HQ  NA ++ K   A V+ E +LD  
Sbjct  262  ADVMVCRSGAITLAELLATSTASILIPSPNVTHNHQEYNARVLEKNGAALVVLEKDLDGD  321

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
             L +    I+ D   + +M   A K +K+DA+ EI + + +L
Sbjct  322  VLYNKILSIVNDSGKLKNMKANAKKLSKIDAANEIYRLVCTL  363



>ref|WP_015025374.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Psychroflexus torquis]
 ref|YP_006868573.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase MurG 
[Psychroflexus torquis ATCC 700755]
 gb|AFU69823.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase MurG 
[Psychroflexus torquis ATCC 700755]
Length=365

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 139/280 (50%), Gaps = 33/280 (12%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A+L  +  ++ EQNA   + N+ L+S+               AD I +A++S ++ F+ K
Sbjct  114  ASLLKIPTLIQEQNAYAGVTNKWLASQ---------------ADSICVAYES-MDRFFPK  157

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
            +K +  GNPVR  L      K++  QHF                    +   ++  + +N
Sbjct  158  QKLIFSGNPVRKDLLDITNKKDLGLQHF----------QLDPSKKTLLVIGGSLGSQRIN  207

Query  432  -LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
             L SN L+  + +DL +IWQ G   F    SL      + +  F+  MDLAYA+AD+IIS
Sbjct  208  ELISNRLELFKAEDLQVIWQCGKIYFDRYTSL--NSNTVKVEKFISKMDLAYASADIIIS  265

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA    E+   GKP I IPSPNVAE HQ KNA  +     A ++ E++L+     S  
Sbjct  266  RAGAGAVSELSLAGKPVIFIPSPNVAEDHQTKNAKSIEDKEAAIMLKESDLEKH-FESVF  324

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
            ++++  E L   +S+  LK AK +A+  I   I  + N S
Sbjct  325  KDLISSEQLQDKLSQNILKLAKPNATKTIVDQIERIENKS  364



>ref|WP_028872419.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Psychroserpens burtonensis]
Length=364

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 143/286 (50%), Gaps = 45/286 (16%)
 Frame = +3

Query  51   FQNAIFLDAALG-GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFD  227
            F +   L +A+  G+  ++ EQN+ P I N++LSS++               DKI +A++
Sbjct  105  FASGPLLKSAISKGIPSLIQEQNSYPGITNKLLSSQV---------------DKICVAYE  149

Query  228  SSIECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgAN  407
              +E F+ K+K ++ GNP+R  L     K +  +  F  +        +   LG      
Sbjct  150  G-LEAFFPKEKIILTGNPIRKDLLDMAHKHIEGKDAFTLIHSKHTLLVLGGSLGARRVNQ  208

Query  408  AINVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAA  587
             I  KL         E +++ +IWQ G + +++          + +  FL+ MD+AYAAA
Sbjct  209  LIEEKLEYF------ESQNIQVIWQCG-KLYYQQYKQYNALENIQVHAFLNNMDMAYAAA  261

Query  588  DLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD-SF  764
            D+IISR+GA +  E+   GKP + IPSPNVAE HQ KNA  ++    A +I E+ELD  F
Sbjct  262  DIIISRAGASSVSELCVVGKPVVFIPSPNVAEDHQTKNARAISDKNAAILIKESELDVQF  321

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHI--LSLVN  896
             +          ++LM+ + KR           E+SK+I  L+LVN
Sbjct  322  EVEF--------DALMSSLEKR----------VELSKNIKQLALVN  349



>ref|WP_037981802.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tannerella sp. oral taxon BU063]
 gb|ETK09415.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Tannerella sp. oral taxon BU063 isolate Cell 6/7/9]
Length=384

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 136/276 (49%), Gaps = 34/276 (12%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  ++ EQN+   I N+ L+                 A +I +A+   +E F+  +K V
Sbjct  118  GVPTLIQEQNSYAGITNKWLAKR---------------AARICVAY-PGMERFFPAEKIV  161

Query  267  VCGNPVRSSLKRNVS-KEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR  L+  ++  + A +HF          G         +   ++  + +N    
Sbjct  162  LTGNPVRKDLEEAINCHDEALKHF----------GLDPACKTLLVLGGSLGARTINEAVE  211

Query  444  V-LDERKDLF--LIWQTGVEAFHEIESLV---KTHPRLVLTPFLHAMDLAYAAADLIISR  605
            V L    DL   LIWQTG   +  I S V   +  P+  + PF+  MD AYAAADL++SR
Sbjct  212  VALPTLADLGVQLIWQTGRSYYDAIRSRVADLEPEPKRWVGPFITRMDYAYAAADLVVSR  271

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E+   GKP IL+PSPNVAE HQ KNA  +A   GA +I + E+   +L  A  
Sbjct  272  AGASSISELCLLGKPAILVPSPNVAEDHQTKNARSVADRGGAVMIADGEVRK-SLPDALR  330

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             + GD   +  ++  + + A+ D+   I   +++L+
Sbjct  331  RLFGDREQLKTLALHSGQLAERDSDERIVDELVALI  366



>ref|WP_014726569.1| N-acetylglucosaminyl transferase [Blattabacterium sp. (Blaberus 
giganteus)]
 ref|YP_006337363.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyl 
transferase [Blattabacterium sp. (Blaberus giganteus)]
 gb|AFJ90698.1| undecaprenyldiphospho-muramoylpentapeptidebeta-N-acetylglucosaminyltransferase 
[Blattabacterium sp. (Blaberus giganteus)]
Length=371

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 145/269 (54%), Gaps = 25/269 (9%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  ++ EQN+ P + NR+ S                +A+KI +A++ + + F QKK  ++
Sbjct  126  IPILIQEQNSFPGLTNRIFSH---------------YANKICIAYEQAKKYFPQKK-TII  169

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNPVRS + +  SKE A  H       L+    ++L +GGS G+N++N   +     ++
Sbjct  170  TGNPVRSEILQLPSKEKACIHL-----GLKITRPIILSIGGSQGSNSMNNAWIKGLKKII  224

Query  450  DERKDLFLIWQTGVEAFHEIE-SLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
            +   D+ LIWQ G    H+I+ + +  H  ++   F+  + + YAAAD+I+SR+GA+T  
Sbjct  225  EL--DMQLIWQIGKFDLHKIKKNKMSHHSNIIFMEFIENIPICYAAADIIVSRAGALTIS  282

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            EI   GKP ILIP P  +  HQ +NA ++ +   A +I   E++   L ++  +++ + S
Sbjct  283  EICLIGKPYILIPFPWASNDHQNQNAKILEEKKAALIIKNEEIEK-KLVNSVIQLMNNSS  341

Query  807  LMADMSKRALKAAKLDASAEISKHILSLV  893
            +   MSK  L+  K  A+ +I   IL ++
Sbjct  342  MKKKMSKNILELGKPKATNDIVNEILQII  370



>ref|WP_010751486.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Enterococcus villorum]
 gb|EOH89299.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Enterococcus villorum ATCC 700913]
 gb|EOW76107.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Enterococcus villorum ATCC 700913]
Length=361

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 84/265 (32%), Positives = 143/265 (54%), Gaps = 24/265 (9%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++HEQN+VP I N+ LS                + D+I L+F  +   F+ ++K  + GN
Sbjct  119  IIHEQNSVPGITNKFLSR---------------YVDRIALSFQDA-APFFPEEKSFLIGN  162

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            P R+    +++K    ++F      L+ E K VL+ GGS GA  IN  +    + +  + 
Sbjct  163  P-RAQEVADMNKTRILENF-----GLDPEKKTVLIFGGSQGALRINQAVTEFLATL--DC  214

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILA  638
             D  +++ +G   +++I+  V + P + + P++  M    AA+DL++ R+GA +  E+ A
Sbjct  215  PDYQVLYASGERYYNDIKGKVPSSPNISIQPYISEMAEVMAASDLLVGRAGATSIAELTA  274

Query  639  TGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMAD  818
             G P ILIPSP V   HQ KNA  +  +  A++I ++ELD  +L+ A EEI+ D++L   
Sbjct  275  LGLPAILIPSPYVTNDHQTKNAMSLVNVNAAKMIKDDELDGQSLKLAIEEIMSDDTLQKQ  334

Query  819  MSKRALKAAKLDASAEISKHILSLV  893
            MS  + K    DAS  + K + +L+
Sbjct  335  MSNASKKQGIPDASERMYKLVTALI  359



>ref|WP_012821411.1| N-acetylglucosaminyl transferase [Blattabacterium sp. (Periplaneta 
americana)]
 ref|YP_003257026.1| N-acetylglucosaminyl transferase [Blattabacterium sp. (Periplaneta 
americana) str. BPLAN]
 gb|ACX83883.1| N-acetylglucosaminyl transferase [Blattabacterium sp. (Periplaneta 
americana) str. BPLAN]
Length=368

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 144/271 (53%), Gaps = 26/271 (10%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  ++ EQN+ P   NR+ S                +A KI +A++ + + ++ K K ++
Sbjct  122  IPILLQEQNSFPGFTNRIFSR---------------YAKKICIAYEEA-KKYFPKGKTII  165

Query  270  CGNPVRSSLKRNV-SKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
             GNPVRS + + + S++ A  H       L+    ++L +GGS G+N+IN   +     +
Sbjct  166  TGNPVRSGILQELPSRDQACIHL-----GLKVNRPIILSIGGSQGSNSINKAWMKGLKKL  220

Query  447  LDERKDLFLIWQTGVEAFHEIE-SLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +    D+ LIWQ G    H I+ + +  H   +L  F+  + + YAAAD+I+SR+GA+T 
Sbjct  221  I--HLDIQLIWQIGKADIHNIKKNRISHHHNFLLMEFIENLPICYAAADIIVSRAGALTI  278

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EI   GKP ILIP P  ++ HQ KNA ++A    A +I   E++   L ++T E+L D 
Sbjct  279  SEICLIGKPYILIPFPWSSDDHQNKNAKILADKEAALIIKNEEVEK-KLVNSTIELLNDC  337

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVN  896
            S    MS+  LK  +  A+ +I   IL ++N
Sbjct  338  SRKKKMSRNILKLGRPKATNDIVNEILQIIN  368



>ref|WP_013298229.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermoanaerobacterium thermosaccharolyticum]
 ref|YP_003852347.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacterium 
thermosaccharolyticum DSM 571]
 ref|YP_007299090.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacterium 
thermosaccharolyticum M0795]
 gb|ADL69263.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacterium 
thermosaccharolyticum DSM 571]
 gb|AGB19393.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermoanaerobacterium 
thermosaccharolyticum M0795]
Length=364

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 126/282 (45%), Gaps = 31/282 (11%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + + AAL  +  ++HEQNA P + NR+LS                F D I  AFD S + 
Sbjct  107  VVMIAALKHIPTLIHEQNAFPGLTNRILSR---------------FVDIIATAFDDSKKY  151

Query  243  FWQKKKCVVCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINV  419
            F  K    V GNPVR   L  N  +   +    P    +   G           A  IN 
Sbjct  152  FRNKDNVYVTGNPVRMEILGANKVQAFKKLGLEPGKKVVVSVGGSRG-------AAKINE  204

