BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23535_g5_i1 len=1751 path=[9088:0-1084 4320:1085-1109
4345:1110-1750]

Length=1751
                                                                      Score     E

ref|XP_006343164.1|  PREDICTED: lysine histidine transporter 1-like     605   0.0      
ref|XP_009798464.1|  PREDICTED: lysine histidine transporter 1-like     597   0.0      
ref|XP_006341808.1|  PREDICTED: lysine histidine transporter-like...    603   0.0      
ref|XP_009604772.1|  PREDICTED: lysine histidine transporter 1-like     595   0.0      
ref|XP_004239501.1|  PREDICTED: lysine histidine transporter 2          595   0.0      
ref|XP_009761107.1|  PREDICTED: lysine histidine transporter-like 2     593   0.0      
ref|XP_010499181.1|  PREDICTED: lysine histidine transporter 2-like     582   0.0      
ref|XP_010460462.1|  PREDICTED: lysine histidine transporter 2-like     580   0.0      
dbj|BAK05191.1|  predicted protein                                      579   0.0      
ref|NP_564217.1|  lysine histidine transporter 2                        578   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307531.1|  hypothetical protein CARUB_v10009155mg             578   0.0      
ref|XP_002514999.1|  amino acid transporter, putative                   577   0.0      Ricinus communis
emb|CDX84942.1|  BnaC05g21130D                                          575   0.0      
ref|NP_001149518.1|  AATL2                                              575   0.0      Zea mays [maize]
ref|XP_009113791.1|  PREDICTED: lysine histidine transporter 2-like     574   0.0      
ref|XP_004310190.1|  PREDICTED: lysine histidine transporter 1-like     573   0.0      
ref|XP_007222282.1|  hypothetical protein PRUPE_ppa005886mg             573   0.0      
emb|CDY27596.1|  BnaA09g28110D                                          572   0.0      
ref|XP_008222041.1|  PREDICTED: lysine histidine transporter 2-like     572   0.0      
ref|XP_006438111.1|  hypothetical protein CICLE_v10033376mg             570   0.0      
ref|XP_002870677.1|  hypothetical protein ARALYDRAFT_916150             571   0.0      
ref|XP_006484040.1|  PREDICTED: lysine histidine transporter 2-like     570   0.0      
ref|XP_004973098.1|  PREDICTED: lysine histidine transporter 1-like     570   0.0      
ref|XP_011086736.1|  PREDICTED: lysine histidine transporter 1-like     568   0.0      
ref|XP_003575989.2|  PREDICTED: lysine histidine transporter 2-like     568   0.0      
ref|XP_004305932.1|  PREDICTED: lysine histidine transporter 1-like     568   0.0      
ref|XP_010029034.1|  PREDICTED: lysine histidine transporter 1-like     568   0.0      
ref|XP_011045191.1|  PREDICTED: lysine histidine transporter 1          568   0.0      
ref|XP_010478023.1|  PREDICTED: lysine histidine transporter 2          568   0.0      
ref|XP_010436013.1|  PREDICTED: lysine histidine transporter 1-like     567   0.0      
ref|XP_002443126.1|  hypothetical protein SORBIDRAFT_08g009800          567   0.0      Sorghum bicolor [broomcorn]
ref|XP_009359311.1|  PREDICTED: lysine histidine transporter 2 is...    567   0.0      
ref|XP_002298597.2|  lysine and histidine specific transporter fa...    567   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010531369.1|  PREDICTED: lysine histidine transporter 2          566   0.0      
emb|CDY68763.1|  BnaAnng28300D                                          566   0.0      
ref|XP_004310189.1|  PREDICTED: lysine histidine transporter 1-like     566   0.0      
ref|XP_010450621.1|  PREDICTED: lysine histidine transporter 1          566   0.0      
gb|KFK33072.1|  hypothetical protein AALP_AA6G326500                    566   0.0      
ref|NP_851109.1|  Lysine histidine transporter 1                        566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010025349.1|  PREDICTED: lysine histidine transporter-like 2     565   0.0      
ref|XP_008446084.1|  PREDICTED: lysine histidine transporter 1-like     565   0.0      
gb|EMT33617.1|  hypothetical protein F775_08592                         565   0.0      
ref|XP_006301797.1|  hypothetical protein CARUB_v10022261mg             564   0.0      
ref|XP_007216208.1|  hypothetical protein PRUPE_ppa016172mg             565   0.0      
gb|EYU44856.1|  hypothetical protein MIMGU_mgv1a006274mg                564   0.0      
ref|XP_011098833.1|  PREDICTED: lysine histidine transporter 1-like     564   0.0      
ref|XP_006283741.1|  hypothetical protein CARUB_v10004814mg             563   0.0      
ref|NP_198894.2|  Lysine histidine transporter 1                        563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004159706.1|  PREDICTED: lysine histidine transporter 1-like     563   0.0      
ref|XP_008348004.1|  PREDICTED: lysine histidine transporter 1-like     563   0.0      
ref|XP_008340170.1|  PREDICTED: lysine histidine transporter 2-like     563   0.0      
ref|NP_176932.1|  lysine histidine transporter 5                        563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682865.1|  PREDICTED: lysine histidine transporter-like 2     562   0.0      
gb|KFK44499.1|  hypothetical protein AALP_AA1G265000                    563   0.0      
ref|XP_004960693.1|  PREDICTED: lysine histidine transporter 2-like     562   0.0      
gb|ABK28455.1|  unknown                                                 563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336550.1|  PREDICTED: lysine histidine transporter 1-like     563   0.0      
ref|XP_009125162.1|  PREDICTED: lysine histidine transporter 1-li...    563   0.0      
gb|EYU25937.1|  hypothetical protein MIMGU_mgv1a006620mg                562   0.0      
ref|XP_006415799.1|  hypothetical protein EUTSA_v10007648mg             562   0.0      
ref|XP_010528186.1|  PREDICTED: lysine histidine transporter 1          561   0.0      
ref|XP_003573327.1|  PREDICTED: lysine histidine transporter 2-like     561   0.0      
ref|XP_009140039.1|  PREDICTED: lysine histidine transporter 1          561   0.0      
ref|XP_009381698.1|  PREDICTED: lysine histidine transporter 1          561   0.0      
ref|XP_002509568.1|  amino acid transporter, putative                   561   0.0      Ricinus communis
ref|XP_007210727.1|  hypothetical protein PRUPE_ppa022404mg             560   0.0      
ref|XP_009802950.1|  PREDICTED: lysine histidine transporter 1-like     561   0.0      
ref|XP_010554094.1|  PREDICTED: lysine histidine transporter 1-like     561   0.0      
gb|EAY82729.1|  hypothetical protein OsI_37940                          560   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002890710.1|  hypothetical protein ARALYDRAFT_890234             560   0.0      
ref|XP_006447153.1|  hypothetical protein CICLE_v10015213mg             561   0.0      
ref|XP_007140885.1|  hypothetical protein PHAVU_008G149600g             560   0.0      
ref|XP_008231173.1|  PREDICTED: lysine histidine transporter 1-li...    561   0.0      
ref|XP_009359534.1|  PREDICTED: lysine histidine transporter 1-like     560   0.0      
emb|CDY52705.1|  BnaA04g10600D                                          560   0.0      
emb|CDY11714.1|  BnaC06g13220D                                          560   0.0      
ref|XP_008231174.1|  PREDICTED: lysine histidine transporter 1-li...    560   0.0      
ref|XP_002298599.2|  hypothetical protein POPTR_0001s36340g             560   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO55693.1|  hypothetical protein CISIN_1g013039mg                   560   0.0      
ref|XP_007140886.1|  hypothetical protein PHAVU_008G149700g             560   0.0      
ref|XP_009103008.1|  PREDICTED: lysine histidine transporter 2          559   0.0      
ref|XP_004304006.1|  PREDICTED: lysine histidine transporter 1-like     559   0.0      
ref|XP_002888613.1|  predicted protein                                  559   0.0      
gb|AGN03890.1|  lysine histidine transporter                            559   0.0      
ref|XP_004159807.1|  PREDICTED: lysine histidine transporter 1-like     559   0.0      
emb|CDY15733.1|  BnaA07g09040D                                          558   0.0      
gb|KFK33647.1|  hypothetical protein AALP_AA5G041200                    558   0.0      
ref|XP_008389807.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    558   0.0      
ref|XP_007031757.1|  Lysine histidine transporter 1 isoform 1           559   0.0      
emb|CDY03895.1|  BnaC07g11200D                                          558   0.0      
emb|CDY36379.1|  BnaC04g32870D                                          558   0.0      
gb|EPS70921.1|  hypothetical protein M569_03830                         557   0.0      
ref|XP_008379764.1|  PREDICTED: lysine histidine transporter 1-like     558   0.0      
ref|XP_007031759.1|  Lysine histidine transporter 1                     558   0.0      
ref|XP_008792218.1|  PREDICTED: lysine histidine transporter 1          557   0.0      
gb|KGN45724.1|  hypothetical protein Csa_6G008070                       558   0.0      
ref|XP_003547674.1|  PREDICTED: lysine histidine transporter 1 is...    558   0.0      
gb|KHN10848.1|  Lysine histidine transporter 1                          558   0.0      
ref|XP_006395461.1|  hypothetical protein EUTSA_v10004214mg             557   0.0      
gb|KDP46333.1|  hypothetical protein JCGZ_10173                         557   0.0      
ref|XP_002265308.1|  PREDICTED: lysine histidine transporter 1          556   0.0      Vitis vinifera
ref|XP_011045189.1|  PREDICTED: lysine histidine transporter 1-li...    556   0.0      
ref|XP_006338671.1|  PREDICTED: lysine histidine transporter 1-like     556   0.0      
ref|XP_009613346.1|  PREDICTED: lysine histidine transporter 1-like     556   0.0      
ref|XP_002265721.1|  PREDICTED: lysine histidine transporter 1          555   0.0      Vitis vinifera
ref|XP_010415341.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    555   0.0      
ref|NP_001066488.1|  Os12g0244400                                       555   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHG21056.1|  Lysine histidine transporter 1 -like protein            555   0.0      
ref|XP_004231799.1|  PREDICTED: lysine histidine transporter 1-like     555   0.0      
ref|XP_003555159.1|  PREDICTED: lysine histidine transporter 1-like     555   0.0      
ref|XP_003547675.1|  PREDICTED: lysine histidine transporter 1-like     555   0.0      
ref|XP_008231175.1|  PREDICTED: lysine histidine transporter 1-like     555   0.0      
ref|XP_006405428.1|  hypothetical protein EUTSA_v10027769mg             555   0.0      
ref|XP_006599056.1|  PREDICTED: lysine histidine transporter 1 is...    556   0.0      
ref|XP_006292474.1|  hypothetical protein CARUB_v10018703mg             554   0.0      
ref|NP_001060901.1|  Os08g0127100                                       555   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006405427.1|  hypothetical protein EUTSA_v10027769mg             554   0.0      
ref|XP_007215373.1|  hypothetical protein PRUPE_ppa005662mg             554   0.0      
ref|XP_009411834.1|  PREDICTED: lysine histidine transporter 1          554   0.0      
ref|XP_002443797.1|  hypothetical protein SORBIDRAFT_07g002250          555   0.0      Sorghum bicolor [broomcorn]
ref|XP_009601963.1|  PREDICTED: lysine histidine transporter 1-like     554   0.0      
ref|XP_009414681.1|  PREDICTED: lysine histidine transporter 1-like     553   0.0      
ref|XP_010531645.1|  PREDICTED: lysine histidine transporter 2-like     553   0.0      
ref|XP_010673705.1|  PREDICTED: lysine histidine transporter 2-li...    553   0.0      
ref|XP_009758938.1|  PREDICTED: lysine histidine transporter 2-like     553   0.0      
ref|XP_008800948.1|  PREDICTED: lysine histidine transporter 1-like     553   0.0      
ref|NP_001152139.1|  LHT1                                               552   0.0      Zea mays [maize]
ref|XP_008450063.1|  PREDICTED: lysine histidine transporter 2-li...    552   0.0      
emb|CAD89802.1|  histidine amino acid transporter                       552   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010502695.1|  PREDICTED: lysine histidine transporter 1-like     552   0.0      
ref|XP_010037451.1|  PREDICTED: lysine histidine transporter 1-like     551   0.0      
emb|CDP16662.1|  unnamed protein product                                551   0.0      
ref|XP_009408762.1|  PREDICTED: lysine histidine transporter 1-like     551   0.0      
emb|CBI27555.3|  unnamed protein product                                552   0.0      
ref|XP_011073064.1|  PREDICTED: lysine histidine transporter 2-like     551   0.0      
ref|XP_010673704.1|  PREDICTED: lysine histidine transporter 2-li...    551   0.0      
ref|XP_009616066.1|  PREDICTED: lysine histidine transporter 2-like     551   0.0      
gb|KDP46332.1|  hypothetical protein JCGZ_10172                         551   0.0      
ref|XP_009627910.1|  PREDICTED: lysine histidine transporter 1-li...    550   0.0      
ref|XP_010673703.1|  PREDICTED: lysine histidine transporter 2-li...    551   0.0      
ref|XP_002270050.1|  PREDICTED: lysine histidine transporter 1          550   0.0      Vitis vinifera
ref|XP_009802948.1|  PREDICTED: lysine histidine transporter 1-li...    550   0.0      
ref|XP_010250839.1|  PREDICTED: lysine histidine transporter 1-like     550   0.0      
ref|XP_010248878.1|  PREDICTED: lysine histidine transporter 1-like     550   0.0      
ref|XP_009111561.1|  PREDICTED: lysine histidine transporter 1-like     550   0.0      
ref|XP_010111626.1|  hypothetical protein L484_017652                   550   0.0      
ref|XP_009371699.1|  PREDICTED: lysine histidine transporter 1-like     550   0.0      
ref|XP_009802949.1|  PREDICTED: lysine histidine transporter 1-li...    550   0.0      
emb|CDP13304.1|  unnamed protein product                                549   0.0      
emb|CDY00162.1|  BnaC09g01390D                                          550   0.0      
ref|XP_008662066.1|  PREDICTED: LHT1 isoform X1                         549   0.0      
ref|XP_004489585.1|  PREDICTED: lysine histidine transporter 1-like     550   0.0      
ref|XP_009127569.1|  PREDICTED: lysine histidine transporter-like 2     549   0.0      
ref|XP_009627908.1|  PREDICTED: lysine histidine transporter 1-li...    549   0.0      
dbj|BAJ93280.1|  predicted protein                                      549   0.0      
ref|XP_006663932.1|  PREDICTED: lysine histidine transporter 2-like     548   0.0      
ref|XP_004972968.1|  PREDICTED: lysine histidine transporter 2-like     548   0.0      
ref|XP_009414682.1|  PREDICTED: lysine histidine transporter 1-like     548   0.0      
ref|XP_011029638.1|  PREDICTED: lysine histidine transporter 2-like     548   0.0      
ref|XP_006845127.1|  hypothetical protein AMTR_s00005p00198670          547   0.0      
ref|XP_004145678.1|  PREDICTED: lysine histidine transporter 1-like     548   0.0      
ref|XP_003631324.1|  PREDICTED: lysine histidine transporter 2          547   0.0      
ref|XP_009385141.1|  PREDICTED: lysine histidine transporter 1-like     547   0.0      
gb|KHG23351.1|  Lysine histidine transporter 1 -like protein            547   0.0      
gb|KEH22296.1|  transmembrane amino acid transporter family protein     546   0.0      
ref|XP_009370386.1|  PREDICTED: lysine histidine transporter 1-like     550   0.0      
ref|XP_004514798.1|  PREDICTED: lysine histidine transporter 1-like     546   0.0      
gb|EMS65836.1|  hypothetical protein TRIUR3_16273                       546   0.0      
ref|XP_011042297.1|  PREDICTED: lysine histidine transporter 1-like     545   0.0      
emb|CAN75546.1|  hypothetical protein VITISV_035992                     544   0.0      Vitis vinifera
ref|XP_007216314.1|  hypothetical protein PRUPE_ppa019812mg             545   0.0      
gb|EMT09875.1|  hypothetical protein F775_21766                         545   0.0      
ref|XP_008341344.1|  PREDICTED: lysine histidine transporter 1-like     545   0.0      
gb|EMT11525.1|  hypothetical protein F775_27209                         544   0.0      
gb|KEH25437.1|  transmembrane amino acid transporter family protein     545   0.0      
ref|XP_010034655.1|  PREDICTED: lysine histidine transporter 1-like     544   0.0      
ref|XP_010033379.1|  PREDICTED: lysine histidine transporter 1-like     544   0.0      
gb|KCW52997.1|  hypothetical protein EUGRSUZ_J02297                     544   0.0      
ref|XP_011041568.1|  PREDICTED: lysine histidine transporter 1-like     543   0.0      
ref|XP_010550273.1|  PREDICTED: lysine histidine transporter 1-like     543   0.0      
ref|XP_004146646.1|  PREDICTED: lysine histidine transporter 1-like     543   0.0      
ref|XP_004305931.1|  PREDICTED: lysine histidine transporter 1-like     543   0.0      
ref|XP_002312642.1|  hypothetical protein POPTR_0008s17910g             543   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004489582.1|  PREDICTED: lysine histidine transporter 1-li...    543   0.0      
ref|XP_008341345.1|  PREDICTED: lysine histidine transporter 1-like     543   0.0      
ref|XP_009601838.1|  PREDICTED: lysine histidine transporter 1-like     542   0.0      
ref|XP_002315629.1|  hypothetical protein POPTR_0010s06590g             542   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW53000.1|  hypothetical protein EUGRSUZ_J02300                     542   0.0      
ref|XP_010930433.1|  PREDICTED: lysine histidine transporter 1-like     542   0.0      
ref|XP_002265948.1|  PREDICTED: lysine histidine transporter 1          541   0.0      Vitis vinifera
ref|XP_006476987.1|  PREDICTED: lysine histidine transporter 1-like     541   0.0      
ref|XP_004236350.1|  PREDICTED: lysine histidine transporter 2-like     541   0.0      
ref|XP_004158062.1|  PREDICTED: lysine histidine transporter 1-like     542   0.0      
ref|XP_006440052.1|  hypothetical protein CICLE_v10024278mg             541   0.0      
ref|XP_002443796.1|  hypothetical protein SORBIDRAFT_07g002240          541   0.0      Sorghum bicolor [broomcorn]
gb|KFK36072.1|  hypothetical protein AALP_AA4G073800                    541   0.0      
emb|CDP13303.1|  unnamed protein product                                540   0.0      
ref|XP_003637320.1|  Lysine/histidine transporter                       540   0.0      
ref|XP_004972971.1|  PREDICTED: lysine histidine transporter 1-li...    540   0.0      
gb|KFK41172.1|  hypothetical protein AALP_AA2G095000                    540   0.0      
ref|XP_009412996.1|  PREDICTED: lysine histidine transporter 1-like     540   0.0      
gb|KEH20551.1|  transmembrane amino acid transporter family protein     539   0.0      
ref|XP_006469985.1|  PREDICTED: lysine histidine transporter 1-li...    540   0.0      
ref|XP_006469984.1|  PREDICTED: lysine histidine transporter 1-li...    540   0.0      
ref|XP_010034657.1|  PREDICTED: lysine histidine transporter 1-like     539   0.0      
gb|KEH25432.1|  transmembrane amino acid transporter family protein     539   0.0      
ref|XP_004972966.1|  PREDICTED: lysine histidine transporter 1-li...    540   0.0      
ref|XP_008379141.1|  PREDICTED: lysine histidine transporter 1-like     539   0.0      
ref|XP_006338803.1|  PREDICTED: lysine histidine transporter 1-like     538   0.0      
ref|XP_008799990.1|  PREDICTED: lysine histidine transporter 1-like     538   0.0      
ref|XP_011071191.1|  PREDICTED: lysine histidine transporter-like 2     538   0.0      
ref|XP_010105172.1|  hypothetical protein L484_006910                   538   0.0      
emb|CBI27567.3|  unnamed protein product                                546   0.0      
ref|XP_004972969.1|  PREDICTED: lysine histidine transporter 1-li...    540   0.0      
ref|XP_010033378.1|  PREDICTED: lysine histidine transporter 1-like     539   0.0      
ref|XP_011097401.1|  PREDICTED: lysine histidine transporter 1-like     538   0.0      
ref|XP_007158719.1|  hypothetical protein PHAVU_002G176400g             537   0.0      
gb|KDP30960.1|  hypothetical protein JCGZ_11336                         537   0.0      
ref|XP_007151556.1|  hypothetical protein PHAVU_004G056700g             537   0.0      
dbj|BAJ99236.1|  predicted protein                                      537   0.0      
ref|XP_006351492.1|  PREDICTED: lysine histidine transporter 2-like     536   0.0      
ref|XP_006304414.1|  hypothetical protein CARUB_v10010989mg             537   0.0      
ref|XP_004233593.1|  PREDICTED: lysine histidine transporter 1-like     534   0.0      
ref|XP_003553873.1|  PREDICTED: lysine histidine transporter 1-like     534   0.0      
ref|XP_010103180.1|  hypothetical protein L484_006730                   533   0.0      
gb|AES68006.2|  transmembrane amino acid transporter family protein     534   0.0      
ref|XP_004514799.1|  PREDICTED: lysine histidine transporter 1-like     533   0.0      
ref|XP_010479290.1|  PREDICTED: lysine histidine transporter-like 1     533   0.0      
ref|XP_006338802.1|  PREDICTED: lysine histidine transporter 1-like     533   0.0      
ref|XP_002266410.1|  PREDICTED: lysine histidine transporter 1          533   0.0      Vitis vinifera
ref|XP_006447151.1|  hypothetical protein CICLE_v10018030mg             533   0.0      
ref|XP_004972964.1|  PREDICTED: lysine histidine transporter 1-li...    533   0.0      
ref|XP_010500403.1|  PREDICTED: lysine histidine transporter-like 1     532   0.0      
gb|EMS62880.1|  hypothetical protein TRIUR3_08614                       535   0.0      
ref|XP_007037907.1|  Lysine histidine transporter 1                     533   0.0      
ref|NP_001141364.1|  uncharacterized protein LOC100273455               532   0.0      Zea mays [maize]
ref|XP_007155522.1|  hypothetical protein PHAVU_003G208900g             531   0.0      
ref|XP_004972963.1|  PREDICTED: lysine histidine transporter 1-li...    531   0.0      
ref|NP_175297.2|  transmembrane amino acid transporter family pro...    531   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511233.1|  amino acid transporter, putative                   530   0.0      Ricinus communis
ref|XP_004502326.1|  PREDICTED: lysine histidine transporter 2-like     530   1e-180   
emb|CDY32547.1|  BnaC02g17400D                                          529   1e-180   
ref|NP_001150973.1|  LHT1                                               530   2e-180   Zea mays [maize]
ref|XP_008647549.1|  PREDICTED: uncharacterized protein LOC100273...    530   2e-180   
ref|XP_006393375.1|  hypothetical protein EUTSA_v10011468mg             530   2e-180   
ref|XP_007140887.1|  hypothetical protein PHAVU_008G149800g             530   2e-180   
ref|XP_004236736.1|  PREDICTED: lysine histidine transporter 2-like     529   2e-180   
ref|XP_004489581.1|  PREDICTED: uncharacterized protein LOC101496478    545   3e-180   
ref|XP_010932713.1|  PREDICTED: lysine histidine transporter 1-like     528   3e-180   
ref|XP_010425472.1|  PREDICTED: lysine histidine transporter 1-like     528   3e-180   
gb|EYU22567.1|  hypothetical protein MIMGU_mgv1a026549mg                528   4e-180   
gb|AFW74414.1|  hypothetical protein ZEAMMB73_547648                    528   7e-180   
gb|KDO82016.1|  hypothetical protein CISIN_1g014861mg                   526   2e-179   
ref|XP_010041420.1|  PREDICTED: lysine histidine transporter 1-like     528   3e-179   
ref|XP_003551873.1|  PREDICTED: lysine histidine transporter 2-like     526   4e-179   
gb|AAC49885.1|  lysine and histidine specific transporter               525   6e-179   Arabidopsis thaliana [mouse-ear cress]
emb|CDP15024.1|  unnamed protein product                                525   9e-179   
ref|XP_004972967.1|  PREDICTED: lysine histidine transporter 1-like     524   2e-178   
ref|XP_008647548.1|  PREDICTED: uncharacterized protein LOC100273...    529   2e-178   
gb|AAG60126.1|AC073555_10  lysine and histidine specific transpor...    537   3e-178   Arabidopsis thaliana [mouse-ear cress]
gb|AEE98384.1|  LHT-type plant amino acid transporter 1.2               524   4e-178   
ref|XP_002454589.1|  hypothetical protein SORBIDRAFT_04g033960          523   6e-178   Sorghum bicolor [broomcorn]
ref|XP_010030725.1|  PREDICTED: lysine histidine transporter 1-like     523   8e-178   
ref|XP_003538566.1|  PREDICTED: lysine histidine transporter 2-like     522   1e-177   
ref|XP_003550864.1|  PREDICTED: lysine histidine transporter 1-like     521   2e-177   
gb|ACU19477.1|  unknown                                                 521   2e-177   Glycine max [soybeans]
gb|KHN14086.1|  Lysine histidine transporter 1                          521   2e-177   
ref|XP_003573326.1|  PREDICTED: lysine histidine transporter 1-like     521   3e-177   
ref|XP_010315936.1|  PREDICTED: lysine histidine transporter 2-like     520   4e-177   
gb|KCW55870.1|  hypothetical protein EUGRSUZ_I01676                     520   8e-177   
ref|NP_001141837.1|  uncharacterized protein LOC100273979               520   1e-176   Zea mays [maize]
ref|XP_009359312.1|  PREDICTED: lysine histidine transporter 2 is...    518   1e-176   
ref|XP_002443799.1|  hypothetical protein SORBIDRAFT_07g002260          520   1e-176   Sorghum bicolor [broomcorn]
ref|XP_011097400.1|  PREDICTED: lysine histidine transporter 1-like     520   2e-176   
ref|XP_009802947.1|  PREDICTED: lysine histidine transporter 1-like     518   3e-176   
ref|XP_006283740.1|  hypothetical protein CARUB_v10004814mg             516   3e-176   
ref|XP_008648185.1|  PREDICTED: uncharacterized protein LOC100384...    519   8e-176   
gb|AFW74425.1|  hypothetical protein ZEAMMB73_550344                    518   1e-175   
gb|KCW55869.1|  hypothetical protein EUGRSUZ_I01675                     516   1e-175   
ref|XP_007044995.1|  Lysine histidine transporter 1                     516   1e-175   
ref|XP_003597755.1|  Lysine/histidine transporter                       518   2e-175   
ref|NP_001170379.1|  uncharacterized protein LOC100384362               517   2e-175   
ref|XP_010030724.1|  PREDICTED: lysine histidine transporter 1-like     516   2e-175   
ref|XP_004310043.1|  PREDICTED: lysine histidine transporter 1-like     516   3e-175   
ref|XP_008357859.1|  PREDICTED: lysine histidine transporter 1-like     514   4e-175   
gb|KHN01915.1|  Lysine histidine transporter 1                          513   8e-175   
emb|CAN70437.1|  hypothetical protein VITISV_043017                     513   1e-174   
ref|XP_007031758.1|  Lysine histidine transporter 1 isoform 2           512   2e-174   
ref|NP_001147827.1|  LHT1                                               514   3e-174   
ref|XP_004515896.1|  PREDICTED: lysine histidine transporter 1-like     512   4e-174   
gb|KHN10849.1|  Lysine histidine transporter 1                          510   1e-173   
ref|XP_004138579.1|  PREDICTED: uncharacterized protein LOC101220661    556   2e-173   
ref|XP_008648430.1|  PREDICTED: lysine histidine transporter 2-li...    512   4e-173   
gb|KHG15504.1|  Lysine histidine transporter 2 -like protein            510   7e-173   
gb|KHG05774.1|  Lysine histidine transporter 1 -like protein            508   1e-172   
ref|XP_011045190.1|  PREDICTED: lysine histidine transporter 1-li...    507   2e-172   
ref|XP_008441370.1|  PREDICTED: lysine histidine transporter 1          507   2e-172   
gb|KHN44411.1|  Lysine histidine transporter 1                          508   3e-172   
ref|XP_010672332.1|  PREDICTED: lysine histidine transporter 2-like     521   1e-171   
gb|KEH25431.1|  transmembrane amino acid transporter family protein     506   1e-171   
ref|XP_004972970.1|  PREDICTED: lysine histidine transporter 1-li...    507   2e-171   
ref|XP_008648428.1|  PREDICTED: lysine histidine transporter 2-li...    506   2e-171   
ref|XP_011024074.1|  PREDICTED: lysine histidine transporter 1-like     505   4e-171   
gb|KHN01916.1|  Lysine histidine transporter 1                          505   5e-171   
ref|NP_176322.1|  transmembrane amino acid transporter family pro...    505   5e-171   
gb|KCW55866.1|  hypothetical protein EUGRSUZ_I01671                     503   8e-171   
ref|XP_002884261.1|  hypothetical protein ARALYDRAFT_896068             504   1e-170   
ref|XP_009370295.1|  PREDICTED: lysine histidine transporter 1-like     501   3e-170   
ref|XP_006297566.1|  hypothetical protein CARUB_v10013589mg             504   4e-170   
ref|NP_186825.2|  Lysine histidine transporter-like 4                   503   5e-170   
gb|AAF01559.1|AC009325_29  putative amino acid permease                 504   6e-170   
ref|XP_009371700.1|  PREDICTED: lysine histidine transporter 1          501   6e-170   
gb|KEH25438.1|  transmembrane amino acid transporter family protein     501   1e-169   
ref|XP_010497181.1|  PREDICTED: lysine histidine transporter-like 4     502   1e-169   
ref|XP_002321681.1|  hypothetical protein POPTR_0015s10350g             501   2e-169   
ref|XP_002886552.1|  hypothetical protein ARALYDRAFT_475192             501   2e-169   
ref|XP_010672312.1|  PREDICTED: lysine histidine transporter 2-like     511   2e-168   
gb|AAB48944.1|  amino acid permease 1                                   499   4e-168   
ref|XP_004489583.1|  PREDICTED: lysine histidine transporter 1-li...    496   1e-167   
ref|XP_002972653.1|  hypothetical protein SELMODRAFT_270979             498   1e-167   
ref|XP_002988158.1|  hypothetical protein SELMODRAFT_271974             498   1e-167   
gb|EMT07962.1|  hypothetical protein F775_11283                         494   3e-167   
ref|XP_009124047.1|  PREDICTED: lysine histidine transporter-like...    496   3e-167   
gb|KDO55696.1|  hypothetical protein CISIN_1g013039mg                   495   4e-167   
ref|XP_003532716.2|  PREDICTED: lysine histidine transporter-like...    492   1e-166   
ref|XP_008392965.1|  PREDICTED: lysine histidine transporter 1-like     491   3e-166   
gb|KFK37637.1|  hypothetical protein AALP_AA3G009100                    503   3e-166   
gb|KFK37639.1|  hypothetical protein AALP_AA3G009100                    503   2e-165   
ref|XP_003601825.1|  Lysine/histidine transporter                       489   2e-165   
ref|XP_010041088.1|  PREDICTED: lysine histidine transporter 1-like     489   3e-165   
gb|KFK37638.1|  hypothetical protein AALP_AA3G009100                    503   3e-165   
ref|XP_003566406.2|  PREDICTED: lysine histidine transporter 1-like     489   8e-165   
gb|KEH22297.1|  transmembrane amino acid transporter family protein     486   2e-164   
gb|KHN32061.1|  Lysine histidine transporter 1                          486   3e-164   
ref|XP_009124048.1|  PREDICTED: lysine histidine transporter-like...    488   3e-164   
ref|XP_004960672.1|  PREDICTED: lysine histidine transporter 2-like     489   2e-163   
emb|CDX77082.1|  BnaC04g38770D                                          484   7e-163   
gb|AAB71468.1|  amino acid permease                                     483   9e-163   
gb|KEH39425.1|  transmembrane amino acid transporter family protein     483   9e-163   
gb|KDO55697.1|  hypothetical protein CISIN_1g013039mg                   481   1e-162   
gb|KCW44358.1|  hypothetical protein EUGRSUZ_L02171                     481   3e-162   
gb|AES91069.2|  transmembrane amino acid transporter family protein     482   4e-162   
ref|XP_010111627.1|  hypothetical protein L484_017653                   484   8e-162   
ref|XP_002988157.1|  hypothetical protein SELMODRAFT_127260             481   1e-161   
ref|XP_004135512.1|  PREDICTED: lysine histidine transporter 1-like     479   2e-161   
ref|XP_002509567.1|  amino acid transporter, putative                   478   4e-161   
gb|KCW52998.1|  hypothetical protein EUGRSUZ_J02298                     479   6e-161   
ref|XP_004963482.1|  PREDICTED: lysine histidine transporter-like...    479   1e-160   
ref|XP_010524279.1|  PREDICTED: lysine histidine transporter-like...    479   1e-160   
ref|XP_010524278.1|  PREDICTED: lysine histidine transporter-like...    478   2e-160   
ref|XP_009782379.1|  PREDICTED: lysine histidine transporter-like...    478   4e-160   
ref|XP_003608872.1|  Lysine/histidine transporter                       475   2e-159   
ref|XP_009782380.1|  PREDICTED: lysine histidine transporter-like...    474   4e-159   
gb|KEH22298.1|  transmembrane amino acid transporter family protein     472   5e-159   
ref|XP_009595466.1|  PREDICTED: lysine histidine transporter-like...    474   8e-159   
gb|AFW74426.1|  hypothetical protein ZEAMMB73_550344                    472   1e-158   
ref|XP_010695848.1|  PREDICTED: lysine histidine transporter-like 6     473   1e-158   
ref|XP_009595467.1|  PREDICTED: lysine histidine transporter-like...    473   2e-158   
ref|XP_006391240.1|  hypothetical protein EUTSA_v10019811mg             471   3e-158   
ref|XP_001752686.1|  predicted protein                                  470   2e-157   
gb|AFW74421.1|  hypothetical protein ZEAMMB73_903350                    469   4e-157   
gb|EMS50903.1|  hypothetical protein TRIUR3_31402                       467   1e-156   
ref|XP_002311447.2|  hypothetical protein POPTR_0008s11680g             469   2e-156   
ref|XP_011070828.1|  PREDICTED: lysine histidine transporter-like 6     468   2e-156   
ref|XP_011021805.1|  PREDICTED: lysine histidine transporter-like 6     468   2e-156   
ref|XP_009358666.1|  PREDICTED: lysine histidine transporter-like 6     468   3e-156   
ref|XP_002315954.2|  lysine and histidine specific transporter fa...    467   3e-156   
ref|XP_011008370.1|  PREDICTED: lysine histidine transporter-like...    467   3e-156   
ref|XP_004972965.1|  PREDICTED: lysine histidine transporter 1-li...    470   9e-156   
ref|XP_009336604.1|  PREDICTED: lysine histidine transporter-like 6     466   1e-155   
ref|XP_008361735.1|  PREDICTED: lysine histidine transporter-like 6     465   2e-155   
ref|XP_010044286.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    465   2e-155   
ref|XP_008649457.1|  PREDICTED: lysine histidine transporter 2-like     465   2e-155   
ref|XP_009105820.1|  PREDICTED: lysine histidine transporter-like...    465   2e-155   
emb|CDP00586.1|  unnamed protein product                                465   2e-155   
gb|KDO69322.1|  hypothetical protein CISIN_1g0360962mg                  462   3e-155   
emb|CDX72814.1|  BnaC06g32620D                                          464   4e-155   
ref|XP_009105821.1|  PREDICTED: lysine histidine transporter-like...    464   6e-155   
ref|XP_008648429.1|  PREDICTED: lysine histidine transporter 1-li...    463   7e-155   
ref|XP_007222166.1|  hypothetical protein PRUPE_ppa005790mg             464   7e-155   
ref|XP_010044283.1|  PREDICTED: lysine histidine transporter-like 6     463   1e-154   
ref|XP_008243407.1|  PREDICTED: lysine histidine transporter-like 6     463   2e-154   
ref|XP_003614500.1|  Lysine/histidine transporter                       462   3e-154   
ref|XP_008340293.1|  PREDICTED: lysine histidine transporter-like 6     463   4e-154   
ref|XP_003536314.2|  PREDICTED: lysine histidine transporter-like...    461   4e-154   
ref|XP_010265227.1|  PREDICTED: lysine histidine transporter-like 6     462   4e-154   
ref|XP_004238954.1|  PREDICTED: lysine histidine transporter-like 6     461   5e-154   
gb|AES62039.2|  transmembrane amino acid transporter family protein     461   7e-154   
ref|XP_010111624.1|  hypothetical protein L484_017650                   474   3e-153   
ref|XP_006362547.1|  PREDICTED: lysine histidine transporter-like...    459   3e-153   
emb|CDY12661.1|  BnaA02g13290D                                          457   3e-153   
ref|XP_006301360.1|  hypothetical protein CARUB_v10021770mg             460   3e-153   
ref|XP_002439496.1|  hypothetical protein SORBIDRAFT_09g008100          459   4e-153   
gb|EYU29952.1|  hypothetical protein MIMGU_mgv1a006560mg                459   5e-153   
ref|XP_004505841.1|  PREDICTED: lysine histidine transporter-like...    458   1e-152   
ref|XP_008239425.1|  PREDICTED: lysine histidine transporter 1-like     455   1e-152   
ref|XP_007046289.1|  Amino acid transporter, putative isoform 1         459   1e-152   
gb|KDP29375.1|  hypothetical protein JCGZ_18296                         457   2e-152   
gb|KCW44653.1|  hypothetical protein EUGRSUZ_L018182                    455   4e-152   
ref|XP_003516838.1|  PREDICTED: lysine histidine transporter-like...    456   5e-152   
dbj|BAK00033.1|  predicted protein                                      456   1e-151   
ref|XP_010242583.1|  PREDICTED: lysine histidine transporter-like 5     457   1e-151   
emb|CDY36101.1|  BnaA08g19470D                                          455   1e-151   
ref|XP_009115334.1|  PREDICTED: lysine histidine transporter-like 6     455   2e-151   
ref|XP_006415882.1|  hypothetical protein EUTSA_v10007653mg             455   2e-151   
ref|XP_004954726.1|  PREDICTED: lysine histidine transporter 2-like     455   3e-151   
ref|XP_006653485.1|  PREDICTED: lysine histidine transporter-like...    454   4e-151   
ref|XP_002887379.1|  amino acid permease                                454   6e-151   
ref|XP_006478272.1|  PREDICTED: lysine histidine transporter-like...    454   6e-151   
ref|XP_009109889.1|  PREDICTED: lysine histidine transporter-like 6     453   8e-151   
ref|XP_008450064.1|  PREDICTED: lysine histidine transporter 1-li...    450   1e-150   
ref|XP_007153354.1|  hypothetical protein PHAVU_003G028400g             453   1e-150   
gb|AAF43217.1|AC012654_1  Contains similarity to the lysine and h...    453   1e-150   
ref|XP_009391402.1|  PREDICTED: lysine histidine transporter-like...    452   1e-150   
emb|CDY42098.1|  BnaA09g28620D                                          452   2e-150   
ref|XP_002891447.1|  hypothetical protein ARALYDRAFT_336986             459   2e-150   
ref|XP_010427989.1|  PREDICTED: lysine histidine transporter-like...    452   3e-150   
ref|XP_002890685.1|  hypothetical protein ARALYDRAFT_472817             452   3e-150   
ref|XP_010415865.1|  PREDICTED: lysine histidine transporter-like 5     452   4e-150   
ref|XP_002281867.1|  PREDICTED: lysine histidine transporter-like 6     451   4e-150   
ref|NP_565019.2|  transmembrane amino acid transporter family pro...    451   6e-150   
ref|NP_173924.1|  transmembrane amino acid transporter family pro...    451   8e-150   
ref|XP_002488994.1|  hypothetical protein SORBIDRAFT_0610s002010        451   9e-150   
gb|AES62040.2|  transmembrane amino acid transporter family protein     451   9e-150   
ref|XP_008339076.1|  PREDICTED: lysine histidine transporter-like 5     451   1e-149   
ref|XP_009357188.1|  PREDICTED: lysine histidine transporter-like 5     451   2e-149   
ref|XP_010041256.1|  PREDICTED: lysine histidine transporter 1-like     447   2e-149   
gb|KDO55694.1|  hypothetical protein CISIN_1g013039mg                   446   3e-149   
ref|XP_008648431.1|  PREDICTED: lysine histidine transporter 2-li...    449   7e-149   
ref|XP_010477902.1|  PREDICTED: lysine histidine transporter-like...    448   8e-149   
ref|XP_010427990.1|  PREDICTED: lysine histidine transporter-like...    447   9e-149   
ref|XP_010460351.1|  PREDICTED: lysine histidine transporter-like...    448   1e-148   
ref|XP_006484421.1|  PREDICTED: lysine histidine transporter-like...    448   1e-148   
emb|CAN79675.1|  hypothetical protein VITISV_012213                     447   1e-148   
ref|XP_006307543.1|  hypothetical protein CARUB_v10009167mg             447   2e-148   
ref|XP_008446564.1|  PREDICTED: lysine histidine transporter-like 6     447   2e-148   
gb|KDO70063.1|  hypothetical protein CISIN_1g013753mg                   447   2e-148   
ref|XP_003591788.1|  Lysine/histidine transporter                       448   2e-148   
ref|XP_010460349.1|  PREDICTED: lysine histidine transporter-like...    446   4e-148   
ref|XP_010064854.1|  PREDICTED: lysine histidine transporter-like 5     446   6e-148   
ref|XP_010521102.1|  PREDICTED: lysine histidine transporter-like 5     446   7e-148   
gb|KHG11018.1|  hypothetical protein F383_12609                         446   8e-148   
ref|XP_006390760.1|  hypothetical protein EUTSA_v10018602mg             445   8e-148   
ref|XP_010477904.1|  PREDICTED: lysine histidine transporter-like...    445   1e-147   
ref|XP_004135109.1|  PREDICTED: lysine histidine transporter-like...    444   2e-147   
ref|XP_006437724.1|  hypothetical protein CICLE_v10031570mg             444   2e-147   
ref|XP_011008388.1|  PREDICTED: lysine histidine transporter-like...    444   2e-147   
ref|XP_009378994.1|  PREDICTED: lysine histidine transporter-like 5     445   3e-147   
gb|AAU90160.1|  hypothetical protein                                    444   5e-147   
ref|XP_002868702.1|  hypothetical protein ARALYDRAFT_916331             443   7e-147   
ref|XP_004975866.1|  PREDICTED: lysine histidine transporter-like...    443   7e-147   
ref|XP_002443800.1|  hypothetical protein SORBIDRAFT_07g002265          442   7e-147   
ref|XP_009145072.1|  PREDICTED: LOW QUALITY PROTEIN: lysine histi...    440   2e-146   
gb|AFK44764.1|  unknown                                                 442   2e-146   
ref|XP_001765744.1|  predicted protein                                  442   3e-146   
ref|XP_008357610.1|  PREDICTED: lysine histidine transporter-like 5     442   4e-146   
gb|AFW61320.1|  hypothetical protein ZEAMMB73_753788                    439   6e-146   
gb|KEH43447.1|  transmembrane amino acid transporter family protein     439   9e-146   
emb|CAE01537.2|  OSJNBa0072F16.19                                       442   9e-146   
ref|XP_009587049.1|  PREDICTED: lysine histidine transporter-like 5     441   1e-145   
gb|EEE61136.1|  hypothetical protein OsJ_15073                          440   2e-145   
gb|KDO55698.1|  hypothetical protein CISIN_1g013039mg                   434   6e-145   
ref|XP_003579910.1|  PREDICTED: lysine histidine transporter-like 6     437   1e-144   
gb|EYU29951.1|  hypothetical protein MIMGU_mgv1a006617mg                436   6e-144   
ref|XP_008669315.1|  PREDICTED: lysine histidine transporter-like...    436   7e-144   
ref|XP_009779906.1|  PREDICTED: lysine histidine transporter-like 5     436   1e-143   
ref|XP_004158554.1|  PREDICTED: lysine histidine transporter-like...    436   1e-143   
ref|XP_008347870.1|  PREDICTED: lysine histidine transporter-like 5     442   2e-143   
ref|XP_004505842.1|  PREDICTED: lysine histidine transporter-like...    434   2e-143   
ref|XP_009779152.1|  PREDICTED: lysine histidine transporter-like 5     434   5e-143   
gb|AGT16963.1|  hypothetical protein SHCRBa_121_P14_R_160               433   6e-143   
ref|XP_003618799.1|  Lysine/histidine transporter                       431   9e-143   
ref|XP_009612421.1|  PREDICTED: lysine histidine transporter-like...    432   3e-142   
ref|XP_008441159.1|  PREDICTED: lysine histidine transporter-like 5     432   4e-142   
ref|XP_007143803.1|  hypothetical protein PHAVU_007G103000g             429   1e-141   
ref|XP_009391401.1|  PREDICTED: lysine histidine transporter-like...    430   1e-141   
gb|EMT11218.1|  hypothetical protein F775_16304                         425   3e-140   
ref|XP_002529150.1|  amino acid transporter, putative                   424   2e-139   
gb|AAG51818.1|AC016163_7  putative amino acid permease; 31199-29477     424   2e-139   
ref|XP_008219132.1|  PREDICTED: lysine histidine transporter-like 5     425   3e-139   
ref|XP_006441625.1|  hypothetical protein CICLE_v10023838mg             423   7e-139   
ref|XP_003598055.1|  Lysine/histidine transporter                       424   7e-139   
gb|KCW44360.1|  hypothetical protein EUGRSUZ_L02171                     418   1e-138   
ref|XP_001768749.1|  predicted protein                                  421   4e-138   
ref|XP_004499579.1|  PREDICTED: lysine histidine transporter-like...    419   6e-137   
ref|XP_004301460.1|  PREDICTED: lysine histidine transporter-like...    415   6e-136   
ref|XP_007148621.1|  hypothetical protein PHAVU_005G001700g             414   2e-135   
ref|XP_007227308.1|  hypothetical protein PRUPE_ppa016691mg             413   2e-135   
gb|KEH39426.1|  transmembrane amino acid transporter family protein     410   3e-135   
ref|XP_003591789.1|  Lysine/histidine transporter                       413   8e-135   
ref|XP_007163727.1|  hypothetical protein PHAVU_001G259200g             415   1e-134   
ref|XP_004138830.1|  PREDICTED: lysine histidine transporter-like...    410   7e-134   
tpg|DAA37435.1|  TPA: hypothetical protein ZEAMMB73_473474              407   2e-133   
ref|XP_006578996.1|  PREDICTED: lysine histidine transporter-like...    409   3e-133   
tpg|DAA48608.1|  TPA: hypothetical protein ZEAMMB73_897444              409   3e-133   
ref|XP_009612422.1|  PREDICTED: lysine histidine transporter-like...    407   3e-133   
ref|XP_010551300.1|  PREDICTED: lysine histidine transporter-like...    407   8e-133   
ref|XP_010105773.1|  hypothetical protein L484_009969                   406   2e-132   
gb|KEH15811.1|  transmembrane amino acid transporter family protein     402   6e-132   
gb|KDO51717.1|  hypothetical protein CISIN_1g037598mg                   397   5e-130   