Query  420  KLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLT-----PFLHAMDLAYAA  584
             ++ L   V D   D  ++  TG   +  +  ++K +   +       P+ + M   YA 
Sbjct  205  YMIELIKRVDD---DFQILMITGKNQYDTVIKMIKDYDIKIGKNIKIIPYCYDMGDVYAV  261

Query  585  ADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSF  764
            AD+++ R+GA+T  E+LAT    ILIPSPNV   HQ  NA ++ K   A  I E EL+  
Sbjct  262  ADIMVCRAGAITLAELLATSTASILIPSPNVTHNHQEYNARVLEKNGAAIAILERELNGD  321

Query  765  ALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
             L      IL D  ++  M   A K +K+DA+ EI K I  L
Sbjct  322  ILYDKVSSILKDPVVLERMKSNAKKLSKIDATKEIYKLINDL  363



>ref|WP_027189051.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Desulfovibrio longus]
Length=365

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 89/273 (33%), Positives = 126/273 (46%), Gaps = 37/273 (14%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A L G+   +HEQN+VP  ANR L                 FAD+++L+F+ S E F 
Sbjct  108  LAAGLTGIPAAIHEQNSVPGAANRTLRR---------------FADEMYLSFEESREWF-  151

Query  249  QKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLL  428
               +CVV GNPVR+ +     +   R                 LVLGGS GA AIN  ++
Sbjct  152  PADRCVVTGNPVRADIAAVGRRPRVRSRTL-------------LVLGGSQGARAINDAVI  198

Query  429  NLYSNVLDERKDLFLIWQTG------VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAAD  590
                 + D   D+ ++ QTG      V A +         PR  +  F+  M  AYA A 
Sbjct  199  EALPALGD--ADVSVLHQTGPSDLERVRAAYVAAGFDPDGPRFRVCGFIEDMASAYAEAG  256

Query  591  LIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFAL  770
            L+  RSGA T +E  A G+ C+ +P P+    HQ +NA  M +   ARV+ ++ L    L
Sbjct  257  LVFCRSGASTVFEAAAAGRACVFVPFPHATHDHQTRNAQAMERAGAARVLPQDGLSGGTL  316

Query  771  RSATEEILGDESLMADMSKRALKAAKLDASAEI  869
                  +  DE  +  MS+ A   A+ DA+A I
Sbjct  317  AGTAVGLFNDEEKLDRMSEAARGFARPDAAAGI  349



>ref|WP_018127246.1| hypothetical protein [Balneola vulgaris]
Length=366

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 143/273 (52%), Gaps = 29/273 (11%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            V  V+ EQN+ P + NR+L+                +A K++ AF  + + F      V 
Sbjct  119  VSVVIQEQNSFPGVTNRMLAK---------------YASKVYTAFSDAAKYF-PGANIVE  162

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNP R++L     +++  + F     D E    V++V+GGS GA  IN  +       L
Sbjct  163  SGNPTRNTLV-TADRQVGLEAF-----DFESTKPVLMVMGGSGGAKTINEAV----KENL  212

Query  450  DERKDLFLIWQTGVEAFHEI--ESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +E KD+ +IWQ G      +  E  ++ +  + LT F+  M  AYAA+DL++SR+GA +C
Sbjct  213  EELKDIQVIWQCGSRYIDSLLDEVDLEKYSNVRLTAFIDNMPEAYAASDLVVSRAGASSC  272

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             E++ TGKP +LIPSPNVA  HQ  NA  M     + +I + E  + AL +   ++L ++
Sbjct  273  SELMITGKPSVLIPSPNVAGDHQTMNAKSMVDAGASELILDREAKA-ALPNLVNDLLRNQ  331

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
              +  M+K AL  AK +A+  I+K IL L   S
Sbjct  332  ERLRAMNKAALSLAKPNAAELIAKDILELAKTS  364



>ref|WP_026707713.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium frigidarium]
Length=368

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 93/266 (35%), Positives = 142/266 (53%), Gaps = 27/266 (10%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I N++L  +               A  I +A+++ +E F+ K K  + GN
Sbjct  122  LIQEQNSFPGITNKLLGKK---------------AHSICVAYEN-LERFFSKNKMCLTGN  165

Query  279  PVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDE  455
            PVR  L   +  +E A ++F      L+   K +LVLGGSLGA  IN  +    +N++ +
Sbjct  166  PVRQDLIDIDSKREQAIEYF-----KLDPNKKTLLVLGGSLGARRINQLIEKSRTNIISQ  220

Query  456  RKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEIL  635
              ++ +IWQ G   F E +     + ++V  PF+  MDL YAAAD+IISR+GA +  E+ 
Sbjct  221  --EVQIIWQCGKLYFEEYKKYEAHNIQVV--PFIEKMDLVYAAADIIISRAGASSVSELC  276

Query  636  ATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMA  815
              GKP I IPSPNVAE HQ KNA  +    GA ++ E ELD+    +  +E+L D     
Sbjct  277  IVGKPVIYIPSPNVAEDHQTKNAKAIVDQGGALLLKEYELDT-VFETVFKELLLDTEKQK  335

Query  816  DMSKRALKAAKLDASAEISKHILSLV  893
             +S      A+  A+ +I   I+ L+
Sbjct  336  QLSANCKALARPKATQDIVNEIVKLI  361



>ref|WP_025071878.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella timonensis]
Length=372

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 140/271 (52%), Gaps = 34/271 (13%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+   + N++L  +               ADKI +A++  +E F+   K ++ GN
Sbjct  123  LIQEQNSYAGVTNKLLGKK---------------ADKICVAYEG-MERFFPADKIIMTGN  166

Query  279  PVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN--LYSNV-  446
            PVR + L+  +SKE AR+ F          G         L   ++  + LN  + S++ 
Sbjct  167  PVRQNVLQTTLSKEAARETF----------GLDPKRKTILLVGGSLGARTLNESIQSHLD  216

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTH---PRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            +    D+  IWQTG   + +I + +KT    P L +T F+  M +AY A+DL+ISR+GA 
Sbjct  217  MIRTGDVQFIWQTGKYYYKDICNALKTQAPLPNLYVTDFISDMGVAYQASDLVISRAGAS  276

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ +NA  +     A  + + E     L  A  +I+ 
Sbjct  277  SISEFCLIGKPVILVPSPNVAEDHQTQNAMALVNKNAAIYVKDVESKDILLEQAM-KIVQ  335

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            D++ +A +S+  LK A  +++  I++ +L L
Sbjct  336  DDAKLASLSENILKLALPNSAEIIAQEVLKL  366



>ref|WP_022565187.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Blattabacterium 
sp. (Nauphoeta cinerea)]
 ref|YP_008658090.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Blattabacterium 
sp. (Nauphoeta cinerea)]
 gb|AGW86138.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Blattabacterium 
sp. (Nauphoeta cinerea)]
Length=329

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 142/269 (53%), Gaps = 25/269 (9%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  ++ EQN+ P + NR+ S                +A+KI +A++ + + ++ K K +V
Sbjct  84   IPILIQEQNSFPGLTNRIFSR---------------YANKICIAYEQA-KKYFPKDKTIV  127

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNPVRS + +  SKE A  H       L+    ++L +GGS G+N++N   +     ++
Sbjct  128  TGNPVRSEILQLPSKEEACIHL-----GLKITKPIILSIGGSQGSNSMNNAWIKGLKKII  182

Query  450  DERKDLFLIWQTGVEAFHEIE-SLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
            +   D+ LIWQ G   FH+I+   +  H  ++   F+  +   YAAAD+I+SR+GA+T  
Sbjct  183  EW--DMQLIWQVGKLDFHKIKKDKMPHHSNIIFMEFIENIPAYYAAADIIVSRAGALTIS  240

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            EI   GKP ILIP P  +  HQ KNA ++ +   A +I   E++   L ++  +++ D +
Sbjct  241  EICLIGKPSILIPFPGSSNDHQNKNAKILEEKKAALIIKNEEIEQ-KLVNSVIQLVNDHN  299

Query  807  LMADMSKRALKAAKLDASAEISKHILSLV  893
            +   M    LK  K  A+ +I   IL ++
Sbjct  300  MKEKMRINILKLGKPKATNDIINEILQII  328



>ref|WP_026452569.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Aequorivita capsosiphonis]
Length=363

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/276 (33%), Positives = 141/276 (51%), Gaps = 26/276 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA+  +  ++ EQN+   I N+ LS ++                KI +A++  +  F+  
Sbjct  114  AAMRNIPCLIQEQNSHAGITNKWLSGKV---------------QKICVAYEG-MGAFFPS  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K  + GNPVR  L   +SKE A   F   L   +    V+    G+   N +  K L  
Sbjct  158  EKIKLTGNPVRQDLLTTISKEEAISFF--NLKKEKKTLLVLGGSLGARRINELIEKSLPF  215

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            ++     +  L +IWQ G   F+E     K    + +  FL+ MD+AYAAAD IISR+GA
Sbjct  216  FA-----KHKLQVIWQCG--KFYEETYKNKGSETVQIHAFLNRMDMAYAAADFIISRAGA  268

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            ++  E+   GKP + IPSPNVAE HQ KNA  +++   A +I+E+ELDS +  +   E++
Sbjct  269  LSVSELCLVGKPVVFIPSPNVAEDHQTKNATAISEKNAALLISESELDS-SFENNFLELI  327

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
              E     +S+   K AK +A+ +I + I  L+  S
Sbjct  328  ASEEKQNTLSENIKKLAKPNATKDIVEEIEKLLKMS  363



>ref|WP_033960078.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Psychroserpens sp. PAMC 27130]
Length=364

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 134/269 (50%), Gaps = 24/269 (9%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+ P I N++L  ++               D I +A++  +E F+ K+K V
Sbjct  118  GIPSLIQEQNSYPGITNKLLGKKV---------------DTICVAYEG-LEKFFPKEKIV  161

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNP+R  L    +K +  +  F  +        +   LG       I  KL    S  
Sbjct  162  LTGNPIRKDLLDVENKHIQGKDAFTLIHSKHTLLILGGSLGARRINELIESKLEYFKS--  219

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
                 ++ LIWQ G   + +     K    + +  FL+ MD+AYAAAD+IISR+GA +  
Sbjct  220  ----LNVQLIWQCGKLYYQQYRQYNKLE-NVQVHAFLNNMDMAYAAADVIISRAGASSVS  274

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            E+   GKP I IPSPNVAE HQ KNA  ++    A +I E++LD     +   E+L  + 
Sbjct  275  ELCVVGKPVIFIPSPNVAEDHQTKNAKSISDKGAAVLIKESDLDE-QFENEFSEVLNSKE  333

Query  807  LMADMSKRALKAAKLDASAEISKHILSLV  893
               D+SK+  + A ++A+ +I+  +  L+
Sbjct  334  KREDLSKQIKELALVNATKDIANEVEKLL  362



>ref|WP_027137179.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Gaetbulibacter saemankumensis]
Length=368

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/275 (31%), Positives = 136/275 (49%), Gaps = 36/275 (13%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+  ++ EQN+ P I N++L+ +                 KI +A+D  ++ F+ K
Sbjct  118  AEINGIPSLIQEQNSYPGITNKLLAKK---------------TQKICVAYDD-LDRFFPK  161

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-  431
             K +  GNPVR  L     K +A ++FF                   +   ++  + +N 
Sbjct  162  DKIIKTGNPVRKGLLDIEDKTVAAKNFF---------NLKHGKYTLLVLGGSLGARRINE  212