>ref|XP_006343164.1| PREDICTED: lysine histidine transporter 1-like [Solanum tuberosum]
Length=442

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/439 (68%), Positives = 369/439 (84%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             + K   A+    K  +D WLP+ S R+ KWWYSTFHNVTAMVGAG+LSLPYAMSEMGWGP
Sbjct  5     NEKEIDARTEEEKA-IDAWLPITSDRNAKWWYSTFHNVTAMVGAGVLSLPYAMSEMGWGP  63

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +M++SWAIT YT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +V++
Sbjct  64    GVIVMLMSWAITFYTIWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQIVVDV  123

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
             S CIIYMVTGG S+KK  E +C DC+PIKL+Y+I+IFS   F+ S LPNFNSISFVSL A
Sbjct  124   SSCIIYMVTGGKSLKKFHETVCPDCQPIKLTYFIIIFSSVHFVLSHLPNFNSISFVSLAA  183

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS++YST+AW ++L + IE   V Y  R  K +DNVFMF+SALGD+AF+YAGHNVVLE
Sbjct  184   AVMSLTYSTVAWATSLGRGIEGRVVSYELRGEKTSDNVFMFLSALGDVAFAYAGHNVVLE  243

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MWKGV +AY++VA+CY PVAF+GY A GNQV DNILL+LEKP+W
Sbjct  244   IQATIPSTPEKPSKGPMWKGVWVAYIIVAICYLPVAFLGYWAFGNQVEDNILLSLEKPMW  303

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             L+AAAN+FVVVHV+GSYQV+AM MFDMIET+ VK++K KP+  LRF  R  +VA TLFVG
Sbjct  304   LVAAANMFVVVHVIGSYQVFAMPMFDMIETYAVKSIKLKPSTFLRFTVRTTYVALTLFVG  363

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             +++PFFGGL+GFFGGFA APT+YY+PCI+WLI++KPK+FG SW MNW  I++G+LLT+L+
Sbjct  364   MTIPFFGGLMGFFGGFALAPTSYYLPCIIWLIIVKPKRFGFSWWMNWFCIIVGVLLTVLS  423

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGG+W+++K AK Y FYQ
Sbjct  424   PIGGMWTLIKQAKNYRFYQ  442



>ref|XP_009798464.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana sylvestris]
Length=442

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/449 (67%), Positives = 368/449 (82%), Gaps = 7/449 (2%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             M    E E+ D + E  K       +D WLP+ S R+ KWWYSTFHNVTAMVGAG+LSLP
Sbjct  1     MAHANEKEI-DTRTEEEK------AIDAWLPITSDRNAKWWYSTFHNVTAMVGAGVLSLP  53

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAMSEMGWGPG+ +M+LSWAIT YT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI
Sbjct  54    YAMSEMGWGPGITVMLLSWAITFYTIWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWI  113

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +V++S CIIYMVTGG S+KK  E +C DC+PIKL+Y+I+IFS   F+ S LPNF
Sbjct  114   VVPQQIVVDVSSCIIYMVTGGKSLKKFHETVCPDCQPIKLTYFIIIFSSVHFVLSHLPNF  173

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VSL AA+MS++YS +AW  ++ + IE   V Y  R  K +DN+FMF+SALGD+AF
Sbjct  174   NSISLVSLAAAVMSLTYSIVAWACSIGRGIEGREVSYELRGEKTSDNIFMFLSALGDVAF  233

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGV +AY++VA+CY PVAFIGY A GN V DN
Sbjct  234   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVWVAYLIVAVCYLPVAFIGYWAFGNVVEDN  293

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             ILL+LEKPVW++AAAN+FVVVHV+GSYQV+AM +FDMIET+ VK+++ KP+  LRF  R 
Sbjct  294   ILLSLEKPVWVVAAANLFVVVHVIGSYQVFAMPVFDMIETYAVKSMRLKPSTLLRFGVRT  353

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
              FVAFTLFVG+++PFFGGL+GFFGGFA APT+YY+PCI+WLI++KPK+FG SW MNW  I
Sbjct  354   TFVAFTLFVGMTIPFFGGLMGFFGGFALAPTSYYLPCIIWLIIVKPKRFGFSWFMNWFCI  413

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             + GILLT+L+PIGG+W+++K AK Y FYQ
Sbjct  414   IAGILLTVLSPIGGMWTLIKQAKNYRFYQ  442



>ref|XP_006341808.1| PREDICTED: lysine histidine transporter-like 2-like [Solanum 
tuberosum]
Length=613

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/459 (67%), Positives = 373/459 (81%), Gaps = 7/459 (2%)
 Frame = -1

Query  1646  AFKMGF-DRELEMGDYKAEGAKPAAN-----KGEVDDWLPVGSQRSGKWWYSTFHNVTAM  1485
              FK  F DR   M      G   A +     +  +D+WLP+ S R+ KWWYST HNVTAM
Sbjct  155   GFKEAFLDRYFFMARVGENGVNNAIDTRTKEQKAIDEWLPITSNRNAKWWYSTMHNVTAM  214

Query  1484  VGAGILSLPYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAA  1305
             VGAG+LSLPYAMS+MGWG GV  M+LSW IT YT++QMVEMHE +PGKRFDRYHELGQ A
Sbjct  215   VGAGVLSLPYAMSQMGWGAGVTAMLLSWIITFYTIWQMVEMHEMIPGKRFDRYHELGQCA  274

Query  1304  FGPKLGLWIVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQ  1125
             FG KLGLWIVVPQQ +VE+S CIIYMVTGG S++K  E++  + KP+KL+Y+I  FS  +
Sbjct  275   FGEKLGLWIVVPQQMIVEVSTCIIYMVTGGKSLQKFQEIIFPNMKPLKLTYFITFFSSIE  334

Query  1124  FIASFLPNFNSISFVSLLAAIMSVSYSTIAWGSALHKW-IESHAVDYGPRSHKKTDNVFM  948
             F  S LPNFNS+S VS +AA++S++YS IAW +++ +  I +  V YGPRS K +DNVFM
Sbjct  335   FGLSLLPNFNSLSSVSFVAAVLSIAYSFIAWTASIKEHAIGTQVVSYGPRSSKSSDNVFM  394

Query  947   FMSALGDMAFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGY  768
             F+SALG++AFSYAGHNVVLEIQATIPSTP+NPSKKAMWKGV+IAY++VA+CY PVAF+GY
Sbjct  395   FLSALGNVAFSYAGHNVVLEIQATIPSTPENPSKKAMWKGVLIAYIIVAICYLPVAFVGY  454

Query  767   LALGNQVSDNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKP  588
                GN V DNILLTL KPVWL+AAANIFVV HV+GSYQVYAM +FDM ETF V+++KFKP
Sbjct  455   WVFGNGVDDNILLTLYKPVWLVAAANIFVVFHVIGSYQVYAMPVFDMFETFAVRSMKFKP  514

Query  587   TKTLRFVTRNLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFG  408
             +  LRFV R LFVAFTLFVGI++PFFGGL+GFFGGFA APT+YY+PCI+WLIL KPK+FG
Sbjct  515   SFRLRFVVRMLFVAFTLFVGITIPFFGGLMGFFGGFALAPTSYYLPCIIWLILKKPKRFG  574

Query  407   LSWCMNWTFIVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             LSW +NW  I++G+LLT+L+PIGG+WSI+KS KTY FYQ
Sbjct  575   LSWTINWVCIIVGVLLTLLSPIGGMWSIIKSVKTYKFYQ  613



>ref|XP_009604772.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana tomentosiformis]
Length=442

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/437 (67%), Positives = 363/437 (83%), Gaps = 0/437 (0%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             + E       +  +D WLP+ S R+ KWWYSTFHNVTAMVGAG+LSLPYAMSEMGWGPGV
Sbjct  6     EKEKDTRTEEEKAIDAWLPITSDRNAKWWYSTFHNVTAMVGAGVLSLPYAMSEMGWGPGV  65

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              +M+LSWAIT YT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V++S 
Sbjct  66    TVMLLSWAITFYTIWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQIVVDVSS  125

Query  1241  CIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             CIIYMVTGG S+KK  E +C DC+PIKL+Y+I+IFS   F+ S LPNFNSIS VSL AA+
Sbjct  126   CIIYMVTGGKSLKKFHETVCPDCQPIKLTYFIIIFSSVHFVLSHLPNFNSISLVSLAAAV  185

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS++YS +AW +++ + IE   V Y  R  K +DN+FMF+SALGD+AF+YAGHNVVLEIQ
Sbjct  186   MSLTYSIVAWAASVGRGIEGREVSYELRGEKTSDNIFMFLSALGDVAFAYAGHNVVLEIQ  245

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSK  MWKGV +AY++VA+CY PVAFIGY A GN V DNILL+LEKP W+I
Sbjct  246   ATIPSTPEKPSKGPMWKGVWVAYLIVAVCYLPVAFIGYWAFGNVVEDNILLSLEKPTWVI  305

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             AAAN+FVVVHV+GSYQV+AM +FDMIET+ VK+++ KP+  LRF  R  +VA TLFVG++
Sbjct  306   AAANLFVVVHVIGSYQVFAMPVFDMIETYAVKSMRLKPSTILRFSVRTTYVALTLFVGLT  365

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
             +PFFGGL+GFFGGFA APT+YY+PCI+WLI++KPK+FG SW +NW  I++GILLT+L+PI
Sbjct  366   IPFFGGLMGFFGGFALAPTSYYLPCIIWLIIVKPKRFGFSWFINWFCIIVGILLTVLSPI  425

Query  341   GGLWSIVKSAKTYHFYQ  291
             GG+W+++K AK Y FYQ
Sbjct  426   GGMWTLIKQAKNYRFYQ  442



>ref|XP_004239501.1| PREDICTED: lysine histidine transporter 2 [Solanum lycopersicum]
Length=447

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/443 (68%), Positives = 368/443 (83%), Gaps = 2/443 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             E G  K    +    K  +D+WLP+ S R+ KWWYST HNVTAMVGAG+LSLPYAMS+MG
Sbjct  6     ENGVNKEIDTRTKEQK-SIDEWLPITSNRTAKWWYSTMHNVTAMVGAGVLSLPYAMSQMG  64

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WG G   ++LSW IT YT++QMVEMHE +PGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  65    WGAGATALVLSWVITFYTIWQMVEMHEMIPGKRFDRYHELGQCAFGDKLGLWIVVPQQLV  124

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+S CIIY+VTGG S++K  E++  + KP+KL+Y+I+ FS  QF+ S LPNFNS+S VS
Sbjct  125   VEVSTCIIYLVTGGKSLQKFQEIISPNAKPLKLTYFIIFFSSIQFLLSLLPNFNSLSSVS  184

Query  1076  LLAAIMSVSYSTIAWGSALHKW-IESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHN  900
              +AA++S++YS IAW +++ +  + +  V Y PRS K +DNVFMF+SALG++AFSYAGHN
Sbjct  185   FVAAVLSITYSFIAWIASIKEHAVGTQVVSYSPRSTKDSDNVFMFLSALGNVAFSYAGHN  244

Query  899   VVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLE  720
             VVLEIQATIPSTP+NPSKKAMWKGV+IAYV+VA+CY PVAFIGY   GN V DNILLTL 
Sbjct  245   VVLEIQATIPSTPENPSKKAMWKGVLIAYVIVAICYLPVAFIGYWVFGNGVEDNILLTLH  304

Query  719   KPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFT  540
             KPVW++AAANIFVV HV+GSYQV+AM +FDMIETF VKT+K+KP+ +LRF+ R +FVAFT
Sbjct  305   KPVWIVAAANIFVVFHVIGSYQVFAMPVFDMIETFAVKTMKYKPSFSLRFLVRMVFVAFT  364

Query  539   LFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILL  360
             LFV I+ PFFGGL+GFFGGFA APTTYY+PCI+WL L KPK+FGLSW +NW  I++GILL
Sbjct  365   LFVAITFPFFGGLMGFFGGFALAPTTYYLPCIIWLRLKKPKRFGLSWTINWVCIIVGILL  424

Query  359   TILAPIGGLWSIVKSAKTYHFYQ  291
             T+L+PIGG+WSI+KS KTYHFYQ
Sbjct  425   TVLSPIGGMWSIIKSVKTYHFYQ  447



>ref|XP_009761107.1| PREDICTED: lysine histidine transporter-like 2 [Nicotiana sylvestris]
Length=439

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/431 (69%), Positives = 357/431 (83%), Gaps = 2/431 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             K    +  +D+WLP+ S R+ KWWYST HNVTAMVGAG+LSLPYAMS+MGWG GV +M+L
Sbjct  10    KRREEEKAIDEWLPITSDRNAKWWYSTMHNVTAMVGAGVLSLPYAMSQMGWGAGVTVMLL  69

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW IT YT++QMVEMHE +PGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+S CIIYM
Sbjct  70    SWIITFYTIWQMVEMHEMIPGKRFDRYHELGQYAFGEKLGLWIVVPQQIVVEVSTCIIYM  129

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  E+L  + KPIKL+Y+ILIFS  QFI S LPNFNSIS VS +AAI+S++Y
Sbjct  130   VTGGKSLKKFQEILFPNAKPIKLTYFILIFSSFQFILSHLPNFNSISSVSFVAAILSMTY  189

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             S IAW  +L +      V YGP S K +DNVFMF+SALG++AF+YAGHNVVLEIQATIPS
Sbjct  190   SAIAWTVSLKE--SGREVSYGPTSEKTSDNVFMFLSALGNVAFAYAGHNVVLEIQATIPS  247

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             T D PSKKAMWKGV+ AY++VA+CY PVAFIGY A GN V DNILLTL  P WLIA ANI
Sbjct  248   TEDAPSKKAMWKGVLTAYIIVALCYLPVAFIGYWAFGNGVDDNILLTLHTPTWLIATANI  307

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV HV+GSYQVYAM +FDMIET+ VK+L++KP+  LR   R +FVAFTL VG+++PFFG
Sbjct  308   FVVAHVIGSYQVYAMPVFDMIETYAVKSLRYKPSTILRVCVRTVFVAFTLVVGMTIPFFG  367

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GL+GFFGGFA APT+YY+PCI+WLI+ KP++FGLSWC NW  I++G+LLT+ +PIGGLWS
Sbjct  368   GLMGFFGGFALAPTSYYLPCIIWLIIKKPRRFGLSWCTNWLCIIVGVLLTLTSPIGGLWS  427

Query  326   IVKSAKTYHFY  294
             I+KSAKTY FY
Sbjct  428   IIKSAKTYRFY  438



>ref|XP_010499181.1| PREDICTED: lysine histidine transporter 2-like [Camelina sativa]
Length=439

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/441 (68%), Positives = 363/441 (82%), Gaps = 2/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             MG+  A   KPAA +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GW
Sbjct  1     MGEMSAS-EKPAAKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGW  59

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGV +M+LSW ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +V
Sbjct  60    GPGVTLMVLSWVITLYTLWQMVEMHEIVPGKRLDRYHELGQEAFGEKLGLWIVVPQQLIV  119

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YMVTGG S+KKV +LLC DCK I+ +++I+IF+   F+ S LPNFNSIS +SL
Sbjct  120   EVGVDIVYMVTGGHSLKKVHQLLCTDCKDIRTTFWIMIFASIHFVISHLPNFNSISVISL  179

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS++YSTIAW +++HK +    VDY  R+      VF F+SALGD+AF+YAGHNVV
Sbjct  180   AAAVMSLTYSTIAWAASVHKGVHPD-VDYTARASTDAGKVFNFLSALGDVAFAYAGHNVV  238

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP+ PSK  MW+GVV+AY++VA+CY+PVAF+G+   GN V DNILLTLEKP
Sbjct  239   LEIQATIPSTPEVPSKIPMWRGVVVAYIIVAICYFPVAFVGFYIFGNSVDDNILLTLEKP  298

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
             VWL+A AN+FVVVHV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+ 
Sbjct  299   VWLVAMANLFVVVHVIGSYQIFAMPVFDMLETVLVKKMDFAPSFKLRFITRSLYVAFTMI  358

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             V I VPFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKFGLSW +NW  IV+G+LLTI
Sbjct  359   VAICVPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFGLSWTINWFCIVVGVLLTI  418

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             LAPIGGL +I+ +A TY F+ 
Sbjct  419   LAPIGGLRTIIVNASTYKFFS  439



>ref|XP_010460462.1| PREDICTED: lysine histidine transporter 2-like [Camelina sativa]
Length=441

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/442 (67%), Positives = 364/442 (82%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGA-KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +   + K AA +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNNELSASEKAAAKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +M+LSW ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTLMVLSWVITLYTLWQMVEMHEMVPGKRLDRYHELGQEAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KKV +LLC DCK I+ +++I+IF+   F+ S LPNFNSIS +S
Sbjct  121   VEVGVDIVYMVTGGHSLKKVHQLLCTDCKDIRTTFWIMIFASIHFVISHLPNFNSISVIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK ++   VDY  R+      VF F+SALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWAASVHKGVQPD-VDYTARASTDAGRVFNFLSALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GVV+AY++VA+CY+PVAF+G+   GN V DNILLTLEK
Sbjct  240   VLEIQATIPSTPEVPSKIPMWRGVVVAYIIVAICYFPVAFVGFYIFGNSVDDNILLTLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWL+A AN+FVV+HV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+
Sbjct  300   PVWLVAMANLFVVIHVIGSYQIFAMPVFDMLETVLVKKMDFTPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
              V I VPFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKFGLSW +NW  IV+G+LLT
Sbjct  360   IVAICVPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFGLSWTINWFCIVVGVLLT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ILAPIGGL +I+ +A TY F+ 
Sbjct  420   ILAPIGGLRTIIVNASTYKFFS  441



>dbj|BAK05191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/445 (68%), Positives = 359/445 (81%), Gaps = 4/445 (1%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M    ++ A       ++DDWLP+ S RS KWWYS FHNVTAMVGAG+LSLPYAMSE+GW
Sbjct  1     MAMSTSKAAPTEKELQDIDDWLPITSSRSAKWWYSAFHNVTAMVGAGVLSLPYAMSELGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGVA MILSW ITLYTL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V
Sbjct  61    GPGVAAMILSWVITLYTLWQMVEMHECVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             E+ +CI+YMVTGG S+KKV +LL  +   PI+ SY+I IF    F+ S LPNFNSI+ VS
Sbjct  121   EVGVCIVYMVTGGKSLKKVHDLLRPEHSHPIRTSYFICIFGSAHFLLSQLPNFNSITGVS  180

Query  1076  LLAAIMSVSYSTIAWGSALH---KWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAG  906
             L AA+MS+SYSTIAW ++LH   K    HAVDY   +   T   F F+SALGD+AF+YAG
Sbjct  181   LAAAVMSLSYSTIAWAASLHHAGKAGPDHAVDYSMTASTSTGRTFNFLSALGDVAFAYAG  240

Query  905   HNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLT  726
             HNVVLEIQATIPSTP+ PSKK MW+GVV+AY+VVA+CY PVAF+GY   GN V DNIL+T
Sbjct  241   HNVVLEIQATIPSTPEKPSKKPMWRGVVLAYIVVAICYLPVAFLGYYVFGNAVDDNILIT  300

Query  725   LEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVA  546
             LEKP WLIAAAN+FVVVHV+GSYQ+YAM +FDM+ETF VK L+FKP   LR + R+L+VA
Sbjct  301   LEKPRWLIAAANLFVVVHVIGSYQIYAMPVFDMLETFLVKKLRFKPGWPLRLIARSLYVA  360

Query  545   FTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGI  366
             FT+ VGI++PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP +F +SWC+NW  I+IG+
Sbjct  361   FTMLVGIAIPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIKKPARFSMSWCINWVCIIIGV  420

Query  365   LLTILAPIGGLWSIVKSAKTYHFYQ  291
             LL+ILAPIGGL SI+ + KTY F+ 
Sbjct  421   LLSILAPIGGLRSIIVNYKTYQFFS  445



>ref|NP_564217.1| lysine histidine transporter 2 [Arabidopsis thaliana]
 sp|Q9LRB5.1|LHT2_ARATH RecName: Full=Lysine histidine transporter 2; Short=AtLHT2; AltName: 
Full=Amino acid transporter-like protein 2 [Arabidopsis 
thaliana]
 gb|AAF97980.1|AC000103_30 F21J9.6 [Arabidopsis thaliana]
 dbj|BAB01766.1| amino acid transporter-like protein 2 [Arabidopsis thaliana]
 gb|AEE30526.1| lysine histidine transporter 2 [Arabidopsis thaliana]
Length=441

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/442 (66%), Positives = 366/442 (83%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGE-VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +   ++ AA K + VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNSEMSASEVAAAKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +M++SW ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTIMVMSWIITLYTLWQMVEMHEIVPGKRLDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG+S+KKV +L+C DCK I+ +++I+IF+   F+ S LPNFNSIS +S
Sbjct  121   VEVGVDIVYMVTGGASLKKVHQLVCPDCKEIRTTFWIMIFASVHFVISHLPNFNSISIIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK +    VDY PR+      VF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWAASVHKGVHPD-VDYSPRASTDVGKVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVAF+GY   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEMPSKVPMWRGVIVAYIVVAICYFPVAFLGYYIFGNSVDDNILITLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P+WLIA AN+FVV+HV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+
Sbjct  300   PIWLIAMANMFVVIHVIGSYQIFAMPVFDMLETVLVKKMNFNPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
              V I VPFFGGLLGFFGGFAFAPTTYY+PCIMWL+L KPK+FGLSW  NW  I++G+LLT
Sbjct  360   IVAICVPFFGGLLGFFGGFAFAPTTYYLPCIMWLVLKKPKRFGLSWTANWFCIIVGVLLT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ILAPIGGL +I+ +AKTY F+ 
Sbjct  420   ILAPIGGLRTIIINAKTYKFFS  441



>ref|XP_006307531.1| hypothetical protein CARUB_v10009155mg [Capsella rubella]
 gb|EOA40429.1| hypothetical protein CARUB_v10009155mg [Capsella rubella]
Length=441

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/430 (68%), Positives = 358/430 (83%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +M+LSW
Sbjct  13    AAKQKSVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVTLMVLSW  72

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWI+VPQQ +VE+ + I+YMVT
Sbjct  73    LITLYTLWQMVEMHEIVPGKRLDRYHELGQHAFGEKLGLWIIVPQQLIVEVGVDIVYMVT  132

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG+S+KKV  LLC DCK I+ +Y+I+IF+   F+ S LPNFNSIS +SL AA+MS++YST
Sbjct  133   GGASLKKVHNLLCSDCKDIRTTYWIMIFASIHFVISHLPNFNSISIISLAAAVMSLTYST  192

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW +++HK +    VDY PR+      VF F++ALGD+AF+YAGHNVVLEIQATIPSTP
Sbjct  193   IAWAASVHKGVHPD-VDYSPRASTDAGRVFNFLNALGDVAFAYAGHNVVLEIQATIPSTP  251

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GV++AY+VVA+CY+PVAF+GY   GN V DN+L+TL+KP+WLIA AN+FV
Sbjct  252   EMPSKVPMWRGVIVAYIVVAICYFPVAFLGYYIFGNSVDDNVLITLQKPIWLIAMANMFV  311

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQ++AM +FDM+ETF VK + F P+  LRF+TR+L+VAFT+ V I VPFFGGL
Sbjct  312   VVHVIGSYQIFAMPVFDMLETFLVKKMDFDPSFKLRFITRSLYVAFTMIVAICVPFFGGL  371

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTYY+PCI+WL L KPKKF LSW +NW  IV+G+LLTILAPIGGL +I+
Sbjct  372   LGFFGGFAFAPTTYYLPCIIWLTLKKPKKFSLSWTINWFCIVVGVLLTILAPIGGLRTII  431

Query  320   KSAKTYHFYQ  291
              +AKTY F+ 
Sbjct  432   VNAKTYKFFS  441



>ref|XP_002514999.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF47553.1| amino acid transporter, putative [Ricinus communis]
Length=440

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/449 (65%), Positives = 363/449 (81%), Gaps = 9/449 (2%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             M +D+ L+        +  AA +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     MAYDKPLD--------SDAAAKQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  52

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAM+ +GWGPGV ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI
Sbjct  53    YAMASLGWGPGVVILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWI  112

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VE+ + I+YMVTGG S+KK  +L+C +CK I+ +Y+I+IF+   F+ S LPNF
Sbjct  113   VVPQQLIVEVGVNIVYMVTGGKSLKKFHDLVCSNCKDIRTTYFIMIFASVHFVLSHLPNF  172

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSI+ VSL AA+MS+SYSTIAW + +HK +    VDY  ++   T  +F F+SALGD+AF
Sbjct  173   NSITIVSLAAAVMSLSYSTIAWAATVHKGVNPD-VDYSNKASTSTGKLFHFLSALGDVAF  231

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSKK MWKGV++AY++VA+CY+PVA IGY   GN V DN
Sbjct  232   AYAGHNVVLEIQATIPSTPEVPSKKPMWKGVIVAYLIVAVCYFPVALIGYWYFGNAVDDN  291

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL++LEKP WLIA ANIFVV+HV+GSYQ+YAM +FDMIET  VK L FKP   LRF+TR 
Sbjct  292   ILISLEKPAWLIATANIFVVIHVIGSYQIYAMPVFDMIETVLVKKLSFKPCFRLRFITRT  351

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             L+VAFT+F+ I +PFFGGLLGFFGGFAFAPTTYY+PCI+WL++ KPK+FGLSW +NW  I
Sbjct  352   LYVAFTMFIAICIPFFGGLLGFFGGFAFAPTTYYLPCIIWLVVRKPKRFGLSWTINWICI  411

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             V+G+LLT+LAPIGGL  I+ SAK+Y F+ 
Sbjct  412   VLGVLLTVLAPIGGLRQIIISAKSYQFFS  440