Query  432  LYSNVLD--ERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
            L    LD  + +++ +IWQ G + +++   +      + +  FL+ MDLAYAAAD++ISR
Sbjct  213  LIEKELDFLDTQNVQVIWQCG-KLYYQQYKIYNNIKNVQVCEFLNNMDLAYAAADIVISR  271

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD-----SFAL  770
            +GA +  E+   GKP I IPSPNVAE HQ KNA  +     A +I E+ELD      F+ 
Sbjct  272  AGASSVSELCIVGKPVIFIPSPNVAEDHQTKNAMAVVNKDAALIIREDELDVDFENKFSS  331

Query  771  RSATEEILGDESLMADMSKRALKAAKLDASAEISK  875
              A+ E    + L  ++ K AL  A  D + E+ K
Sbjct  332  LIASPE--RQKELGTNIKKMALVNATKDIADEVEK  364



>ref|WP_006988472.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Gillisia limnaea]
 gb|EHQ02160.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Gillisia 
limnaea DSM 15749]
Length=382

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/270 (37%), Positives = 141/270 (52%), Gaps = 33/270 (12%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN++P + NR+L +                A  I  A+D+ +E F+   K    GN
Sbjct  123  LIQEQNSLPGVTNRLLGNH---------------ATIICTAYDN-LEKFFPADKIKKTGN  166

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  +     K    Q FF     L+   K VLVLGGSLGA  +N  L+  +  +  ER
Sbjct  167  PVRQDILGISEKRKEAQSFF----KLKENKKTVLVLGGSLGARRVN-HLIEAFQPLFKER  221

Query  459  KDLFLIWQTGVEAFHEIE----SLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
             D+ LIWQTG   + E +     LV+TH       FL+ MDLAYAAAD+IISR+GA +  
Sbjct  222  -DVQLIWQTGSLYYEEYKKFDTDLVQTHA------FLNRMDLAYAAADVIISRAGAGSVS  274

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            E+   GKP + IPSPNVAE HQ KNA  +A    A V+ E EL     +     +L  ++
Sbjct  275  ELCIVGKPVLFIPSPNVAEDHQTKNAMAVANKKAAVVLKEEELVE-KFKDTILSLLESKN  333

Query  807  LMADMSKRALKAAKLDASAEISKHILSLVN  896
            +  ++S+   K A  +A++ I   +  L+N
Sbjct  334  VQQELSENIKKLALPNATSAIVDEVEKLIN  363



>ref|WP_011916485.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-UDP 
N-acetylglucosamine transferase [Caldicellulosiruptor 
saccharolyticus]
 ref|YP_001179730.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
saccharolyticus DSM 8903]
 sp|A4XI04.1|MURG_CALS8 RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase; 
AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc 
GlcNAc transferase [Caldicellulosiruptor saccharolyticus 
DSM 8903]
 gb|ABP66539.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Caldicellulosiruptor 
saccharolyticus DSM 8903]
Length=370

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/267 (33%), Positives = 143/267 (54%), Gaps = 30/267 (11%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +K ++HEQNA P +AN+++S                F +KI ++F+ S   F    K V+
Sbjct  121  IKTILHEQNAYPGLANKIISR---------------FCEKILISFEESKRFFKNSNKVVL  165

Query  270  CGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVL  449
             GNPVR  +        +      +      +  +VL +GGS GA  +N  ++ L S   
Sbjct  166  TGNPVRLEI-------FSHNERAAKSSLGLEDKIIVLAVGGSRGAENLNKAVIRL-SKEF  217

Query  450  DERKDLFLIWQTG----VEAFHEIESL-VKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            +  KD++ I  +G    +EA +   SL VK++ +++  P++  M    AAAD++ISR+GA
Sbjct  218  EGCKDVYFILSSGDTKYLEAVNFANSLGVKSNIKIL--PYISDMPRYLAAADIVISRAGA  275

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            +   EI A GKP I++PSP VA  HQ  NA  + K+    V+ E+EL+S  L+S  E+++
Sbjct  276  IAISEITALGKPSIIVPSPYVANNHQEYNAKALEKVGACFVVLESELESDKLKSFLEKLI  335

Query  795  GDESLMADMSKRALKAAKLDASAEISK  875
             D++L   MS+ + K  K +A+  I K
Sbjct  336  YDKALYERMSESSKKMGKPEATQNIGK  362



>ref|WP_038132751.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA168-F10]
Length=373

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 97/272 (36%), Positives = 142/272 (52%), Gaps = 34/272 (13%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+ P + NR+L S                A +IF AF  + E ++      
Sbjct  122  GIPVMIQEQNSYPGVTNRMLGSS---------------AKRIFTAFPDA-EDYFPVHNVR  165

Query  267  VCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNP R +L   N SK  AR  F     ++  +  V+LVLGGSLGA +IN  LL+    
Sbjct  166  MVGNPTRKNLVHTNPSK--ARASF-----NISEDRSVLLVLGGSLGAKSINEALLHSL-E  217

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKT-----HPRLVLTPFLHAMDLAYAAADLIISRS  608
             L +   L++IWQ G      I++L K      +PRL L  +L  M  AYAAADL++SR+
Sbjct  218  TLHDHAGLYIIWQCGKR---YIDALTKKIDLEEYPRLRLQAYLDDMPAAYAAADLVVSRA  274

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GA +C E++ TG P +LIPSP VA  HQ  NA  M +   A +++++E     L      
Sbjct  275  GASSCSELMVTGTPSVLIPSPFVAGDHQTMNARSMQEQGAAEMLSDDEAKD-TLTELVTR  333

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHIL  884
            +L D+  +  M+  AL  AK  A+  I++ IL
Sbjct  334  LLADQEQLRRMNDAALAMAKPYAAEHIAEEIL  365



>ref|WP_019723320.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Enterococcus mundtii]
Length=362

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 136/276 (49%), Gaps = 37/276 (13%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++HEQN+VP + N+ LS                + D+I L+F  +   F+ ++K V
Sbjct  115  GIPTIIHEQNSVPGMTNKFLSR---------------YVDRIALSFKDA-ATFFPEEKSV  158

Query  267  VCGNP----VRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            + GNP    V  ++K ++ K+       PE   +   G                +K+   
Sbjct  159  LIGNPRAQEVADTMKTDILKKF---DLDPEKKTVLIFGGSQGA-----------LKINQA  204

Query  435  YSNVLD--ERKDLFLIWQTGVEAFHEI-ESLVKTHPRLVLTPFLHAMDLAYAAADLIISR  605
             ++ LD  E  D  +++ +G   +  I E L +T   + + P+++ M    AA+DL++ R
Sbjct  205  VTSYLDTFEATDYQILYASGERYYQSIKEKLGETKANISIQPYINEMAAVMAASDLLVGR  264

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E+ A G P ILIPSP V   HQ KNA  + ++  A++I + ELD  +L +A  
Sbjct  265  AGATSIAELTALGLPAILIPSPYVTNDHQTKNAMSLVRVGAAKMIADGELDGDSLGAAIN  324

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            EI+ DESL  +MS  +      DAS  + +   SL+
Sbjct  325  EIMTDESLQQNMSTASKTLGIPDASERLYQLAKSLI  360



>ref|WP_022054659.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Bacteroides 
plebeius CAG:211]
 emb|CCZ87732.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Bacteroides 
plebeius CAG:211]
Length=376

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/276 (34%), Positives = 147/276 (53%), Gaps = 28/276 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+  ++ EQN+   + N++L+ +               A+KI +A++  +E F+ K
Sbjct  115  AGMMGIPTLIQEQNSYAGVTNKLLAQK---------------AEKICVAYEG-MERFFDK  158

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             K ++ GNPVR  L  +N+S+E A + F      L+ E K +L++GGSLGA  IN  ++ 
Sbjct  159  DKIILTGNPVRQGLLNKNISREEAIRSF-----GLDPEKKTILIIGGSLGARTINNCMMQ  213

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLVKTH---PRLVLTPFLHAMDLAYAAADLIIS  602
             +  +  +   +  IWQTG    +E +  VK +   P L +T F+  M  AY+AAD++IS
Sbjct  214  GFDKI--KESGVQFIWQTGKIYINEAQQAVKAYGKLPMLHVTDFISDMAAAYSAADVVIS  271

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA +  E    GKP IL+PSPNVAE HQ KNA  +     A  I  +E     L +A 
Sbjct  272  RAGAGSISEFCLLGKPVILVPSPNVAEDHQTKNALALVNKNAALYIKNSEATQKLLDTAI  331

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            E +     L+ ++S    K A  D++  I+K +  L
Sbjct  332  ETVH-KPDLLKELSNNITKLAIKDSATIIAKEVCKL  366



>ref|WP_026712323.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium daejeonense]
Length=364

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 137/270 (51%), Gaps = 27/270 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  ++ EQN+ P I N++LS +               A+KI +A+++ +E F+ K+K +
Sbjct  118  GVPTLIQEQNSFPGITNKLLSKK---------------ANKICVAYEN-LERFFPKEKMI  161

Query  267  VCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
            + GNPVR  L     K       F    + +    +   LG       I  +L N+ +  
Sbjct  162  LTGNPVRQDLIAIADKRAEAIAHFKLGANKKTLLVLGGSLGARRMNQLIEKELKNILA--  219

Query  447  LDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
                +++ +IWQ G   F E +        + +  F+  MDL YAAAD++ISR+GA +  
Sbjct  220  ----QNVQIIWQCGKLYFEEYQKY--NSENVQVAAFIERMDLVYAAADIVISRAGASSVS  273

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEILGDE  803
            E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E++LD+ F+L    E +L D 
Sbjct  274  ELCIVGKPVIFIPSPNVAEDHQTKNAKAIVDKKGAILLKESQLDAEFSL--VFEALLKDP  331

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLV  893
                 +S+   + A  +A+ +I+  ++ L+
Sbjct  332  EKQKQLSENIKELALPEATKQIADEVVKLI  361



>ref|WP_021930834.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tannerella 
sp. CAG:118]
 emb|CCY36925.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tannerella 
sp. CAG:118]
Length=324

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 152/274 (55%), Gaps = 31/274 (11%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  V+ EQN+   + N++L+S+               A KI +A+D+ +E F+ K+K V+
Sbjct  73   IPTVIQEQNSYAGVTNKLLASK---------------AKKICVAYDN-MEKFFPKEKIVI  116

Query  270  CGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
             GNPVR  L  + +S+E A + F     +L+ E K +LV+GGSLGA  IN  +L+  +  
Sbjct  117  TGNPVRQELLNKTISQEEAVRFF-----NLDPEKKTILVIGGSLGARTINESILDWITR-  170

Query  447  LDERKDLFLIWQTG----VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
              E  ++ +IWQTG     +A   +   +  H + +  PF+  MD+AY AADL+ISR+GA
Sbjct  171  -SESDEVQIIWQTGKNFDAKAQKALSQKISHHIKQM--PFISHMDMAYKAADLVISRAGA  227

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+    KP IL+PSPNVAE HQ KNA  +     A +I +NE     +++A   ++
Sbjct  228  SSISELCLLEKPVILVPSPNVAEDHQTKNAQALEYKGAAILIRDNEARDKLMQTAL-AVI  286

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             D   + +M       A+ +++A I+  I+ +VN
Sbjct  287  RDNDKLKNMQDNIKTLAQENSAARIADIIIQIVN  320



>ref|WP_029282987.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Pedobacter sp. R20-19]
Length=367

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 146/275 (53%), Gaps = 25/275 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A+L G+  ++ EQN+   I N+ L  +               A KI +AFD  ++ F+  
Sbjct  115  ASLKGIPSLIQEQNSYAGITNKWLGKK---------------ASKICVAFDE-MDQFFPA  158

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K +  GNPVR    ++V     + H   EL  L+   K ++V GGSLGA  +N  +   
Sbjct  159  DKILKTGNPVR----KDVVDIKGKHHAGAELLKLDPLKKTIMVTGGSLGAGTLNKAIEKH  214

Query  435  YSNVLDERKDLFLIWQTGVEAFHEI-ESL-VKTHPRLVLTPFLHAMDLAYAAADLIISRS  608
               +L +  D+ +IWQTG   +  I E L ++ HP + +  FL+ MDLAYAAAD+IISR+
Sbjct  215  LPEILAQ--DVQVIWQTGKFYYKGIIERLGLEYHPNVRILEFLNKMDLAYAAADVIISRA  272

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GA T  E+    KP IL+PSPNVAE HQ KNA  + K   A +I +   +   +++A  E
Sbjct  273  GAGTIAELCLIKKPVILVPSPNVAEDHQTKNAMALVKNGAALLINDRSAEDTLVKTAL-E  331

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            +L DES    +S+   K A   A   I+  +L L+
Sbjct  332  LLNDESQCTKLSEYIGKMALPAADEIIAVEVLKLI  366



>ref|WP_014389343.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium indicum]
 ref|YP_005358282.1| Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium indicum GPTSA100-9 = DSM 
17447]
 emb|CCG54225.1| Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium indicum GPTSA100-9 = DSM 
17447]
Length=363

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/279 (31%), Positives = 142/279 (51%), Gaps = 24/279 (9%)
 Frame = +3

Query  57   NAIFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSI  236
             A+   A++ G+  V+ EQN+ P I N++L+ +               A+KI +A+++ +
Sbjct  108  GAVLKVASMLGIPTVIQEQNSFPGITNKLLAKK---------------ANKICVAYEN-L  151

Query  237  ECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAIN  416
            E F+ K+K ++ GNPVR  L    +K+     +F  +   +    +   LG       I 
Sbjct  152  ERFFPKEKMMLTGNPVRQDLIEVGTKKAEALTYFNLVASKKTLLVLGGSLGARRINQLIE  211

Query  417  VKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLI  596
             +L  L S      +++ +IWQ G   F++ E         VL  F+  MDL YAAAD++
Sbjct  212  KELDFLLS------QNIQIIWQCGKLYFNDYEKYNSRENVQVLA-FIDRMDLVYAAADVV  264

Query  597  ISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRS  776
            ISRSGA +  E+   GKP I IPSPNVAE HQ KNA  +    GA +I E++L+     +
Sbjct  265  ISRSGASSVSELCIVGKPTIFIPSPNVAEDHQTKNAKAIVDKNGALLIKESDLEG-QFET  323

Query  777  ATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
               +++ + +   ++S+   K A  +A+  I + I  L+
Sbjct  324  VFSDLISNAAKQIELSQNIKKLALPNATKTIVEEIKKLI  362



>ref|WP_007483446.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Bacteroides nordii]
 gb|EIY54117.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Bacteroides nordii CL02T12C05]
Length=370

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 144/276 (52%), Gaps = 27/276 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + GV  ++ EQN+   + N++L+ +               A KI +A+D  +E F+  
Sbjct  115  AGMMGVPTLIQEQNSYAGVTNKLLAKK---------------ACKICVAYDG-MEKFFPA  158

Query  255  KKCVVCGNPVRSSLKRNV-SKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             K ++ GNPVR +L  N  S+E A Q F      L  E K +L+LGGSLGA  IN  L+ 
Sbjct  159  DKILMTGNPVRQNLFTNTQSREEAIQAF-----GLSPEKKTMLILGGSLGARTINNTLIA  213

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLVKTH---PRLVLTPFLHAMDLAYAAADLIIS  602
                +  E   +  IWQTG   + ++   VKT    P L +T F+  M  AY+AADL+IS
Sbjct  214  GLQTI-KETSGIQFIWQTGKIYYQQVMEAVKTAGEIPNLYVTDFIKDMATAYSAADLVIS  272

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA +  E     KP IL+PSPNVAE HQ KNA  +     A  + + E +   L  A 
Sbjct  273  RAGAGSISEFCLLSKPVILVPSPNVAEDHQTKNALALVNKQAAIYVKDVEAEEKLLSVAL  332

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            E I  + + + D+S+   K A  D++  I+K ++ L
Sbjct  333  ETIT-NATKLKDLSENIAKLALPDSATIIAKEVIKL  367



>ref|WP_027884333.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Mesonia mobilis]
Length=364

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 134/269 (50%), Gaps = 33/269 (12%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            V+ EQN+   I N+ L+++               ADKI +A+ + +E F+ K+K    GN
Sbjct  122  VLQEQNSFAGITNKWLANQ---------------ADKICVAY-AGMEKFFPKEKIRFTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  L    +KE   + +F  + + +    +   LG       I   L    +N     
Sbjct  166  PVRQDLIEIQNKENEAEAYFNLIPNKKTVLVIGGSLGAKRVNELIEANLSYFEAN-----  220

Query  459  KDLFLIWQTG---VEAFHEIESL-VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
             +L L+WQTG    E + + +S  V+ H       FL  MDLAY+AAD+IISR+GA +  
Sbjct  221  -NLQLVWQTGKLYFEKYKKYQSANVQVHE------FLDRMDLAYSAADMIISRAGAGSVS  273

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDES  806
            E+    KP + IPSPNVAE HQ KNA  + K   A ++ E EL+    +     ++  E+
Sbjct  274  ELCMVAKPVVFIPSPNVAEDHQTKNAMSLVKEEAAIMLKETELEE-KFQQEFSALISSET  332

Query  807  LMADMSKRALKAAKLDASAEISKHILSLV  893
            L   +S   LK AK +A+ +I+  I  L+
Sbjct  333  LQQKLSANILKLAKPNATKDIAGEIEKLI  361



>ref|WP_035134946.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium beibuense]
 gb|KGO79478.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium beibuense F44-8]
Length=363

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 146/271 (54%), Gaps = 28/271 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  V+ EQN+ P I N+ LS +               A+ I +A+D+ ++ F+   K V
Sbjct  118  GVPTVIQEQNSYPGITNKWLSKK---------------ANVICVAYDN-LDRFFPASKIV  161

Query  267  VCGNPVRSSLKRNV--SKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYS  440
              GNPVR  L  NV   +E A +HF     +L+   K +L+LGGSLG+  IN  +     
Sbjct  162  FTGNPVRQDLI-NVEDKREEAIKHF-----ELDPNKKTLLILGGSLGSRRINQLIAKELG  215

Query  441  NVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMT  620
             +L++   + ++WQ G   F E           V++ F+  MDL YAAAD+IISRSGA +
Sbjct  216  WLLEQ--GVQVLWQCGRLYFEEYRHYHDGKQVQVMS-FIDRMDLVYAAADMIISRSGASS  272

Query  621  CYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGD  800
              E+   GKP + IPSPNVAE HQ KNA  +    GA ++ E++LD+    S    +L +
Sbjct  273  VSELCIVGKPVVFIPSPNVAEDHQTKNAQAVVSKGGALLLKESQLDA-EFESTFSALLAN  331

Query  801  ESLMADMSKRALKAAKLDASAEISKHILSLV  893
                 ++S+   K AK++A+ +I + I+ L+
Sbjct  332  NEQQQELSENIKKLAKVNATKDIVEEIIKLI  362



>ref|WP_028912111.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella sp. MA2016]
Length=368

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 147/275 (53%), Gaps = 27/275 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+ +               A+KI +A++  +E F+  
Sbjct  114  AAAMGIPCLIQEQNSYAGVTNKLLAKK---------------AEKICVAYEG-MERFFPS  157

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
            +K ++ GNPVR +L    +S E A + F     +L+   K +L++GGSLGA  IN  +L 
Sbjct  158  EKIILTGNPVRQALLDTQISHEDAIKAF-----NLDPAKKTILLVGGSLGARTINESVLQ  212

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEI-ESLVKTH-PRLVLTPFLHAMDLAYAAADLIISR  605
                 L +  D   IWQTG     EI E L   H P LV+T F+  M  AY AADL+ISR
Sbjct  213  HLD--LIKAADAQFIWQTGKYYSAEIAERLKGEHIPNLVVTDFITDMGAAYKAADLVISR  270

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E    GKP IL+PSPNVAE HQ KNA  +A    A  + + E  +  L  A +
Sbjct  271  AGASSISEFCLIGKPVILVPSPNVAEDHQTKNALALANRDAAIYVKDAEAPAMLLELAIK  330

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
             +  DE  +  +S+  LK A  D++  I+K ++ L
Sbjct  331  TV-ADEQKLKSLSENVLKLALPDSADIIAKEVIKL  364



>ref|WP_022130251.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Bacteroides 
sp. CAG:530]
 emb|CDA74902.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Bacteroides 
sp. CAG:530]
Length=372

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 144/276 (52%), Gaps = 28/276 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + GV  ++ EQN+   + N++L+ +               A KI +A++  +E F+ K
Sbjct  115  AGMMGVPTLLQEQNSYAGVTNKLLAKK---------------ACKICVAYEG-MEKFFDK  158

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             K ++ GNPVR  L   N+S E A + F      L+ + K VL++GGSLGA  +N  ++N
Sbjct  159  DKIIITGNPVRQGLLNHNISHEDAVKSF-----GLDPQKKTVLIIGGSLGARTLNNCMIN  213

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESL---VKTHPRLVLTPFLHAMDLAYAAADLIIS  602
                +   + D+ +IWQTG    +E  S    +   P + +T F+  M  AY+AADLIIS
Sbjct  214  GIETI--RKSDVQVIWQTGKGYINEARSAMEKIGNVPNVFVTDFISDMATAYSAADLIIS  271

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + E D   L  A 
Sbjct  272  RAGASSISEFCLLGKPVILVPSPNVAEDHQTKNALALVNKDAALYVKDKEADGKLLELAI  331

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            + +   + L  D+S    K A  D++  I++ +  L
Sbjct  332  QTVAQPDKL-KDLSTNIKKLAYTDSANVIAREVCKL  366



>ref|WP_039114487.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. KMS]
 gb|KIA97137.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. KMS]
Length=362

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 133/274 (49%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+  ++E F+  
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAY-KNLERFFPA  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N+
Sbjct  158  DKIVLTGNPVRQDLIDIDSKRDEAIAFYNLDANKKTLLVLGGSLGARRVNQLIEKELPNM  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ +IWQ G   F + +      P + +  F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QNVQVIWQCGKLYFEDYKKY--NQPNVKVVDFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL+S F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDQKGAILLKESELNSEFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L DE     + +   + A   A+  I   I+ L+
Sbjct  328  LKDEEKQKQLRENIKRLAMPGATKAIVAEIIKLI  361



>ref|WP_026775448.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Polaribacter sp. Hel_I_88]
Length=365