>emb|CDX84942.1| BnaC05g21130D [Brassica napus]
Length=441

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/442 (66%), Positives = 365/442 (83%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYK-AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ + +E    AA + +VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNNETSESETAAAKQKKVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI+VPQQ +
Sbjct  61    WGPGVTLMIMSWVITLYTLWQMVEMHEIVPGKRFDRYHELGQEAFGEKLGLWIIVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S++KV ELLC DCK IK +Y+I+IF+   F+ S LPNFNS+S +S
Sbjct  121   VEVGVDIVYMVTGGKSLQKVHELLCSDCKDIKTTYWIMIFASIHFVISHLPNFNSMSVIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK +    VDY  R+     NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWTASVHKGVRPD-VDYSSRASTSAGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  M +GVV+AY++VA+CY+PVAF+GY   GN V DN+L+TLEK
Sbjct  240   VLEIQATIPSTPEVPSKVPMLRGVVVAYIIVAICYFPVAFLGYWIFGNSVDDNVLMTLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVVVHV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+
Sbjct  300   PVWLIAMANLFVVVHVIGSYQIFAMPVFDMLETVLVKKMNFDPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             F+ I +PFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKF LSW +NW  I++G++LT
Sbjct  360   FIAICIPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFSLSWIINWFCIIVGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ++APIGGL +I+ +A TY F+ 
Sbjct  420   VMAPIGGLRTIIVNASTYKFFS  441



>ref|NP_001149518.1| AATL2 [Zea mays]
 gb|ACG35694.1| AATL2 [Zea mays]
 gb|ACN32104.1| unknown [Zea mays]
 tpg|DAA35840.1| TPA: AATL2 [Zea mays]
Length=438

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/428 (69%), Positives = 350/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV  M+LSW I
Sbjct  12    KEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVVAMVLSWVI  71

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VEI +CI+YMVTGG
Sbjct  72    TLYTLWQMVEMHECVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLIVEIGVCIVYMVTGG  131

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S +K   + C DCKP++ S +I++F+    + S LPNFNSI+ VSL AA+MS++YSTIA
Sbjct  132   KSFEKCYTVACPDCKPLRTSSWIMVFAAIHLLLSQLPNFNSITLVSLAAAVMSLTYSTIA  191

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++ HK   S AVDY  ++   T   F F+SALGD+AF+YAGHNVVLEIQATIPSTPD 
Sbjct  192   WAASAHKGRHS-AVDYSMKASTTTGQTFNFLSALGDVAFAYAGHNVVLEIQATIPSTPDK  250

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MW+GVV+AY+VVA+CY PVAF+GY   GN V DNIL+TLEKP WLIAAANIFVVV
Sbjct  251   PSKKPMWQGVVLAYLVVAICYLPVAFVGYYVFGNAVDDNILITLEKPRWLIAAANIFVVV  310

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDM+ETF VK L+FKP   LR + R+L+V  T  VGI+VPFFGGLLG
Sbjct  311   HVIGSYQIYAMPVFDMLETFLVKKLRFKPGMPLRLIARSLYVVLTALVGIAVPFFGGLLG  370

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTYY+PCI+WL + KPKKF LSW +NW  I++G+LLT+LAPIGGL SIV +
Sbjct  371   FFGGFAFAPTTYYLPCILWLKIKKPKKFSLSWFINWFCIIVGVLLTVLAPIGGLRSIVVN  430

Query  314   AKTYHFYQ  291
             A TY F+ 
Sbjct  431   ASTYKFFS  438



>ref|XP_009113791.1| PREDICTED: lysine histidine transporter 2-like [Brassica rapa]
Length=441

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/442 (66%), Positives = 365/442 (83%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANK-GEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +   ++ AA K  +VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNNETSASETAAAKQKKVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI+VPQQ +
Sbjct  61    WGPGVTLMIMSWVITLYTLWQMVEMHEIVPGKRFDRYHELGQEAFGEKLGLWIIVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S++KV ELLC DCK IK +Y+I+IF+   F+ S LPNFNS+S +S
Sbjct  121   VEVGVDIVYMVTGGKSLQKVHELLCSDCKDIKTTYWIMIFASIHFVISHLPNFNSMSVIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK +    VDY  R+     NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWTASVHKGVRPD-VDYSSRASTSAGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  M++GVV+AY++VA+CY+PVAF+GY   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEVPSKVPMFRGVVVAYIIVAICYFPVAFLGYWIFGNSVDDNILMTLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVV+HV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+
Sbjct  300   PVWLIAMANLFVVIHVIGSYQIFAMPVFDMLETVLVKKMNFDPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
              + I +PFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKF LSW +NW  I+IG++LT
Sbjct  360   SIAICIPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFSLSWIINWFCIIIGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ++APIGGL +I+ +A TY F+ 
Sbjct  420   VMAPIGGLRTIIVNASTYEFFS  441



>ref|XP_004310190.1| PREDICTED: lysine histidine transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/429 (68%), Positives = 354/429 (83%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYA+SE+GWGPG+A++ILSW 
Sbjct  12    ARQKEIDDWLPITSARNAKWWYSAFHNVTAMVGAGVLSLPYAISELGWGPGIAILILSWI  71

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFGPKLGLWIVVPQQ +VE+ +CI+YMVTG
Sbjct  72    ITLYTLWQMVEMHEMVPGKRFDRYHELGQQAFGPKLGLWIVVPQQVIVEVGVCIVYMVTG  131

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KKV  +LC  CK IK SY+I+IF+   F+ S LPNFNS+S +SL AAIMS+SYSTI
Sbjct  132   GKSLKKVHNVLCPSCKDIKTSYWIMIFASSHFVLSHLPNFNSMSGISLAAAIMSLSYSTI  191

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW +AL+K +  + VDY  ++  K   VF F S LGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  192   AWATALNKGVVPN-VDYSYKATTKAGTVFNFFSGLGDIAFAYAGHNVVLEIQATIPSTPE  250

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV+AY+VVA+CY+PVA +GY   GN V DNIL++LEKP WLIAAAN+FVV
Sbjct  251   KPSKGPMWKGVVVAYIVVALCYFPVAIVGYYVYGNTVEDNILISLEKPAWLIAAANLFVV  310

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             VHV+GSYQV+AM +FDM+ETF V  +KF+P+  LRFVTR  +VA T+F+GI++PFFGGLL
Sbjct  311   VHVIGSYQVFAMGVFDMLETFLVLKMKFRPSFLLRFVTRTTYVAITMFIGIAIPFFGGLL  370

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KPK F LSWC NW  I++G+ L +LAPIG L  I+ 
Sbjct  371   GFFGGFAFAPTTYFLPCIMWLAIYKPKIFSLSWCTNWFCIIVGVTLMLLAPIGALRGIIL  430

Query  317   SAKTYHFYQ  291
              AKTY F+ 
Sbjct  431   QAKTYKFFS  439



>ref|XP_007222282.1| hypothetical protein PRUPE_ppa005886mg [Prunus persica]
 gb|EMJ23481.1| hypothetical protein PRUPE_ppa005886mg [Prunus persica]
Length=439

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/430 (67%), Positives = 358/430 (83%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA + ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+MILSW
Sbjct  11    AARQKQIDDWLPITSARNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAIMILSW  70

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  71    IITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVEVGVNIVYMVT  130

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S++K  +++C  CK I+ SY+I+IF+   F+ S LPNFN+IS +SL AA+MS+SYST
Sbjct  131   GGKSLEKFHDVICPSCKTIRTSYWIMIFASSHFVLSHLPNFNAISGISLAAAVMSLSYST  190

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAWG+ALHK +E + VDY  ++   +  VF F S LGD+AF+YAGHNVVLEIQATIPSTP
Sbjct  191   IAWGAALHKGVEPN-VDYSYKAKTNSGAVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTP  249

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MWKGV++AY+VVA+CY+PV+F+GY   GN++ DNIL++L+KPVWLIA AN+FV
Sbjct  250   EKPSKGPMWKGVIVAYIVVALCYFPVSFVGYWVYGNKIEDNILISLDKPVWLIATANMFV  309

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQV+AM +FDM+ETF VK + F P+  LRFVTR  +VAFT+ VGI++PFF GL
Sbjct  310   VVHVIGSYQVFAMGVFDMVETFLVKKMNFTPSFALRFVTRTTYVAFTMIVGIAIPFFSGL  369

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTY++PCIMWL + KPK+F LSWCMNW  I++G+ L ILAPIG L +I+
Sbjct  370   LGFFGGFAFAPTTYFLPCIMWLSIYKPKRFSLSWCMNWLCILLGLTLMILAPIGALRNII  429

Query  320   KSAKTYHFYQ  291
               AKTY F+ 
Sbjct  430   LQAKTYKFFS  439



>emb|CDY27596.1| BnaA09g28110D [Brassica napus]
Length=441

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/442 (65%), Positives = 365/442 (83%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANK-GEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +   ++ AA K  +VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNNETSASETAAAKQKKVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI+VPQQ +
Sbjct  61    WGPGVTLMIMSWVITLYTLWQMVEMHEIVPGKRFDRYHELGQEAFGEKLGLWIIVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S++KV ELLC DCK IK +Y+I+IF+   F+ S LPNFNS+S +S
Sbjct  121   VEVGVDIVYMVTGGKSLQKVHELLCSDCKDIKTTYWIMIFASIHFVISHLPNFNSMSVIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK +    VDY  R+     NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWTASVHKGVRPD-VDYSSRASTSAGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  M++GVV+AY++VA+CY+PVAF+GY   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEVPSKVPMFRGVVVAYIIVAICYFPVAFLGYWIFGNSVDDNILMTLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVV+HV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+
Sbjct  300   PVWLIAMANLFVVIHVIGSYQIFAMPVFDMLETVLVKKMNFDPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
              + I +PFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKF LSW +NW  I++G++LT
Sbjct  360   SIAICIPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFSLSWIINWFCIILGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ++APIGGL +I+ +A TY F+ 
Sbjct  420   VMAPIGGLRTIIVNASTYKFFS  441



>ref|XP_008222041.1| PREDICTED: lysine histidine transporter 2-like [Prunus mume]
Length=439

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/430 (67%), Positives = 357/430 (83%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA + ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+MILSW
Sbjct  11    AARQKQIDDWLPITSARNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAIMILSW  70

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  71    IITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVEVGVNIVYMVT  130

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S++K  +++C  CK I+ SY+I+IF+   F+ S LPNFN+IS +SL AA+MS+SYST
Sbjct  131   GGKSLEKFHDVICPSCKTIRTSYWIMIFASSHFVLSHLPNFNAISGISLAAAVMSLSYST  190

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAWG+ALHK +E + VDY  ++   +  VF F S LGD+AF+YAGHNVVLEIQATIPSTP
Sbjct  191   IAWGAALHKGVEPN-VDYSYKAKTNSGAVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTP  249

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MWKGV++AY+VVA+CY+PV F+GY   GN++ DNIL++L+KPVWLIA AN+FV
Sbjct  250   EKPSKGPMWKGVIVAYIVVALCYFPVCFVGYWVYGNKIEDNILISLDKPVWLIATANMFV  309

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQV+AM +FDMIETF VK + F P+  LRFVTR  +VAFT+ +GI++PFF GL
Sbjct  310   VVHVIGSYQVFAMGVFDMIETFLVKKMNFTPSFALRFVTRTTYVAFTMIIGIAIPFFSGL  369

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTY++PC+MWL + KPK+F LSWCMNW  I++G+ L ILAPIG L +I+
Sbjct  370   LGFFGGFAFAPTTYFLPCVMWLSIYKPKRFSLSWCMNWLCIILGVTLMILAPIGALRNII  429

Query  320   KSAKTYHFYQ  291
               AKTY F+ 
Sbjct  430   LQAKTYKFFS  439



>ref|XP_006438111.1| hypothetical protein CICLE_v10033376mg [Citrus clementina]
 gb|ESR51351.1| hypothetical protein CICLE_v10033376mg [Citrus clementina]
Length=434

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/432 (68%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPG+A++I+
Sbjct  4     EEEARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSHLGWGPGIAVLII  63

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+S  IIYM
Sbjct  64    SWVVTLYTLWQMVEMHEMVPGKRFDRYHELGQGAFGDKLGLWIVVPQQVIVEVSTNIIYM  123

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S KK  E++C  CK IK SY+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  124   VTGGKSFKKAHEVICPSCKEIKTSYWIMIFAAIHFVLSHLPNFNSISVVSLAAAVMSLSY  183

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW   L K +E   VDY   +   TD +F F +ALGD+AF+YAGHNVVLEIQATIPS
Sbjct  184   STIAWVVPLEKGVEPD-VDYSYNAKSTTDAMFNFFTALGDVAFAYAGHNVVLEIQATIPS  242

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MWKGVV+AY++VA+CY+PVA +GY   GN V DNILLTLEKP+W++AAAN+
Sbjct  243   TPEKPSKGPMWKGVVVAYIIVAICYFPVALVGYYIFGNTVEDNILLTLEKPIWIVAAANL  302

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVVVHV+GSYQ++AM +FDMIETF VK LKF P+  LR VTR+L+VAFT+ V ISVPFFG
Sbjct  303   FVVVHVIGSYQIFAMPVFDMIETFLVKQLKFTPSFMLRLVTRSLYVAFTMIVAISVPFFG  362

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
              L+GFFGGFA APT+YY+PCIMWL + KP++F LSW  NW  IV+G+LL ILAPIGGL S
Sbjct  363   SLMGFFGGFALAPTSYYLPCIMWLCIYKPRRFSLSWFANWFCIVLGVLLMILAPIGGLRS  422

Query  326   IVKSAKTYHFYQ  291
             I+ SAK Y F+ 
Sbjct  423   IIMSAKNYEFFS  434



>ref|XP_002870677.1| hypothetical protein ARALYDRAFT_916150 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46936.1| hypothetical protein ARALYDRAFT_916150 [Arabidopsis lyrata subsp. 
lyrata]
Length=445

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/439 (66%), Positives = 353/439 (80%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D   +  K AA + E+D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  8     DDHQDDEKLAARQKEIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  67

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  68    GIAVLVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  127

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  128   GVCIVYMVTGGKSLKKFHELVCEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  187

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW S+  K ++   V YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  188   AVMSLSYSTIAWASSASKGVQED-VQYGYKAKTTAGTVFNFFSGLGDVAFAYAGHNVVLE  246

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP W
Sbjct  247   IQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNGVEDNILMSLKKPAW  306

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT TLRF  RN +VA T+FVG
Sbjct  307   LIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTTLRFFVRNFYVAATMFVG  366

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PCI+WL + KPKKFGLSW  NW  IV G+ L +L+
Sbjct  367   MTFPFFGGLLAFFGGFAFAPTTYFLPCIIWLAIYKPKKFGLSWWANWVCIVFGLFLMVLS  426

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +IV  AK Y FY 
Sbjct  427   PIGGLRTIVIQAKGYKFYS  445



>ref|XP_006484040.1| PREDICTED: lysine histidine transporter 2-like [Citrus sinensis]
Length=440

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/432 (68%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPG+A++I+
Sbjct  10    EEEARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSHLGWGPGIAVLII  69

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+S  IIYM
Sbjct  70    SWVVTLYTLWQMVEMHEMVPGKRFDRYHELGQGAFGDKLGLWIVVPQQVIVEVSTNIIYM  129

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S KK  E++C  CK IK SY+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  130   VTGGKSFKKAHEVICPSCKEIKTSYWIMIFAAIHFVLSHLPNFNSISVVSLAAAVMSLSY  189

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW   L K +E   VDY   +   TD +F F +ALGD+AF+YAGHNVVLEIQATIPS
Sbjct  190   STIAWVVPLEKGVEPD-VDYSYNAKSTTDAMFNFFTALGDVAFAYAGHNVVLEIQATIPS  248

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MWKGVV+AY++VA+CY+PVA +GY   GN V DNILLTLEKP+W++AAAN+
Sbjct  249   TPEKPSKGPMWKGVVVAYIIVAICYFPVALVGYYIFGNTVEDNILLTLEKPIWIVAAANL  308

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVVVHV+GSYQ++AM +FDMIETF VK LKF P+  LR VTR+L+VAFT+ V ISVPFFG
Sbjct  309   FVVVHVIGSYQIFAMPVFDMIETFLVKQLKFTPSFMLRLVTRSLYVAFTMIVAISVPFFG  368

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
              L+GFFGGFA APT+YY+PCIMWL + KP++F LSW  NW  IV+G+LL ILAPIGGL S
Sbjct  369   SLMGFFGGFALAPTSYYLPCIMWLCIYKPRRFSLSWFANWFCIVLGVLLMILAPIGGLRS  428

Query  326   IVKSAKTYHFYQ  291
             I+ SAK Y F+ 
Sbjct  429   IIMSAKNYEFFS  440



>ref|XP_004973098.1| PREDICTED: lysine histidine transporter 1-like [Setaria italica]
Length=446

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/447 (67%), Positives = 356/447 (80%), Gaps = 7/447 (2%)
 Frame = -1

Query  1613  MGDYKAEGAKPA-----ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAM  1449
             MG    E   PA     A +  ++DWLP+   R+ KWWYS FHNVTAMVGAG+L LPYAM
Sbjct  1     MGTQAPESYSPAKDGKTAQEKAIEDWLPINGSRNAKWWYSAFHNVTAMVGAGVLGLPYAM  60

Query  1448  SEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVP  1269
             SE+GWGPG+A+MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVP
Sbjct  61    SELGWGPGIAVMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGEKLGLWIVVP  120

Query  1268  QQALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNS  1092
             QQ +VE+SL IIYMVTGG S+KK  +++C   CK IKLSY+I+IF+   F+ S LPNFNS
Sbjct  121   QQLVVEVSLNIIYMVTGGQSLKKFHDVICDGKCKDIKLSYFIMIFASVHFVLSQLPNFNS  180

Query  1091  ISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSY  912
             IS VSL AAIMS+SYSTIAWG++L K  E++ VDYG R+      VF  +  LGD+AF+Y
Sbjct  181   ISAVSLAAAIMSISYSTIAWGASLDKGREAN-VDYGLRATTTPGKVFGILGGLGDVAFAY  239

Query  911   AGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNIL  732
             +GHNVVLEIQATIPSTP+ PSK AMWKG ++AY++VAMCY+PV F+GY A GN V DNIL
Sbjct  240   SGHNVVLEIQATIPSTPEKPSKHAMWKGALVAYIIVAMCYFPVTFVGYWAFGNSVDDNIL  299

Query  731   LTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLF  552
             +TL KP WLIAAAN+FVVVHV+GSYQVYAM +FDM+E+  VK L+F P+  LR V+R  +
Sbjct  300   ITLNKPKWLIAAANMFVVVHVIGSYQVYAMPVFDMMESVLVKKLRFAPSLRLRLVSRTFY  359

Query  551   VAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVI  372
             VAFT+F+GIS PFFGGLL FFGG AFAPTTY++PCIMWL + KPK+FGLSW  NW  IVI
Sbjct  360   VAFTMFIGISFPFFGGLLSFFGGLAFAPTTYFLPCIMWLAVYKPKRFGLSWFTNWICIVI  419

Query  371   GILLTILAPIGGLWSIVKSAKTYHFYQ  291
             G+LL +L+PIGGL  I+ +AKTY FYQ
Sbjct  420   GVLLLVLSPIGGLRQIILTAKTYKFYQ  446



>ref|XP_011086736.1| PREDICTED: lysine histidine transporter 1-like [Sesamum indicum]
Length=440

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/441 (67%), Positives = 362/441 (82%), Gaps = 1/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             MG  + +  + +A +  +DDWLP+ S R+ KWWYSTFHNVTAMVGAG+LSLPYAMS MGW
Sbjct  1     MGTDEPKKHEKSAEEKAIDDWLPITSSRTAKWWYSTFHNVTAMVGAGVLSLPYAMSSMGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGV +MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +V
Sbjct  61    GPGVTLMILSWLITLYTLWQMVEMHEIVPGKRFDRYHELGQHAFGEKLGLYIVVPQQVVV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+S CIIYMVTGG S+KK  + +C DC  IKL+Y+ILIF+   F+ S LPNFNSIS +SL
Sbjct  121   EVSTCIIYMVTGGKSLKKFHQTVCPDCSDIKLTYFILIFASVHFVLSHLPNFNSISIISL  180

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS++YSTIAW +A+ + ++   VDY  R     +NVF F +ALG++AF+YAGHNVV
Sbjct  181   AAAVMSLTYSTIAWTAAIARGVQKD-VDYSLRGKNAGENVFNFCNALGEIAFAYAGHNVV  239

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP  PSKK MWKGV+ AY+VVA+CY+PVAF GY   GN V DNILLTLEKP
Sbjct  240   LEIQATIPSTPIKPSKKPMWKGVIFAYIVVAICYFPVAFAGYYIYGNSVDDNILLTLEKP  299

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
              WLIAAANIFV++HV+GSYQ+YAM +FDM+ET+ VK +K KP+ TLRFVTR +FVAFT+F
Sbjct  300   AWLIAAANIFVLIHVIGSYQIYAMPVFDMMETYLVKQVKLKPSFTLRFVTRTIFVAFTMF  359

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             +G++ PFFG L+GFFGGFA APTTY++PCI+WLI++KPKKF  SW +NW FI+ G++L +
Sbjct  360   IGMTFPFFGALVGFFGGFALAPTTYFLPCIIWLIVVKPKKFSFSWFLNWIFIIFGVILML  419

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             LAPIGGL +IV SA+ Y FYQ
Sbjct  420   LAPIGGLRTIVASAQNYKFYQ  440



>ref|XP_003575989.2| PREDICTED: lysine histidine transporter 2-like [Brachypodium 
distachyon]
Length=440

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/436 (67%), Positives = 351/436 (81%), Gaps = 4/436 (1%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             K    + ++DDWLP+ S R  KWWYS FHNVTA+VGAG+LSLPYAMSE+GWGPGVA MIL
Sbjct  5     KEQKEQQDIDDWLPITSSRKAKWWYSAFHNVTALVGAGVLSLPYAMSELGWGPGVAAMIL  64

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +CI+YM
Sbjct  65    SWVITLYTLWQMVEMHECVPGKRFDRYHELGQHAFGQKLGLWIVVPQQLIVEVGVCIVYM  124

Query  1226  VTGGSSIKKVVELLC-HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVS  1050
             VTGG S+KK  +++   D  PI+ SY+I+IF     + S LPNFNSI+ VSL AA+MS+S
Sbjct  125   VTGGKSLKKFHDVVAPADAAPIRTSYFIVIFGSAHLLLSQLPNFNSITVVSLAAAVMSLS  184

Query  1049  YSTIAWGSALHKWIE---SHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             YSTIAW ++L        SH VDY   +       F F+SALGD+AF+YAGHNVVLEIQA
Sbjct  185   YSTIAWVASLEHRRHGGSSHVVDYSMTASTSAGRTFNFLSALGDVAFAYAGHNVVLEIQA  244

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP  PSKK MW GV++AY+VVA+CY PVAF+GY   GN V DNIL+TLEKP WLIA
Sbjct  245   TIPSTPGKPSKKPMWLGVMVAYLVVAVCYLPVAFVGYYVFGNAVDDNILITLEKPRWLIA  304

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
             AAN+FVVVHV+GSYQ+YAM +FDM+ETF VK L+F P   LR + R+L+V FT+ VGI++
Sbjct  305   AANMFVVVHVIGSYQIYAMPVFDMLETFLVKKLRFHPGWPLRLIARSLYVVFTMIVGIAI  364

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFGGLLGFFGGFAFAPTTY++PCIMWLI+MKPKKFG SWC NW  I+IG+LL++LAPIG
Sbjct  365   PFFGGLLGFFGGFAFAPTTYFLPCIMWLIIMKPKKFGFSWCTNWICIIIGVLLSLLAPIG  424

Query  338   GLWSIVKSAKTYHFYQ  291
             GL SI+ +AKTY F+ 
Sbjct  425   GLRSIIINAKTYKFFS  440



>ref|XP_004305932.1| PREDICTED: lysine histidine transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=444

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/443 (66%), Positives = 362/443 (82%), Gaps = 2/443 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             E  + +A+  +    + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP+AMS +G
Sbjct  3     EQPEKQAKIDEKLQRQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPFAMSNLG  62

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPG+ ++ILSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  63    WGPGIVILILSWVITLFTLWQMVEMHEIVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  122

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKP-IKLSYYILIFSVGQFIASFLPNFNSISFV  1080
              E+ + I+YMVTGG S++KV +++  D K  IKLSY+I+IF+   F+ + LPNFNSIS V
Sbjct  123   CEVGVDIVYMVTGGKSLQKVHKIVRKDEKDSIKLSYFIMIFASAHFVLAHLPNFNSISGV  182

Query  1079  SLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHN  900
             SL AA+MS+SYSTIAW +++HK +++  VDYG  +H  +  VF F SALGD+AF+YAGHN
Sbjct  183   SLAAAVMSLSYSTIAWTASVHKGVQAD-VDYGYLAHSTSGTVFNFFSALGDVAFAYAGHN  241

Query  899   VVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLE  720
             VVLEIQATIPSTP NPSKK MW+GVV+AY+VVA+CY+PVA IGY   GN+V DNIL++LE
Sbjct  242   VVLEIQATIPSTPGNPSKKPMWRGVVMAYIVVALCYFPVALIGYYTFGNKVEDNILISLE  301

Query  719   KPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFT  540
             KP WLI  AN+FVVVHV+GSYQ+YAM +FDMIET  VK L F+PT TLRF++RNL+VAFT
Sbjct  302   KPEWLIIMANMFVVVHVIGSYQLYAMPVFDMIETVLVKKLNFRPTTTLRFISRNLYVAFT  361

Query  539   LFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILL  360
             +FVGI+ PFFGGLLGFFGGFAF+PTTY++PCIMWL + KP+KF LSW +NW  I +G++L
Sbjct  362   MFVGITFPFFGGLLGFFGGFAFSPTTYFLPCIMWLAIKKPRKFSLSWIVNWICITLGLML  421

Query  359   TILAPIGGLWSIVKSAKTYHFYQ  291
              IL+PIGGL SI+  AK Y FY 
Sbjct  422   MILSPIGGLRSIIIQAKNYKFYN  444



>ref|XP_010029034.1| PREDICTED: lysine histidine transporter 1-like [Eucalyptus grandis]
 gb|KCW55865.1| hypothetical protein EUGRSUZ_I01671 [Eucalyptus grandis]
Length=449

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/439 (66%), Positives = 357/439 (81%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D ++   +    +  +D+WLP+ S R+ KWWYSTFHNVTAMVGAG+L LPYAM+E+GWGP
Sbjct  12    DRQSSVEEKLEKQKAIDEWLPITSSRNAKWWYSTFHNVTAMVGAGVLGLPYAMAELGWGP  71

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+
Sbjct  72    GVAVMVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEV  131

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  + +C  CKP+K +Y+I+IFS   F+ S LPNFNSI+ VSL A
Sbjct  132   GVNIVYMVTGGQSLKKFHDTVCPSCKPLKTTYFIMIFSSVHFVLSHLPNFNSIAGVSLAA  191

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW ++L+K ++S  V YG  +      VF F +ALGD+AF+YAGHNVVLE
Sbjct  192   AVMSLSYSTIAWAASLNKGVQSD-VQYGYAAKSTPGTVFNFFAALGDVAFAYAGHNVVLE  250

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY++VA+CY+PVA IGY   GN V+DNILL+LEKP W
Sbjct  251   IQATIPSTPEKPSKGPMWRGVIVAYIIVALCYFPVALIGYWVFGNSVADNILLSLEKPAW  310

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L FKPT+TLRFVTRN++VAFT+FVG
Sbjct  311   LIAMANMFVVIHVIGSYQIYAMPVFDMIETALVKKLHFKPTRTLRFVTRNIYVAFTMFVG  370

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I+ PFF GLL FFGGFAFAPTTY++PCIMWL + KP+++ LSW  NW  IVIG+LL I+A
Sbjct  371   ITFPFFSGLLSFFGGFAFAPTTYFLPCIMWLAIYKPRRYSLSWWTNWICIVIGVLLMIVA  430

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL  I+  AKTY FY 
Sbjct  431   PIGGLRLIIIKAKTYKFYS  449



>ref|XP_011045191.1| PREDICTED: lysine histidine transporter 1 [Populus euphratica]
Length=449

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/442 (67%), Positives = 359/442 (81%), Gaps = 1/442 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             + G  + E  +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+G
Sbjct  9     DHGYTQKEDDEQVARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELG  68

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGVA++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +
Sbjct  69    WGPGVAVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLI  128

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VEI +CI+YMVTGG S+KK  +++C  CKPIK +Y+I+IF+   F+ S LPNFNSIS VS
Sbjct  129   VEIGVCIVYMVTGGKSLKKFHDIVCSTCKPIKQTYFIMIFASVHFVLSHLPNFNSISGVS  188

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++ K ++   V YG ++  K   VF F SALGD+AF+YAGHNV
Sbjct  189   LAAAVMSLSYSTIAWSASVDKGVQPD-VQYGYKASSKAGTVFNFFSALGDVAFAYAGHNV  247

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN VSDNIL+TLEK
Sbjct  248   VLEIQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALIGYWMYGNSVSDNILITLEK  307

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVVVHV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN++VAFT+
Sbjct  308   PVWLIAMANMFVVVHVIGSYQIYAMPVFDMMETVLVKKLNFRPTMILRFFVRNIYVAFTM  367

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPKKFGLSW  NW  IV G++L 
Sbjct  368   FVGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKKFGLSWWTNWICIVFGVILM  427

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             +++PIGG+  I+  AK Y FY 
Sbjct  428   VVSPIGGMRQIIIQAKDYKFYN  449



>ref|XP_010478023.1| PREDICTED: lysine histidine transporter 2 [Camelina sativa]
Length=439

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/441 (68%), Positives = 364/441 (83%), Gaps = 2/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             MG+  A   K AA +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GW
Sbjct  1     MGELSAS-EKAAAKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGW  59

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGV +M+LSW ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +V
Sbjct  60    GPGVTLMVLSWVITLYTLWQMVEMHEMVPGKRLDRYHELGQEAFGEKLGLWIVVPQQLIV  119

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YMVTGG S+KKV +LLC DCK I+ +++I+IF+   F+ S LPNFNSIS +SL
Sbjct  120   EVGVDIVYMVTGGHSLKKVHQLLCTDCKEIRTTFWIMIFASVHFVISHLPNFNSISVISL  179

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS++YSTIAW +++HK ++   VDY PR+      VF F+SALGD+AF+YAGHNVV
Sbjct  180   AAAVMSLTYSTIAWAASVHKGVQPD-VDYTPRASTDAGRVFNFLSALGDVAFAYAGHNVV  238

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAFIG+   GN V DNILLTLEKP
Sbjct  239   LEIQATIPSTPEVPSKIPMWRGVVVAYIVVAICYFPVAFIGFYIFGNSVDDNILLTLEKP  298

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
             VWL+A AN+FVV+HV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+ 
Sbjct  299   VWLVAMANLFVVIHVIGSYQIFAMPVFDMLETVLVKKMDFTPSFKLRFITRSLYVAFTMI  358

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             V I VPFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKFGLSW +NW  IV+G+LLTI
Sbjct  359   VAICVPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFGLSWTINWFCIVVGVLLTI  418

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             LAPIGGL +I+ +A TY F+ 
Sbjct  419   LAPIGGLRTIIVNASTYKFFS  439



>ref|XP_010436013.1| PREDICTED: lysine histidine transporter 1-like [Camelina sativa]
Length=444

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/429 (66%), Positives = 350/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+A+++LSW 
Sbjct  17    ARQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGIAVLVLSWI  76

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I+VPQQ +VEI +C++YMVTG
Sbjct  77    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIIVPQQLIVEIGVCVVYMVTG  136

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  137   GKSLKKFHELVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  196

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V YG ++      VF F S LGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  197   AWGASVSKGVQED-VQYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTPE  255

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLIA ANIFVV
Sbjct  256   KPSKGPMWKGVIVAYIVVALCYFPVALVGYYIFGNGVEDNILMSLKKPAWLIATANIFVV  315

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+FVG++ PFFGGLL
Sbjct  316   IHVIGSYQIYAMPVFDMMETLLVKKLNFRPTIALRFCVRNFYVAATMFVGMTFPFFGGLL  375

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY+IPC++WL + KPKK+ LSWC NW  I+ G+ L IL+PIGGL +IV 
Sbjct  376   AFFGGFAFAPTTYFIPCVIWLAIYKPKKYSLSWCANWVCIMFGLCLMILSPIGGLRTIVI  435

Query  317   SAKTYHFYQ  291
              AK Y FY 
Sbjct  436   QAKDYKFYS  444



>ref|XP_002443126.1| hypothetical protein SORBIDRAFT_08g009800 [Sorghum bicolor]
 gb|EES16964.1| hypothetical protein SORBIDRAFT_08g009800 [Sorghum bicolor]
Length=438

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/428 (68%), Positives = 347/428 (81%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV  M+LSW I
Sbjct  12    EEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVVAMLLSWVI  71

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +CI+YMVTGG
Sbjct  72    TLYTLWQMVEMHECVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLIVEVGVCIVYMVTGG  131

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S +K   + C DCKP+  S +I+IF+    + S LPNFNSI+ VSL AA+MS+SYSTIA
Sbjct  132   KSFEKCYAVSCPDCKPLNTSSWIMIFAAIHLLLSQLPNFNSITLVSLAAAVMSLSYSTIA  191

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++ HK   + AVDY  ++   T   F F+SALGD+AF+YAGHNVVLEIQATIPSTPD 
Sbjct  192   WAASAHKGRHA-AVDYSMKASTATGQTFNFLSALGDVAFAYAGHNVVLEIQATIPSTPDK  250

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MW+GVV+AY+VVA+CY PVAF+GY   GN V DNIL+TLEKP WLIA ANIFVVV
Sbjct  251   PSKKPMWQGVVLAYIVVAICYLPVAFVGYYVFGNAVDDNILITLEKPRWLIAMANIFVVV  310

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDM+ETF VK L+F+P   LR + R+L+V FT  VGI+VPFFGGLLG
Sbjct  311   HVIGSYQIYAMPVFDMLETFLVKKLRFRPGLPLRLIARSLYVVFTALVGIAVPFFGGLLG  370

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTYY+PCI+WL + KPK F LSW +NW  I++G+LLT+ APIGGL SI+ +
Sbjct  371   FFGGFAFAPTTYYLPCILWLKIKKPKTFSLSWFINWFCIIVGVLLTVFAPIGGLRSIIVN  430

Query  314   AKTYHFYQ  291
             A TY F+ 
Sbjct  431   ASTYKFFS  438



>ref|XP_009359311.1| PREDICTED: lysine histidine transporter 2 isoform X1 [Pyrus x 
bretschneideri]
Length=440

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 357/435 (82%), Gaps = 1/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             E  +    + ++DDWLPV S R+ KWWYS FHNVTAMVGAG+LSLPYAM+E+GWGPG+A+
Sbjct  7     EAEEARQKQKQIDDWLPVTSARNAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWGPGIAV  66

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+ + I
Sbjct  67    MLLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQLIVEVGVNI  126

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG S+KKV +++C  CK IKL+ +ILIF+   F+ S LPN NS+S +SL AA+MS
Sbjct  127   VYMVTGGKSLKKVHDVICPSCKDIKLTLWILIFASAHFVLSHLPNLNSVSGISLAAAVMS  186

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAWG+A+HK  +   VDY  ++      VF F S LGD+AF+YAGHNVVLEIQAT
Sbjct  187   LSYSTIAWGAAIHKG-KVPNVDYSYKAKSNVGAVFNFFSGLGDIAFAYAGHNVVLEIQAT  245

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSK  MWKGV++AY+VVA+CY+PV F+GY   GN V DNIL++LEKPVWLIAA
Sbjct  246   IPSTPEKPSKGPMWKGVIVAYIVVALCYFPVCFVGYYMYGNSVEDNILISLEKPVWLIAA  305

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+GSYQV+AM +FDM+ETF VK + F P+ TLRF+TR ++VA T+ +G+++P
Sbjct  306   ANMFVVIHVIGSYQVFAMGVFDMVETFLVKKMNFPPSFTLRFITRTIYVAITMVIGMAIP  365

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSWC+NWT I++G+ L ILAPIG 
Sbjct  366   FFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWCINWTCIILGVTLMILAPIGA  425

Query  335   LWSIVKSAKTYHFYQ  291
             L SI+  +KTY F+ 
Sbjct  426   LRSIILQSKTYTFFS  440



>ref|XP_002298597.2| lysine and histidine specific transporter family protein [Populus 
trichocarpa]
 gb|EEE83402.2| lysine and histidine specific transporter family protein [Populus 
trichocarpa]
Length=448

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/449 (66%), Positives = 359/449 (80%), Gaps = 1/449 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             MG +       Y  +     A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     MGVETTNNDHGYTQKEDDEVARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  60

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAMSE+GWGPGVA++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I
Sbjct  61    YAMSELGWGPGVAVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYI  120

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VE+ +CI+YMVTGG S+KK  +++C  CKPIK +Y+I+IF+   F+ S LPNF
Sbjct  121   VVPQQLIVEVGVCIVYMVTGGKSLKKFHDIVCSTCKPIKQTYFIMIFASVHFVLSHLPNF  180

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VSL AA+MS+SYSTIAW +A+ K ++   V YG ++  K   VF F SALGD+AF
Sbjct  181   NSISGVSLAAAVMSLSYSTIAWSAAVDKGVQPD-VQYGYKATTKVGTVFNFFSALGDVAF  239

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN +SDN
Sbjct  240   AYAGHNVVLEIQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALIGYWIYGNSISDN  299

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL+TLEKPVWLIA AN+FVVVHV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN
Sbjct  300   ILITLEKPVWLIAMANMFVVVHVIGSYQIYAMPVFDMMETVLVKKLNFRPTMILRFFVRN  359

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             ++VAFT+FVGI+ PFFGGLLGFFGGFAFAPTTY++PC+MWL + KPKKFGLSW  NW  I
Sbjct  360   IYVAFTMFVGITFPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPKKFGLSWWANWICI  419

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             V G++L I++PIGG+  I+  AK Y FY 
Sbjct  420   VFGVILMIVSPIGGMRQIIIQAKDYKFYN  448



>ref|XP_010531369.1| PREDICTED: lysine histidine transporter 2 [Tarenaya hassleriana]
Length=441

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/436 (67%), Positives = 363/436 (83%), Gaps = 1/436 (0%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             +E    AA +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV 
Sbjct  7     SESEAAAAKQKNIDDWLPITSSRDAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVT  66

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             +MI+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + 
Sbjct  67    IMIMSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVEVGVD  126

Query  1238  IIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             I+YMVTGG S+KKV +LLC DCK I+L+++I+IF+   F+ + LPNFNSIS VSL AA+M
Sbjct  127   IVYMVTGGKSLKKVHDLLCKDCKDIRLTFWIMIFASIHFVLAHLPNFNSISGVSLAAAVM  186

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S++YST+AW +++HK ++   VDY  R+  +T  VF F++ALGD+AF+YAGHNVVLEIQA
Sbjct  187   SLTYSTVAWTASVHKGVQPD-VDYSYRASTETGKVFNFLNALGDVAFAYAGHNVVLEIQA  245

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP+ PSK  MW+GVV+AY+VVA+CY PVAFIGY   GN V DNIL+TLEKP WLIA
Sbjct  246   TIPSTPETPSKIPMWRGVVVAYIVVAICYLPVAFIGYWMFGNAVDDNILITLEKPTWLIA  305

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
             AAN+FVV+HV+GSYQ+YAM +FDM+ETF VK + F P+  LRF+TR L+VAFT+F+GI +
Sbjct  306   AANLFVVIHVIGSYQIYAMPVFDMLETFLVKKMGFNPSFKLRFITRTLYVAFTMFIGICI  365

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFGGLLGFFGGFAFAPTTYY+PCIMWL + KPK+FGLSW +NW  I++G+LLTI++PIG
Sbjct  366   PFFGGLLGFFGGFAFAPTTYYLPCIMWLAIKKPKRFGLSWTVNWFCIIVGVLLTIISPIG  425

Query  338   GLWSIVKSAKTYHFYQ  291
             GL +I+ SAK Y F+ 
Sbjct  426   GLRTIIVSAKNYTFFS  441



>emb|CDY68763.1| BnaAnng28300D [Brassica napus]
Length=443

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/439 (66%), Positives = 353/439 (80%), Gaps = 4/439 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY  E     A + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  9     DYDDE---KLARQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  65

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  66    GVAVLVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  125

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCKPIKL+Y+I+I++   F+ S LPNFNSIS VSL A
Sbjct  126   GVCIVYMVTGGKSLKKFHELVCEDCKPIKLTYFIMIYASVHFVLSHLPNFNSISGVSLAA  185

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW ++  K +    V+YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  186   AVMSLSYSTIAWAASTSKGVRED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLE  244

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MWKGV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KPVW
Sbjct  245   IQATIPSTPEKPSKGPMWKGVIVAYIVVALCYFPVALVGYYIFGNSVEDNILISLKKPVW  304

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIAAANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+F+G
Sbjct  305   LIAAANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRNFYVAATMFLG  364

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PCI+WL + KP+K+GLSW  NW  IV GI L +L+
Sbjct  365   MTFPFFGGLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYGLSWWANWVCIVFGIFLMVLS  424

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +IV  AK Y FY 
Sbjct  425   PIGGLRTIVIQAKEYQFYS  443



>ref|XP_004310189.1| PREDICTED: lysine histidine transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/429 (67%), Positives = 354/429 (83%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP+A++E+GWGPG+A++I+SW 
Sbjct  12    ARQKQIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPFALAELGWGPGIAILIMSWV  71

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFGPKLGLWIVVPQQ +VE+ +CI+YMVTG
Sbjct  72    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGPKLGLWIVVPQQVIVEVGVCIVYMVTG  131

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KKV +LLC  CK IK SY+I+IF+   F+ S LPNFNS+S +SL AAIMS+SYSTI
Sbjct  132   GKSLKKVHDLLCPSCKDIKTSYWIMIFASCHFVLSHLPNFNSMSGISLAAAIMSLSYSTI  191

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW +A HK +    VDY  ++   +  +F F   LG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  192   AWTAAAHKGVVPD-VDYSYKATTTSGTMFNFFGGLGEVAFAYAGHNVVLEIQATIPSTPE  250

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV+AY+VVA+CY+PVA +G+   GN V DNIL++LEKP WLIAAAN+FVV
Sbjct  251   KPSKGPMWKGVVVAYIVVALCYFPVAIVGFYVYGNSVEDNILISLEKPAWLIAAANLFVV  310

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             VHV+GSYQV+AM +FDMIETF V  +KF+P+  LRFVTR  +VA T+F+GI++PFFGGLL
Sbjct  311   VHVIGSYQVFAMGVFDMIETFLVIKMKFRPSFVLRFVTRTTYVAITMFIGIAIPFFGGLL  370

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KPK F LSWC+NW  IV+G+LL ILAPIG L +I+ 
Sbjct  371   GFFGGFAFAPTTYFLPCIMWLAIYKPKPFSLSWCVNWVCIVLGVLLMILAPIGALRNIIL  430

Query  317   SAKTYHFYQ  291
              AK Y F+ 
Sbjct  431   QAKNYEFFS  439



>ref|XP_010450621.1| PREDICTED: lysine histidine transporter 1 [Camelina sativa]
Length=444

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/429 (66%), Positives = 350/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+A+++LSW 
Sbjct  17    ARQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGIAVLVLSWI  76

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I+VPQQ +VEI +C++YMVTG
Sbjct  77    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIIVPQQLIVEIGVCVVYMVTG  136

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  137   GKSLKKFHELVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  196

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V YG ++      VF F S LGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  197   AWGASVSKGVQED-VQYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTPE  255

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLIA ANIFVV
Sbjct  256   KPSKGPMWKGVIVAYIVVALCYFPVALVGYYIFGNGVEDNILMSLKKPAWLIATANIFVV  315

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+FVG++ PFFGGLL
Sbjct  316   IHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTALRFCVRNFYVAATMFVGMTFPFFGGLL  375

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY+IPC++WL + KPKK+ LSWC NW  I+ G+ L IL+PIGGL +IV 
Sbjct  376   AFFGGFAFAPTTYFIPCVIWLAIYKPKKYSLSWCANWVCIMFGLCLMILSPIGGLRTIVI  435

Query  317   SAKTYHFYQ  291
              AK Y FY 
Sbjct  436   QAKDYKFYS  444



>gb|KFK33072.1| hypothetical protein AALP_AA6G326500 [Arabis alpina]
Length=443

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/433 (66%), Positives = 351/433 (81%), Gaps = 1/433 (0%)
 Frame = -1

Query  1589  AKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMI  1410
             AK  A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS++GWGPGV +++
Sbjct  12    AKEIARQKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSQLGWGPGVVILV  71

Query  1409  LSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIY  1230
             LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI +CI+Y
Sbjct  72    LSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEIGVCIVY  131

Query  1229  MVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVS  1050
             MVTGG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+S
Sbjct  132   MVTGGKSLKKFHELVCEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLS  191

Query  1049  YSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIP  870
             YSTIAW +++ K ++   V YG ++      VF F S LGD+AF+YAGHNVVLEIQATIP
Sbjct  192   YSTIAWSASVSKGVQED-VQYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIP  250

Query  869   STPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAAN  690
             STP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLIA AN
Sbjct  251   STPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNDVEDNILMSLKKPAWLIATAN  310

Query  689   IFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPff  510
             IFVV+HV+GSYQ+YAM +FDM+ETF VK L F+PT  LRF  R+ +VA T+F G++ PFF
Sbjct  311   IFVVIHVIGSYQIYAMPVFDMMETFLVKKLNFRPTTILRFCVRSFYVAATMFAGMTFPFF  370

Query  509   ggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLW  330
             GGLL FFGGFAFAPTTY++PC++WL + KPK++ LSWC NW  IV G+LL IL+PIGGL 
Sbjct  371   GGLLAFFGGFAFAPTTYFLPCVIWLAIYKPKRYSLSWCANWVCIVFGLLLMILSPIGGLR  430

Query  329   SIVKSAKTYHFYQ  291
             +IV  +K Y FY 
Sbjct  431   TIVIKSKDYKFYS  443



>ref|NP_851109.1| Lysine histidine transporter 1 [Arabidopsis thaliana]
 sp|Q9FKS8.1|LHT1_ARATH RecName: Full=Lysine histidine transporter 1 [Arabidopsis thaliana]
 gb|AAK56270.1|AF367281_1 AT5g40780/K1B16_3 [Arabidopsis thaliana]
 dbj|BAB11340.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM91380.1| At5g40780/K1B16_3 [Arabidopsis thaliana]
 gb|AED94593.1| Lysine histidine transporter 1 [Arabidopsis thaliana]
Length=446

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 353/439 (80%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D++ +    AA + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  9     DHQDDEKLAAARQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  68

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  69    GIAVLVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  128

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  129   GVCIVYMVTGGKSLKKFHELVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  188

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW S+  K ++   V YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  189   AVMSLSYSTIAWASSASKGVQED-VQYGYKAKTTAGTVFNFFSGLGDVAFAYAGHNVVLE  247

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP W
Sbjct  248   IQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNGVEDNILMSLKKPAW  307

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT TLRF  RN +VA T+FVG
Sbjct  308   LIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTTLRFFVRNFYVAATMFVG  367

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PC++WL + KPKK+ LSW  NW  IV G+ L +L+
Sbjct  368   MTFPFFGGLLAFFGGFAFAPTTYFLPCVIWLAIYKPKKYSLSWWANWVCIVFGLFLMVLS  427

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +IV  AK Y FY 
Sbjct  428   PIGGLRTIVIQAKGYKFYS  446



>ref|XP_010025349.1| PREDICTED: lysine histidine transporter-like 2 [Eucalyptus grandis]
 gb|KCW61985.1| hypothetical protein EUGRSUZ_H04668 [Eucalyptus grandis]
Length=438

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/437 (65%), Positives = 352/437 (81%), Gaps = 1/437 (0%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             + E  K   ++  +DDWLP+ S R  KWWYSTFHNVTAMVGAG+LSLPY+++ +GWGPGV
Sbjct  3     QHEPRKDEIDEKAIDDWLPITSSRKAKWWYSTFHNVTAMVGAGVLSLPYSLAALGWGPGV  62

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              ++I+SW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +
Sbjct  63    TVLIISWVVTLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGV  122

Query  1241  CIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             CI+YM+TGG S+KK+ + LC  CKPIK SY+I+IF+   F+ S LPNFNSIS VSL AA+
Sbjct  123   CIVYMITGGKSMKKIHDSLCTGCKPIKTSYFIIIFASIHFVLSHLPNFNSISVVSLAAAV  182

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTIAW ++LH+ ++   VDY  +   +   +F F SALGD+AF+YAGHNVVLEIQ
Sbjct  183   MSLSYSTIAWTASLHRGVQPD-VDYSYKGKDQQTVMFNFFSALGDVAFAYAGHNVVLEIQ  241

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSKK MW GVV AY+VVA+CY+PVA +GY   GN V DNIL+TLEKP WLI
Sbjct  242   ATIPSTPEKPSKKPMWLGVVFAYIVVAICYFPVALVGYYVFGNSVDDNILITLEKPKWLI  301

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             AAAN+FVV+HV+GSYQ+YAM +FDM+ETF V+ L+FKP  TLRF+TR L+VAFT+ VGI 
Sbjct  302   AAANLFVVIHVIGSYQIYAMPVFDMMETFLVRKLRFKPRFTLRFITRTLYVAFTMIVGIC  361

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
             +PFFG LLGFFGG A APTTY++PCIMWL + KP+ F LSW  NW  I++G++L IL PI
Sbjct  362   IPFFGSLLGFFGGLALAPTTYFLPCIMWLCVYKPRTFSLSWFANWICIILGVMLVILGPI  421

Query  341   GGLWSIVKSAKTYHFYQ  291
             GGL +I+ S+K Y F+ 
Sbjct  422   GGLRNIIISSKDYKFFS  438



>ref|XP_008446084.1| PREDICTED: lysine histidine transporter 1-like [Cucumis melo]
Length=441

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/444 (66%), Positives = 357/444 (80%), Gaps = 5/444 (1%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSE  1443
             +LEM    AE +   AN+  +DDWLP+ S R+ KWWY+ FHNVTAMVGAG+LSLPYAMSE
Sbjct  3     QLEM----AEQSGKNANQKAIDDWLPITSSRNAKWWYAAFHNVTAMVGAGVLSLPYAMSE  58

Query  1442  MGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQ  1263
             +GWGPG  +MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ
Sbjct  59    LGWGPGSVIMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQ  118

Query  1262  ALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISF  1083
               VEI + I+YMVTGG S+KK  E +C  C  IK SY+I+IF+   F+ S LPNFNSIS 
Sbjct  119   LTVEIGVNIVYMVTGGKSLKKFHETVCPSCSQIKTSYFIVIFASLHFVLSHLPNFNSISG  178

Query  1082  VSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGH  903
             VSL AA+MS+SYSTIAW ++L K ++ + VDY  ++   ++ VF F+S LG++AF++AGH
Sbjct  179   VSLAAAVMSLSYSTIAWVASLEKGVQPN-VDYSYKASSTSEGVFHFLSGLGEVAFAFAGH  237

Query  902   NVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTL  723
             NVVLEIQATIPSTP+ PSK  MWKGV++AY+VVA+CY+PVAFIGY   GN V DNIL++L
Sbjct  238   NVVLEIQATIPSTPEKPSKGPMWKGVILAYLVVALCYFPVAFIGYWVFGNTVEDNILISL  297

Query  722   EKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAF  543
             EKP WLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK LKFKP   LRF+TR+L+VAF
Sbjct  298   EKPAWLIATANMFVVIHVIGSYQIYAMPVFDMIETLLVKRLKFKPCFRLRFITRSLYVAF  357

Query  542   TLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGIL  363
             T+ VGI+VPFFGGLLGFFGG AFAPTTY++PC MWL + KP++F LSW  NW  IV G+L
Sbjct  358   TMLVGIAVPFFGGLLGFFGGLAFAPTTYFLPCTMWLAICKPRRFSLSWITNWICIVFGVL  417

Query  362   LTILAPIGGLWSIVKSAKTYHFYQ  291
             L +L+PIGGL +++ SAK Y F+ 
Sbjct  418   LMVLSPIGGLRTLILSAKNYRFFS  441



>gb|EMT33617.1| hypothetical protein F775_08592 [Aegilops tauschii]
Length=448

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/448 (65%), Positives = 359/448 (80%), Gaps = 4/448 (1%)
 Frame = -1

Query  1625  RELEMGDYKAEGAKP--AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYA  1452
             +E+   +   E  +    A +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYA
Sbjct  2     KEMPGANKNTENPQDERTAREKAIDDWLPITSSRKAKWWYSAFHNVTAMVGAGVLSLPYA  61

Query  1451  MSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVV  1272
             MSE+GWGPG+A+M LSW IT+YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVV
Sbjct  62    MSELGWGPGIAVMTLSWIITVYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVV  121

Query  1271  PQQALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFN  1095
             PQQ +VE+SL I+YMVTGG+S+KK  +++C   CK IKL+Y+I+IF+   F+ S LPNFN
Sbjct  122   PQQLVVEVSLNIVYMVTGGNSLKKFHDVICDGKCKDIKLTYFIMIFASVHFVLSQLPNFN  181

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS +SL AA+MS+SYSTIAWG++LHK  ++  VDY  R+      VF F+  LGD+AFS
Sbjct  182   SISGISLAAAVMSLSYSTIAWGASLHKG-KAENVDYSLRASTTPGQVFGFLGGLGDVAFS  240

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             Y+GHNVVLEIQATIPSTP NPSKK MWKGVV+AY+++A CY PVAFIGY A GN V DNI
Sbjct  241   YSGHNVVLEIQATIPSTPGNPSKKPMWKGVVVAYIIIAACYMPVAFIGYWAFGNSVDDNI  300

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL KP WLIA AN+ VVVH++GSYQ+YAM +FDM+ETF V+ L+F P  TLR +TR +
Sbjct  301   LITLNKPKWLIAMANMMVVVHLIGSYQIYAMPVFDMMETFLVRKLEFAPGITLRLITRTI  360

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+FVG++ PFFGGL+GFFGG AFAPTTY++PCIMWLI+ KP++F LSW  NW  IV
Sbjct  361   YVAFTMFVGMTFPFFGGLIGFFGGLAFAPTTYFLPCIMWLIICKPRRFSLSWFTNWICIV  420

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +G++L I+APIGGL  I+ SAKTY FY 
Sbjct  421   LGVILMIIAPIGGLRQIIISAKTYKFYS  448



>ref|XP_006301797.1| hypothetical protein CARUB_v10022261mg [Capsella rubella]
 gb|EOA34695.1| hypothetical protein CARUB_v10022261mg [Capsella rubella]
Length=441

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/442 (68%), Positives = 366/442 (83%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPA-ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ K   +K A A +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGENKLSPSKDASAKEKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW IT YTL+QMV+MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTIMIMSWLITFYTLWQMVQMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KK+ +LLC DCK I+ +Y+I+IF+   F+ + LPNFNSIS VS
Sbjct  121   VEVGVDIVYMVTGGKSLKKIHDLLCTDCKNIRTTYWIMIFASVHFVLAHLPNFNSISIVS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++ K ++ + VDY  R+   + NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLSYSTIAWATSVKKGVQPN-VDYSFRASTSSGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK AMWKGVV+AY+VVA+CY+PVAFI Y   GN V DN+L+TL+K
Sbjct  240   VLEIQATIPSTPEKPSKIAMWKGVVVAYIVVAICYFPVAFICYYIFGNTVDDNVLMTLQK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN FVVVHV+GSYQ+YAM +FDM+ETF VK + F P+  LRF+TR L+VAFT+
Sbjct  300   PVWLIAIANAFVVVHVIGSYQIYAMPVFDMLETFLVKKMMFTPSFKLRFITRTLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FV I +PFFGGLLGFFGGFAFAPTTYY+PCIMWLIL KPKK+GLSW +NW  IV+G++LT
Sbjct  360   FVAICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLILKKPKKYGLSWSINWFCIVVGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             I+APIGGL +I+ SAK Y F+ 
Sbjct  420   IVAPIGGLRTIIVSAKDYEFFS  441



>ref|XP_007216208.1| hypothetical protein PRUPE_ppa016172mg [Prunus persica]
 gb|EMJ17407.1| hypothetical protein PRUPE_ppa016172mg [Prunus persica]
Length=461

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/442 (64%), Positives = 358/442 (81%), Gaps = 1/442 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             E  + +++  +    + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  21    ERPEKQSQIDEQLKRQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  80

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPG  +++LSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  81    WGPGTVILVLSWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  140

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
              E+ + I+YMVTGG S++K+ ++   D  PIKL+Y+I+IF+   F+ + LPNFNSIS VS
Sbjct  141   CEVGVDIVYMVTGGKSLQKIHKIARKDKDPIKLTYFIMIFASAHFVLAHLPNFNSISGVS  200

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++HK ++   V+YG  +H  +  VF F +ALGD+AF+YAGHNV
Sbjct  201   LAAAVMSLSYSTIAWTASVHKGVQPD-VEYGYLAHSTSGTVFNFFTALGDVAFAYAGHNV  259

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPS+P+ PSKK MW+GVVIAY+VVA+CY+PVAFIGY   GN+V DNIL++LEK
Sbjct  260   VLEIQATIPSSPEKPSKKPMWRGVVIAYIVVALCYFPVAFIGYYIFGNKVEDNILISLEK  319

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+PT  LRF++RN +VAFT+
Sbjct  320   PEWLIITANMFVVIHVIGSYQLYAMPVFDMIETLLVKKLHFRPTTMLRFISRNTYVAFTM  379

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+ PFFGGLLGFFGGFAF+PTTY++PCIMWL + KP+KF LSW +NW  I +G+LL 
Sbjct  380   FVGITFPFFGGLLGFFGGFAFSPTTYFLPCIMWLTVKKPRKFSLSWVVNWICITLGVLLM  439

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             IL+PIGGL +I+  AK Y FY 
Sbjct  440   ILSPIGGLRNIILQAKNYKFYN  461



>gb|EYU44856.1| hypothetical protein MIMGU_mgv1a006274mg [Erythranthe guttata]
Length=450

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/438 (67%), Positives = 358/438 (82%), Gaps = 1/438 (0%)
 Frame = -1

Query  1604  YKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPG  1425
             Y   G +  A +  +D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG
Sbjct  14    YSKNGDERTAEEKAIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPG  73

Query  1424  VAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEIS  1245
             V++MI+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ 
Sbjct  74    VSVMIISWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVG  133

Query  1244  LCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
             + I+YMVTGG S+KK  +L+C DCK IKLS++I+IF+   F+ S LPNFNSIS VSL AA
Sbjct  134   VDIVYMVTGGKSLKKFHDLVCKDCKSIKLSFFIMIFASVHFVLSHLPNFNSISGVSLAAA  193

Query  1064  IMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +MS+SYSTIAWG+++ K ++   V YG ++  K   VF F SALG++AF+YAGHNVVLEI
Sbjct  194   VMSLSYSTIAWGASVDKGVQPD-VQYGYKATTKIGTVFNFFSALGEVAFAYAGHNVVLEI  252

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPSTP+ PSK AMW+GVV+AY+VVA+CY+PVAFIGY   GN V DNIL++L+ P WL
Sbjct  253   QATIPSTPEKPSKIAMWRGVVVAYIVVALCYFPVAFIGYWMFGNAVDDNILMSLQNPTWL  312

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             IA AN+FVV+HV+GSYQ+YAM +FDMIET  VK LKFKPT  LRF++RN +VAFT+FVGI
Sbjct  313   IAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLKFKPTWYLRFISRNFYVAFTMFVGI  372

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
             + PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  IV+G++L I+AP
Sbjct  373   TFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWIANWICIVLGVMLMIVAP  432

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IGGL  I+  AK Y FY 
Sbjct  433   IGGLRQIIVQAKDYKFYS  450



>ref|XP_011098833.1| PREDICTED: lysine histidine transporter 1-like [Sesamum indicum]
Length=445

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/439 (67%), Positives = 357/439 (81%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY        A +  +D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  8     DYSKNVDTRTAEEKAIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  67

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +M++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+
Sbjct  68    GVTVMVISWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEV  127

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  +L+C  CK IKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  128   GVDIVYMVTGGKSLKKFHDLVCPGCKSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  187

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAWG+++ K ++ + V YG ++      VF F SALGD+AF+YAGHNVVLE
Sbjct  188   AVMSLSYSTIAWGASVDKGVQRN-VQYGYKATTTAGTVFNFFSALGDVAFAYAGHNVVLE  246

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVAFIGY   GN V DNIL+TL KPVW
Sbjct  247   IQATIPSTPEKPSKIPMWRGVIVAYIVVALCYFPVAFIGYWMFGNSVEDNILMTLNKPVW  306

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVVVHV+GSYQ+YAM +FDMIET  VK L+F+PT  LRF++RN++VAFT+FVG
Sbjct  307   LIAMANMFVVVHVIGSYQIYAMPVFDMIETVLVKKLRFRPTWYLRFISRNIYVAFTMFVG  366

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  IV+G+LL I+A
Sbjct  367   MTFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWFTNWICIVLGVLLMIIA  426

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL  I+  AK+Y FY 
Sbjct  427   PIGGLRQIILQAKSYQFYS  445



>ref|XP_006283741.1| hypothetical protein CARUB_v10004814mg [Capsella rubella]
 gb|EOA16639.1| hypothetical protein CARUB_v10004814mg [Capsella rubella]
Length=443

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/429 (66%), Positives = 348/429 (81%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+A+++LSW 
Sbjct  16    AREKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGIAVLVLSWI  75

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I+VPQQ +VEI +C++YMVTG
Sbjct  76    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIIVPQQLIVEIGVCVVYMVTG  135

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  EL+C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AAIMS+SYSTI
Sbjct  136   GKSLKKFHELVCDDCKQIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAIMSLSYSTI  195

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V YG ++      VF F S LGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  196   AWGASVSKGVQED-VQYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTPE  254

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLIA ANIFVV
Sbjct  255   KPSKGPMWKGVIVAYIVVALCYFPVALVGYYIFGNAVDDNILMSLKKPAWLIATANIFVV  314

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+FVG++ PFFGGLL
Sbjct  315   IHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTALRFCVRNFYVAATMFVGMTFPFFGGLL  374

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY+IPC++WL + KPKK+ LSWC NW  I  G+ L IL+PIGGL +IV 
Sbjct  375   AFFGGFAFAPTTYFIPCVIWLAIYKPKKYSLSWCANWVCIFFGLCLMILSPIGGLRTIVI  434

Query  317   SAKTYHFYQ  291
              AK Y FY 
Sbjct  435   QAKDYKFYS  443



>ref|NP_198894.2| Lysine histidine transporter 1 [Arabidopsis thaliana]
 gb|AED94594.1| Lysine histidine transporter 1 [Arabidopsis thaliana]
Length=445

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/430 (66%), Positives = 349/430 (81%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+A+++LSW
Sbjct  17    AARQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGIAVLVLSW  76

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI +CI+YMVT
Sbjct  77    VITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEIGVCIVYMVT  136

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYST
Sbjct  137   GGKSLKKFHELVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYST  196

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW S+  K ++   V YG ++      VF F S LGD+AF+YAGHNVVLEIQATIPSTP
Sbjct  197   IAWASSASKGVQED-VQYGYKAKTTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPSTP  255

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLIA ANIFV
Sbjct  256   EKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNGVEDNILMSLKKPAWLIATANIFV  315

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             V+HV+GSYQ+YAM +FDM+ET  VK L F+PT TLRF  RN +VA T+FVG++ PFFGGL
Sbjct  316   VIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTTLRFFVRNFYVAATMFVGMTFPFFGGL  375

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             L FFGGFAFAPTTY++PC++WL + KPKK+ LSW  NW  IV G+ L +L+PIGGL +IV
Sbjct  376   LAFFGGFAFAPTTYFLPCVIWLAIYKPKKYSLSWWANWVCIVFGLFLMVLSPIGGLRTIV  435

Query  320   KSAKTYHFYQ  291
               AK Y FY 
Sbjct  436   IQAKGYKFYS  445



>ref|XP_004159706.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus]
 gb|KGN51697.1| hypothetical protein Csa_5G590140 [Cucumis sativus]
Length=441

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/444 (66%), Positives = 357/444 (80%), Gaps = 5/444 (1%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSE  1443
             +LEM    AE +   AN+  +DDWLP+ S R+ KWWY+ FHNVTAMVGAG+LSLPYAMSE
Sbjct  3     QLEM----AEQSGKDANQKAIDDWLPITSSRNAKWWYAAFHNVTAMVGAGVLSLPYAMSE  58

Query  1442  MGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQ  1263
             +GWGPG  +MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ
Sbjct  59    LGWGPGSVIMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQ  118

Query  1262  ALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISF  1083
               VEI + I+YMVTGG S+KK  E +C  C  IK SY+I+IF+   F+ S LPNFNSIS 
Sbjct  119   LTVEIGVNIVYMVTGGKSLKKFHETVCPSCSQIKTSYFIVIFASIHFVLSHLPNFNSISG  178

Query  1082  VSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGH  903
             VSL AA+MS+SYSTIAW ++L K ++ + VDY  ++   +D VF F+S LG++AF++AGH
Sbjct  179   VSLAAAVMSLSYSTIAWVASLEKGVQPN-VDYSYKASSTSDGVFHFLSGLGEVAFAFAGH  237

Query  902   NVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTL  723
             NVVLEIQATIPSTP+ PSK  MWKGV++AY+VVA+CY+PVA IGY   GN V DNIL++L
Sbjct  238   NVVLEIQATIPSTPEKPSKGPMWKGVILAYLVVAVCYFPVAMIGYWVFGNAVEDNILISL  297

Query  722   EKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAF  543
             EKP WLIA AN+FVVVHVVGSYQ+YAM +FDMIET  VK LKFKP   LRF+TR+L+VAF
Sbjct  298   EKPAWLIATANMFVVVHVVGSYQIYAMPVFDMIETLLVKRLKFKPCFRLRFITRSLYVAF  357

Query  542   TLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGIL  363
             T+ VGI+VPFFGGLLGFFGG AFAPTTY++PC MWL + KP++F LSW +NW  IV G+L
Sbjct  358   TMLVGIAVPFFGGLLGFFGGLAFAPTTYFLPCTMWLAICKPRRFSLSWIINWICIVFGVL  417

Query  362   LTILAPIGGLWSIVKSAKTYHFYQ  291
             L +L+PIGG+ +++ SAK Y F+ 
Sbjct  418   LMVLSPIGGMRTLILSAKNYQFFS  441



>ref|XP_008348004.1| PREDICTED: lysine histidine transporter 1-like [Malus domestica]
Length=449

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/450 (65%), Positives = 360/450 (80%), Gaps = 2/450 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDY-KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSL  1461
             MG        +Y +AE  +  A + ++D+WLP+   R+ KWWYS FHNVTAMVGAG+LSL
Sbjct  1     MGTQAPTNDNNYNRAEIDEKLAKQKKIDEWLPITGSRNAKWWYSAFHNVTAMVGAGVLSL  60

Query  1460  PYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLW  1281
             PYAMS +GWGPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+
Sbjct  61    PYAMSNLGWGPGVVILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLY  120

Query  1280  IVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPN  1101
             IVVPQQ +VE+ + I+YMVTGG S++KV + LC DCK IKL+Y+I+IF+   F+ S LPN
Sbjct  121   IVVPQQLIVEVGVDIVYMVTGGKSLQKVHKSLCSDCKNIKLTYFIMIFASVHFVLSHLPN  180

Query  1100  FNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMA  921
             FNSIS VSL AA+MS+SYSTIAW +++ K +  + V Y  RS   + NV  F +ALGD+A
Sbjct  181   FNSISGVSLAAAVMSLSYSTIAWAASVDKGVVEN-VSYDYRSKTTSGNVLNFFTALGDVA  239

Query  920   FSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSD  741
             F+YAGHNVVLEIQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   G  V D
Sbjct  240   FAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGKSVDD  299

Query  740   NILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTR  561
             NILL+LEKP WLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L FKPT+TLRF+TR
Sbjct  300   NILLSLEKPNWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLNFKPTRTLRFITR  359

Query  560   NLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTF  381
             N++VAFT+FVGI+ PFF GLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  N+  
Sbjct  360   NIYVAFTMFVGITFPFFSGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWWCNYIC  419

Query  380   IVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             I +G+LL ILAPIGGL +I+  AKTY FY 
Sbjct  420   IFLGVLLMILAPIGGLRTIIIQAKTYKFYN  449



>ref|XP_008340170.1| PREDICTED: lysine histidine transporter 2-like [Malus domestica]
Length=438

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/429 (66%), Positives = 354/429 (83%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + ++DDWLPV S R+ KWWYS FHNVTAMVGAG+LSLPYAM+E+GWGPG+A+++LSW 
Sbjct  11    ARQKQIDDWLPVTSARNAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWGPGIAVVLLSWI  70

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+ + I+YMVTG
Sbjct  71    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQLIVEVGVNIVYMVTG  130

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KKV +++C  CK IKL+ +ILIF+   F+ S LPN NS+S +SL AA+MS+SYSTI
Sbjct  131   GKSLKKVHDVICPSCKDIKLTLWILIFASAHFVLSHLPNLNSVSGISLAAAVMSLSYSTI  190

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+A+HK  +   VDY  ++      VF F S LGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  191   AWGAAIHKG-KVPNVDYSYKAKSNVGAVFNFFSGLGDIAFAYAGHNVVLEIQATIPSTPE  249

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV+AY+VVA+CY+PV F+GY   GN V DNIL++LEKPVWLIAAAN FVV
Sbjct  250   KPSKGPMWKGVVVAYIVVALCYFPVCFVGYYIYGNSVEDNILISLEKPVWLIAAANXFVV  309

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQV+AM +FDM+ETF VK + F P+ TLRF+TR ++VA T+ +G+++PFFGGLL
Sbjct  310   IHVIGSYQVFAMGVFDMVETFLVKKMNFPPSFTLRFITRTIYVAITMVIGMAIPFFGGLL  369

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KP++F LSWC+NWT I++G  L ILAPIG L SI+ 
Sbjct  370   GFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWCINWTCIILGATLMILAPIGALRSIIL  429

Query  317   SAKTYHFYQ  291
              +KTY F+ 
Sbjct  430   QSKTYTFFS  438



>ref|NP_176932.1| lysine histidine transporter 5 [Arabidopsis thaliana]
 sp|Q9SR44.1|LHTL2_ARATH RecName: Full=Lysine histidine transporter-like 2 [Arabidopsis 
thaliana]
 gb|AAG28894.1|AC008113_10 F12A21.22 [Arabidopsis thaliana]
 gb|AAG52310.1|AC011020_17 putative amino acid permease [Arabidopsis thaliana]
 gb|ABE65751.1| lysine and histidine specific transporter [Arabidopsis thaliana]
 gb|AEE34675.1| lysine histidine transporter 5 [Arabidopsis thaliana]
Length=441

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/442 (67%), Positives = 364/442 (82%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGE-VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             M   ++   K A+ K + VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MEKSQSSPTKDASTKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW IT YTL+QMV+MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTIMIMSWLITFYTLWQMVQMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KK+ +LLC DCK I+ +Y+I+IF+   F+ + LPNFNSIS VS
Sbjct  121   VEVGVDIVYMVTGGKSLKKIHDLLCTDCKNIRTTYWIMIFASIHFVLAHLPNFNSISIVS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++ K +  + VDY  R+   + NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLSYSTIAWATSVKKGVHPN-VDYSSRASTTSGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK AMWKGVV+AY+VVA+CY+PVAF+ Y   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEKPSKIAMWKGVVVAYIVVAICYFPVAFVCYYIFGNSVDDNILMTLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P+WLIA AN FVVVHV+GSYQ+YAM +FDM+ETF VK + F P+  LRF+TR L+VAFT+
Sbjct  300   PIWLIAIANAFVVVHVIGSYQIYAMPVFDMLETFLVKKMMFAPSFKLRFITRTLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FV I +PFFGGLLGFFGGFAFAPTTYY+PCIMWL + KPKK+GLSWC+NW  IV+G++LT
Sbjct  360   FVAICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLCIKKPKKYGLSWCINWFCIVVGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ILAPIGGL +I+ SAK Y F+ 
Sbjct  420   ILAPIGGLRTIIISAKNYEFFS  441



>ref|XP_010682865.1| PREDICTED: lysine histidine transporter-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/428 (67%), Positives = 353/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
             N   +DDWLPV S R+ KWWYSTFHNVTAMVGAG+LSLP+AMSE+GWGPGV +M+LSW +
Sbjct  5     NNVNIDDWLPVTSNRNAKWWYSTFHNVTAMVGAGVLSLPFAMSELGWGPGVTVMVLSWVV  64