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 134/271 (49%), Gaps = 45/271 (17%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I N++LS  +               +KI +A+D  +  F+   K V  GN
Sbjct  122  LIQEQNSYPGITNKLLSKRV---------------NKICVAYDG-LSRFFPIAKIVKTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN-LYSNVLD-  452
            PVR  L +  +K    + FF                   +   ++  + +N L  + LD 
Sbjct  166  PVRQDLLQIHTKVQEAKEFF---------KIDKKKKTILVLGGSLGARKINQLIESNLDF  216

Query  453  -ERKDLFLIWQTGVEAFHEIESL-----VKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             +++D+ +IWQ G   F E +       V+ H       F++ MDLAYAA+D+IISRSGA
Sbjct  217  FKKQDVQIIWQCGKFYFEEYKKYDNLEHVQVHE------FINKMDLAYAASDIIISRSGA  270

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+   GKP I IPSPNVAE HQ KNA  +A   GA ++ E+EL++F +    E +L
Sbjct  271  GSVSELCIVGKPVIFIPSPNVAEDHQTKNAKSVADKHGAILLPESELETFPI--VFETLL  328

Query  795  GD----ESLMADMSKRALKAAKLDASAEISK  875
             D    E L  ++++ AL  A      EI K
Sbjct  329  KDKGKQEHLSENINELALPGATNAIVNEIEK  359



>ref|WP_007559923.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Bacteroides plebeius]
 gb|EDY97067.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Bacteroides plebeius DSM 17135]
Length=376

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/276 (34%), Positives = 148/276 (54%), Gaps = 28/276 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A + G+  ++ EQN+   + N++L+ +               A+KI +A++  +E F+ K
Sbjct  115  AGMMGIPTLIQEQNSYAGVTNKLLAQK---------------AEKICVAYEG-MERFFDK  158

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             K ++ GNPVR  L  +N+S+E A + F      L+ E K +L++GGSLGA  IN  ++ 
Sbjct  159  NKIILTGNPVRQGLLNKNISREEAIRSF-----GLDPEKKTILIIGGSLGARTINNCMMQ  213

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLVKTH---PRLVLTPFLHAMDLAYAAADLIIS  602
             +  +  +   +  IWQTG    +E +  VK +   P L +T F+  M  AY+AAD++IS
Sbjct  214  GFDKI--KESGVQFIWQTGKIYINEAKQAVKAYGELPMLHVTDFISDMAAAYSAADVVIS  271

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA +  E    GKP IL+PSPNVAE HQ KNA  +     A  I ++E     L +A 
Sbjct  272  RAGAGSISEFCLLGKPVILVPSPNVAEDHQTKNALALVNKNAAVYIKDSEATQKLLDTAI  331

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
            E +     L+ ++S    K A  D++  I+K +  L
Sbjct  332  EAVH-KPDLLKELSSNITKLAIKDSANIIAKEVCKL  366



>ref|WP_039118458.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. JRM]
 gb|KIC01767.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. JRM]
Length=362

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 133/274 (49%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A+ I +A+  ++E F+  
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ANAICVAY-KNLERFFPA  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N+
Sbjct  158  DKIVLTGNPVRQDLIDIDSKRDEAIAFYNLDANKKTLLVLGGSLGARRVNQLIEKELPNM  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S      +++ +IWQ G   F + +      P + +  F+  MD  YAAAD+IISR+GA
Sbjct  218  LS------QNVQVIWQCGKLYFEDYKKY--NQPNVKVVDFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL+S F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDQKGAILLKESELNSEFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L DE     + +   + A   A+  I   I+ L+
Sbjct  328  LKDEEKQKQLRENIKRLAMPGATKAIVAEIIKLI  361



>ref|WP_008612391.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Joostella marina]
 gb|EIJ39031.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Joostella marina DSM 19592]
Length=365

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/241 (37%), Positives = 124/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  51   FQNAIFLDAALG-GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFD  227
            + +   L AA G G+  V+ EQN+ P I N+ L+ E+                KIF+A+D
Sbjct  105  YASGPLLKAAAGKGISCVLQEQNSFPGITNKWLAKEV---------------RKIFVAYD  149

Query  228  SSIECFWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgAN  407
            + +E F+   K    GNPVR  L     K+ A   FF  L +      V+    G+   N
Sbjct  150  N-LERFFPADKIEKTGNPVRQDLLEIADKKEAGIKFF-NLDENRKTLFVMGGSLGARRIN  207

Query  408  AINVKLLNLYSNVLDERKDLFLIWQTG---VEAFHEIES-LVKTHPRLVLTPFLHAMDLA  575
             +  K LN +     +  ++ LIWQ G    E + + ES LVK +       F++ M LA
Sbjct  208  QLVEKELNFF-----KENNVQLIWQCGKLYYEEYKKYESDLVKVNA------FINDMKLA  256

Query  576  YAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENEL  755
            YAAAD+IISR+GA++  E+   GKP I IPSPNV+E HQ KNA  +     A ++ ENEL
Sbjct  257  YAAADIIISRAGAISVSELAIVGKPTIFIPSPNVSEDHQTKNAMAVVNKDAAVLLRENEL  316

Query  756  D  758
            D
Sbjct  317  D  317



>ref|WP_037986583.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tannerella sp. oral taxon BU063]
 gb|ETK03536.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Tannerella sp. oral taxon BU063 isolate Cell 5]
Length=381

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 134/276 (49%), Gaps = 34/276 (12%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            GV  ++ EQN+   I N+ L+                 A +I +A+   +E F+  +K V
Sbjct  118  GVPTLIQEQNSYAGITNKWLAKR---------------AARICVAY-PGMERFFPAEKIV  161

Query  267  VCGNPVRSSLKRNVS-KEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR  L+  ++  + A +HF          G         +   ++  + +N    
Sbjct  162  LTGNPVRKDLEEAINCHDEALKHF----------GLDPACKTLLVLGGSLGARTINEAVE  211

Query  444  V-LDERKDLF--LIWQTGVEAFHEIESLV---KTHPRLVLTPFLHAMDLAYAAADLIISR  605
            V L    DL   LIWQTG   +  I S V   +  P+  + PF+  MD AYAAADL++SR
Sbjct  212  VALPTLADLGVQLIWQTGRSYYDAIRSRVADLEPEPKRWVGPFITRMDYAYAAADLVVSR  271

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E+   GKP IL+PSPNVAE HQ KNA  +A   GA +I + E+    L     
Sbjct  272  AGASSISELCLLGKPAILVPSPNVAEDHQTKNARSVADRGGAVMIADGEVRKL-LPDTLR  330

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             + GD   +  ++  + + A+ D+   I   +++L+
Sbjct  331  RLFGDREQLKALALHSGQLAERDSDERIVDELVTLI  366



>ref|WP_025762875.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Dyadobacter tibetensis]
Length=364

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 141/281 (50%), Gaps = 27/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            + L A++ G+  V+ EQN+   I N+VLS                +A KIF+A+  ++E 
Sbjct  107  LLLVASMLGLPTVIQEQNSYAGITNKVLSK---------------WAKKIFVAY-PNMEK  150

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F+  +K +  GNPVRS +    SK       F      +    +   LG      +I   
Sbjct  151  FFPNEKILFYGNPVRSDILDISSKRDQAAKLFQLDASKKTLLIIGGSLGARSINESIAAG  210

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEIESLV---KTHPRLVLTPFLHAMDLAYAAADL  593
            L+ L    LD+   +  +WQTG     + E L+   K  P   LT F++ MDLAYA AD+
Sbjct  211  LVRL----LDQGYQI--LWQTGKGYARQAEELILKMKGRPVRSLT-FIYDMDLAYALADV  263

Query  594  IISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALR  773
            ++SR+GA++  E+    KPCIL+P P  +E HQ +NA  +  +  A ++ +++L S  L 
Sbjct  264  VVSRAGALSVSELCLVAKPCILVPYPYASEDHQTQNALSLVNINAAWMV-KDDLASSELI  322

Query  774  SATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            + T  +L D      ++K     A+ DA+  I+K I+ LV+
Sbjct  323  TKTLALLSDVGQQEILAKNIRTLAQPDAAMHIAKEIIGLVD  363



>ref|WP_035627630.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium hydatis]
 gb|KFF09679.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium hydatis]
Length=362

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 130/274 (47%), Gaps = 27/274 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            A   G+  V+ EQN+ P I N++LS +               A  I +A+  ++E F+  
Sbjct  114  AGSAGIPTVIQEQNSFPGITNKLLSKK---------------ASAICVAY-KNLERFFPA  157

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             K V+ GNPVR  L    SK      F+    + +    +   LG       I  +L N+
Sbjct  158  DKIVLTGNPVRQDLIDIGSKRDEAIAFYNLDANKKTLLVLGGSLGARRVNQLIEKELPNM  217

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             S  +       +IWQ G   F + +      P + +  F+  MD  YAAAD+IISR+GA
Sbjct  218  LSQYVQ------VIWQCGKLYFEDYKKY--NQPNVKVVDFIERMDFVYAAADVIISRAGA  269

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDS-FALRSATEEI  791
             +  E+   GKP I IPSPNVAE HQ KNA  +    GA ++ E+EL+S F++    E +
Sbjct  270  SSVSELCIVGKPVIFIPSPNVAEDHQTKNAQAIVDQNGAILLKESELNSEFSI--VFEAL  327

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L DE     + +   K A   A+  I   I+ L+
Sbjct  328  LKDEEKQKQLRENIKKLAMPGATKAIVAEIIKLI  361



>ref|WP_014782610.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Aequorivita sublithincola]
 ref|YP_006418370.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Aequorivita 
sublithincola DSM 14238]
 gb|AFL81355.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Aequorivita 
sublithincola DSM 14238]
Length=363

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 140/276 (51%), Gaps = 25/276 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AAL  +  ++ EQN+   I N+ LSS++                KI +A++  ++ F+  
Sbjct  113  AALRTIPCLIQEQNSHAGITNKWLSSKV---------------QKICVAYEG-MQQFFPL  156

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
            +K  + GNPVR  L    SK      FF  L   +    V+    G+   N +  K L  
Sbjct  157  EKIRLTGNPVRQDLLDISSKREEAISFF-NLKKDKKTLLVLGGSLGARRINELIEKSLPF  215

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
            +     E+ ++ +IWQ G   ++E     K    + +  FL+ MDLAYAAAD IISR+GA
Sbjct  216  F-----EKNNVQVIWQCG--KYYEETYKNKGSETVQVHTFLNRMDLAYAAADFIISRAGA  268

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
            ++  E+   GKP + IPSPNVAE HQ KNA  ++    A +I E+ELDS    S   E++
Sbjct  269  LSVSELCLVGKPVVFIPSPNVAEDHQTKNARSISDKNAALLIKESELDS-NFESEFSELI  327

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVNFS  902
              E     +SK   K AK +A+ +I + I  L+N S
Sbjct  328  TSEEKQKALSKNIKKLAKPNATKDIVEEIEKLLNKS  363



>ref|WP_022390265.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tannerella 
sp. CAG:51]
 emb|CDD88569.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Tannerella 
sp. CAG:51]
Length=374

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 143/278 (51%), Gaps = 32/278 (12%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+S+               A  I +A+++ +E F+ K
Sbjct  115  AARRGIPTLIQEQNSYAGVTNKLLASK---------------AKAICVAYEN-MERFFPK  158