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL++MVEMHE +PGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+   I+YMVTGG
Sbjct  65    TLYTLWEMVEMHEMIPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGSDIVYMVTGG  124

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK+ EL+CHDCKPIKL+Y+ILIFS   F+ S LPN NS+S +SL AAIMS+SYSTIA
Sbjct  125   KSMKKIHELVCHDCKPIKLTYFILIFSSVHFVISHLPNLNSVSIISLAAAIMSLSYSTIA  184

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++L K +  + VDY  R    T     F +ALGD+AF++AGHNVVLEIQAT+PS+P+ 
Sbjct  185   WAASLVKGVNEN-VDYSYRGKTPTAQTMNFFTALGDVAFAFAGHNVVLEIQATMPSSPER  243

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK+ MWKGV  AY+VVA+CY+PVA+IGY   GN V DN+L++LE+PVWLI AAN+FV+V
Sbjct  244   PSKEPMWKGVKFAYIVVAICYFPVAWIGYYTFGNSVEDNVLISLEEPVWLIIAANVFVLV  303

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQV+AM +FDM+ETF VK +KFKPT  LRFVTRN++VAFT+FV I+ PFFGGLLG
Sbjct  304   HVIGSYQVFAMPVFDMLETFLVKKMKFKPTSILRFVTRNVYVAFTVFVAITFPFFGGLLG  363

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPT+Y++PCI+WL + KPK+F  +WC NW  I+ G LL +LAPIG L +I+++
Sbjct  364   FFGGFAFAPTSYFLPCIIWLRICKPKRFSFTWCTNWFCIIFGGLLMMLAPIGALRNIIQT  423

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  424   AKNYEFYS  431



>gb|KFK44499.1| hypothetical protein AALP_AA1G265000 [Arabis alpina]
Length=441

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/442 (64%), Positives = 362/442 (82%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAK-PAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+     ++  AA + ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNSDMSASEIEAAKQKKIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +++LSW ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWI+VPQQ +
Sbjct  61    WGPGVTILVLSWVITLYTLWQMVEMHEIVPGKRLDRYHELGQHAFGEKLGLWIIVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S++KV +LLC DCK I+ +++I+IF+   F+ S LPNFNSIS +S
Sbjct  121   VEVGVDIVYMVTGGKSLQKVHQLLCPDCKDIRTTFWIMIFASIHFVISHLPNFNSISVIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK +    VDY  R+      VF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWAASVHKGVHPD-VDYSYRASTSPGKVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GVV+AY++VA+CY+PVA  G+   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEMPSKVPMWRGVVVAYIIVAICYFPVAICGFWIFGNSVDDNILITLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVVVHV+GSYQ++AM +FDM+ET+ VK +KF P+  LRF+TR+L+VAFT+
Sbjct  300   PVWLIAMANLFVVVHVIGSYQIFAMPVFDMMETYLVKKMKFDPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             F+ I VPFFGGLLGFFGGFAFAPTTYY+PCI+WL L KPK+F LSW +NW  I++G+LLT
Sbjct  360   FIAICVPFFGGLLGFFGGFAFAPTTYYLPCIIWLKLKKPKRFSLSWTINWICIILGVLLT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             +LAPIGGL +I+ +AK Y F+ 
Sbjct  420   VLAPIGGLRTIIVNAKGYQFFS  441



>ref|XP_004960693.1| PREDICTED: lysine histidine transporter 2-like [Setaria italica]
Length=436

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/436 (67%), Positives = 341/436 (78%), Gaps = 1/436 (0%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             A  A     +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV 
Sbjct  2     APSAMSTEKEQAIDDWLPITSSRKAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVV  61

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
              M+LSW ITLYTL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+  C
Sbjct  62    AMLLSWIITLYTLWQMVEMHECVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGTC  121

Query  1238  IIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             I+YMVTGG S +K   + C DCKP++ S +I+IF+    + S LPNFNSI+ VSL AA+M
Sbjct  122   IVYMVTGGKSFEKCYTMACPDCKPLRTSSWIMIFAAIHLLLSQLPNFNSITLVSLAAAVM  181

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S+SYSTIAW ++ HK      VDYG  +   T   F F++ALGD+AF+YAGHNVVLEIQA
Sbjct  182   SLSYSTIAWAASAHKG-RVPDVDYGKSASTATGQTFNFLNALGDVAFAYAGHNVVLEIQA  240

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTPD PSKK MW+GVV+AY VVA+CY PVAF+GY   GN V DNIL+TLEKP WLIA
Sbjct  241   TIPSTPDKPSKKPMWQGVVLAYFVVAICYLPVAFVGYYVFGNAVDDNILITLEKPRWLIA  300

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              ANIFVVVHV+G YQ+YAM +FDM+ETF VK L+F P   LR + R+L+V FT   GI+V
Sbjct  301   MANIFVVVHVIGGYQIYAMPVFDMLETFLVKKLRFTPGLPLRLIARSLYVVFTALFGIAV  360

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFGGLLGFFGGFA APTTYY+PCI+WL +MKPK F LSW  NW  I++G+LLTI APIG
Sbjct  361   PFFGGLLGFFGGFALAPTTYYLPCILWLRIMKPKTFSLSWFTNWFCIIVGVLLTIFAPIG  420

Query  338   GLWSIVKSAKTYHFYQ  291
             GL SI+ +A TY F+ 
Sbjct  421   GLRSIIVNASTYKFFS  436



>gb|ABK28455.1| unknown [Arabidopsis thaliana]
Length=442

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/442 (67%), Positives = 364/442 (82%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGE-VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             M   ++   K A+ K + VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MEKSQSSPTKDASTKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW IT YTL+QMV+MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTIMIMSWLITFYTLWQMVQMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KK+ +LLC DCK I+ +Y+I+IF+   F+ + LPNFNSIS VS
Sbjct  121   VEVGVDIVYMVTGGKSLKKIHDLLCTDCKNIRTTYWIMIFASIHFVLAHLPNFNSISIVS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++ K +  + VDY  R+   + NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLSYSTIAWATSVKKGVHPN-VDYSSRASTTSGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK AMWKGVV+AY+VVA+CY+PVAF+ Y   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEKPSKIAMWKGVVVAYIVVAICYFPVAFVCYYIFGNSVDDNILMTLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P+WLIA AN FVVVHV+GSYQ+YAM +FDM+ETF VK + F P+  LRF+TR L+VAFT+
Sbjct  300   PIWLIAIANAFVVVHVIGSYQIYAMPVFDMLETFLVKKMMFAPSFKLRFITRTLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FV I +PFFGGLLGFFGGFAFAPTTYY+PCIMWL + KPKK+GLSWC+NW  IV+G++LT
Sbjct  360   FVAICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLCIKKPKKYGLSWCINWFCIVVGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ILAPIGGL +I+ SAK Y F+ 
Sbjct  420   ILAPIGGLRTIIISAKNYEFFS  441



>ref|XP_009336550.1| PREDICTED: lysine histidine transporter 1-like [Pyrus x bretschneideri]
Length=442

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/443 (66%), Positives = 354/443 (80%), Gaps = 3/443 (1%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKG--EVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEM  1440
             MG    E  +    K   ++++WLP+   R+  WWYS FHNVTAMVGAG+L LPYAMS +
Sbjct  1     MGGSSGEIREEEQQKEVLDINEWLPITKSRNATWWYSAFHNVTAMVGAGVLGLPYAMSHL  60

Query  1439  GWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQA  1260
             GWGPGVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ 
Sbjct  61    GWGPGVAVLVLSWIITLYTLWQMVEMHEIVPGKRFDRYHELGQHAFGEKLGLYIVVPQQL  120

Query  1259  LVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFV  1080
             +VE+  CI+YM+TGG+S+KK+   +C DCKPIK SY+I+IF+   F+ S LP+ NSI+ V
Sbjct  121   MVELGTCIVYMITGGNSLKKIHSTVCPDCKPIKTSYFIMIFASVHFVLSHLPSLNSIASV  180

Query  1079  SLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHN  900
             SL AA+MS+SYSTIAWG++LHK +E   V YGPR+     N F F SALGD+AF++AGHN
Sbjct  181   SLAAAVMSLSYSTIAWGASLHKGVEPQ-VQYGPRASTPAGNTFNFFSALGDVAFAFAGHN  239

Query  899   VVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLE  720
             VVLEIQATIPSTP+ PSKK MWKGVV+AY+VVAMCY+PVA IGY   GN V DNIL++LE
Sbjct  240   VVLEIQATIPSTPEKPSKKPMWKGVVLAYIVVAMCYFPVALIGYWVFGNHVEDNILISLE  299

Query  719   KPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFT  540
             KP WLI  AN FVVVHV+GSYQVYAM +FDM E F +K +KFKP+  LRFVTRN+ VAFT
Sbjct  300   KPAWLIVLANCFVVVHVIGSYQVYAMPVFDMAELFLLKKMKFKPSLVLRFVTRNVIVAFT  359

Query  539   LFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILL  360
             LFVGI+ PFFGGLLGFFGGFAFAPTTYY+PCIMWLI+ KPKKFGLSW  NW  I++G+ L
Sbjct  360   LFVGITFPFFGGLLGFFGGFAFAPTTYYLPCIMWLIIYKPKKFGLSWFANWFCIIVGVSL  419

Query  359   TILAPIGGLWSIVKSAKTYHFYQ  291
              +LAPIG L +++  AK + FY 
Sbjct  420   MLLAPIGALRNLILQAKNFKFYS  442



>ref|XP_009125162.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009125163.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Brassica 
rapa]
Length=443

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 351/439 (80%), Gaps = 4/439 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY  E     A + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  9     DYDDE---KLARQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  65

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+ +LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  66    GVAVFVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  125

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCKPIKL+Y+I+I++   F+ S LPNFNSIS VSL A
Sbjct  126   GVCIVYMVTGGKSLKKFHELVCEDCKPIKLTYFIMIYASVHFVLSHLPNFNSISGVSLAA  185

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW +++ K +    V+YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  186   AVMSLSYSTIAWAASMSKGVRED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLE  244

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MWKGV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KPVW
Sbjct  245   IQATIPSTPEKPSKGPMWKGVIVAYIVVALCYFPVALVGYYIFGNSVEDNILISLKKPVW  304

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+F+G
Sbjct  305   LIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRNFYVAATMFLG  364

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PCI+WL + KP+K+GLSW  NW  I IGI L +L+
Sbjct  365   MTFPFFGGLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYGLSWWANWVCIAIGIFLMVLS  424

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIG L +IV  AK Y FY 
Sbjct  425   PIGELRTIVIQAKEYQFYS  443



>gb|EYU25937.1| hypothetical protein MIMGU_mgv1a006620mg [Erythranthe guttata]
Length=437

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/432 (69%), Positives = 355/432 (82%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS MGWGPGV MMIL
Sbjct  7     EKTAEEKAIDDWLPITSSRTAKWWYSAFHNVTAMVGAGVLSLPYAMSNMGWGPGVTMMIL  66

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+S CIIYM
Sbjct  67    SWLITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQVVVEVSTCIIYM  126

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  + +C DC  I+L+Y+ILIF+   F+ S LPNFNSIS VSL AA+MS++Y
Sbjct  127   VTGGKSLKKFHQSVCPDCHEIRLTYFILIFASIHFVLSHLPNFNSISVVSLAAAVMSLTY  186

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             S+IAW ++L K   S  VDY  R      NVF F +ALGD+AF+YAGHNVVLEIQATIPS
Sbjct  187   SSIAWIASLVKG-TSKDVDYTLRGENTQANVFNFFNALGDIAFAYAGHNVVLEIQATIPS  245

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSKKAMWKGV+ AY VVA+CY+PVAF+GY   GN V DNILLTLEKP WLIA AN+
Sbjct  246   TPEKPSKKAMWKGVIFAYAVVAICYFPVAFVGYYIFGNTVDDNILLTLEKPRWLIACANM  305

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FV+VHV+GSYQ+YAM +FDM+ETF VK +KF+P+  LRF TR L+VAFT+FVG++ PFFG
Sbjct  306   FVLVHVIGSYQIYAMPVFDMLETFLVKQMKFRPSFCLRFTTRTLYVAFTMFVGMTFPFFG  365

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GL+GFFGGFA APTTYY+PCI+WLI+ KPKKF +SW  NW FI++G++L I+APIGG+ +
Sbjct  366   GLVGFFGGFALAPTTYYLPCIIWLIVKKPKKFSISWIFNWIFIIVGVMLMIVAPIGGMRN  425

Query  326   IVKSAKTYHFYQ  291
             I+ SAK Y FYQ
Sbjct  426   IILSAKDYKFYQ  437



>ref|XP_006415799.1| hypothetical protein EUTSA_v10007648mg [Eutrema salsugineum]
 gb|ESQ34152.1| hypothetical protein EUTSA_v10007648mg [Eutrema salsugineum]
Length=441

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/439 (67%), Positives = 363/439 (83%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             + ++     AA +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGP
Sbjct  4     NERSASEIAAAKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGP  63

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +M++SW ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWI+VPQQ +VE+
Sbjct  64    GVTLMVMSWVITLYTLWQMVEMHEIVPGKRLDRYHELGQHAFGEKLGLWIIVPQQLIVEV  123

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S++KV +LLC DCK I+ +Y+I+IF+   F+ S LPNFNSIS +SL A
Sbjct  124   GVDIVYMVTGGKSLQKVHQLLCSDCKDIRTTYWIMIFASIHFVLSHLPNFNSISIISLAA  183

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS++YSTIAW +++HK +    V+Y  R+     NVF F++A+GD+AF+YAGHNVVLE
Sbjct  184   AVMSLTYSTIAWAASVHKGVHRD-VEYSSRASTTPGNVFNFLNAMGDVAFAYAGHNVVLE  242

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAF+GY   GN V DNIL+TLEKPVW
Sbjct  243   IQATIPSTPEMPSKIPMWRGVVVAYIVVAICYFPVAFLGYWIFGNSVDDNILITLEKPVW  302

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVVVHV+GSYQ++AM +FDM+ETF VK +KF P+  LRF+ R+L+VAFT+FV 
Sbjct  303   LIAMANLFVVVHVIGSYQIFAMPVFDMMETFLVKKMKFDPSFKLRFIARSLYVAFTMFVA  362

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I VPFFGGLLGFFGGFAFAPTTYY+PCI+WLIL KPKKFGLSW +NW  I++G+LLTILA
Sbjct  363   ICVPFFGGLLGFFGGFAFAPTTYYLPCIIWLILKKPKKFGLSWTINWFCIIVGVLLTILA  422

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +I+ +A TY F+ 
Sbjct  423   PIGGLRTIIVNASTYKFFS  441



>ref|XP_010528186.1| PREDICTED: lysine histidine transporter 1 [Tarenaya hassleriana]
Length=447

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/438 (64%), Positives = 356/438 (81%), Gaps = 1/438 (0%)
 Frame = -1

Query  1604  YKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPG  1425
             Y +   +  A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAM+++GWGPG
Sbjct  11    YHSSIEQKLARQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMAQLGWGPG  70

Query  1424  VAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEIS  1245
             VA+++LSW ITLYTL+QMVEMHE VPG+RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ 
Sbjct  71    VAVLVLSWVITLYTLWQMVEMHEMVPGRRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVG  130

Query  1244  LCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
             +C++YMVTGG S+KK  +L+C DCKPIKL+Y+I+IF+   F+ S LPNFNSI+ VSL AA
Sbjct  131   VCVVYMVTGGKSLKKFHDLVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSIAGVSLAAA  190

Query  1064  IMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +MS+SYSTIAW ++  K ++   V YG ++      VF F SALGD+AF+YAGHNVVLEI
Sbjct  191   VMSLSYSTIAWAASAAKGVQED-VQYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEI  249

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA +GY   GN V DNIL++L+KP W+
Sbjct  250   QATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALVGYWMFGNAVEDNILISLKKPAWI  309

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             IA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+P++TLRFV RN +VA T+FVG+
Sbjct  310   IAMANIFVVIHVIGSYQIYAMPVFDMMETLLVKRLHFRPSRTLRFVVRNFYVAATMFVGM  369

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
             + PFFGGLL FFGGFAFAPTTY++PC+MWL + KP+K+ LSW  NW  IV+G++L +++P
Sbjct  370   TFPFFGGLLAFFGGFAFAPTTYFLPCVMWLAIYKPRKYSLSWWTNWICIVLGVMLMVVSP  429

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IGGL +I+  AK Y FY 
Sbjct  430   IGGLRTIILQAKHYKFYS  447



>ref|XP_003573327.1| PREDICTED: lysine histidine transporter 2-like [Brachypodium 
distachyon]
Length=445

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/440 (66%), Positives = 352/440 (80%), Gaps = 2/440 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             +Y     +  A +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  7     NYTPPKDERTAQEKAIDDWLPITSSRKAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  66

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A+M LSW IT+YTL+QMVEMHE VPG+RFDRYHELGQ AFG KLGLWIVVPQQ +VE+
Sbjct  67    GIAVMTLSWIITVYTLWQMVEMHEIVPGRRFDRYHELGQYAFGDKLGLWIVVPQQLVVEV  126

Query  1247  SLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
             SL I+YMVTGG+S+KK  +++C   CK IKLSY+I+IF+   F+ S LPNFNSIS +SL 
Sbjct  127   SLNIVYMVTGGNSLKKFHDVICDGRCKDIKLSYFIMIFASVHFVLSQLPNFNSISGISLA  186

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AA+MS+SYSTIAWG++L K  +S  VDY  R+      VF F+  LGD+AFSY+GHNVVL
Sbjct  187   AAVMSLSYSTIAWGASLDKG-KSANVDYSLRATTTAGQVFGFLGGLGDVAFSYSGHNVVL  245

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTPD PSKK MWKGVV+AYV++A CY PVA IGY A GN V DNIL+TL KP 
Sbjct  246   EIQATIPSTPDKPSKKPMWKGVVVAYVIIAACYMPVAMIGYWAFGNSVDDNILITLNKPK  305

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLIA AN+ VVVH++GSYQ+YAM +FDM+ET  VK +KF P   LR + R ++VAFT+FV
Sbjct  306   WLIAMANMMVVVHLIGSYQIYAMPVFDMMETLLVKKMKFAPGLKLRVIARTIYVAFTMFV  365

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
             GI+ PFFGGL+GFFGG AFAPTTY++PCIMWLI+ KP++F LSW  NWT IV+G+LL I+
Sbjct  366   GITFPFFGGLIGFFGGLAFAPTTYFLPCIMWLIICKPRRFSLSWFSNWTCIVLGVLLMIV  425

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             APIGGL  I+ SAKTY FY 
Sbjct  426   APIGGLRQIIMSAKTYKFYS  445



>ref|XP_009140039.1| PREDICTED: lysine histidine transporter 1 [Brassica rapa]
Length=442

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/432 (66%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+ +M+L
Sbjct  12    EKSARQKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGITVMVL  71

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI +CI+YM
Sbjct  72    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEIGVCIVYM  131

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  +L+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  132   VTGGKSLKKFHDLVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSY  191

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW ++  K ++   V+YG ++      VF F S LGD+AF+YAGHNVVLEIQATIPS
Sbjct  192   STIAWAASASKGVQED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPS  250

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MWKGV++AY+VVA+CY+PVAF+GY   GN V DNIL++L+KP WLIA AN+
Sbjct  251   TPEKPSKGPMWKGVIVAYIVVALCYFPVAFVGYYIFGNGVDDNILMSLKKPAWLIATANM  310

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+F+G++ PFFG
Sbjct  311   FVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRNFYVAVTMFLGMTFPFFG  370

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLL FFGGFAFAPTTY++PCI+WL + KP+K+GLSW  NW  IV GI L +L+PIGGL +
Sbjct  371   GLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYGLSWWANWVCIVFGIFLMVLSPIGGLRT  430

Query  326   IVKSAKTYHFYQ  291
             IV  AK Y FY 
Sbjct  431   IVIQAKEYKFYS  442



>ref|XP_009381698.1| PREDICTED: lysine histidine transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=438

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/444 (66%), Positives = 352/444 (79%), Gaps = 8/444 (2%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSE  1443
             E E  D +    K       +DDWLP+ S RS KWWYS FHNVTAMVGAG+LSLPYAM+E
Sbjct  3     EPERNDLQQSKEK------AIDDWLPITSNRSAKWWYSAFHNVTAMVGAGVLSLPYAMAE  56

Query  1442  MGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQ  1263
             +GWGPGVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWI+VPQQ
Sbjct  57    LGWGPGVAVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGEKLGLWIIVPQQ  116

Query  1262  ALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISF  1083
              +VE+   I+YMVTGG SIKK  + +C DCK IKLSY+I+IF+  QF+ S LP+FNSIS 
Sbjct  117   LIVEVGTDIVYMVTGGRSIKKFHDTICPDCKNIKLSYFIMIFASVQFVLSQLPDFNSISG  176

Query  1082  VSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGH  903
             VSL AA+MS+SYSTIAW +++ K      VDY  ++   T  VF F+SALGD+AF+YAGH
Sbjct  177   VSLAAAVMSLSYSTIAWVASVEK--GQPDVDYSYKASTTTGVVFNFLSALGDVAFAYAGH  234

Query  902   NVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTL  723
             NVVLEIQATIPSTP+ PSKK MW+GVV+AY+VVA+CY+PVA IGY A GN V DNIL+TL
Sbjct  235   NVVLEIQATIPSTPEKPSKKPMWRGVVVAYLVVAICYFPVALIGYWAFGNAVDDNILITL  294

Query  722   EKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAF  543
             EKP WLIA ANIFVV+HV+GSYQ+YAM +FDMIET  VK     P  TLR V R+ +VAF
Sbjct  295   EKPRWLIATANIFVVIHVIGSYQIYAMPVFDMIETVLVKKFHLPPGLTLRLVARSAYVAF  354

Query  542   TLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGIL  363
             T+FVGI+VPFFGGLLGF GGFAFAPTTY++PCIMWL + KPKKF LSW  NW  I++G+L
Sbjct  355   TMFVGIAVPFFGGLLGFLGGFAFAPTTYFLPCIMWLAIYKPKKFSLSWITNWICIILGVL  414

Query  362   LTILAPIGGLWSIVKSAKTYHFYQ  291
             L IL+PIGG+ +I+ SAK Y F+ 
Sbjct  415   LMILSPIGGMRTIILSAKDYAFFS  438



>ref|XP_002509568.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF50955.1| amino acid transporter, putative [Ricinus communis]
Length=440

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/440 (66%), Positives = 358/440 (81%), Gaps = 1/440 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M  Y+++  +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GW
Sbjct  1     MCCYESQDQETLARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGV ++++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +V
Sbjct  61    GPGVVVLVISWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ +CI+YMVTGG S+KK  +L+C  CKPIK +Y+I+IF+   F+ S LPN NSIS VSL
Sbjct  121   EVGVCIVYMVTGGKSLKKFHDLVCSTCKPIKQTYFIMIFASVHFVLSHLPNLNSISGVSL  180

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS+SYSTIAW +++HK ++   V YG ++      VF F SALG++AF+YAGHNVV
Sbjct  181   AAAVMSLSYSTIAWTASVHKGVQPD-VQYGYKAKSAAGTVFNFFSALGEVAFAYAGHNVV  239

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN V DNIL++L+KP
Sbjct  240   LEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMYGNSVEDNILISLQKP  299

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
             VWLIA AN+FVVVHV+GSYQ+YAM +FDM+ET  VK L FKP+  LRFV RN++VAFT+F
Sbjct  300   VWLIAMANLFVVVHVIGSYQIYAMPVFDMMETVLVKKLNFKPSMMLRFVVRNIYVAFTMF  359

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             VGI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL++ KP+K+ LSW  NW  IVIG+LL I
Sbjct  360   VGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLVIYKPRKYSLSWWTNWICIVIGVLLMI  419

Query  353   LAPIGGLWSIVKSAKTYHFY  294
             ++PIG L  I+  AK Y FY
Sbjct  420   VSPIGALRQIILDAKDYEFY  439



>ref|XP_007210727.1| hypothetical protein PRUPE_ppa022404mg [Prunus persica]
 gb|EMJ11926.1| hypothetical protein PRUPE_ppa022404mg [Prunus persica]
Length=432

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/425 (66%), Positives = 352/425 (83%), Gaps = 1/425 (0%)
 Frame = -1

Query  1565  EVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAITLY  1386
             +++DWLP+   R+  WWYS FHNVTAMVGAG+L LPYAMS++GWGPGVA+++LSW ITLY
Sbjct  9     DINDWLPITKSRNANWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGVAVLVLSWIITLY  68

Query  1385  TLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGSSI  1206
             TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE  +CI+YM+TGG+SI
Sbjct  69    TLWQMVEMHEIVPGKRFDRYHELGQHAFGEKLGLWVVVPQQLMVECGVCIVYMITGGNSI  128

Query  1205  KKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAWGS  1026
             KK+ + LC +CK IK +Y+I+IF+   F+ S LP+FNSI+ VSL AA+MS+SYSTIAW +
Sbjct  129   KKIHDTLCPNCKSIKTTYFIMIFASVHFVLSHLPSFNSIAGVSLAAAVMSLSYSTIAWTA  188

Query  1025  ALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNPSK  846
             ++HK ++   V YGP++     NVF F SALG++AF++AGHNVVLEIQATIPSTP+ PSK
Sbjct  189   SVHKGVDPE-VQYGPKASSTAGNVFNFFSALGNVAFAFAGHNVVLEIQATIPSTPEKPSK  247

Query  845   KAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvhvV  666
             K MWKGV IAYVVVA+CY+PVA IGY   GN V DNIL++L+KP WLIA AN FVV+HV+
Sbjct  248   KPMWKGVFIAYVVVALCYFPVAMIGYWVFGNNVEDNILISLQKPRWLIALANFFVVIHVI  307

Query  665   GSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllgffg  486
             GSYQV+AM +FDM+E+F V  +KFKP+ +LRF+TR  FVAFTLF+GI+ PFFGGLL FFG
Sbjct  308   GSYQVFAMPVFDMLESFLVTVMKFKPSMSLRFLTRTAFVAFTLFIGITFPFFGGLLSFFG  367

Query  485   gfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKSAKT  306
             GFAFAPTTY++PC+MWL++ KPKKFGLSW  NW  I++G+LL +L+PIG L +I+  AK 
Sbjct  368   GFAFAPTTYFLPCVMWLVMYKPKKFGLSWWANWLCIIVGVLLMVLSPIGALKNIILQAKD  427

Query  305   YHFYQ  291
             + FY 
Sbjct  428   FKFYS  432



>ref|XP_009802950.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana sylvestris]
Length=455

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/436 (68%), Positives = 358/436 (82%), Gaps = 8/436 (2%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV +M++SW 
Sbjct  21    AEEKAIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVTVMVVSWI  80

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTG
Sbjct  81    VTLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTG  140

Query  1217  GSSIKKVVELLC-------HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             G S+ KV EL+C       H  K IKLSY+I+IF+   F+ S LPNFNSIS VSL AA+M
Sbjct  141   GRSLMKVHELVCKKNEDNIHCTKDIKLSYFIMIFASVHFVLSHLPNFNSISGVSLAAAVM  200

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S+SYSTIAWG+++ K ++S  VDYG ++H  +  VF F+S LG++AF+YAGHNVVLEIQA
Sbjct  201   SLSYSTIAWGASVKKGVQSD-VDYGYKAHSTSGTVFNFLSGLGEVAFAYAGHNVVLEIQA  259

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAFIGY   GN VSDNIL++LEKP WLI 
Sbjct  260   TIPSTPEKPSKIPMWRGVVVAYIVVALCYFPVAFIGYWMFGNSVSDNILVSLEKPTWLIV  319

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              AN+FVVVHV+GSYQ+YAM +FDMIET  VK L+F+PT  LRFVTRN++VAFT+FVGI+ 
Sbjct  320   MANMFVVVHVIGSYQIYAMPVFDMIETVLVKKLRFRPTWYLRFVTRNIYVAFTMFVGITF  379

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP+++ LSW  NW  I+ G+LL +LAPIG
Sbjct  380   PFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRWSLSWITNWICIIFGVLLMVLAPIG  439

Query  338   GLWSIVKSAKTYHFYQ  291
             GL SI+  AKTY FY 
Sbjct  440   GLRSIIVQAKTYKFYN  455



>ref|XP_010554094.1| PREDICTED: lysine histidine transporter 1-like [Tarenaya hassleriana]
Length=447

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/429 (66%), Positives = 352/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAM+E+GWGPGV +++LSW 
Sbjct  20    ARQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMAELGWGPGVVVLVLSWV  79

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YMVTG
Sbjct  80    ITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGVCIVYMVTG  139

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  +L+C +CK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  140   GKSLKKFHDLVCENCKSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  199

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW ++  K ++   V+YG ++      VF F SALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  200   AWAASAAKGVQKD-VEYGYKAKTTAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPE  258

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MW+GVV+AY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLIA ANIFVV
Sbjct  259   KPSKGPMWRGVVVAYIVVALCYFPVALVGYWMFGNAVEDNILISLKKPAWLIATANIFVV  318

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK L+F+P++ LRFV RN +VA T+FVG++ PFFGGLL
Sbjct  319   IHVIGSYQIYAMPVFDMMETVLVKKLRFRPSRALRFVVRNFYVAATMFVGMTFPFFGGLL  378

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PCIMWL + KP+K+ LSW  NW  IV+G+LL +++PIGGL +I+ 
Sbjct  379   AFFGGFAFAPTTYFLPCIMWLAIYKPRKYSLSWWANWICIVLGVLLMVISPIGGLRTIIL  438

Query  317   SAKTYHFYQ  291
              AK Y FY 
Sbjct  439   QAKDYKFYS  447



>gb|EAY82729.1| hypothetical protein OsI_37940 [Oryza sativa Indica Group]
Length=444

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/433 (67%), Positives = 352/433 (81%), Gaps = 4/433 (1%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP+AMSE+GWGPGVA MI+SW 
Sbjct  12    AEEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPFAMSELGWGPGVAAMIMSWV  71

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHECVPG+RFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +CI+YMVTG
Sbjct  72    ITLYTLWQMVEMHECVPGRRFDRYHELGQHAFGDKLGLWIVVPQQLVVEVGVCIVYMVTG  131

Query  1217  GSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             G S+KK  +L+      PI+ SY+I+IF     + S LPNFNSI+ VSL AA+MS+SYST
Sbjct  132   GKSLKKFHDLVAPPSAPPIRTSYFIVIFGCLHLVLSQLPNFNSITGVSLAAAVMSLSYST  191

Query  1040  IAWGSALHKWIESH---AVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIP  870
             IAW ++LH    ++   AVDY   +       F F+SALGD+AF+YAGHNVVLEIQATIP
Sbjct  192   IAWAASLHHRNHNNGAAAVDYSLTAATPAGRTFNFLSALGDVAFAYAGHNVVLEIQATIP  251

Query  869   STPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAAN  690
             STP+ PSK  MW+GVV+AY VVA+CY PVAF GY   GN V DN+L+TLE+P WLIAAAN
Sbjct  252   STPERPSKGPMWRGVVLAYGVVAVCYLPVAFAGYYVFGNAVDDNVLITLERPAWLIAAAN  311

Query  689   IFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPff  510
             +FVVVHVVGSYQ+YAM +FDM+ETF VK L+FKP   LR + R+L+V FT+FV I+VPFF
Sbjct  312   MFVVVHVVGSYQIYAMPVFDMLETFLVKKLRFKPGMPLRLIARSLYVLFTMFVAIAVPFF  371

Query  509   ggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLW  330
             GGLLGFFGGFAFAPTTY++PCIMWL +MKPK+FGLSWC+NW  I+IG+LL++ APIGGL 
Sbjct  372   GGLLGFFGGFAFAPTTYFLPCIMWLSIMKPKRFGLSWCINWFCIIIGVLLSVFAPIGGLR  431

Query  329   SIVKSAKTYHFYQ  291
             SI+ +A++Y F+ 
Sbjct  432   SIIVNAQSYKFFS  444



>ref|XP_002890710.1| hypothetical protein ARALYDRAFT_890234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66969.1| hypothetical protein ARALYDRAFT_890234 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/442 (66%), Positives = 366/442 (83%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAK-PAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +   ++  AA +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGNNEMSASEVAAARQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +M++SW IT+YTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTIMVMSWLITMYTLWQMVEMHEIVPGKRLDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG+S+KKV +LLC DCK I+ +++I+IF+   F+ S LPNFNSIS +S
Sbjct  121   VEVGVDIVYMVTGGASLKKVHQLLCSDCKEIRTTFWIMIFASIHFVISHLPNFNSISIIS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS++YSTIAW +++HK +    VDY PR+      VF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLTYSTIAWTASVHKGVHPD-VDYTPRASTDAGKVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAF+GY   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPEMPSKIPMWRGVVVAYIVVAICYFPVAFLGYYIFGNSVDDNILITLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVVVHV+GSYQ++AM +FDM+ET  VK + F P+  LRF+TR+L+VAFT+
Sbjct  300   PVWLIAMANMFVVVHVIGSYQIFAMPVFDMMETVLVKKMNFDPSFKLRFITRSLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
              V I VPFFGGLLGFFGGFAFAPTTYY+PCI+WL+L KPK+FGLSW +NW  I++G+LLT
Sbjct  360   IVAICVPFFGGLLGFFGGFAFAPTTYYLPCIIWLVLKKPKRFGLSWTINWFCIIVGVLLT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ILAPIGGL +I+ +AKTY F+ 
Sbjct  420   ILAPIGGLRTIIINAKTYKFFS  441



>ref|XP_006447153.1| hypothetical protein CICLE_v10015213mg [Citrus clementina]
 ref|XP_006469983.1| PREDICTED: lysine histidine transporter 1-like [Citrus sinensis]
 gb|ESR60393.1| hypothetical protein CICLE_v10015213mg [Citrus clementina]
Length=451

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/436 (67%), Positives = 355/436 (81%), Gaps = 2/436 (0%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             A   + AA +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGVA
Sbjct  16    ATSEEQAAKQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVA  75

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +C
Sbjct  76    ILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVC  135

Query  1238  IIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             I+YMVTGG S+ KV ELLC + CK IKLSY+I+IF+   F+ S LPNFNSI+ VSL AA+
Sbjct  136   IVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNSIAGVSLAAAV  195

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTIAW +++ K ++   V YG ++      VF F SALGD+AF+YAGHNVVLEIQ
Sbjct  196   MSLSYSTIAWSASVRKGVQPD-VAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQ  254

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN+V DNILL+LEKP WLI
Sbjct  255   ATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKVEDNILLSLEKPTWLI  314

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
               AN FVVVHV+GSYQ+YAM +FDMIET  VK L F PT+ LRFV RNL+VA T+F+GI+
Sbjct  315   VMANFFVVVHVIGSYQIYAMPVFDMIETLLVKKLNFSPTRLLRFVVRNLYVASTMFIGIT  374

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFFGGLLGFFGGFAFAPTTY++PCI+WL + KP+K+ LSWC+NW  IV+G+ L IL+PI
Sbjct  375   FPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWCINWICIVLGLCLMILSPI  434

Query  341   GGLWSIVKSAKTYHFY  294
             GGL  I+  AK Y FY
Sbjct  435   GGLRQIILQAKDYKFY  450



>ref|XP_007140885.1| hypothetical protein PHAVU_008G149600g [Phaseolus vulgaris]
 gb|ESW12879.1| hypothetical protein PHAVU_008G149600g [Phaseolus vulgaris]
Length=448

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/448 (65%), Positives = 355/448 (79%), Gaps = 1/448 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             M     +E    K    +    +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     MATQTPVENNYLKNATEEELQRQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  60

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAMSE+GWGPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I
Sbjct  61    YAMSELGWGPGVTVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYI  120

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VEI + I+YMVTGG S++K  + +C  CK IKL+++I+IF+   F+ S LPNF
Sbjct  121   VVPQQLVVEIGVNIVYMVTGGKSLQKFHDTVCDSCKKIKLTFFIMIFASVHFVLSHLPNF  180

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VSL AA+MS+SYSTIAW ++ HK ++   V YG ++   +  VF F SALGD+AF
Sbjct  181   NSISGVSLAAAVMSLSYSTIAWAASAHKGVQED-VQYGYKAKSTSGTVFNFFSALGDVAF  239

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGVVIAY+VVA+CY+PVA IGY   GN V DN
Sbjct  240   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVVIAYIVVALCYFPVALIGYWMFGNGVQDN  299

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL++LEKP WLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F P++ LRF+ RN
Sbjct  300   ILISLEKPKWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLNFNPSRVLRFIVRN  359

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             L+VAFT+ V I+ PFFGGLLGFFGGFAFAPTTY++PC+MWL + KPK+F LSWC NW  I
Sbjct  360   LYVAFTMVVAITFPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPKRFSLSWCTNWICI  419

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFY  294
             V+G++L IL+PIGGL +I+  AK YHFY
Sbjct  420   VLGLMLMILSPIGGLRTIIIDAKNYHFY  447



>ref|XP_008231173.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Prunus 
mume]
Length=464

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/442 (64%), Positives = 356/442 (81%), Gaps = 1/442 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             E  + +++  +    + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  24    ERPEKQSQIDEQLKRQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  83

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPG  +++LSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  84    WGPGTVILVLSWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  143

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
              E+ + I+YMVTGG S++K+  +   D  PIKL+Y+I+IF+   F+ + LPNFNSIS VS
Sbjct  144   CEVGVDIVYMVTGGKSLQKIHNIARKDKDPIKLTYFIMIFASAHFVLAHLPNFNSISGVS  203

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++HK ++   V+YG  +   +  VF F +ALGD+AF+YAGHNV
Sbjct  204   LAAAVMSLSYSTIAWTASVHKGVQPD-VEYGYLAPSTSGTVFNFFTALGDVAFAYAGHNV  262

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPS+P+ PSKK MW+GVVIAY+VVA+CY+PVAFIGY   GN+V DNIL++LEK
Sbjct  263   VLEIQATIPSSPEKPSKKPMWRGVVIAYIVVALCYFPVAFIGYYIFGNKVEDNILISLEK  322

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+PT  LRF++RN +VAFT+
Sbjct  323   PEWLIITANMFVVIHVIGSYQLYAMPVFDMIETLLVKKLHFRPTTMLRFISRNTYVAFTM  382

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+ PFFGGLLGFFGGFAF+PTTY++PCIMWL + KP+KF LSW +NW  I +G+LL 
Sbjct  383   FVGITFPFFGGLLGFFGGFAFSPTTYFLPCIMWLTIKKPRKFSLSWVVNWICITLGVLLM  442

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             IL+PIGGL +I+  AK Y FY 
Sbjct  443   ILSPIGGLRNIILQAKNYKFYN  464



>ref|XP_009359534.1| PREDICTED: lysine histidine transporter 1-like [Pyrus x bretschneideri]
Length=441

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/439 (66%), Positives = 353/439 (80%), Gaps = 3/439 (1%)
 Frame = -1

Query  1610  GDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWG  1431
             G+ + E  +      +++DWLP+   R+  WWYS FHNVTAMVGAG+L LPYAMS++GWG
Sbjct  5     GEIREEEQQKEVQ--DINDWLPITKSRNATWWYSAFHNVTAMVGAGVLGLPYAMSQLGWG  62

Query  1430  PGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVE  1251
             PGVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE
Sbjct  63    PGVAVLVLSWIITLYTLWQMVEMHEIVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLMVE  122

Query  1250  ISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
             +  CI+YM+TGG+S+KK+   +C DCKPIK +Y+I+IF+   F+ S LP+ NSI+ VSL 
Sbjct  123   LGTCIVYMITGGNSLKKIHSTVCPDCKPIKTTYFIMIFASVHFVLSHLPSLNSIASVSLA  182

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AA+MS+SYSTIAWG++LHK +E   V YGPR+     N F F SALGD+AF++AGHNVVL
Sbjct  183   AAVMSLSYSTIAWGASLHKGVEPQ-VQYGPRASTAAGNTFNFFSALGDIAFAFAGHNVVL  241

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP+ PSKK MWKGVV+AY+VVAMCY PVA IGY   GN V DNIL++LEKP 
Sbjct  242   EIQATIPSTPEKPSKKPMWKGVVLAYIVVAMCYLPVALIGYWVFGNHVEDNILISLEKPA  301

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLI  AN FVVVHV+GSYQVYAM +FDM E F +K +KFKP+   RF+TRN+ VAFTLFV
Sbjct  302   WLIVLANCFVVVHVIGSYQVYAMPVFDMAELFLLKKMKFKPSLFRRFITRNVIVAFTLFV  361

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
             GI+ PFFGGLLGFFGGFAFAPTTYY+PCIMWL++ KPKKFGLSW  NW  I++G+ L +L
Sbjct  362   GITFPFFGGLLGFFGGFAFAPTTYYLPCIMWLVICKPKKFGLSWFANWFCIIVGVSLMLL  421

Query  350   APIGGLWSIVKSAKTYHFY  294
             APIG L +++  AK + FY
Sbjct  422   APIGALRNLILQAKNFKFY  440



>emb|CDY52705.1| BnaA04g10600D [Brassica napus]
Length=442

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/432 (66%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+ +M+L
Sbjct  12    EKSARQKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGITVMVL  71

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI +CI+YM
Sbjct  72    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEIGVCIVYM  131

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  +L+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  132   VTGGKSLKKFHDLVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSY  191

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW +++ K ++   V+YG ++      VF F S LGD+AF+YAGHNVVLEIQATIPS
Sbjct  192   STIAWAASVSKGVQED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLEIQATIPS  250

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MWKGVV+AY+VVA+CY+PVAF+GY   GN V DNIL++L+KP WLIA AN+
Sbjct  251   TPEKPSKGPMWKGVVVAYIVVALCYFPVAFVGYYIFGNGVDDNILMSLKKPAWLIATANM  310

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  RN +VA T+F+G++ PFFG
Sbjct  311   FVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRNFYVAATMFLGMTFPFFG  370

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLL FFGGFAFAPTTY++PCI+WL + KP+K+ LSW  NW  IV GI L +L+PIGGL +
Sbjct  371   GLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWWANWVCIVFGIFLMVLSPIGGLRT  430

Query  326   IVKSAKTYHFYQ  291
             IV  AK Y FY 
Sbjct  431   IVIQAKEYKFYS  442



>emb|CDY11714.1| BnaC06g13220D [Brassica napus]
Length=443

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/439 (65%), Positives = 350/439 (80%), Gaps = 4/439 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY  E     A + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  9     DYDDENL---ARQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  65

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  66    GVAVLVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  125

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  126   GVCIVYMVTGGQSLKKFHELVCEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  185

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW ++  K +    V+YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  186   AVMSLSYSTIAWAASTSKGVRED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLE  244

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DN+L++L+KP W
Sbjct  245   IQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNSVEDNLLISLKKPAW  304

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  R+ +VA T+F+G
Sbjct  305   LIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRSFYVAATMFLG  364

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PCI+WL + KP+K+ LSW  NW  IV GI L +L+
Sbjct  365   MTFPFFGGLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWWANWVCIVFGIFLMVLS  424

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +IV  AK Y FY 
Sbjct  425   PIGGLRTIVIQAKEYQFYS  443



>ref|XP_008231174.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Prunus 
mume]
Length=461

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/442 (64%), Positives = 356/442 (81%), Gaps = 1/442 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             E  + +++  +    + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  21    ERPEKQSQIDEQLKRQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  80

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPG  +++LSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  81    WGPGTVILVLSWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  140

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
              E+ + I+YMVTGG S++K+  +   D  PIKL+Y+I+IF+   F+ + LPNFNSIS VS
Sbjct  141   CEVGVDIVYMVTGGKSLQKIHNIARKDKDPIKLTYFIMIFASAHFVLAHLPNFNSISGVS  200

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++HK ++   V+YG  +   +  VF F +ALGD+AF+YAGHNV
Sbjct  201   LAAAVMSLSYSTIAWTASVHKGVQPD-VEYGYLAPSTSGTVFNFFTALGDVAFAYAGHNV  259

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPS+P+ PSKK MW+GVVIAY+VVA+CY+PVAFIGY   GN+V DNIL++LEK
Sbjct  260   VLEIQATIPSSPEKPSKKPMWRGVVIAYIVVALCYFPVAFIGYYIFGNKVEDNILISLEK  319

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+PT  LRF++RN +VAFT+
Sbjct  320   PEWLIITANMFVVIHVIGSYQLYAMPVFDMIETLLVKKLHFRPTTMLRFISRNTYVAFTM  379

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+ PFFGGLLGFFGGFAF+PTTY++PCIMWL + KP+KF LSW +NW  I +G+LL 
Sbjct  380   FVGITFPFFGGLLGFFGGFAFSPTTYFLPCIMWLTIKKPRKFSLSWVVNWICITLGVLLM  439

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             IL+PIGGL +I+  AK Y FY 
Sbjct  440   ILSPIGGLRNIILQAKNYKFYN  461



>ref|XP_002298599.2| hypothetical protein POPTR_0001s36340g [Populus trichocarpa]
 gb|EEE83404.2| hypothetical protein POPTR_0001s36340g [Populus trichocarpa]
Length=449

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 356/439 (81%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D   E ++    K E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+ +GWGP
Sbjct  12    DVPEELSEADRRKKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMANLGWGP  71

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G  +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+
Sbjct  72    GTVILVLSWTITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLICEV  131

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S++K+  L+C DC PIKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  132   GVDIVYMVTGGKSLQKIHNLVCKDCAPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  191

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW +++HK ++   VDYG ++   +  VF F SALGD+AF+YAGHNVVLE
Sbjct  192   AVMSLSYSTIAWSASVHKGVQPD-VDYGYKASTTSGTVFNFFSALGDVAFAYAGHNVVLE  250

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPS P  PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN+V DNIL++LEKP W
Sbjct  251   IQATIPSKPGKPSKGPMWKGVVVAYIVVALCYFPVALIGYYMFGNKVEDNILISLEKPTW  310

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LI AAN+FVV+HV+GSYQ+YA+ +FDM+ET  VK L F+P++ LRF+TRN++VAFT+FVG
Sbjct  311   LIVAANMFVVIHVIGSYQIYAIPVFDMLETLLVKKLHFRPSRKLRFITRNIYVAFTMFVG  370

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I  PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  I++G LL IL+
Sbjct  371   ICFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWITNWICIILGFLLMILS  430

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +I+ +AK Y F+ 
Sbjct  431   PIGGLRTIILNAKGYKFFS  449



>gb|KDO55693.1| hypothetical protein CISIN_1g013039mg [Citrus sinensis]
Length=451

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/436 (67%), Positives = 355/436 (81%), Gaps = 2/436 (0%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             A   + AA +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGVA
Sbjct  16    ATSEEQAAKQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVA  75

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +C
Sbjct  76    ILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVC  135

Query  1238  IIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             I+YMVTGG S+ KV ELLC + CK IKLSY+I+IF+   F+ S LPNFN+I+ VSL AA+
Sbjct  136   IVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNAIAGVSLAAAV  195

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTIAW +++ K ++   V YG ++      VF F SALGD+AF+YAGHNVVLEIQ
Sbjct  196   MSLSYSTIAWSASVRKGVQPD-VAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQ  254

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN+V DNILL+LEKP WLI
Sbjct  255   ATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKVEDNILLSLEKPTWLI  314

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
               AN FVVVHV+GSYQ+YAM +FDMIET  VK L F PT+ LRFV RNL+VA T+F+GI+
Sbjct  315   VMANFFVVVHVIGSYQIYAMPVFDMIETLLVKKLNFSPTRLLRFVVRNLYVASTMFIGIT  374

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFFGGLLGFFGGFAFAPTTY++PCI+WL + KP+K+ LSWC+NW  IV+G+ L IL+PI
Sbjct  375   FPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWCINWICIVLGLCLMILSPI  434

Query  341   GGLWSIVKSAKTYHFY  294
             GGL  I+  AK Y FY
Sbjct  435   GGLRQIILQAKDYKFY  450



>ref|XP_007140886.1| hypothetical protein PHAVU_008G149700g [Phaseolus vulgaris]
 gb|ESW12880.1| hypothetical protein PHAVU_008G149700g [Phaseolus vulgaris]
Length=448

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/448 (65%), Positives = 355/448 (79%), Gaps = 1/448 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             M     +E    K    +    +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     METQTAVENNYLKNASEEELQRQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  60

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAMSE+GWGPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I
Sbjct  61    YAMSELGWGPGVTVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYI  120

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VEI + I+YMVTGG S++K+ + +C +CK IKL+++I+IF+   F+ S LPNF
Sbjct  121   VVPQQLVVEIGVNIVYMVTGGRSLQKLHDTVCDNCKKIKLTFFIMIFASVHFVLSHLPNF  180

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VSL AA+MS+SYSTIAW ++ HK ++   V YG ++  K+  VF F S LGD+AF
Sbjct  181   NSISGVSLAAAVMSLSYSTIAWAASAHKGVQED-VQYGYKATSKSGTVFNFFSGLGDVAF  239

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGV++AY VVA+CY+PVA IGY   GN V DN
Sbjct  240   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVLVAYTVVALCYFPVALIGYWMFGNGVEDN  299

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL++LEKP WLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L FKP++ LRF+ RN
Sbjct  300   ILISLEKPKWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVMVKKLNFKPSRMLRFIVRN  359

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             L+VAFT+FVGI  PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPKKF LSWC NW  I
Sbjct  360   LYVAFTMFVGIIFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKKFSLSWCCNWVCI  419

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFY  294
               G+ L IL+PIGGL SI+ SAK Y F+
Sbjct  420   AFGLFLMILSPIGGLRSIIISAKNYEFF  447



>ref|XP_009103008.1| PREDICTED: lysine histidine transporter 2 [Brassica rapa]
Length=441

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/430 (68%), Positives = 360/430 (84%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA + +VDDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +MILSW
Sbjct  13    AAKQKKVDDWLPITSSRKAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVTLMILSW  72

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  73    LITLYTLWQMVEMHEIVPGKRLDRYHELGQEAFGEKLGLWIVVPQQLIVEVGVDIVYMVT  132

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KKV ELLC DCK I+ +++I+IF+   F+ S LPNFNSIS +SL AA+MS++YST
Sbjct  133   GGKSLKKVHELLCPDCKDIRTTFWIMIFASVHFVISHLPNFNSISGISLAAAVMSLTYST  192

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW +++HK ++   VDY  R+      VF F++A+GD+AF+YAGHNVVLEIQATIPSTP
Sbjct  193   IAWAASVHKGVKPD-VDYSYRASTTPGKVFNFLNAMGDVAFAYAGHNVVLEIQATIPSTP  251

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GVV+AY+VVA+CY+PVAF+GY   GN V DNIL+TLEKPVWL+A AN+FV
Sbjct  252   EVPSKVPMWRGVVVAYIVVAICYFPVAFLGYWTFGNSVDDNILMTLEKPVWLVAMANLFV  311

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQ++AM +FDM+ET  VK L F P+ TLRF+TR+L+VAFT+F+ I +PFFGGL
Sbjct  312   VVHVIGSYQIFAMPVFDMMETVLVKKLNFDPSFTLRFITRSLYVAFTMFIAICIPFFGGL  371

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTYY+PCI+WLIL KPK+FGLSW +NW  I++G++LTILAPIGGL +I+
Sbjct  372   LGFFGGFAFAPTTYYLPCIIWLILKKPKRFGLSWTINWFCIIVGVILTILAPIGGLRTII  431

Query  320   KSAKTYHFYQ  291
              +A TY F+ 
Sbjct  432   INASTYKFFS  441



>ref|XP_004304006.1| PREDICTED: lysine histidine transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/437 (65%), Positives = 353/437 (81%), Gaps = 1/437 (0%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             + E  +  A +  ++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAM+E+GWGPG+
Sbjct  15    QTELDEKLAKEKAINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMAELGWGPGI  74

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +
Sbjct  75    TILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGV  134

Query  1241  CIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             CI+YMVTGG S++KV + +C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+
Sbjct  135   CIVYMVTGGKSLQKVHDTVCSDCKNIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAV  194

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTIAW +AL K    + VDY  ++   T N F F++ALG++AF+YAGHNVVLEIQ
Sbjct  195   MSLSYSTIAWTAALDKGTVEN-VDYSYKAKTTTGNFFNFLAALGEVAFAYAGHNVVLEIQ  253

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSK  MWKGV++AY++VA+CY+PVA +GY   GN V DNIL++LEKP WLI
Sbjct  254   ATIPSTPEKPSKVPMWKGVIVAYIIVALCYFPVALVGYYIYGNSVEDNILVSLEKPKWLI  313

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             A AN+FVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRFVTR  +VA T+FVGI+
Sbjct  314   ATANMFVVIHVIGSYQIYAMPVFDMMETLLVKKLDFRPTFMLRFVTRTSYVAITMFVGIT  373

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFF GLLGFFGGFAFAPTTY++PC+MWL + KP++F LSWC N+  I  G+LL +L+PI
Sbjct  374   FPFFSGLLGFFGGFAFAPTTYFLPCVMWLAIYKPRRFSLSWCCNYICIFFGVLLMVLSPI  433

Query  341   GGLWSIVKSAKTYHFYQ  291
             GGL SI+  AKTY FY 
Sbjct  434   GGLRSIIVQAKTYKFYS  450



>ref|XP_002888613.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64872.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/443 (66%), Positives = 360/443 (81%), Gaps = 1/443 (0%)
 Frame = -1

Query  1619  LEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEM  1440
             +E           +  +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +
Sbjct  1     MEKSQLSPTKDDASTKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNL  60

Query  1439  GWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQA  1260
             GWGPGV +MI+SW IT YT++QMV+MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ 
Sbjct  61    GWGPGVTIMIMSWLITFYTIWQMVQMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQL  120

Query  1259  LVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFV  1080
             +VE+ + I+YMVTGG S+KK+ +LLC DCK I+ SY+I+IF+   F+ + LPNFNS+S V
Sbjct  121   IVEVGVDIVYMVTGGKSLKKIHDLLCTDCKNIRTSYWIMIFASIHFVLAHLPNFNSMSIV  180

Query  1079  SLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHN  900
             SL AA+MS+SYSTIAW +++ K +  + VDY  R+   + NVF F++ALGD+AF+YAGHN
Sbjct  181   SLAAAVMSLSYSTIAWATSVKKGVHPN-VDYSSRASTTSGNVFNFLNALGDVAFAYAGHN  239

Query  899   VVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLE  720
             VVLEIQATIPSTP+ PSK AMWKGVV+AYVVVA+CY+PVAF+ Y   GN V DNIL+TL+
Sbjct  240   VVLEIQATIPSTPEKPSKIAMWKGVVVAYVVVAICYFPVAFVCYYIFGNSVDDNILMTLQ  299

Query  719   KPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFT  540
             KP+WLIA AN FVVVHV+GSYQ+YAM +FDM+ETF VK + F P+  LRF+TR L+VAFT
Sbjct  300   KPIWLIAIANAFVVVHVIGSYQIYAMPVFDMLETFLVKKMMFAPSFKLRFITRTLYVAFT  359

Query  539   LFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILL  360
             +FV I +PFFGGLLGFFGGFAFAPTTYY+PCIMWL + KPKK+GLSWC+NW  IV+G++L
Sbjct  360   MFVAICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLCIKKPKKYGLSWCINWFCIVVGVIL  419

Query  359   TILAPIGGLWSIVKSAKTYHFYQ  291
             TI+APIGGL +I+ SAK Y F+ 
Sbjct  420   TIVAPIGGLRTIIISAKNYKFFS  442



>gb|AGN03890.1| lysine histidine transporter [Panax ginseng]
Length=449

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/445 (65%), Positives = 354/445 (80%), Gaps = 2/445 (0%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSE  1443
             + +  D      +  A +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMSE
Sbjct  6     QTDHHDNSNNVDRRTAKEKAIDDWLPITSSRHAKWWYSAFHNVTAMVGAGVLSLPYAMSE  65

Query  1442  MGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQ  1263
             +GWGPGVA++++SW +TLYTL+QMVEMHE VPG+RFDRYHELGQ AFG KLGL+IVVPQQ
Sbjct  66    LGWGPGVAVLVISWVVTLYTLWQMVEMHEMVPGRRFDRYHELGQYAFGEKLGLYIVVPQQ  125

Query  1262  ALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSIS  1086
              +VE+ + I+YMVTGG S+KK  +L+C  DCK IKL+++I+IF+   F+ S LPNFNSIS
Sbjct  126   LIVEVGMDIVYMVTGGKSLKKFHDLICKKDCKDIKLTFFIMIFASVHFVLSHLPNFNSIS  185

Query  1085  FVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAG  906
             +VSL+AAIMS+SYSTIAW +++ K ++   V+YG ++      VF F SALGD+AF+YAG
Sbjct  186   WVSLVAAIMSLSYSTIAWSASVKKGVQPD-VEYGYKAKSTAGTVFNFFSALGDVAFAYAG  244

Query  905   HNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLT  726
             HNVVLEIQATIPSTP+ PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN VSDNIL+T
Sbjct  245   HNVVLEIQATIPSTPEKPSKGPMWKGVVVAYIVVALCYFPVALIGYWMFGNAVSDNILIT  304

Query  725   LEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVA  546
             LEKP WLIA ANIFVV HV+GSYQ+YAM +FDMIET  VK L F P+ TLRFV+RNL+VA
Sbjct  305   LEKPTWLIAMANIFVVFHVIGSYQIYAMPVFDMIETVLVKKLHFAPSITLRFVSRNLYVA  364

Query  545   FTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGI  366
             FT+FV I  PFFGGLLGFFGGFA APTTY++PC+MWL + KP+++ LSW  NW  I  G+
Sbjct  365   FTMFVAICFPFFGGLLGFFGGFALAPTTYFLPCVMWLAIYKPRRYSLSWFTNWICIFFGV  424

Query  365   LLTILAPIGGLWSIVKSAKTYHFYQ  291
              L IL+PIGGL  I+  AKTY F+ 
Sbjct  425   CLMILSPIGGLRQIIIQAKTYEFFS  449



>ref|XP_004159807.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus]
Length=454

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 358/457 (78%), Gaps = 10/457 (2%)
 Frame = -1

Query  1655  RTPAFKMGFDRE---LEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAM  1485
             + P F+    ++   L+M + K    K      E+DDWLP+ S R+ KWWYS FHNVTAM
Sbjct  4     QAPQFEADPKKDPNSLQMDEEKIRKQK------EIDDWLPITSSRNAKWWYSAFHNVTAM  57

Query  1484  VGAGILSLPYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAA  1305
             VGAG+LSLP AM+ +GWGPGV ++++SW +TLYTL+QMVEMHE VPGKRFDRYHELGQ A
Sbjct  58    VGAGVLSLPSAMASLGWGPGVTVLVISWVVTLYTLWQMVEMHEMVPGKRFDRYHELGQHA  117

Query  1304  FGPKLGLWIVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQ  1125
             FG KLGL+IVVPQQ +VE+ + I+YMVTGG S+KK  + +C  C  IK +Y+I+IF+   
Sbjct  118   FGEKLGLYIVVPQQLVVEVGVNIVYMVTGGQSLKKFYDTVCPSCTKIKQTYFIMIFASVH  177

Query  1124  FIASFLPNFNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMF  945
             F+ S LPNFNSIS VSL AA+MS+SYSTIAW +++HK I+   V YG ++H     VF F
Sbjct  178   FVLSHLPNFNSISGVSLAAAVMSLSYSTIAWAASVHKGIQED-VQYGYKAHSTPGTVFNF  236

Query  944   MSALGDMAFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYL  765
              +ALGD+AF+YAGHNVVLEIQATIPSTPD PSK  MW+GV++AY+VVA+CY+PVA IGY 
Sbjct  237   FTALGDVAFAYAGHNVVLEIQATIPSTPDKPSKGPMWRGVIVAYIVVALCYFPVAIIGYW  296

Query  764   ALGNQVSDNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPT  585
               GN V DNILL+LEKP WLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+P+
Sbjct  297   MFGNSVKDNILLSLEKPAWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLHFRPS  356

Query  584   KTLRFVTRNLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGL  405
               LRFV+RN++V FT+F+GI+ PFFGGLLGFFGGF FAPTTY++PC+MWL + KPKKF L
Sbjct  357   FLLRFVSRNIYVGFTMFIGITFPFFGGLLGFFGGFVFAPTTYFLPCVMWLAIYKPKKFSL  416

Query  404   SWCMNWTFIVIGILLTILAPIGGLWSIVKSAKTYHFY  294
             SW  NW  IV+G+LL ILAPIGGL +I+  AK Y FY
Sbjct  417   SWWSNWVAIVLGVLLMILAPIGGLRTIILQAKDYKFY  453



>emb|CDY15733.1| BnaA07g09040D [Brassica napus]
Length=441

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/430 (68%), Positives = 360/430 (84%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA + +VDDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +MILSW
Sbjct  13    AAKQKKVDDWLPITSSRKAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVTLMILSW  72

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  73    LITLYTLWQMVEMHEIVPGKRLDRYHELGQEAFGEKLGLWIVVPQQLIVEVGVDIVYMVT  132

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KKV ELLC DCK I+ +++I+IF+   F+ S LPNFNSIS +SL AA+MS++YST
Sbjct  133   GGKSLKKVHELLCPDCKDIRTTFWIMIFASVHFVISHLPNFNSISGISLAAAVMSLTYST  192

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW +++HK ++   VDY  R+      VF F++A+GD+AF+YAGHNVVLEIQATIPSTP
Sbjct  193   IAWAASVHKGVKPD-VDYSYRASTTPGKVFNFLNAMGDVAFAYAGHNVVLEIQATIPSTP  251

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GVV+AY+VVA+CY+PVAF+GY   GN V DNIL+TLEKPVWL+A AN+FV
Sbjct  252   EVPSKVPMWRGVVVAYIVVAICYFPVAFLGYWIFGNSVDDNILMTLEKPVWLVAMANLFV  311

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQ++AM +FDM+ET  VK L F P+ TLRF+TR+L+VAFT+F+ I +PFFGGL
Sbjct  312   VVHVIGSYQIFAMPVFDMMETVLVKKLNFDPSFTLRFITRSLYVAFTMFIAICIPFFGGL  371

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTYY+PCI+WLIL KPK+FGLSW +NW  I++G++LTILAPIGGL +I+
Sbjct  372   LGFFGGFAFAPTTYYLPCIIWLILKKPKRFGLSWTINWFCIIVGVILTILAPIGGLRTII  431

Query  320   KSAKTYHFYQ  291
              +A TY F+ 
Sbjct  432   INASTYKFFS  441



>gb|KFK33647.1| hypothetical protein AALP_AA5G041200 [Arabis alpina]
Length=449

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 353/439 (80%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY  + A+  A + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+ +GWGP
Sbjct  12    DYDKDMAEKRAREKEINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMASLGWGP  71

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+
Sbjct  72    GVVILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEV  131

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK   L+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  132   GVCIVYMVTGGKSLKKFHHLVCEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  191

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW ++  K ++ + V+YG ++      VF F SALG++AF+YAGHNVVLE
Sbjct  192   AVMSLSYSTIAWSASAAKGVQEN-VEYGYKAKSAIGTVFNFFSALGEVAFAYAGHNVVLE  250

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MWKGVV+AY+VVA+CY+PVA +GY   GN V DNIL TL+KP W
Sbjct  251   IQATIPSTPEKPSKGPMWKGVVVAYIVVALCYFPVALVGYYVFGNTVDDNILETLKKPAW  310

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVV+HV+GSYQ+YAM +FDM+ET  VK + F+P+  LRFV RN +VA T+FVG
Sbjct  311   LIATANMFVVIHVIGSYQIYAMPVFDMMETLLVKKMNFRPSWILRFVVRNFYVAATMFVG  370

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PC+MWL + KP+++ LSW  NW  IV G+ L +L+
Sbjct  371   MTFPFFGGLLAFFGGFAFAPTTYFLPCVMWLKIYKPRRYSLSWWTNWICIVFGLCLMVLS  430

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +I+  AK Y FY 
Sbjct  431   PIGGLRTIIIQAKDYKFYS  449



>ref|XP_008389807.1| PREDICTED: LOW QUALITY PROTEIN: lysine histidine transporter 
2 [Malus domestica]
Length=438

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/429 (66%), Positives = 355/429 (83%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + +++DWLPV S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+M+LSW 
Sbjct  11    ARQKKIEDWLPVTSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAVMLLSWI  70

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+ + I+YMVTG
Sbjct  71    ITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWVVVPQQLVVEVGVNIVYMVTG  130

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  +++C  CK IKL+ +I IF+   F+ S LPN NS+S +SL AA+MS+SYSTI
Sbjct  131   GKSLKKFHDVICPSCKDIKLTLWIFIFASVHFVISHLPNLNSVSGISLAAAVMSLSYSTI  190

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+A+H+  ++  VDY  ++   +  VF F S LG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  191   AWGAAIHRG-KAPDVDYSYKAKSNSGAVFNFFSGLGEIAFAYAGHNVVLEIQATIPSTPE  249

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV+AY+VVA+CY+PV+F+GY   GN V DN+L++LEKPVWLIAAAN+FVV
Sbjct  250   KPSKGPMWKGVVVAYIVVALCYFPVSFVGYYIYGNTVEDNVLISLEKPVWLIAAANMFVV  309

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQV+AM +FDM+ETF V  + F+P+ TLRFVTR  +VAFT+ VG+++PFFGGLL
Sbjct  310   IHVIGSYQVFAMGVFDMVETFLVTKMNFEPSFTLRFVTRTTYVAFTMVVGMAIPFFGGLL  369

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KP+ F LSW +NWT I++G+ L ILAPIG L SI+ 
Sbjct  370   GFFGGFAFAPTTYFLPCIMWLAIYKPRVFSLSWFINWTCIILGVTLMILAPIGALRSIIL  429

Query  317   SAKTYHFYQ  291
              AKTY F+ 
Sbjct  430   QAKTYKFFS  438



>ref|XP_007031757.1| Lysine histidine transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY02683.1| Lysine histidine transporter 1 isoform 1 [Theobroma cacao]
Length=471

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/428 (67%), Positives = 353/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGPGV +++LSW 
Sbjct  44    ARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGVVVLVLSWI  103

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YMVTG
Sbjct  104   ITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGVCIVYMVTG  163

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  + +C  C+ IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  164   GKSLKKFHDTVCSTCQSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  223

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++ + V YG ++      VF F  ALG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  224   AWGASVDKGVQPN-VQYGYKAKTAAGTVFDFFGALGEVAFAYAGHNVVLEIQATIPSTPE  282

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLIA AN+FVV
Sbjct  283   KPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNAVEDNILMSLEKPAWLIAMANMFVV  342

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK L FKPT+TLRF+ RNL+VAFT+FVGI+ PFFGGLL
Sbjct  343   IHVIGSYQIYAMPVFDMMETVLVKKLNFKPTRTLRFIVRNLYVAFTMFVGITFPFFGGLL  402

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KP+KFGLSW  NW  IV+G++L +++PIGGL  I+ 
Sbjct  403   GFFGGFAFAPTTYFLPCIMWLAIYKPRKFGLSWWTNWICIVLGVVLMVVSPIGGLRQIII  462

Query  317   SAKTYHFY  294
              AK Y FY
Sbjct  463   QAKNYEFY  470



>emb|CDY03895.1| BnaC07g11200D [Brassica napus]
Length=436

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/430 (68%), Positives = 360/430 (84%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA + +VDDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +MILSW
Sbjct  8     AAKQKKVDDWLPITSSRKAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVTLMILSW  67

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKR DRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  68    LITLYTLWQMVEMHEIVPGKRLDRYHELGQEAFGEKLGLWIVVPQQLIVEVGVDIVYMVT  127

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KKV ELLC DCK I+ +++I+IF+   F+ S LPNFNSIS +SL AA+MS++YST
Sbjct  128   GGKSLKKVHELLCPDCKDIRTTFWIMIFASVHFVISHLPNFNSISGISLAAAVMSLTYST  187

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW +++HK ++   VDY  R+      VF F++A+GD+AF+YAGHNVVLEIQATIPSTP
Sbjct  188   IAWAASVHKGVKPD-VDYSYRASTTPGKVFNFLNAMGDVAFAYAGHNVVLEIQATIPSTP  246

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GVV+AY+VVA+CY+PVAF+GY   GN V DNIL+TLEKPVWL+A AN+FV
Sbjct  247   EVPSKVPMWRGVVVAYIVVAICYFPVAFLGYWIFGNSVDDNILMTLEKPVWLVAMANLFV  306

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQ++AM +FDM+ET  VK L F P+ TLRF+TR+L+VAFT+F+ I +PFFGGL
Sbjct  307   VVHVIGSYQIFAMPVFDMMETVLVKKLNFDPSFTLRFITRSLYVAFTMFIAICIPFFGGL  366

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTYY+PCI+WLIL KPK+FGLSW +NW  I++G++LTILAPIGGL +I+
Sbjct  367   LGFFGGFAFAPTTYYLPCIIWLILKKPKRFGLSWTINWFCIIVGVILTILAPIGGLRTII  426

Query  320   KSAKTYHFYQ  291
              +A TY F+ 
Sbjct  427   INASTYKFFS  436



>emb|CDY36379.1| BnaC04g32870D [Brassica napus]
Length=442

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/432 (65%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGPG+ +M+L
Sbjct  12    EKSARQKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGPGITVMVL  71

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI +CI+YM
Sbjct  72    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEIGVCIVYM  131

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  +L+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  132   VTGGKSLKKFHDLVCDDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSY  191

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW ++  K ++   V+YG ++      VF F SALGD+AF+YAGHNVVLEIQATIPS
Sbjct  192   STIAWAASASKGVQED-VEYGYKAKSTAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPS  250

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MWKGV++AY+VVA+CY+PVAF+GY   GN V DNIL++L+KP WLIA AN+
Sbjct  251   TPEKPSKGPMWKGVIVAYIVVALCYFPVAFVGYYIFGNGVEDNILMSLKKPAWLIATANM  310

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  R+ +VA T+F+G++ PFFG
Sbjct  311   FVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRSFYVAATMFLGMTFPFFG  370

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLL FFGGFAFAPTTY++PCI+WL + KP+K+ LSW  NW  IV GI L +L+PIGGL +
Sbjct  371   GLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWWANWVCIVFGIFLMVLSPIGGLRT  430

Query  326   IVKSAKTYHFYQ  291
             IV  AK Y FY 
Sbjct  431   IVIQAKEYKFYS  442



>gb|EPS70921.1| hypothetical protein M569_03830, partial [Genlisea aurea]
Length=439

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/440 (66%), Positives = 362/440 (82%), Gaps = 6/440 (1%)
 Frame = -1

Query  1598  AEGAKPAANKGE----VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWG  1431
             A+ A  A N+ E    +D WLP+ S RS KWWYS FHNVTAMVGAG+LSLPYAM+E+GWG
Sbjct  2     ADSAVVADNRTEEEKAIDAWLPISSSRSAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWG  61

Query  1430  PGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVE  1251
             PGV +M++SW ITLYTL+QMV+MHE VPG+RFDRYHELGQ AFG +LGL+IVVPQQ +VE
Sbjct  62    PGVTVMVISWLITLYTLWQMVQMHEMVPGRRFDRYHELGQHAFGERLGLYIVVPQQLIVE  121

Query  1250  ISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
             I + I+YMVTGG S+KK  +L+C DCK I+L+++I+IF+   F+ S LPNFNSIS VSL 
Sbjct  122   IGVDIVYMVTGGKSLKKFHDLVCKDCKNIRLTFFIMIFASVHFVLSHLPNFNSISGVSLA  181

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AA+MS+SYSTIAW ++  K ++   VDY   +   TD VF F  ALG++AF+YAGHNVVL
Sbjct  182   AAVMSLSYSTIAWAASADKGVQP-GVDY-RLTGTTTDKVFNFFGALGNVAFAYAGHNVVL  239

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP+ PSK  MW+GV++AY VVA+CY+PVAF+GY   GN V DN+L++LEKPV
Sbjct  240   EIQATIPSTPEKPSKVPMWRGVIVAYAVVALCYFPVAFVGYAMFGNSVQDNVLVSLEKPV  299

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLIA AN+FVVVHV+GSYQ+YAM +FDM+ET  VK L+FKPT  LRF+TRN++VAFT+F+
Sbjct  300   WLIAMANLFVVVHVIGSYQIYAMPVFDMMETVMVKKLRFKPTWYLRFITRNIYVAFTMFI  359

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
             G++ PFFGGLLGFFGGFAFAPTTY++PCIMWL++ KPKKFGLSW  NW  I++G+LLT++
Sbjct  360   GMTFPFFGGLLGFFGGFAFAPTTYFLPCIMWLVIYKPKKFGLSWWTNWICIILGVLLTVI  419