Query  255  KKCVVCGNPVRSSLKRN-VSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             + ++ GNPVR  L+ + +S+E A + FF      +    +   LG     N+I   +  
Sbjct  159  DRIILTGNPVRQELQNDTISREEAIR-FFNLDPSKKTILVIGGSLGARTINNSIAAGIEK  217

Query  432  LYSNVLDERKDLFLIWQTG----VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLII  599
            +  N+        LIWQ+G     +A   +E   K    +   PF+  MD+AY AADL+I
Sbjct  218  IPQNIQ-------LIWQSGKGYDTQAQKALEE--KKPENIKQMPFISRMDMAYKAADLVI  268

Query  600  SRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSA  779
            SR+GA +  E+   GKP ILIPSPNVAE HQ KNA  ++    A +I + +  +  + +A
Sbjct  269  SRAGASSISELCLLGKPVILIPSPNVAEDHQTKNAQALSTKNAALMIRDCDAQNLLIDTA  328

Query  780  TEEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             + +  DE+ + +MS    K A+ D++  I+  I  LV
Sbjct  329  LKAVQ-DETSLKNMSDNISKMAQRDSATRIADIIFELV  365



>ref|WP_028903018.1| MULTISPECIES: UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella]
Length=370

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 146/275 (53%), Gaps = 27/275 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+ +               A+KI +A++  +E F+  
Sbjct  116  AATMGIPCLIQEQNSYAGVTNKLLAKK---------------AEKICVAYEG-MERFFPA  159

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
            +K ++ GNPVR +L    VS+E A + F      L+   K +L++GGSLGA  IN  +L 
Sbjct  160  EKIILTGNPVRQALLDTKVSREDAIKSFH-----LDPAKKTILLVGGSLGARTINESVLQ  214

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLVKTH--PRLVLTPFLHAMDLAYAAADLIISR  605
                 L +  D   +WQTG     EI   +K    P LV+T F+  M  AY AADL+ISR
Sbjct  215  HLD--LIKASDAQFVWQTGKYYSAEIAERMKGEHIPNLVITDFITDMGAAYKAADLVISR  272

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E    GKP IL+PSPNVAE HQ KNA  +A    A  + + E  +  L  A +
Sbjct  273  AGASSISEFCLIGKPVILVPSPNVAEDHQTKNALALANRDAAIYVKDAEAPATLLELAIK  332

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
             +  DE  +  +S+  LK A  +++  I+K ++ L
Sbjct  333  TV-ADEQKLQSLSENVLKLALPNSADIIAKEVIKL  366



>gb|ERM88085.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Coprobacter fastidiosus NSB1]
Length=377

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 137/277 (49%), Gaps = 30/277 (11%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+S+               A  I +A+++ +E F+ K
Sbjct  118  AARRGIPTLIQEQNSYAGVTNKLLASK---------------AKAICVAYEN-MERFFPK  161

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             + ++ GNPVR  L+ +         FF      +    +   LG     N+I   +  +
Sbjct  162  DRIILTGNPVRQELQNDTINREEAIRFFNLDPSKKTILVIGGSLGARTINNSIAAGIEKI  221

Query  435  YSNVLDERKDLFLIWQTG----VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
              N+        LIWQ+G     +A   +E   K    +   PF+  MD+AY AADL+IS
Sbjct  222  PQNIQ-------LIWQSGKGYDTQAKKALEE--KKPENIKQMPFISRMDMAYKAADLVIS  272

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA +  E+   GKP ILIPSPNVAE HQ KNA  ++    A +I + +  +  + +A 
Sbjct  273  RAGASSISELCLLGKPVILIPSPNVAEDHQTKNAQALSTKNAALMIRDCDAQNLLIDTAL  332

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            + +  DE+ + +MS    K A+ D++  I+  I  LV
Sbjct  333  KTVQ-DETSLKNMSDNISKMAQRDSATRIADIIFELV  368



>ref|WP_031258943.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Coprobacter fastidiosus]
Length=374

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 137/277 (49%), Gaps = 30/277 (11%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+S+               A  I +A+++ +E F+ K
Sbjct  115  AARRGIPTLIQEQNSYAGVTNKLLASK---------------AKAICVAYEN-MERFFPK  158

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             + ++ GNPVR  L+ +         FF      +    +   LG     N+I   +  +
Sbjct  159  DRIILTGNPVRQELQNDTINREEAIRFFNLDPSKKTILVIGGSLGARTINNSIAAGIEKI  218

Query  435  YSNVLDERKDLFLIWQTG----VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIIS  602
              N+        LIWQ+G     +A   +E   K    +   PF+  MD+AY AADL+IS
Sbjct  219  PQNIQ-------LIWQSGKGYDTQAKKALEE--KKPENIKQMPFISRMDMAYKAADLVIS  269

Query  603  RSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSAT  782
            R+GA +  E+   GKP ILIPSPNVAE HQ KNA  ++    A +I + +  +  + +A 
Sbjct  270  RAGASSISELCLLGKPVILIPSPNVAEDHQTKNAQALSTKNAALMIRDCDAQNLLIDTAL  329

Query  783  EEILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            + +  DE+ + +MS    K A+ D++  I+  I  LV
Sbjct  330  KTVQ-DETSLKNMSDNISKMAQRDSATRIADIIFELV  365



>ref|WP_036910570.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella sp. FD3004]
Length=367

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 95/275 (35%), Positives = 145/275 (53%), Gaps = 27/275 (10%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+ +               A+KI +A++  +E F+  
Sbjct  115  AAAMGIPCLIQEQNSYAGVTNKLLAKK---------------AEKICVAYEG-MERFFPA  158

Query  255  KKCVVCGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLN  431
             K ++ GNPVR +L    +SKE A + F      L+   K +L++GGSLGA  IN  +L 
Sbjct  159  DKIILTGNPVRQALLDTTISKEEAVKSF-----GLDPTKKTILLVGGSLGARTINESVLQ  213

Query  432  LYSNVLDERKDLFLIWQTGVEAFHEIESLVKTH--PRLVLTPFLHAMDLAYAAADLIISR  605
                 L +  D+  IWQTG     EI   +K    P L +T F+  M  AY AADL+ISR
Sbjct  214  HLD--LVKSSDVQFIWQTGKYYSAEIAERLKGQDIPNLKVTDFITDMGAAYQAADLVISR  271

Query  606  SGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATE  785
            +GA +  E    GKP IL+PSPNVAE HQ KNA  +A    A  + + +     L  A +
Sbjct  272  AGASSISEFCLIGKPVILVPSPNVAEDHQTKNALALANRDAAIYVKDVDAPDTLLELAVK  331

Query  786  EILGDESLMADMSKRALKAAKLDASAEISKHILSL  890
             +  D++ +  +S+  LK A  D++  I+K ++ L
Sbjct  332  TV-NDDAWLKSLSENVLKLALPDSAEIIAKEVIKL  365



>ref|WP_039751574.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Hassallia byssoidea]
 gb|KIF30800.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Hassallia byssoidea VB512170]
Length=373

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 92/290 (32%), Positives = 147/290 (51%), Gaps = 45/290 (16%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            I L A   G+  V  EQN+   + N+ + S++                K+ +A++  +E 
Sbjct  113  IMLAATRFGIASVAQEQNSFAGMVNKQVGSKV---------------SKVCVAYEG-MEK  156

Query  243  FWQKKKCVVCGNPVRSSL-----KRN-----VSKEMARQHFFPelgdlegegkvvlvlgg  392
            ++ K+K V+ GNPVR  +     KR+     +  EM R+                 ++GG
Sbjct  157  YFPKEKIVLTGNPVRKDILVIHSKRDRALAQLGFEMNRKTLL--------------IIGG  202

Query  393  slgANAINVKLLNLYSNVLDERKDLFLIWQTGVEAFHEIESLV--KTHPRLVLTPFLHAM  566
            SLGA  IN  +L     ++D +  + +IWQTG   +  + + +  K   ++ +  FL  M
Sbjct  203  SLGARTINESILGGIDKLIDAQ--IQVIWQTGKGYYQNVTAQLSGKDLKKIRVFDFLKEM  260

Query  567  DLAYAAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITE  746
            DLAYAAAD++ISRSGA+   E+   GKP IL+PSPNVAE HQ KNA  + +   A ++T+
Sbjct  261  DLAYAAADVVISRSGALAVSELCIAGKPSILVPSPNVAEDHQTKNALALVEKKAACLVTD  320

Query  747  NELDSFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             + +   +  A  ++L DE     +S+   K AK +A+ EI   I  L+ 
Sbjct  321  KDANETLVDEAM-KLLFDEQRANALSENITKLAKPNATREIVNEIEKLIG  369



>ref|WP_022327220.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Prevotella 
sp. CAG:732]
 emb|CDD20683.1| uDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Prevotella 
sp. CAG:732]
Length=368

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 142/271 (52%), Gaps = 27/271 (10%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++L+ +               ADKI +A++  +E F+   K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLAKK---------------ADKICVAYEG-MERFFPADKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L   ++KE ARQ F      L+   K +L++GGSLGA  IN  +L+    
Sbjct  163  MTGNPVRQNVLDNKMTKEEARQQF-----GLQPNKKTILLVGGSLGARTINESVLSHLEV  217

Query  444  VLDERKDLFLIWQTGVEAFHEIESLVKTH--PRLVLTPFLHAMDLAYAAADLIISRSGAM  617
            +  E+ D+  IWQTG      I+  +K    P L +  F+  M  AY AADL+ISR+GA 
Sbjct  218  I--EKSDIQFIWQTGKYYSASIQEQLKGKEIPNLKVLDFISDMGAAYRAADLVISRAGAS  275

Query  618  TCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILG  797
            +  E    GKP IL+PSPNVAE HQ KNA  +     A  + + E  S  +  A   I G
Sbjct  276  SISEFCLIGKPVILVPSPNVAEDHQTKNAMALVNKDAAVYVKDCEAPSLLIDKAI-SIAG  334

Query  798  DESLMADMSKRALKAAKLDASAEISKHILSL  890
            DE+ +  +S+   K    +++  I+  ++ L
Sbjct  335  DENKLNSLSENIKKLGFKNSADVIADEVIKL  365



>ref|WP_009318117.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Tannerella sp. 6_1_58FAA_CT1]
 gb|EHL85235.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tannerella sp. 6_1_58FAA_CT1]
Length=374

 Score =   111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/275 (30%), Positives = 137/275 (50%), Gaps = 26/275 (9%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AA  G+  ++ EQN+   + N++L+S+               A  I +A+++ +E F+ K
Sbjct  115  AARRGIPTLIQEQNSYAGVTNKLLASK---------------AKAICVAYEN-MERFFPK  158

Query  255  KKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNL  434
             + ++ GNPVR  L+ +         FF      +    +   LG     N+I   +  +
Sbjct  159  DRIILTGNPVRQELQNDTINREEAIRFFNLDPSKKTILVIGGSLGARTINNSIAAGIEKI  218

Query  435  YSNVLDERKDLFLIWQTGVEAFHEIESLV--KTHPRLVLTPFLHAMDLAYAAADLIISRS  608
              N+        LIWQ+G     + + ++  K    +   PF+  MD+AY AADL+ISR+
Sbjct  219  PQNIQ-------LIWQSGKGYDTQAKKVLDEKKPENIKQMPFISRMDMAYKAADLVISRA  271

Query  609  GAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEE  788
            GA +  E+   GKP ILIPSPNVAE HQ KNA  ++    A +I + +  +  + +A + 
Sbjct  272  GASSISELCLLGKPVILIPSPNVAEDHQTKNAQALSTKNAALMIRDCDAQNLLIDTALKT  331

Query  789  ILGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            +  DE+ + +MS    K A+ D++  I+  I  LV
Sbjct  332  VQ-DETSLKNMSDNISKMAQRDSATRIADIIFELV  365



>ref|WP_026839564.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Gillisia sp. JM1]
Length=364

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 124/223 (56%), Gaps = 32/223 (14%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I NR+L                  AD I  A+D+ +E ++  +K +  GN
Sbjct  123  LIQEQNSYPGITNRLLGKN---------------ADAICTAYDN-LESYFPLEKTIKTGN  166

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  +     K    Q FF    +L+ + K +LVLGGSLGA  IN +L+  ++ +  E+
Sbjct  167  PVRQDILNIKDKREEAQLFF----NLKNDRKTLLVLGGSLGARRIN-QLMEAFAAIF-EK  220

Query  459  KDLFLIWQTGVEAFHEIESL----VKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCY  626
            K + LIWQTG   + E +      V+TH       +L  MDLAYAAAD+I+SR+GA++  
Sbjct  221  KKIQLIWQTGSLYYEEYKKYDSEYVQTHA------YLSRMDLAYAAADVIVSRAGAISVS  274

Query  627  EILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENEL  755
            E+   GKP + IPSPNVAE HQ KNA  +A    + V+ E +L
Sbjct  275  ELCIVGKPVLFIPSPNVAENHQAKNALTVANEGASYVLDEKDL  317



>ref|WP_015481049.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Polaribacter sp. MED152]
 ref|YP_007671305.1| UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Polaribacter 
sp. MED152]
 gb|EAQ42337.1| UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Polaribacter 
sp. MED152]
Length=363

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 128/268 (48%), Gaps = 31/268 (12%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+ P I N++L                  A+KI +A+D  +  F+   K V  GN
Sbjct  122  LIQEQNSFPGITNKLLGRR---------------ANKICVAYDD-LNRFFPANKIVKTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  L    +K+     FF      +    +   LG       +   L  L      E 
Sbjct  166  PVRQDLLSIHAKKEEATDFFQLDKKKKTILILGGSLGARKINQLVETNLTFL------EE  219

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRL---VLTPFLHAMDLAYAAADLIISRSGAMTCYE  629
            +++ +IWQ G   F E     K H  L    +  F++ MDLAYAA+D+IISR+GA +  E
Sbjct  220  QNVQVIWQCGKLYFDE----YKKHNELKHVQVHQFINKMDLAYAASDIIISRAGASSVSE  275

Query  630  ILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESL  809
            +   GKP I IPSPNVAE HQ KNA  +    GA ++ E+ELD+F +    E +L DE  
Sbjct  276  LCIVGKPVIFIPSPNVAEDHQTKNAKFIVDRHGAILLKESELDTFKI--VFETLLKDEGK  333

Query  810  MADMSKRALKAAKLDASAEISKHILSLV  893
               +S+   + A   A+  I+  +  L+
Sbjct  334  QQQLSENINELALPSATRSIANEVEKLL  361



>ref|WP_025607080.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Pontibacter actiniarum]
Length=370

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 95/274 (35%), Positives = 147/274 (54%), Gaps = 31/274 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   I N++LS                 ADK+ +A+  S+E F+   K V
Sbjct  122  GIPSLIQEQNSYAGITNKLLSKR---------------ADKVCVAY-PSMEAFFPADKLV  165

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVRS  +     ++ A QHF      L+ E K +L++GGSLGA  IN  +      
Sbjct  166  LTGNPVRSDIMDLKGKRDEAMQHF-----GLQPEKKTILIIGGSLGARTINQSIAAGVEQ  220

Query  444  VLDERKDLFLIWQTGVEAFH----EIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSG  611
            +        LIWQTG +AF+    E+E+  K      L  F+  MDLAYAAAD++ISR+G
Sbjct  221  IAG--AGCQLIWQTG-KAFYPQAQELETKYKAQGIRALD-FIKRMDLAYAAADVVISRAG  276

Query  612  AMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEI  791
            A++  E+   GKP +L+PSPNVAE HQ KNA  + +   A ++ + E     + +A  ++
Sbjct  277  ALSISELCLAGKPAVLVPSPNVAEDHQTKNAMALVQQEAAILVKDAEAMERLVPTAL-QL  335

Query  792  LGDESLMADMSKRALKAAKLDASAEISKHILSLV  893
            L DE     + +   K A+ +A+A+I   ++ L+
Sbjct  336  LEDEQEQQRLQQNIRKMARPNAAADIVNELIKLI  369



>ref|WP_015691270.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Saprospira grandis]
 ref|YP_005321203.1| udp-N-acetylglucosamine--N-acetylmuramyL- (pentapeptide) pyrophosphoryL-undecaprenol 
N-acetylglucosamine [Saprospira grandis 
str. Lewin]
 gb|AFC23619.1| udp-N-acetylglucosamine--N-acetylmuramyL- (pentapeptide) pyrophosphoryL-undecaprenol 
N-acetylglucosamine [Saprospira grandis 
str. Lewin]
Length=361

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 81/265 (31%), Positives = 138/265 (52%), Gaps = 23/265 (9%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            +VHEQN+     N++L   +               DK+ +A+  +++ F+   K V+ GN
Sbjct  119  LVHEQNSYAGKTNQILGKSV---------------DKVCVAY-PNMQRFFPANKIVLTGN  162

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            P+R  L +   K      F+      +   K + + GGSLGA ++N  +L     +  ++
Sbjct  163  PIRKDLLQKSDKRAEAFDFY----GFDPNKKTIFLTGGSLGARSLNESVLPFVEEL--QK  216

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILA  638
            +++ ++WQ G     E E L + +P L +  F+  MDLAYA AD++I+R+GA+T  E+  
Sbjct  217  QEVQVLWQAGKLYIKEFEPLAQKYPNLKIQAFIQRMDLAYAMADMVIARAGALTLSELCE  276

Query  639  TGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMAD  818
             GK  IL+PSPNVAE HQ  NA  + +   A  + + E     +  A  E+L +E+ +  
Sbjct  277  NGKAAILVPSPNVAEDHQTANAKALTEQKAALWLADAEAREKLIPQAL-ELLQNETDIQK  335

Query  819  MSKRALKAAKLDASAEISKHILSLV  893
            + + A   AK  A+ EI++ +L L+
Sbjct  336  LGEAAKGLAKPQAAQEIAQEVLKLI  360



>ref|WP_015370753.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Blattabacterium 
sp. (Blatta orientalis)]
 ref|YP_007392019.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Blattabacterium 
sp. (Blatta orientalis) str. Tarazona]
 gb|AGD98266.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Blattabacterium 
sp. (Blatta orientalis) str. Tarazona]
Length=366

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 143/271 (53%), Gaps = 26/271 (10%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  ++ EQN+ P   NR+ S                +A KI +A++ + + ++ K+K ++
Sbjct  120  IPILLQEQNSFPGFTNRIFSR---------------YAKKICIAYEEA-KKYFPKEKTII  163

Query  270  CGNPVRSSLKRNV-SKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
             GNPVRS + + + S++ A  H       L+    ++L +GGS G+N+IN   +     +
Sbjct  164  TGNPVRSGILQELPSRDQACIHL-----GLKVNRPIILSIGGSQGSNSINKAWMKGLKRL  218

Query  447  LDERKDLFLIWQTGVEAFHEIE-SLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
            +    D+ LIWQ G    H I+ + +  H   +L  F+  + + YAAAD+I+SR+GA+T 
Sbjct  219  I--HLDIQLIWQIGKADIHNIKKNRISHHHNFLLMEFIENLPICYAAADIIVSRAGALTI  276

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             EI   GKP ILIP P  ++ HQ KNA ++A    A +I   E++   L + T E+L D 
Sbjct  277  SEICLIGKPYILIPFPWSSDDHQNKNAKILADKEAALIIKNEEVEK-KLVNYTIELLNDC  335

Query  804  SLMADMSKRALKAAKLDASAEISKHILSLVN  896
                 MS+  LK  +  A+ +I   IL ++N
Sbjct  336  RRKKKMSRNILKLGRPKATNDIVNEILQIIN  366



>ref|WP_002659887.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Saprospira grandis]
 gb|EJF54155.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Saprospira grandis DSM 2844]
Length=361

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 139/265 (52%), Gaps = 23/265 (9%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            +VHEQN+     N++L   +               DK+ +A+  +++ F+   K V+ GN
Sbjct  119  LVHEQNSYAGKTNQILGKSV---------------DKVCVAY-PNMQRFFPSDKIVLTGN  162

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            P+R  + +   K      F+      +   K + + GGSLGA ++N  +L     +  ++
Sbjct  163  PIRKDVLQKSDKRTEAFDFY----GFDPHKKTIFLTGGSLGARSLNESMLPFVEEL--QK  216

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILA  638
            +++ ++WQ G     E + L + +P L +  F+  MDLAYA AD++I+R+GA+T  E+  
Sbjct  217  QEVQVLWQAGKLYIKEFDPLAQKYPNLKIQAFIQRMDLAYAMADMVIARAGALTLSELCE  276

Query  639  TGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDESLMAD  818
             GK  IL+PSPNVAE HQ  NA  + +   A  + + E     +  A  E+L +E+ +  
Sbjct  277  NGKAAILVPSPNVAEDHQTANAKALTEEEAALWLADAEAREKLIPQAL-ELLQNEAEIQK  335

Query  819  MSKRALKAAKLDASAEISKHILSLV  893
            + + A + AK  A+ EI++ IL L+
Sbjct  336  LGEAAKRLAKPQAAQEIAQEILQLI  360



>ref|WP_010135604.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacteriaceae bacterium S85]
Length=364

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 98/267 (37%), Positives = 144/267 (54%), Gaps = 38/267 (14%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            ++ EQN+   I N++L+  +                KI +A++  +E ++ K K V  GN
Sbjct  123  LIQEQNSYAGITNKLLAKSV---------------SKICVAYEG-MEAYFPKDKIVFTGN  166

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  L     K  A   +F     L+   K +LVLGGSLGA AIN  + N ++  L+ER
Sbjct  167  PVRQDLLNVAEKRTAAIQYF----QLDERKKTLLVLGGSLGARAINQIIAN-HTVDLEER  221

Query  459  KDLFLIWQTG---VEAFHEI--ESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTC  623
             +L ++WQTG   +E + E   +  ++TH       +L  MDLAYAAAD+I+SR+GA + 
Sbjct  222  -NLQILWQTGKFYIEDYQEYNKKEGIQTHA------YLSKMDLAYAAADIIVSRAGASSV  274

Query  624  YEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEILGDE  803
             E+   GKP + IPSPNVAE HQ KNA  + K   A ++ E++ D F      + +   E
Sbjct  275  SELCIVGKPVVFIPSPNVAEDHQTKNALAVVKHKAAEMLKESDKDLFI--EVIDRLQNKE  332

Query  804  SLMADMSKRALKA-AKLDASAEISKHI  881
               AD   + +KA AK +A+ EI K I
Sbjct  333  --YADQLTKNIKALAKPNATKEIVKEI  357



>gb|KHM49051.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Coprobacter sp. 177]
Length=371

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 151/274 (55%), Gaps = 31/274 (11%)
 Frame = +3

Query  90   VKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVV  269
            +  V+ EQN+   + N++L+S+               A KI +A+D+ +E F+ K+K V+
Sbjct  120  IPTVIQEQNSYAGVTNKLLASK---------------AKKICVAYDN-MEKFFPKEKIVI  163

Query  270  CGNPVRSSL-KRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNV  446
             GNP+R  L  + +S+E A + F     +L+ E K +L +GGSLGA  IN  +L+  +  
Sbjct  164  TGNPIRQELLNKTISQEEAVRFF-----NLDPEKKTILAIGGSLGARTINESILDWITR-  217

Query  447  LDERKDLFLIWQTG----VEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
              E  ++ +IWQTG     +A   +   +  H + +  PF+  MD+AY AADL+ISR+GA
Sbjct  218  -SESDEIQIIWQTGKNFDAKAQKALSQKICHHIKQM--PFISRMDMAYKAADLVISRAGA  274

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E+    KP IL+PSPNVAE HQ KNA  +     A +I +NE     +++A   ++
Sbjct  275  SSISELCLLEKPVILVPSPNVAEDHQTKNAQALEYKGAAILIRDNEARDKLMQTAL-VVI  333

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
             D   + +M       A+ +++A I+  I+ +VN
Sbjct  334  RDNDKLKNMQDNIKTLAQANSAARIADIIIQIVN  367



>ref|WP_013275756.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Thermosediminibacter oceani]
 ref|YP_003825337.1| UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol 
N- acetylglucosamine transferase [Thermosediminibacter 
oceani DSM 16646]
 gb|ADL07714.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Thermosediminibacter 
oceani DSM 16646]
Length=370

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 137/286 (48%), Gaps = 40/286 (14%)
 Frame = +3

Query  75   AALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQK  254
            AAL  +   +HEQN  P + NR+LS                F DKI ++F  SI+ F Q+
Sbjct  113  AALFNIPTFIHEQNVKPGVTNRILSR---------------FVDKIAVSFSDSIKYFPQE  157

Query  255  KKCVVCGNPVR----SSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            K  VV GNP+R    S+ +    KE+      P +    G             A  IN  
Sbjct  158  K-VVVTGNPIRPEIVSADRMKALKELDLDPEKPVILSFGGSQG----------ARRINEA  206

Query  423  LLNLYSNVLDERK-DLFLIWQTGVEAFHE-IESLVKT--HPRLV----LTPFLHAMDLAY  578
            +++L   + DE    LF I  TG + + E I+ L     +PR +    + P+++ M  A 
Sbjct  207  MMDLIERIGDESSFQLFHI--TGQKNYEEFIQKLENKGINPRTLGNIKIRPYVYDMHNAI  264

Query  579  AAADLIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD  758
            AAADL+ISR+GA+T  E+ A GKP IL+P P  A+ HQ  NA LM K   A V+ + +L 
Sbjct  265  AAADLVISRAGAITIAELTAAGKPAILVPLPTAADRHQDYNANLMKKNGAAVVVKDWDLS  324

Query  759  SFALRSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
               L S   +++ D   +  MS  +    K DA   I   I+ L+N
Sbjct  325  GEKLHSIIRDLVFDRERLQKMSAASKSLGKPDALDRILDEIILLLN  370



>ref|WP_027726132.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Tuberibacillus calidus]
Length=364

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 135/281 (48%), Gaps = 27/281 (10%)
 Frame = +3

Query  63   IFLDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIEC  242
            +   AA  GV  V+HEQN+VP + N+ LS                + DKI ++   +   
Sbjct  107  VLYAAAKSGVPTVIHEQNSVPGLTNKFLSK---------------YVDKIAVSMKEAAAY  151

Query  243  FWQKKKCVVCGNPVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
            F Q+K  VV GNP R+S   N  ++ A          L    K VL+ GGS GA  IN  
Sbjct  152  FPQEK-TVVTGNP-RASEILNGDRKKAYD-----ATGLVPGKKTVLIFGGSRGARPINDA  204

Query  423  LLNLYSNVLDERKDLFLIWQTGVEAFHEI---ESLVKTHPRLVLTPFLHAMDLAYAAADL  593
            +L L   + D  K   +++ TG   + ++      +   P +++ PFLH M    A  DL
Sbjct  205  VLALLGKIKD--KAYQILYVTGDVHYDKVIEEAKRIGLAPNVIIKPFLHNMADVLAVTDL  262

Query  594  IISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALR  773
            ++SR+GA T  E+ A G P ILIPSP V   HQ KNA  + K   A VITE EL    L 
Sbjct  263  VVSRAGATTIAELTALGLPSILIPSPYVTNNHQEKNARALEKSGAALVITEQELSGERLL  322

Query  774  SATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            S    IL DE  +  M   A K    DA+  + + + +++N
Sbjct  323  SEIGRILTDEERLTAMKTAARKVGIPDAAERLYQVVQTVMN  363



>gb|KHN21638.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol 
N-acetylglucosamine transferase [Glycine 
soja]
Length=127

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = +3

Query  591  LIISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFAL  770
            L+ + +G +  +E        I IPSPN +EG+Q +NA LMA LAG  VITE+ELDS  L
Sbjct  14   LLHNSAGYLFGHEPYTIPSTSITIPSPNFSEGNQFRNASLMADLAGVTVITEDELDSSTL  73

Query  771  RSATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVNFSV  905
              A E+IL D+  M DMS+RALKAA  +ASAEI+KHILSLVN S 
Sbjct  74   AIAIEKILRDKKKMEDMSERALKAANPNASAEIAKHILSLVNLST  118



>ref|WP_035636773.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Flavobacterium sp. EM1308]
 gb|KFC59529.1| UDP-diphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase 
[Flavobacterium sp. EM1308]
Length=366

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 87/266 (33%), Positives = 130/266 (49%), Gaps = 27/266 (10%)
 Frame = +3

Query  99   VVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCVVCGN  278
            V+ EQN+ P I N++LS +               A+ I +A+D+ +E F+   K ++ GN
Sbjct  122  VIQEQNSYPGITNKLLSKK---------------ANSICVAYDN-LERFFPADKMILTGN  165

Query  279  PVRSSLKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSNVLDER  458
            PVR  L     K      +F      +    +   LG       I  +L NL S  +   
Sbjct  166  PVRQDLLDIQEKRKEAIEYFNLDPSKKTLLVLGGSLGARRINQLIEKELTNLLSLKVQ--  223

Query  459  KDLFLIWQTGVEAFHEIESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGAMTCYEILA  638
                +IWQ G   F+  +   +    + +T F+  MDL YAAAD+IISR+GA +  E+  
Sbjct  224  ----VIWQCG--KFYLEDYKNQNRHNVQVTAFIERMDLVYAAADVIISRAGASSVSELCI  277

Query  639  TGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELD-SFALRSATEEILGDESLMA  815
             GKP I IPSPNVAE HQ KNA  +    GA ++ E++LD  F+L    E ++ D+    
Sbjct  278  VGKPVIFIPSPNVAEDHQTKNAEAIVNKKGAILLKESQLDEDFSL--VFESLIKDQGKQD  335

Query  816  DMSKRALKAAKLDASAEISKHILSLV  893
             +S+     AK  A+ +I   I+ LV
Sbjct  336  QLSENIKLLAKPKATEQIVDEIIKLV  361



>ref|WP_028905650.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Prevotella intermedia]
Length=367

 Score =   110 bits (274),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 147/273 (54%), Gaps = 29/273 (11%)
 Frame = +3

Query  87   GVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFWQKKKCV  266
            G+  ++ EQN+   + N++LS +               A KI +A++  +E F+  +K +
Sbjct  119  GIPCLIQEQNSYAGVTNKLLSKK---------------AKKICVAYEG-MERFFPAEKII  162

Query  267  VCGNPVRSS-LKRNVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVKLLNLYSN  443
            + GNPVR + L+  +S+E AR+ F     +L  + K +L++GGSLGA  IN  +L     
Sbjct  163  MTGNPVRQNVLETPLSQEEARKSF-----ELNPKKKTILLVGGSLGARTINRAVLEHLD-  216

Query  444  VLDERKDLFLIWQTGVEAFHEI---ESLVKTHPRLVLTPFLHAMDLAYAAADLIISRSGA  614
             L E  D   IWQTG + +H+    E   K  P L +  F+  M  AY AADL+ISR+GA
Sbjct  217  -LIEASDAQFIWQTG-KYYHQSILDEMKGKELPNLKIMDFIGDMGAAYKAADLVISRAGA  274

Query  615  MTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALRSATEEIL  794
             +  E    GKP IL+PSPNVAE HQ KNA  +     A ++ + E     L+ A + + 
Sbjct  275  SSISEFQLIGKPVILVPSPNVAEDHQTKNAMALVNKGAALLVKDVEAPETLLQLAVKTVT  334

Query  795  GDESLMADMSKRALKAAKLDASAEISKHILSLV  893
             DE  +AD+S+   +    D++  I++ ++ L+
Sbjct  335  -DEQKLADLSENVKRMGLHDSADVIAEEVMKLI  366



>ref|WP_028576506.1| UDP-diphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase 
[Desulfomicrobium escambiense]
Length=361

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 135/281 (48%), Gaps = 39/281 (14%)
 Frame = +3

Query  69   LDAALGGVKFVVHEQNAVPRIANRVLSSEIFKYSIFSLNQRISFADKIFLAFDSSIECFW  248
            L A+L G+   +HEQN+VP + NRVL+  + +  +       SF D    AF +      
Sbjct  109  LAASLMGIPAAIHEQNSVPGVTNRVLAKRVGRVLV-------SFKDMDAPAFSTP-----  156

Query  249  QKKKCVVCGNPVRSSLKR--NVSKEMARQHFFPelgdlegegkvvlvlggslgANAINVK  422
                 V+ GNPVR+ ++R  +  + + R                   +GGS GA+A+N  
Sbjct  157  ---PAVLTGNPVRAEIRRLRDEPRVLGRNILV---------------VGGSQGASALNSF  198

Query  423  LLNLYSNVLDERKDLFL-IW-QTGVEAFHEIES-LVKTHPRLVLTPFLHAMDLAYAAADL  593
            +L      LD  K+L L IW QTG + F  +++   + +P+  + PF+  M  AY  ADL
Sbjct  199  MLR----ELDGLKNLGLGIWHQTGKDEFETVKAAYAQKYPQARVEPFISDMHEAYRFADL  254

Query  594  IISRSGAMTCYEILATGKPCILIPSPNVAEGHQLKNACLMAKLAGARVITENELDSFALR  773
            +I R+GA T  E+ A GKP IL+P P     HQL NA  + K   A V  + +LD   L 
Sbjct  255  VICRAGATTIAELTAAGKPSILVPFPYATHDHQLNNARSLEKAGAALVFQQRQLDELNLS  314

Query  774  SATEEILGDESLMADMSKRALKAAKLDASAEISKHILSLVN  896
            +A  ++      +A M++ A      DA   + K +L L  
Sbjct  315  AAVGDLFQMPETLARMARAARDMGIPDAGERVVKQLLELAG  355



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2460719396736