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             APIGGL  I++ AK+Y FY 
Sbjct  420   APIGGLRQIIQDAKSYTFYS  439



>ref|XP_008379764.1| PREDICTED: lysine histidine transporter 1-like [Malus domestica]
Length=443

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/429 (66%), Positives = 351/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + ++D+WLP+   R+ KWWYS FHNVTAMV AG+LSLPYAMS +GWGPGV +++LSW 
Sbjct  16    AKQKKIDEWLPITGSRNAKWWYSAFHNVTAMVRAGVLSLPYAMSNLGWGPGVVILVLSWI  75

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTG
Sbjct  76    ITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGVDIVYMVTG  135

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++KV + LC DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  136   GKSLQKVHKSLCSDCKNIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  195

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW +++ K +  + V Y  RS   + NV  F +ALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  196   AWAASVDKGVVEN-VSYDYRSKTTSGNVLNFFTALGDVAFAYAGHNVVLEIQATIPSTPE  254

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MW+GV++AY+VVA+CY+PVA +GY   G  V DNILL+LEKP WLIA AN+FVV
Sbjct  255   KPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGKSVDDNILLSLEKPNWLIAMANMFVV  314

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDMIET  VK L FKPT+TLRF+TRN++VAFT+FVGI+ PFF GLL
Sbjct  315   IHVIGSYQIYAMPVFDMIETVLVKKLNFKPTRTLRFITRNIYVAFTMFVGITFPFFSGLL  374

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KP++F LSW  N+  I +G+LL ILAPIGGL +I+ 
Sbjct  375   GFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWWCNYICIFLGVLLMILAPIGGLRTIII  434

Query  317   SAKTYHFYQ  291
              AKTY FY 
Sbjct  435   QAKTYKFYN  443



>ref|XP_007031759.1| Lysine histidine transporter 1 [Theobroma cacao]
 gb|EOY02685.1| Lysine histidine transporter 1 [Theobroma cacao]
Length=452

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/429 (66%), Positives = 354/429 (83%), Gaps = 2/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + ++D WLP+ S R+ KWWY+ FHNVTAMVGAG+LSLPYAMS +GWGPG+ +MILSW 
Sbjct  24    AKQKDIDAWLPITSSRNAKWWYAAFHNVTAMVGAGVLSLPYAMSHLGWGPGIVIMILSWI  83

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+S+ I+YMVTG
Sbjct  84    ITLYTLWQMVEMHEMVPGKRFDRYHELGQQAFGEKLGLYIVVPQQLICEVSVDIVYMVTG  143

Query  1217  GSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             G S++K+ +L C + CK IKL+ +I IF+   F+ + LPNFNSIS VSL AA+MS+SYST
Sbjct  144   GKSLQKIHDLACKNHCKDIKLTSFIAIFASVHFVLAHLPNFNSISGVSLAAAVMSLSYST  203

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW +++HK ++   V YG ++       F F++ALGD+AF+YAGHNVVLEIQATIPSTP
Sbjct  204   IAWTASVHKGVQPD-VQYGYKATTTPGTFFGFLNALGDVAFAYAGHNVVLEIQATIPSTP  262

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GVV+AY+VV +CY+PVAFIGY   GN V DNIL++L+KP WLI AAN+FV
Sbjct  263   EKPSKGPMWRGVVVAYIVVGLCYFPVAFIGYYMFGNNVEDNILISLQKPTWLIIAANMFV  322

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             V+HV+GSYQ+YAM +FDMIET  VK   F+PT+TLRFVTRNL+VA T+FVG++ PFFGGL
Sbjct  323   VIHVIGSYQLYAMPVFDMIETLLVKKFHFRPTRTLRFVTRNLYVAATMFVGMTFPFFGGL  382

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFA+APTTY++PCI+WL + KPK+FGLSWC+NW  I++G+LL  LAPIGGL +I+
Sbjct  383   LGFFGGFAYAPTTYFLPCIIWLAIYKPKRFGLSWCINWICIILGVLLMTLAPIGGLRNII  442

Query  320   KSAKTYHFY  294
               AK YHFY
Sbjct  443   LQAKGYHFY  451



>ref|XP_008792218.1| PREDICTED: lysine histidine transporter 1 [Phoenix dactylifera]
Length=436

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 346/435 (80%), Gaps = 1/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
               A     +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+ +GWGPGV +
Sbjct  3     SSATKNDKEKSLDDWLPITSDRNAKWWYSAFHNVTAMVGAGVLSLPYAMAHLGWGPGVVV  62

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+  CI
Sbjct  63    LVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVEVGTCI  122

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG S++K   ++C  CK IKLSY+I+IF+   F+ S LPNFNSIS VSL AA+MS
Sbjct  123   VYMVTGGKSLEKFHNVVCPGCKSIKLSYFIMIFASVHFVLSQLPNFNSISGVSLAAAVMS  182

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAWG A  K  +   VDYG ++   +  VF F SALGD+AF++AGHNVVLEIQAT
Sbjct  183   LSYSTIAWGVAADKG-QQEGVDYGYKASNTSGVVFNFFSALGDVAFAFAGHNVVLEIQAT  241

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSKK MWKGV++AY+VVA+CY+PVA IGY + GN V DNIL+TLE+P WLIAA
Sbjct  242   IPSTPEKPSKKPMWKGVIVAYIVVALCYFPVALIGYWSFGNAVDDNILITLERPRWLIAA  301

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+G YQ+YAM +FDMIET  VK L F P   LR + R+LFV  T+F+GI +P
Sbjct  302   ANMFVVIHVIGGYQIYAMPVFDMIETVLVKKLHFSPGIALRLIARSLFVVLTMFIGICIP  361

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGGFA APTTYY+PCIMWL + KP++F LSW  NW  I++G++L ILAPIGG
Sbjct  362   FFGGLLGFFGGFALAPTTYYLPCIMWLAIYKPRRFSLSWITNWICIILGVMLMILAPIGG  421

Query  335   LWSIVKSAKTYHFYQ  291
             L +I+ +AK Y F+ 
Sbjct  422   LRTIILNAKNYRFFS  436



>gb|KGN45724.1| hypothetical protein Csa_6G008070 [Cucumis sativus]
Length=453

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/427 (66%), Positives = 347/427 (81%), Gaps = 1/427 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP AM+ +GWGPGV ++++SW +
Sbjct  27    KQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPSAMASLGWGPGVTVLVISWVV  86

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTGG
Sbjct  87    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLVVEVGVNIVYMVTGG  146

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  + +C  C  IK +Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  147   QSLKKFYDTVCPSCTKIKQTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTIA  206

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++HK I+   V YG ++H     VF F +ALGD+AF+YAGHNVVLEIQATIPSTPD 
Sbjct  207   WAASVHKGIQED-VQYGYKAHSTPGTVFNFFTALGDVAFAYAGHNVVLEIQATIPSTPDK  265

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V DNILL+LEKP WLIA AN+FVV+
Sbjct  266   PSKGPMWRGVIVAYIVVALCYFPVAIIGYWMFGNSVKDNILLSLEKPAWLIAMANMFVVI  325

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L F+P+  LRFV+RN++V FT+F+GI+ PFFGGLLG
Sbjct  326   HVIGSYQIYAMPVFDMIETVLVKKLHFRPSFLLRFVSRNIYVGFTMFIGITFPFFGGLLG  385

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGF FAPTTY++PC+MWL + KPKKF LSW  NW  IV+G+LL ILAPIGGL +I+  
Sbjct  386   FFGGFVFAPTTYFLPCVMWLAIYKPKKFSLSWWSNWVAIVLGVLLMILAPIGGLRTIILQ  445

Query  314   AKTYHFY  294
             AK Y FY
Sbjct  446   AKDYKFY  452



>ref|XP_003547674.1| PREDICTED: lysine histidine transporter 1 isoform X1 [Glycine 
max]
Length=465

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/442 (65%), Positives = 355/442 (80%), Gaps = 6/442 (1%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             AE  K  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP AM+ +GWGPGV 
Sbjct  24    AEIDKRTAEQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPSAMASLGWGPGVV  83

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + 
Sbjct  84    ILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVD  143

Query  1238  IIYMVTGGSSIKKVVELLCH---DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
             I+YMVTGG S++K+ +L+C    DCK IK +Y+I+IF+   F+ S LPNFN+IS +SL A
Sbjct  144   IVYMVTGGKSLQKIHDLVCQHRKDCKNIKTTYFIMIFASVHFVLSHLPNFNAISGISLAA  203

Query  1067  AIMSVSYSTIAWGSALHKWIESH---AVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             AIMS+SYSTIAW +++ K + +H   AV+YG ++     NVF F +ALGD+AF+YAGHNV
Sbjct  204   AIMSLSYSTIAWVASVDKRVHNHVDVAVEYGYKASTSAGNVFNFFNALGDVAFAYAGHNV  263

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPS+P+ PSK  MW+GV+IAY+VVA+CY+PVA IGY   GN V DNIL+TL K
Sbjct  264   VLEIQATIPSSPEKPSKGPMWRGVLIAYLVVALCYFPVALIGYWVFGNSVDDNILITLNK  323

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN+FVV+HV+GSYQ+YAM +FDMIET  VK L+FKPT  LRFV RN++VAFT+
Sbjct  324   PTWLIVTANMFVVIHVIGSYQLYAMPVFDMIETVMVKQLRFKPTWQLRFVVRNVYVAFTM  383

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+ PFFG LLGFFGGFAFAPTTY++PCI+WL + KPKKF LSW  NW  I+ G+LL 
Sbjct  384   FVGITFPFFGALLGFFGGFAFAPTTYFLPCIIWLAIYKPKKFSLSWITNWICIIFGLLLM  443

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             IL+PIGGL SI+ +AK Y FYQ
Sbjct  444   ILSPIGGLRSIILNAKNYGFYQ  465



>gb|KHN10848.1| Lysine histidine transporter 1 [Glycine soja]
Length=465

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/442 (65%), Positives = 355/442 (80%), Gaps = 6/442 (1%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             AE  K  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP AM+ +GWGPGV 
Sbjct  24    AEIDKRTAEQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPSAMASLGWGPGVV  83

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + 
Sbjct  84    ILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVD  143

Query  1238  IIYMVTGGSSIKKVVELLCH---DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
             I+YMVTGG S++K+ +L+C    DCK IK +Y+I+IF+   F+ S LPNFN+IS +SL A
Sbjct  144   IVYMVTGGKSLQKIHDLVCQHRKDCKNIKTTYFIMIFASVHFVLSHLPNFNAISGISLAA  203

Query  1067  AIMSVSYSTIAWGSALHKWIESH---AVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             AIMS+SYSTIAW +++ K + +H   AV+YG ++     NVF F +ALGD+AF+YAGHNV
Sbjct  204   AIMSLSYSTIAWVASVDKRVHNHVDVAVEYGYKASTSAGNVFNFFNALGDVAFAYAGHNV  263

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPS+P+ PSK  MW+GV+IAY+VVA+CY+PVA IGY   GN V DNIL+TL K
Sbjct  264   VLEIQATIPSSPEKPSKGPMWRGVLIAYLVVALCYFPVALIGYWVFGNSVDDNILITLNK  323

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN+FVV+HV+GSYQ+YAM +FDMIET  VK L+FKPT  LRFV RN++VAFT+
Sbjct  324   PTWLIVTANMFVVIHVIGSYQLYAMPVFDMIETVMVKQLRFKPTWQLRFVVRNVYVAFTM  383

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+ PFFG LLGFFGGFAFAPTTY++PCI+WL + KPKKF LSW  NW  I+ G+LL 
Sbjct  384   FVGITFPFFGALLGFFGGFAFAPTTYFLPCIIWLAIYKPKKFSLSWITNWICIIFGLLLM  443

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             IL+PIGGL SI+ +AK Y FYQ
Sbjct  444   ILSPIGGLRSIILNAKNYGFYQ  465



>ref|XP_006395461.1| hypothetical protein EUTSA_v10004214mg [Eutrema salsugineum]
 gb|ESQ32747.1| hypothetical protein EUTSA_v10004214mg [Eutrema salsugineum]
Length=448

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/449 (64%), Positives = 355/449 (79%), Gaps = 1/449 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             MG     E   Y  +  +  A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     MGTQLLDEDDSYNKDIDERRAREKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  60

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAM+++GWGPGVA++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+I
Sbjct  61    YAMAQLGWGPGVAILILSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYI  120

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VE+ +CI+YMVTGG S+KK  EL+C +CK IKL+Y+I+IF+   F+ S LPNF
Sbjct  121   VVPQQLIVEVGVCIVYMVTGGKSLKKFHELVCDNCKSIKLTYFIMIFASVHFVLSHLPNF  180

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VSL AA+MS+SYSTIAW +++ K ++ + V+YG ++      VF F SALG++AF
Sbjct  181   NSISGVSLAAAVMSLSYSTIAWSASVAKGVKEN-VEYGYKAKSTAGTVFNFFSALGEVAF  239

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN V DN
Sbjct  240   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVVVAYIVVALCYFPVALIGYWMFGNSVDDN  299

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL TLEKP WLIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK + F+P   LRF  RN
Sbjct  300   ILETLEKPAWLIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKMNFRPRWILRFFVRN  359

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
              +VA T+FVG++ PFFGGLL FFGGFAFAPTTY++PC++WL + KP+++ LSW  NW  I
Sbjct  360   FYVAATMFVGMTFPFFGGLLAFFGGFAFAPTTYFLPCVIWLAIYKPRRYSLSWWANWICI  419

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             V G+ L +L+PIGGL +I+  AK Y FY 
Sbjct  420   VFGVCLMVLSPIGGLRTIIIQAKDYKFYS  448



>gb|KDP46333.1| hypothetical protein JCGZ_10173 [Jatropha curcas]
Length=453

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/436 (66%), Positives = 354/436 (81%), Gaps = 1/436 (0%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             K +  +  A +  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV
Sbjct  18    KQQEDEQLARQKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGV  77

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              +++LSW ITLYTL+QMVEMHE VPG+RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +
Sbjct  78    VVLVLSWIITLYTLWQMVEMHEMVPGRRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGV  137

Query  1241  CIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             CI+YMVTGG S+KK  +L+C  CKPIK +Y+I+IF+   F+ S LPNFNSI+ VSL AA+
Sbjct  138   CIVYMVTGGKSLKKFHDLVCESCKPIKQTYFIMIFASVHFVLSHLPNFNSIAGVSLAAAV  197

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTIAW +++HK ++   V YG ++      +F F SALGD+AF+YAGHNVVLEIQ
Sbjct  198   MSLSYSTIAWTASVHKGVQPD-VQYGYKATTTAGTIFNFFSALGDVAFAYAGHNVVLEIQ  256

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V DNIL++L KPVWLI
Sbjct  257   ATIPSTPEKPSKVPMWRGVIVAYIVVALCYFPVALIGYWMYGNSVEDNILISLNKPVWLI  316

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             A AN+FVVVHV+GSYQ+YAM +FDM+ET  VK L FKP+  LRFV RNL+VAFT+FVGI+
Sbjct  317   AMANLFVVVHVIGSYQIYAMPVFDMMETVLVKKLNFKPSTMLRFVIRNLYVAFTMFVGIT  376

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFFGGLLGFFGGFAFAPTTY++PC+MWL + KP+KF LSW  NW  IV G+LL +L+PI
Sbjct  377   FPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPRKFSLSWWTNWLCIVFGVLLMVLSPI  436

Query  341   GGLWSIVKSAKTYHFY  294
             GGL  I+  AKTY FY
Sbjct  437   GGLRLIILQAKTYEFY  452



>ref|XP_002265308.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera]
 emb|CBI40080.3| unnamed protein product [Vitis vinifera]
Length=442

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/429 (67%), Positives = 354/429 (83%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGPGV +M+LSW 
Sbjct  15    ARQKEIDDWLPISSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGVVIMVLSWI  74

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTG
Sbjct  75    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVDIVYMVTG  134

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  + +C  CKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  135   GKSLKKFHDTVCSTCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  194

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++ + V+YG ++      VF F SALG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  195   AWGASVDKGVQDN-VEYGYKAKSTAGTVFNFFSALGEVAFAYAGHNVVLEIQATIPSTPE  253

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MW+GV++AY+VVA+CY+PVA IGY   GN VSDNIL++LE P WLIA AN+FVV
Sbjct  254   KPSKGPMWRGVIVAYIVVALCYFPVALIGYWMFGNAVSDNILISLENPAWLIAMANMFVV  313

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDMIET  VK L FKP+ TLRF++RN++VAFT+FVGI+ PFF GLL
Sbjct  314   IHVIGSYQIYAMPVFDMIETVLVKKLHFKPSTTLRFISRNIYVAFTMFVGITFPFFSGLL  373

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PC+MWL + KPKK+ LSW  NW  I++G+LL ILAPIG L +I+ 
Sbjct  374   SFFGGFAFAPTTYFLPCVMWLAIYKPKKYSLSWIANWICIILGLLLMILAPIGALRNIIL  433

Query  317   SAKTYHFYQ  291
              AKTY FY 
Sbjct  434   EAKTYEFYS  442



>ref|XP_011045189.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/439 (65%), Positives = 357/439 (81%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D   E +     K E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+ +GWGP
Sbjct  12    DVPEEISVADRRKKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMANLGWGP  71

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G  +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+
Sbjct  72    GTVILVLSWTITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLICEV  131

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S++K+ +L+C DC PIKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  132   GVDIVYMVTGGKSLQKIHKLVCKDCAPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  191

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW +++HK ++   V+YG ++ K +  VF F SALGD+AF+YAGHNVVLE
Sbjct  192   AVMSLSYSTIAWTASVHKGVQPD-VEYGYKASKTSGTVFNFFSALGDVAFAYAGHNVVLE  250

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPS P  PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN+V DNIL++LEKP W
Sbjct  251   IQATIPSKPGKPSKGPMWKGVVVAYIVVALCYFPVALIGYYMFGNKVEDNILISLEKPTW  310

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LI AAN+FVV+HV+GSYQ+YA+ +FDM+ET  VK L F+P++ LRF++RN++VAFT+FVG
Sbjct  311   LIVAANMFVVIHVIGSYQIYAIPVFDMLETLLVKKLHFRPSRKLRFISRNIYVAFTMFVG  370

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I  PFFGGLLGFFGGFAFAPTTY++PCI+WL + KPK+F LSW  NW  I++G LL IL+
Sbjct  371   ICFPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPKRFSLSWITNWICIILGFLLMILS  430

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +I+ +AK Y F+ 
Sbjct  431   PIGGLRTIILNAKGYEFFS  449



>ref|XP_006338671.1| PREDICTED: lysine histidine transporter 1-like [Solanum tuberosum]
Length=449

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/431 (68%), Positives = 354/431 (82%), Gaps = 4/431 (1%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV +M++SW I
Sbjct  20    EEKAIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVTVMVVSWII  79

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE +PGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  80    TLYTLWQMVEMHEMIPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGG  139

Query  1214  SSIKKVVELLC---HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
              S++KV +L+C     C  IKLSY+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYS
Sbjct  140   KSLQKVHQLVCKPEDGCADIKLSYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYS  199

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAWG+++ K ++ + VDYG ++H     VF F+S LG++AF+YAGHNVVLEIQATIPST
Sbjct  200   TIAWGASVKKGVQPN-VDYGYKAHSTAGTVFDFLSGLGEVAFAYAGHNVVLEIQATIPST  258

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             PD PSK  MW+GVV+AY+VVA+CY+PVAFIGY   GN V DNIL++L KP WLI  AN+F
Sbjct  259   PDKPSKVPMWRGVVVAYIVVALCYFPVAFIGYWMFGNAVEDNILMSLNKPTWLIIMANMF  318

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VVVHV+GSYQ+YAM +FDMIET  VK L+FKPT  LRFVTRN++VAFT+FVGI+ PFFGG
Sbjct  319   VVVHVIGSYQIYAMPVFDMIETVLVKKLRFKPTWYLRFVTRNIYVAFTMFVGITFPFFGG  378

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KP+++ LSW  NW  I+ G+LL +LAPIGGL SI
Sbjct  379   LLGFFGGFAFAPTTYFLPCIMWLAIYKPRRWSLSWIANWICIIFGVLLMVLAPIGGLRSI  438

Query  323   VKSAKTYHFYQ  291
             +  AKTY FY 
Sbjct  439   IVQAKTYKFYN  449



>ref|XP_009613346.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana tomentosiformis]
Length=455

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/431 (66%), Positives = 352/431 (82%), Gaps = 2/431 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +A +  +D WLPV S R+ KWWYS FHNVTAMVGAG+L LPYAM+++GWGPGVA++++SW
Sbjct  26    SAEERAIDAWLPVTSNRNAKWWYSAFHNVTAMVGAGVLGLPYAMAQLGWGPGVAVLVISW  85

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              IT YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI+VPQQ +VE+ + I+YMVT
Sbjct  86    IITFYTLWQMVEMHEMVPGKRFDRYHELGQHAFGKKLGLWIIVPQQLIVEVGVDIVYMVT  145

Query  1220  GGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
             GG S++K  +L+C  DCK IKL+Y+I+IF+   F+ S LP+FNSI  VSL AA+MS+SYS
Sbjct  146   GGQSLQKFYDLVCKKDCKDIKLTYFIMIFASVHFVISHLPDFNSIVGVSLAAAVMSLSYS  205

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAWG+++ K +    V+YG ++      +F F SALGD+AF+YAGHNVVLEIQATIPST
Sbjct  206   TIAWGASVKKGVVPD-VEYGYKAKSTAGTIFNFFSALGDVAFAYAGHNVVLEIQATIPST  264

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             P+ PSK  MWKGV++AY++VA CY+PVA IGY   GNQV DNIL TLEKP WLIA AN+F
Sbjct  265   PEKPSKGPMWKGVIVAYIIVAFCYFPVALIGYWMFGNQVKDNILKTLEKPTWLIAMANLF  324

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VV+HV+GSYQ+YAM +FDMIET  V+ LKFKP+  LRFVTRN++VAFT+FVGI+ PFF G
Sbjct  325   VVIHVIGSYQIYAMPVFDMIETVLVRKLKFKPSWMLRFVTRNIYVAFTMFVGITFPFFNG  384

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KPKKF LSW +NW  I++G+LL ++APIGGL SI
Sbjct  385   LLGFFGGFAFAPTTYFLPCIMWLAICKPKKFSLSWIINWICIILGVLLMVIAPIGGLRSI  444

Query  323   VKSAKTYHFYQ  291
             +  AK Y FY 
Sbjct  445   IMQAKGYKFYS  455



>ref|XP_002265721.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera]
 emb|CBI27573.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/449 (63%), Positives = 352/449 (78%), Gaps = 11/449 (2%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             MG D + E         K A +K E++DWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     MGLDDQQE---------KDARDK-EINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  50

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAM+ +GWGPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI
Sbjct  51    YAMAGLGWGPGVVILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWI  110

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VE+ + I+YM+TGG S++K    +C DCKPIK +Y+I+IF+   F+ S LPNF
Sbjct  111   VVPQQVIVEVGVDIVYMITGGKSLQKFHNTVCPDCKPIKTTYFIMIFASCHFVLSHLPNF  170

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VS  AA+MS++YSTIAW +++HK ++   V Y   +   T  VF F SALGD+AF
Sbjct  171   NSISGVSFAAAVMSLTYSTIAWTASVHKGVQPD-VQYSYTASTTTGRVFTFFSALGDVAF  229

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGV+ AY+VVA+CY+PVA IGY   GN V+DN
Sbjct  230   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVIFAYIVVALCYFPVALIGYWMFGNSVADN  289

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL+TLEKP WLIA AN+FVV+HV+GSYQ+YAM +FDM+ET  VK LKF+P+  LR +TR 
Sbjct  290   ILITLEKPRWLIAGANMFVVIHVIGSYQIYAMPVFDMLETLLVKNLKFRPSFMLRLITRT  349

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             L+VAFT+FVGI +PFFG LLGF GG AFAPTTY++PCIMWL + KP++F LSW  NW  I
Sbjct  350   LYVAFTMFVGILIPFFGSLLGFLGGLAFAPTTYFLPCIMWLAIYKPRRFSLSWFANWICI  409

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             V+G+LL ILAPIG L  I+ +AK + F+ 
Sbjct  410   VLGVLLMILAPIGALRQIILNAKNFKFFS  438



>ref|XP_010415341.1| PREDICTED: LOW QUALITY PROTEIN: lysine histidine transporter-like 
2 [Camelina sativa]
Length=441

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/442 (67%), Positives = 364/442 (82%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGE-VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +    K A+ K + VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGENQCSPRKDASTKQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW IT YTL+QMV MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTIMIMSWLITFYTLWQMVXMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KK+ +LLC DCK I+ +Y+I+IF+   F+ + LPNFNS+S VS
Sbjct  121   VEVGVDIVYMVTGGKSLKKIHDLLCTDCKNIRTTYWIMIFASVHFVLAHLPNFNSMSVVS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW +++ K ++ + V Y  R+   + NVF F++ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLSYSTIAWATSVKKGVQPN-VHYSFRASTTSGNVFNFLNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK AMWKGVV+AY+VVA+CY+PVAF+ Y   GN V DN+L+TL+K
Sbjct  240   VLEIQATIPSTPEKPSKIAMWKGVVVAYIVVAICYFPVAFVCYYIFGNTVDDNVLMTLQK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN FVVVHVVGSYQ+YAM +FDM+ETF VK + F P+  LRF++R L+VAFT+
Sbjct  300   PVWLIAIANAFVVVHVVGSYQIYAMPVFDMLETFLVKKMMFSPSFKLRFISRTLYVAFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FV I +PFFGGLLGFFGGFAFAPTTYY+PCIMWLIL KPKK+GLSW +NW  IV+G++LT
Sbjct  360   FVAICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLILKKPKKYGLSWSINWFCIVVGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             I+APIGGL +I+ SAK Y F+ 
Sbjct  420   IVAPIGGLRTIIVSAKDYEFFS  441



>ref|NP_001066488.1| Os12g0244400 [Oryza sativa Japonica Group]
 gb|ABA97214.1| lysine and histidine specific transporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29507.1| Os12g0244400 [Oryza sativa Japonica Group]
 gb|EAZ20109.1| hypothetical protein OsJ_35704 [Oryza sativa Japonica Group]
 dbj|BAG91876.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/435 (66%), Positives = 349/435 (80%), Gaps = 6/435 (1%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP+AMSE+GWGPGVA MI+SW 
Sbjct  12    AEEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPFAMSELGWGPGVAAMIMSWV  71

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHECVPG+RFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +CI+YMVTG
Sbjct  72    ITLYTLWQMVEMHECVPGRRFDRYHELGQHAFGDKLGLWIVVPQQLVVEVGVCIVYMVTG  131

Query  1217  GSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             G S+KK  +L+      PI+ SY+I+IF     + S LPNFNSIS VSL AA+MS+SYST
Sbjct  132   GKSLKKFHDLVAPPSAPPIRTSYFIVIFGCLHLVLSQLPNFNSISGVSLAAAVMSLSYST  191

Query  1040  IAWGSALHKWIESHA-----VDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             IAW ++LH    ++      VDY           F F+SALGD+AF+YAGHNVVLEIQAT
Sbjct  192   IAWAASLHHHNHNNGAAAGGVDYSLTEATPAGRTFNFLSALGDVAFAYAGHNVVLEIQAT  251

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPST + PSK  MW+GVV+AY VVA+CY PVAF GY   GN V DN+L+TLE+P WLIAA
Sbjct  252   IPSTAERPSKGPMWRGVVLAYGVVAVCYLPVAFAGYYVFGNAVDDNVLITLERPAWLIAA  311

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVVVHVVGSYQ+YAM +FDM+ETF VK L+FKP   LR + R+L+V FT+FV I+VP
Sbjct  312   ANMFVVVHVVGSYQIYAMPVFDMLETFLVKKLRFKPGMPLRLIARSLYVLFTMFVAIAVP  371

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGGFAFAPTTY++PCIMWL +MKPK+FGLSWC+NW  I+IG+LL++ APIGG
Sbjct  372   FFGGLLGFFGGFAFAPTTYFLPCIMWLSIMKPKRFGLSWCINWFCIIIGVLLSVFAPIGG  431

Query  335   LWSIVKSAKTYHFYQ  291
             L SI+ +A++Y F+ 
Sbjct  432   LRSIIVNAQSYKFFS  446



>gb|KHG21056.1| Lysine histidine transporter 1 -like protein [Gossypium arboreum]
Length=433

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/432 (66%), Positives = 353/432 (82%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +A +  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+E+GWGPGV ++IL
Sbjct  3     EKSAKEKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWGPGVTVLIL  62

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPG+RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YM
Sbjct  63    SWIITLYTLWQMVEMHEMVPGRRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGVCIVYM  122

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S++K  + +C  CK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  123   VTGGKSLQKFHDTVCSTCKHIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSY  182

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAWG+++ K ++   V YG ++      VF F SALGD+AF+YAGHNVVLEIQATIPS
Sbjct  183   STIAWGASVDKGVQPD-VQYGYKAKTTAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPS  241

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++LEKP WLIA AN+
Sbjct  242   TPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYWMFGNSVQDNILISLEKPAWLIAMANM  301

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVVVHV+GSYQ+YAM +FDM+ET  VK L FKP+ TLRF+ RNL+VAFT+F+GI+ PFFG
Sbjct  302   FVVVHVIGSYQIYAMPVFDMMETVLVKKLNFKPSTTLRFIVRNLYVAFTMFIGITFPFFG  361

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLLGFFGGFAFAPTTY++PC+MWL + KP+KF LSW  NW  IV G++L IL+PIGGL  
Sbjct  362   GLLGFFGGFAFAPTTYFLPCVMWLAIYKPRKFSLSWWTNWICIVFGLMLMILSPIGGLRQ  421

Query  326   IVKSAKTYHFYQ  291
             I+  AK Y FY 
Sbjct  422   IILQAKDYEFYS  433



>ref|XP_004231799.1| PREDICTED: lysine histidine transporter 1-like [Solanum lycopersicum]
Length=449

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/431 (67%), Positives = 354/431 (82%), Gaps = 4/431 (1%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV +M++SW I
Sbjct  20    EEKAIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVTVMVVSWII  79

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  80    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGG  139

Query  1214  SSIKKVVELLCHD---CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
              S++KV +L+C     C  IKLSY+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYS
Sbjct  140   KSLQKVHDLVCKQEDGCANIKLSYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYS  199

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAWG+++ K ++ + VDYG ++H     VF F+S LG++AF+YAGHNVVLEIQATIPST
Sbjct  200   TIAWGASVKKGVQPN-VDYGYKAHSTAGTVFDFLSGLGEVAFAYAGHNVVLEIQATIPST  258

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             P+ PSK  MW+GVV+AY+VVA+CY+PVAFIGY   GN V DNIL++L KP WLI  AN+F
Sbjct  259   PEKPSKVPMWRGVVVAYIVVALCYFPVAFIGYWMFGNAVEDNILISLNKPTWLIVMANMF  318

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VVVHV+GSYQ+YAM +FDMIET  VK L+F+PT  LRFVTRN++VAFT+FVGI+ PFFGG
Sbjct  319   VVVHVIGSYQIYAMPVFDMIETVLVKKLRFRPTWYLRFVTRNIYVAFTMFVGITFPFFGG  378

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KP+++ LSW  NW  I+ G+LL +LAPIGGL SI
Sbjct  379   LLGFFGGFAFAPTTYFLPCIMWLAIYKPRRWSLSWLANWICIIFGVLLMVLAPIGGLRSI  438

Query  323   VKSAKTYHFYQ  291
             +  AKTY FY 
Sbjct  439   IVQAKTYKFYN  449



>ref|XP_003555159.1| PREDICTED: lysine histidine transporter 1-like [Glycine max]
Length=450

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/428 (66%), Positives = 350/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  ++DWLP+ S R+GKWWYS  HNVT+MVGAG+LSLPYAMSE+GWGPGV +++LSW I
Sbjct  24    RQKAINDWLPITSSRNGKWWYSAVHNVTSMVGAGVLSLPYAMSELGWGPGVTVLVLSWII  83

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + I+YMVTGG
Sbjct  84    TLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLVVEIGVNIVYMVTGG  143

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++K  + +C  CK IKL+++I+IF+   F+ S LP+FNSIS +SL AA+MS+SYSTIA
Sbjct  144   KSLQKFHDTVCDSCKKIKLTFFIMIFASVHFVLSHLPSFNSISGLSLAAAVMSLSYSTIA  203

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++ HK ++ + V YG ++   +  VF F SALGD+AF+YAGHNVV+EIQATIPSTP+ 
Sbjct  204   WAASAHKGVQEN-VQYGYKAKSTSGTVFNFFSALGDVAFAYAGHNVVMEIQATIPSTPEK  262

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVV+AY+VV +CY+PVA IGY   GN V DNIL++LEKP WLIA AN+FVV+
Sbjct  263   PSKGPMWRGVVVAYIVVGLCYFPVALIGYWMFGNSVEDNILISLEKPKWLIAMANMFVVI  322

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L FKP+ TLRF+ RN++VAFT+FVGI+ PFF GLLG
Sbjct  323   HVIGSYQIYAMPVFDMIETVMVKKLNFKPSSTLRFIVRNVYVAFTMFVGITFPFFSGLLG  382

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  IV GILL IL+PIGGL SI+ S
Sbjct  383   FFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWWANWICIVFGILLMILSPIGGLRSIIIS  442

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  443   AKDYKFYS  450



>ref|XP_003547675.1| PREDICTED: lysine histidine transporter 1-like [Glycine max]
Length=450

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/437 (66%), Positives = 354/437 (81%), Gaps = 1/437 (0%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             K    +    +  ++DWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV
Sbjct  15    KNATEEELQRQKAINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGV  74

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI +
Sbjct  75    TVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLVVEIGV  134

Query  1241  CIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
              I+YMVTGG S++K  + +C  CK IKL+++I+IF+   F+ S LPNFNSIS VSL AA+
Sbjct  135   NIVYMVTGGKSLQKFHDTVCDSCKKIKLTFFIMIFASVHFVLSHLPNFNSISGVSLAAAV  194

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTIAW ++ HK ++ + V+YG ++   +  VF F SALGD+AF+YAGHNVVLEIQ
Sbjct  195   MSLSYSTIAWAASAHKGVQEN-VEYGYKAKSTSGTVFNFFSALGDVAFAYAGHNVVLEIQ  253

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLI
Sbjct  254   ATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNTVEDNILISLEKPKWLI  313

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             A AN+FVV+HV+GSYQ+YAM +FDMIET  VK L FKP+ TLRF+ RNL+VAFT+FV I+
Sbjct  314   AMANMFVVIHVIGSYQIYAMPVFDMIETVMVKKLNFKPSMTLRFIVRNLYVAFTMFVAIT  373

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFFGGLLGFFGGFAFAPTTY++PC+MWL + KP++F +SW  NW  IV G+LL IL+PI
Sbjct  374   FPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPRRFSMSWWANWICIVFGLLLMILSPI  433

Query  341   GGLWSIVKSAKTYHFYQ  291
             GGL SI+ SAK Y FY 
Sbjct  434   GGLRSIIISAKDYKFYS  450



>ref|XP_008231175.1| PREDICTED: lysine histidine transporter 1-like [Prunus mume]
Length=449

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/450 (64%), Positives = 363/450 (81%), Gaps = 2/450 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDY-KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSL  1461
             MG     +  +Y  A+  +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSL
Sbjct  1     MGTQAPTDQNNYASADIDEKLATQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL  60

Query  1460  PYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLW  1281
             PYAMSE+GWGPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+
Sbjct  61    PYAMSELGWGPGVVILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLY  120

Query  1280  IVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPN  1101
             IVVPQQ +VE+ + I+YMVTGG S++KV   +C +CK IKL+Y+I+IF+   F+ S LPN
Sbjct  121   IVVPQQLVVEVGVNIVYMVTGGKSLQKVHNSVCPECKKIKLTYFIMIFASVHFVLSHLPN  180

Query  1100  FNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMA  921
              NSIS VSL AA+MS+SYSTIAW ++++K +  + V YG ++   +  VF F +ALG++A
Sbjct  181   LNSISGVSLAAAVMSLSYSTIAWAASVNKGVVDN-VQYGYKAKSTSGTVFNFFNALGEVA  239

Query  920   FSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSD  741
             F+YAGHNVVLEIQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V D
Sbjct  240   FAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALIGYYIFGNSVED  299

Query  740   NILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTR  561
             NIL++L+KPVWLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+PT+TLRF+TR
Sbjct  300   NILMSLQKPVWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLNFRPTRTLRFITR  359

Query  560   NLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTF  381
             N++VAFT+FVGI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  N+  
Sbjct  360   NIYVAFTMFVGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWWCNYIC  419

Query  380   IVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             I  G+LL +L+PIGGL +I+  AKTY FY 
Sbjct  420   IFFGVLLMVLSPIGGLRTIIIEAKTYKFYS  449



>ref|XP_006405428.1| hypothetical protein EUTSA_v10027769mg [Eutrema salsugineum]
 gb|ESQ46881.1| hypothetical protein EUTSA_v10027769mg [Eutrema salsugineum]
Length=444

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/439 (64%), Positives = 352/439 (80%), Gaps = 3/439 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY+ +  +  + + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  9     DYQDD--EKTSRQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  66

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  67    GVAVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  126

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  127   GVCIVYMVTGGKSLKKFHELVCEDCKSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  186

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW ++  K ++   V+YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  187   AVMSLSYSTIAWAASASKGVQED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLE  245

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP W
Sbjct  246   IQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNNVEDNILMSLKKPAW  305

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  R+ +VA T+FVG
Sbjct  306   LIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRSFYVAATMFVG  365

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PCI+WL + KP+K+ LSW  NW  IV G+ L +L+
Sbjct  366   MTFPFFGGLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWWANWVCIVFGLFLMVLS  425

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +IV  +K Y FY 
Sbjct  426   PIGGLRTIVIQSKGYKFYS  444



>ref|XP_006599056.1| PREDICTED: lysine histidine transporter 1 isoform X2 [Glycine 
max]
 ref|XP_006599057.1| PREDICTED: lysine histidine transporter 1 isoform X3 [Glycine 
max]
Length=466

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/438 (66%), Positives = 353/438 (81%), Gaps = 6/438 (1%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             K  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP AM+ +GWGPGV +++L
Sbjct  29    KRTAEQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPSAMASLGWGPGVVILVL  88

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I+YM
Sbjct  89    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVDIVYM  148

Query  1226  VTGGSSIKKVVELLCH---DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             VTGG S++K+ +L+C    DCK IK +Y+I+IF+   F+ S LPNFN+IS +SL AAIMS
Sbjct  149   VTGGKSLQKIHDLVCQHRKDCKNIKTTYFIMIFASVHFVLSHLPNFNAISGISLAAAIMS  208

Query  1055  VSYSTIAWGSALHKWIESH---AVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +SYSTIAW +++ K + +H   AV+YG ++     NVF F +ALGD+AF+YAGHNVVLEI
Sbjct  209   LSYSTIAWVASVDKRVHNHVDVAVEYGYKASTSAGNVFNFFNALGDVAFAYAGHNVVLEI  268

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPS+P+ PSK  MW+GV+IAY+VVA+CY+PVA IGY   GN V DNIL+TL KP WL
Sbjct  269   QATIPSSPEKPSKGPMWRGVLIAYLVVALCYFPVALIGYWVFGNSVDDNILITLNKPTWL  328

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             I  AN+FVV+HV+GSYQ+YAM +FDMIET  VK L+FKPT  LRFV RN++VAFT+FVGI
Sbjct  329   IVTANMFVVIHVIGSYQLYAMPVFDMIETVMVKQLRFKPTWQLRFVVRNVYVAFTMFVGI  388

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
             + PFFG LLGFFGGFAFAPTTY++PCI+WL + KPKKF LSW  NW  I+ G+LL IL+P
Sbjct  389   TFPFFGALLGFFGGFAFAPTTYFLPCIIWLAIYKPKKFSLSWITNWICIIFGLLLMILSP  448

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IGGL SI+ +AK Y FYQ
Sbjct  449   IGGLRSIILNAKNYGFYQ  466



>ref|XP_006292474.1| hypothetical protein CARUB_v10018703mg [Capsella rubella]
 gb|EOA25372.1| hypothetical protein CARUB_v10018703mg [Capsella rubella]
Length=433

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/432 (65%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             +  A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGV +++L
Sbjct  3     EKTAREKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVVILVL  62

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YM
Sbjct  63    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYM  122

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  EL C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  123   VTGGKSLKKFHELACEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSY  182

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW +++ K ++ + V+YG ++      VF F SALG++AF+YAGHNVVLEIQATIPS
Sbjct  183   STIAWSASVAKGVQEN-VEYGYKAKSAAGTVFNFFSALGEVAFAYAGHNVVLEIQATIPS  241

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             T D PSK  MWKGVV+AY+VVA+CY+PVA +GY   GN V DNIL+TL+KPVWLIA AN+
Sbjct  242   TTDKPSKGPMWKGVVVAYIVVALCYFPVALVGYWMFGNTVDDNILVTLKKPVWLIATANL  301

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV+HV+GSYQ+YAM +FDM+ET  VK + F+P   LRFV RN +VA T+FVG++ PFFG
Sbjct  302   FVVIHVIGSYQIYAMPVFDMMETLLVKKMNFRPNWFLRFVVRNFYVAATMFVGMTFPFFG  361

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLL FFGGFAFAPTTY++PC++WL + KP+++ LSW  NW  IV GI L +L+PIGGL +
Sbjct  362   GLLAFFGGFAFAPTTYFLPCVIWLKIYKPRRYSLSWWTNWICIVFGIFLMVLSPIGGLRT  421

Query  326   IVKSAKTYHFYQ  291
             I+  AK Y FY 
Sbjct  422   IIIQAKDYKFYS  433



>ref|NP_001060901.1| Os08g0127100 [Oryza sativa Japonica Group]
 dbj|BAD08858.1| putative histidine amino acid transporter [Oryza sativa Japonica 
Group]
 dbj|BAF22815.1| Os08g0127100 [Oryza sativa Japonica Group]
 dbj|BAG89420.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95342.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82845.1| hypothetical protein OsI_27668 [Oryza sativa Indica Group]
 gb|EEE67980.1| hypothetical protein OsJ_25900 [Oryza sativa Japonica Group]
Length=447

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/448 (66%), Positives = 357/448 (80%), Gaps = 8/448 (2%)
 Frame = -1

Query  1613  MGDYKAEGAKPA-----ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAM  1449
             MG   A+   PA     A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM
Sbjct  1     MGTQVADNYPPAKDGRSAQEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAM  60

Query  1448  SEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVP  1269
             SE+GWGPG+A++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVP
Sbjct  61    SELGWGPGIAVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVP  120

Query  1268  QQALVEISLCIIYMVTGGSSIKKVVELLC--HDCKPIKLSYYILIFSVGQFIASFLPNFN  1095
             QQ +VE+ + I+YMVTGG S+KK  ++LC  H CK IKL+Y+I+IF+   F+ S LPNFN
Sbjct  121   QQLVVEVGVNIVYMVTGGKSLKKFHDVLCEGHGCKNIKLTYFIMIFASVHFVLSQLPNFN  180

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS VSL AA+MS+SYSTIAWG+++ K  +   VDY  R+   T  VF F SALGD+AF+
Sbjct  181   SISGVSLAAAVMSLSYSTIAWGASVDKG-KVADVDYHLRATTSTGKVFGFFSALGDVAFA  239

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             YAGHNVVLEIQATIPSTP+ PSKK MWKGVV+AY++VA+CY+PVA +GY A GN V DNI
Sbjct  240   YAGHNVVLEIQATIPSTPEKPSKKPMWKGVVVAYIIVALCYFPVALVGYWAFGNHVDDNI  299

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL +P WLIA AN+ VV+HV+GSYQ+YAM +FDMIET  VK L+F P  TLR + R L
Sbjct  300   LITLSRPKWLIALANMMVVIHVIGSYQIYAMPVFDMIETVLVKKLRFPPGLTLRLIARTL  359

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+F+ I+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I+
Sbjct  360   YVAFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWFTNWICII  419

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +G++L IL+PIGGL  I+  AKTY FY 
Sbjct  420   LGVMLMILSPIGGLRQIIIDAKTYKFYS  447



>ref|XP_006405427.1| hypothetical protein EUTSA_v10027769mg [Eutrema salsugineum]
 gb|ESQ46880.1| hypothetical protein EUTSA_v10027769mg [Eutrema salsugineum]
Length=443

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 350/439 (80%), Gaps = 4/439 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             DY  E     + + E++DWLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMS++GWGP
Sbjct  9     DYDDE---KTSRQKEIEDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGWGP  65

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI
Sbjct  66    GVAVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEI  125

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  126   GVCIVYMVTGGKSLKKFHELVCEDCKSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAA  185

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW ++  K ++   V+YG ++      VF F S LGD+AF+YAGHNVVLE
Sbjct  186   AVMSLSYSTIAWAASASKGVQED-VEYGYKAKSTAGTVFNFFSGLGDVAFAYAGHNVVLE  244

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V DNIL++L+KP W
Sbjct  245   IQATIPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNNVEDNILMSLKKPAW  304

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA ANIFVV+HV+GSYQ+YAM +FDM+ET  VK L F+PT  LRF  R+ +VA T+FVG
Sbjct  305   LIATANIFVVIHVIGSYQIYAMPVFDMMETLLVKKLNFRPTTILRFCVRSFYVAATMFVG  364

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPTTY++PCI+WL + KP+K+ LSW  NW  IV G+ L +L+
Sbjct  365   MTFPFFGGLLAFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWWANWVCIVFGLFLMVLS  424

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL +IV  +K Y FY 
Sbjct  425   PIGGLRTIVIQSKGYKFYS  443



>ref|XP_007215373.1| hypothetical protein PRUPE_ppa005662mg [Prunus persica]
 gb|EMJ16572.1| hypothetical protein PRUPE_ppa005662mg [Prunus persica]
Length=449

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/450 (64%), Positives = 362/450 (80%), Gaps = 2/450 (0%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEG-AKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSL  1461
             MG     +  +Y +    +  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSL
Sbjct  1     MGTQAPTDQNNYASTDIDEKLAKQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL  60

Query  1460  PYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLW  1281
             PYAMSE+GWGPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+
Sbjct  61    PYAMSELGWGPGVVILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLY  120

Query  1280  IVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPN  1101
             IVVPQQ +VE+ + I+YMVTGG S++KV   +C +CK IKL+Y+I+IF+   F+ S LPN
Sbjct  121   IVVPQQLVVEVGVNIVYMVTGGKSLQKVHNSVCPECKKIKLTYFIMIFASVHFVLSHLPN  180

Query  1100  FNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMA  921
              NSIS VSL AA+MS+SYSTIAW ++++K +  + V YG ++   +  VF F +ALG++A
Sbjct  181   LNSISGVSLAAAVMSLSYSTIAWAASVNKGVVDN-VQYGYKAKSTSGTVFNFFNALGEVA  239

Query  920   FSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSD  741
             F+YAGHNVVLEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN V D
Sbjct  240   FAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYYIFGNSVED  299

Query  740   NILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTR  561
             NIL++L+KPVWLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+PT+TLRF+TR
Sbjct  300   NILMSLQKPVWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLNFRPTRTLRFITR  359

Query  560   NLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTF  381
             N++VAFT+FVGI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  N+  
Sbjct  360   NIYVAFTMFVGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWWCNYIC  419

Query  380   IVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             I  G+LL +L+PIGGL +I+  AKTY FY 
Sbjct  420   IFFGVLLMVLSPIGGLRTIIIEAKTYKFYS  449



>ref|XP_009411834.1| PREDICTED: lysine histidine transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=440

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 351/441 (80%), Gaps = 1/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M +  +           +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GW
Sbjct  1     MNNQSSSNDNKTDKDKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSHLGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPG+ +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V
Sbjct  61    GPGIVVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YMVTGG S+KK  +++C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL
Sbjct  121   EVGVNIVYMVTGGKSLKKFHDVVCPDCKSIKLTYFIMIFASVHFVLSQLPNFNSISGVSL  180

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS+SYSTIAW + LHK  + H VDY   +   T  VF F +ALGD+AF+YAGHNVV
Sbjct  181   AAAVMSLSYSTIAWATPLHKGKQEH-VDYSNPASTTTGAVFNFFNALGDVAFAYAGHNVV  239

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP+ PSKK MWKGVV+AY++VA+CY+PVA IGY A GN V DNIL+TLEKP
Sbjct  240   LEIQATIPSTPEEPSKKPMWKGVVVAYIIVAICYFPVALIGYWAFGNAVDDNILITLEKP  299

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
              WLIA AN+FVVVHV+GSYQ+YAM +FDMIET  VK L F P  TLR + R+++VA T+F
Sbjct  300   RWLIAMANMFVVVHVIGSYQIYAMPVFDMIETVLVKKLHFPPGLTLRLIARSVYVALTMF  359

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             +GI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F  SW +NW  IV+G+LL +
Sbjct  360   IGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSASWIINWICIVLGVLLMV  419

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             L+PIGGL SI+  A +Y F+ 
Sbjct  420   LSPIGGLRSIILQASSYRFFS  440



>ref|XP_002443797.1| hypothetical protein SORBIDRAFT_07g002250 [Sorghum bicolor]
 gb|EES13292.1| hypothetical protein SORBIDRAFT_07g002250 [Sorghum bicolor]
Length=460

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/436 (65%), Positives = 352/436 (81%), Gaps = 2/436 (0%)
 Frame = -1

Query  1595  EGAKPAANKG-EVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             +G + A  K  E+D+WLP+ + R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWG GV 
Sbjct  26    DGGRSAEEKAAEIDNWLPINASRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGAGVT  85

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             +MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGLWIVVPQQ +VE+ + 
Sbjct  86    IMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGERLGLWIVVPQQLVVEVGVN  145

Query  1238  IIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             I+YMVTGG+S+KK  + +C  CK +KL+Y+I+IF+   F+ S LPNFNSIS VSL AA+M
Sbjct  146   IVYMVTGGTSLKKFHDTVCESCKQLKLTYFIMIFASVHFVLSQLPNFNSISGVSLAAAVM  205

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S+SYSTIAWG+++ K  ++  VDYG R+      VF F+ ALG +AF+YAGHNVVLEIQA
Sbjct  206   SLSYSTIAWGASVDKG-KAANVDYGMRATTTPGKVFGFLGALGTVAFAYAGHNVVLEIQA  264

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP+ PSKK MWKGVV+AY+VVA+CY+PV+F+GY A GN V  +IL+TL +P WLIA
Sbjct  265   TIPSTPEKPSKKPMWKGVVVAYIVVALCYFPVSFVGYWAFGNTVDSDILITLSRPKWLIA  324

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              AN+ VV+HV+GSYQ+YAM +FDM+ET  VK L+F P   LR + R ++VAFT+F+ I+ 
Sbjct  325   LANMMVVIHVIGSYQIYAMPVFDMMETVLVKKLRFPPGLMLRLIARTVYVAFTMFIAITF  384

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFF GLL FFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  I++G+LL +LAPIG
Sbjct  385   PFFDGLLSFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWFTNWICIILGVLLMVLAPIG  444

Query  338   GLWSIVKSAKTYHFYQ  291
             GL +I+ SAKTYHFYQ
Sbjct  445   GLRNIIISAKTYHFYQ  460



>ref|XP_009601963.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana tomentosiformis]
Length=455

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/436 (67%), Positives = 355/436 (81%), Gaps = 8/436 (2%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+E+GWGPGV +M++SW 
Sbjct  21    AEEKAIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWGPGVTVMVVSWI  80

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTG
Sbjct  81    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTG  140

Query  1217  GSSIKKVVELLC-------HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             G S+ KV EL+C       H  K IKLSY+I+IF+   F+ S LPNFNSIS VSL AA+M
Sbjct  141   GRSLMKVHELVCTKNEDNIHCTKDIKLSYFIMIFASVHFVLSHLPNFNSISGVSLAAAVM  200

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S+SYSTIAWG+++ K ++   VDYG ++H  +  VF F+S LG++AF+YAGHNVVLEIQA
Sbjct  201   SLSYSTIAWGASVKKGVQPD-VDYGYKAHSTSGTVFNFLSGLGEVAFAYAGHNVVLEIQA  259

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAFIGY   GN V DNIL++L KP WLIA
Sbjct  260   TIPSTPEKPSKIPMWRGVVVAYIVVALCYFPVAFIGYWMFGNSVEDNILVSLNKPTWLIA  319

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              AN+FVVVHV+GSYQ+YAM +FDM+ET  VK L+F PT  LRFVTRN++VAFT+FVGI+ 
Sbjct  320   MANMFVVVHVIGSYQIYAMPVFDMLETVLVKKLRFSPTWYLRFVTRNIYVAFTMFVGITF  379

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP+++ LSW  NW  I+ G+LL +LAPIG
Sbjct  380   PFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRWSLSWIANWICIIFGVLLMVLAPIG  439

Query  338   GLWSIVKSAKTYHFYQ  291
             GL SI+  AKTY FY 
Sbjct  440   GLRSIIVQAKTYKFYN  455



>ref|XP_009414681.1| PREDICTED: lysine histidine transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/428 (67%), Positives = 351/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG+A++ILSW I
Sbjct  21    KEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGIAVLILSWVI  80

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  81    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVVEVGVNIVYMVTGG  140

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  +++C DCK IKL+Y+I+IF    F+ S LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  141   KSLKKFHDVVCTDCKSIKLTYFIMIFGSVHFVLSQLPNFNSISGVSLAAAVMSLSYSTIA  200

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             WG+++ K  + + V+YG +S   +  VF F SALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  201   WGASVDKGKQEN-VEYGYKSASTSGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEK  259

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MW+GV++AY+VVA+CY+PVA +GY A GN V DNIL+TLEKP WLIA AN+ VVV
Sbjct  260   PSKKPMWRGVIVAYIVVALCYFPVALVGYWAFGNVVDDNILITLEKPRWLIAMANMMVVV  319

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L F P  TLR + R+++VAFT+F+G++ PFFGGLLG
Sbjct  320   HVIGSYQIYAMPVFDMIETVLVKKLHFPPGLTLRLIARSVYVAFTMFIGMTFPFFGGLLG  379

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I+ G+LL IL+PIGGL  I+  
Sbjct  380   FFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWITNWICIIFGVLLMILSPIGGLRQIIID  439

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  440   AKKYTFYS  447



>ref|XP_010531645.1| PREDICTED: lysine histidine transporter 2-like [Tarenaya hassleriana]
Length=434

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/425 (68%), Positives = 358/425 (84%), Gaps = 1/425 (0%)
 Frame = -1

Query  1565  EVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAITLY  1386
             +VD+WLP+ S R+ KWWYS FHNVTA+VGAG+LSLPYAM+ + WGPGV +MILSW ITLY
Sbjct  11    KVDEWLPITSSRNAKWWYSAFHNVTAIVGAGVLSLPYAMANLVWGPGVTVMILSWVITLY  70

Query  1385  TLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGSSI  1206
             TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG S+
Sbjct  71    TLWQMVEMHEMVPGKRFDRYHELGQEAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGGKSL  130

Query  1205  KKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAWGS  1026
             KKV +LLC DCK I+L+++I+IF+   F+ + LPNFNSIS +SL AA+MS++YST+ W +
Sbjct  131   KKVHDLLCKDCKDIRLTFWIMIFASVHFVLAHLPNFNSISGISLAAAVMSLTYSTVGWSA  190

Query  1025  ALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNPSK  846
             +LHK ++   VDY  ++  ++  VF F+SALGD+AF+YAGHNVVLEIQATIPS PD PSK
Sbjct  191   SLHKGLQPD-VDYSYKASTQSGRVFNFLSALGDVAFAYAGHNVVLEIQATIPSEPDKPSK  249

Query  845   KAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvhvV  666
               MW+GVV+AY+VVA+CY PVAFIGY   GN V DNIL+TLEKP WLIAAAN+FVVVHV+
Sbjct  250   IPMWRGVVVAYIVVAVCYLPVAFIGYYMFGNAVDDNILITLEKPTWLIAAANLFVVVHVI  309

Query  665   GSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllgffg  486
             GSYQ++AM +FDM+ETF VK + F P+  LRFVTRN++VAFT+FVGI +PFFGGLLGFFG
Sbjct  310   GSYQIFAMPVFDMLETFLVKKMGFNPSFMLRFVTRNVYVAFTMFVGICIPFFGGLLGFFG  369

Query  485   gfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKSAKT  306
             GFAFAPTTYY+PCI+WL L KPK+FGLSW +NW  IV+GI+LTI+APIGGL +I+ +A +
Sbjct  370   GFAFAPTTYYLPCIIWLALKKPKRFGLSWTINWFCIVVGIVLTIIAPIGGLRTIIVNANS  429

Query  305   YHFYQ  291
             Y F+ 
Sbjct  430   YKFFS  434



>ref|XP_010673705.1| PREDICTED: lysine histidine transporter 2-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=443

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/444 (64%), Positives = 353/444 (80%), Gaps = 4/444 (1%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             MG  + +       + ++D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GW
Sbjct  1     MGTRQPDIEAKLQKQKDIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V
Sbjct  61    GPGVVILVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVVPQQLIV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHD---CKPIKLSYYILIFSVGQFIASFLPNFNSISF  1083
             E+ + I+YMVTGG S++KV +++C +   C P+K +Y+I+IFS   F+ S LPNFNSI+ 
Sbjct  121   EVGVNIVYMVTGGRSLEKVHDIICANKTSCTPMKTTYFIMIFSSVHFVLSHLPNFNSIAG  180

Query  1082  VSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGH  903
             VSL AA+MS+SYSTIAW ++L K ++ H V Y  R H      F F +ALGD+AF+YAGH
Sbjct  181   VSLAAAVMSLSYSTIAWATSLGKGVQPH-VTYTSRHHSDVGKTFGFFNALGDVAFAYAGH  239

Query  902   NVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTL  723
             NVVLEIQATIPSTP+ PSK  MWKGV++AY+VVA+CY+PVA IGY   GN V DNIL++L
Sbjct  240   NVVLEIQATIPSTPEKPSKGPMWKGVIVAYIVVALCYFPVALIGYYVFGNTVRDNILISL  299

Query  722   EKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAF  543
             EKP WLIA ANIFVV+HV+GSYQ+YAM +FDMIET  VK ++FKPT  LRF+ RN++VAF
Sbjct  300   EKPGWLIAMANIFVVIHVIGSYQIYAMPVFDMIETVLVKKIRFKPTWYLRFIARNIYVAF  359

Query  542   TLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGIL  363
             T+FV I+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSWC NW  IV+G++
Sbjct  360   TMFVAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWCANWICIVLGVI  419

Query  362   LTILAPIGGLWSIVKSAKTYHFYQ  291
             L +LAPIGGL  I+  +K Y FY 
Sbjct  420   LMVLAPIGGLRQIIIDSKNYTFYS  443



>ref|XP_009758938.1| PREDICTED: lysine histidine transporter 2-like [Nicotiana sylvestris]
Length=443

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/442 (64%), Positives = 353/442 (80%), Gaps = 2/442 (0%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             E    +  G++ ++NK +++DWLP+ S R+ KW+YS FHNVTAMVGAG+L LPYAMS++G
Sbjct  4     EEKKKRGSGSEGSSNK-DLNDWLPITSSRNAKWYYSAFHNVTAMVGAGVLGLPYAMSQLG  62

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WG G  +M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  63    WGAGATVMVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLM  122

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG SIKK+ +  C  C+P+K +Y+I++FS   F  S  PNFNSI+ VS
Sbjct  123   VEVGVNIVYMVTGGKSIKKIYDTACPSCRPLKTTYFIMMFSSIHFFLSHCPNFNSITLVS  182

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
              LAAIMS+SYSTI WG+++HK I S  VDY PR+   T  VF F+SALGD+AF++AGHNV
Sbjct  183   FLAAIMSLSYSTIGWGASVHKGI-SPEVDYSPRASTTTGRVFGFLSALGDVAFAFAGHNV  241

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQAT+PS+P+ P+KK MWKGV+ AY+VVA+CY+PVAF+GY   G  V DN+L++LEK
Sbjct  242   VLEIQATMPSSPEKPAKKPMWKGVIFAYIVVALCYFPVAFVGYAVFGKSVEDNVLISLEK  301

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN FVVVHV+GSYQV+AM +FDM+E++ VK  KF PTKTLRF+ R  +VA T+
Sbjct  302   PAWLIIIANAFVVVHVIGSYQVFAMGVFDMVESYLVKQRKFTPTKTLRFIVRTSYVALTM  361

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             F+GI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPKKFGLSW  NW  I++G+LL 
Sbjct  362   FLGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKKFGLSWFTNWICIILGVLLM  421

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             ILAPIG L  I+  AK Y FY 
Sbjct  422   ILAPIGALRQIILQAKDYKFYS  443



>ref|XP_008800948.1| PREDICTED: lysine histidine transporter 1-like [Phoenix dactylifera]
Length=447

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/430 (66%), Positives = 347/430 (81%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +  +  VDDWLP+ S R  KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG+ ++ILSW
Sbjct  19    SQKEKSVDDWLPITSSRDAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGIVILILSW  78

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+S+ I+YMVT
Sbjct  79    IITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVVEVSVDIVYMVT  138

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KK  +L+C  CK IK +Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYST
Sbjct  139   GGQSLKKFHDLVCPGCKSIKQTYFIMIFASVHFVLSQLPNFNSISGVSLAAAVMSLSYST  198

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAWG+++ K  + + V+YG +S      VF F+SALG++AF+YAGHNVVLEIQATIPSTP
Sbjct  199   IAWGASVDKGKQEN-VEYGYKSSSTAGTVFGFLSALGNVAFAYAGHNVVLEIQATIPSTP  257

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
               PSKKAMWKGV++AY+VVA+CY+PVA +GY A GN V DNILL+L+KP WLIAAAN+ V
Sbjct  258   QKPSKKAMWKGVIVAYIVVALCYFPVALVGYWAFGNGVQDNILLSLDKPRWLIAAANMMV  317

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             V+HV+GSYQ+YAM +FDM+ET  VK L F P   LR + R+++VA T+F+GI+ PFFG L
Sbjct  318   VIHVIGSYQIYAMPVFDMMETVLVKKLHFPPGLMLRLIARSVYVALTMFIGITFPFFGAL  377

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             L FFGG A+APT+YY+PCI+WL++ KPK   LSW  NW  I++G+LL ILAPIGGL  I+
Sbjct  378   LSFFGGLAYAPTSYYLPCIIWLLIYKPKVGSLSWIANWICIILGVLLMILAPIGGLRQII  437

Query  320   KSAKTYHFYQ  291
               AKTY FY 
Sbjct  438   LEAKTYKFYS  447



>ref|NP_001152139.1| LHT1 [Zea mays]
 gb|ACG46044.1| LHT1 [Zea mays]
Length=446

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/448 (65%), Positives = 350/448 (78%), Gaps = 6/448 (1%)
 Frame = -1

Query  1625  RELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMS  1446
             +E ++ D    G      +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+L LPYAMS
Sbjct  2     QEQDVDD--GGGRTTQQQEKSIDDWLPINSSRKAKWWYSAFHNVTAMVGAGVLGLPYAMS  59

Query  1445  EMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQ  1266
             E+GWGPG+A+MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG +LGLWIVVPQ
Sbjct  60    ELGWGPGIAVMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGDRLGLWIVVPQ  119

Query  1265  QALVEISLCIIYMVTGGSSIKKVVELLCHDCK---PIKLSYYILIFSVGQFIASFLPNFN  1095
             Q  VE+SL IIYMVTGG S+KK  +++C   +    +KLSY+I+IF+    + S LPNFN
Sbjct  120   QLAVEVSLNIIYMVTGGQSLKKFHDVICDGGRCGGDLKLSYFIMIFASVHLVLSQLPNFN  179

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS VSL AA+MS+SYSTIAWG++LH+      VDY  R+      VF F+  LGD+AF+
Sbjct  180   SISAVSLAAAVMSLSYSTIAWGASLHRG-RREDVDYHLRATTTPGKVFGFLGGLGDVAFA  238

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             Y+GHNVVLEIQATIPSTPD PSKKAMWKG  +AYVVVA+CY+PV F+GY A G+ V +NI
Sbjct  239   YSGHNVVLEIQATIPSTPDKPSKKAMWKGAFVAYVVVAICYFPVTFVGYWAFGSGVDENI  298

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL KP WLIA AN+ VVVHV+GSYQVYAM +FDMIET  VK ++F P+ TLR + R++
Sbjct  299   LITLSKPKWLIALANMMVVVHVIGSYQVYAMPVFDMIETVLVKKMRFAPSLTLRLIARSV  358

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+F+GI+ PFFGGLL FFGG AFAPTTY++PCIMWL + KPK+FGLSW +NW  IV
Sbjct  359   YVAFTMFLGITFPFFGGLLSFFGGLAFAPTTYFLPCIMWLKVYKPKRFGLSWFINWICIV  418

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             IG+LL IL PIGGL  I+ SA TY FYQ
Sbjct  419   IGVLLLILGPIGGLRQIILSATTYKFYQ  446



>ref|XP_008450063.1| PREDICTED: lysine histidine transporter 2-like isoform X1 [Cucumis 
melo]
Length=450

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/438 (65%), Positives = 360/438 (82%), Gaps = 5/438 (1%)
 Frame = -1

Query  1592  GAKPAANKGE----VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPG  1425
             G K   NK +    +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP AM+ +GWGPG
Sbjct  14    GDKHMINKTKEQKTIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPSAMANLGWGPG  73

Query  1424  VAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEIS  1245
             V +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +V++ 
Sbjct  74    VTVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVQVG  133

Query  1244  LCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
               I+YMVTGG S+KK  +++C  CK IKL+Y+I+IF+  QF+ S LP+FNS+S VSL AA
Sbjct  134   TNIVYMVTGGQSLKKFHDIVCPSCKSIKLTYFIMIFASVQFVLSHLPSFNSMSGVSLAAA  193

Query  1064  IMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +MS++YSTIAW +++ K ++   VDYG ++   T  VF F++ALGD+AF+YAGH+VVLEI
Sbjct  194   VMSLTYSTIAWTTSIAKGVQPD-VDYGLKASTTTGKVFNFLNALGDVAFAYAGHSVVLEI  252

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPSTP+ PSK+AMWKGV++AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WL
Sbjct  253   QATIPSTPEKPSKRAMWKGVLVAYIVVALCYFPVALIGYWTFGNSVKDNILISLEKPGWL  312

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             IA AN+FVV+HV+G YQ+Y+M +FDMIET  VK + FKP+  LRF+ RN++VA T+F+GI
Sbjct  313   IALANMFVVIHVIGGYQIYSMPVFDMIETVLVKKMHFKPSFLLRFIARNIYVALTMFIGI  372

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
             + PFFGGLLGFFGGFAFAPTTY+IPC++WL++ KPKKFGLSWC NW  I++G+LLT+L+P
Sbjct  373   TFPFFGGLLGFFGGFAFAPTTYFIPCVIWLLMYKPKKFGLSWCTNWICIILGVLLTVLSP  432

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IGGL +I+  AK YHFY 
Sbjct  433   IGGLRNIIIQAKNYHFYS  450



>emb|CAD89802.1| histidine amino acid transporter [Oryza sativa Indica Group]
Length=441

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/432 (67%), Positives = 352/432 (81%), Gaps = 3/432 (1%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG+A++ILSW
Sbjct  11    SAQEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGIAVLILSW  70

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  71    IITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVEVGVNIVYMVT  130

Query  1220  GGSSIKKVVELLC--HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             GG S+KK  ++LC  H CK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  131   GGKSLKKFHDVLCEGHGCKNIKLTYFIMIFASVHFVLSQLPNFNSISGVSLAAAVMSLSY  190

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAWG+++ K  +   VDY  R+   T  VF F SALGD+AF+YAGHNVVLEIQATIPS
Sbjct  191   STIAWGASVDKG-KVADVDYHLRATTSTGKVFGFFSALGDVAFAYAGHNVVLEIQATIPS  249

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSKK MWKGVV+AY++VA+CY+PVA +GY A GN V DNIL+TL +P WLIA AN+
Sbjct  250   TPEKPSKKPMWKGVVVAYIIVALCYFPVALVGYWAFGNHVDDNILITLSRPKWLIALANM  309

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
              VV+HV+GSYQ+YAM +FDMIET  VK L+F P  TLR + R L+VAFT+F+ I+ PFFG
Sbjct  310   MVVIHVIGSYQIYAMPVFDMIETVLVKKLRFPPGLTLRLIARTLYVAFTMFIAITFPFFG  369

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I++G++L IL+PIGGL  
Sbjct  370   GLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWFTNWICIILGVMLMILSPIGGLRQ  429

Query  326   IVKSAKTYHFYQ  291
             I+  AKTY FY 
Sbjct  430   IIIDAKTYKFYS  441



>ref|XP_010502695.1| PREDICTED: lysine histidine transporter 1-like [Camelina sativa]
Length=445

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/432 (63%), Positives = 338/432 (78%), Gaps = 3/432 (1%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             +  A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGV +++L
Sbjct  17    EKTAREKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVVILVL  76

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YM
Sbjct  77    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYM  136

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SY
Sbjct  137   VTGGKSLKKFHELVCEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSY  196

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW +++ K ++ + V+YG ++      VF F S LG++AF+YAGHNVVLEIQATIPS
Sbjct  197   STIAWSASVAKGVQEN-VEYGYKAKSTAGTVFNFFSGLGEVAFAYAGHNVVLEIQATIPS  255

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TPD PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN V DNIL TL+KPVWLIA ANI
Sbjct  256   TPDKPSKGPMWKGVVVAYIVVALCYFPVALIGYWMFGNAVDDNILGTLKKPVWLIATANI  315

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV+HV+GSYQ+YAM +FDM+ET  VK + F+P   LRFV RN +VA T+FVG++ P   
Sbjct  316   FVVIHVIGSYQIYAMPVFDMMETLLVKKMNFRPNWFLRFVVRNFYVAATMFVGMTFP--F  373

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
                       FAPTTY++PC++WL + KP+++ LSW  NW  IV GI L +L+PIGGL +
Sbjct  374   FGGLLAFFGGFAPTTYFLPCVIWLKIYKPRRYSLSWWTNWICIVFGIFLMVLSPIGGLRT  433

Query  326   IVKSAKTYHFYQ  291
             IV  AK Y FY 
Sbjct  434   IVIQAKDYKFYS  445



>ref|XP_010037451.1| PREDICTED: lysine histidine transporter 1-like [Eucalyptus grandis]
 gb|KCW49166.1| hypothetical protein EUGRSUZ_K02749 [Eucalyptus grandis]
Length=440

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/443 (63%), Positives = 354/443 (80%), Gaps = 3/443 (1%)
 Frame = -1

Query  1619  LEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEM  1440
             +E+ D      K   ++ +++DWLP+   R+ KWWYS FHNVTAMVGAG+L LPYA+S++
Sbjct  1     MEIEDQSLSNKK--MSEKDLNDWLPITKSRNAKWWYSAFHNVTAMVGAGVLGLPYAISQL  58

Query  1439  GWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQA  1260
             GWGPG  +MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG K+GLW+VVPQQ 
Sbjct  59    GWGPGATVMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKMGLWVVVPQQL  118

Query  1259  LVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFV  1080
             +VE+ + I+YM+TGG S++K  + +C DCKPIK++Y+I+IF+   F+ S LP+FNSI+ V
Sbjct  119   MVEVGVDIVYMITGGKSLQKFHDTVCPDCKPIKMTYFIMIFAAVHFVLSHLPSFNSITGV  178

Query  1079  SLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHN  900
             SL AA+MS+SYSTIAW ++  + ++   V YG R+   T  VF F SALGD+AF++AGHN
Sbjct  179   SLAAAVMSLSYSTIAWIASADRGVQPD-VQYGSRASTTTGRVFGFFSALGDIAFAFAGHN  237

Query  899   VVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLE  720
             VVLEIQATIPSTP+ PSKK MWKGV  AYV+VA+CY+PVAFIGY   GN V DN+L++LE
Sbjct  238   VVLEIQATIPSTPEKPSKKPMWKGVAFAYVIVALCYFPVAFIGYWVFGNSVQDNVLISLE  297

Query  719   KPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFT  540
             KP WLIAAAN+FVV+HV+GSYQV+A+ +FDMIE+  VK +KFKPT+ LRF+TRNL+VA T
Sbjct  298   KPRWLIAAANMFVVIHVIGSYQVFAIPVFDMIESCLVKKMKFKPTRMLRFMTRNLYVALT  357

Query  539   LFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILL  360
             +F+ I+ PFFGGLL FFGGFAFAPTTYY+PCIMWL + KPKKF LSW  NW  I++G+LL
Sbjct  358   MFLAITFPFFGGLLSFFGGFAFAPTTYYLPCIMWLAIYKPKKFSLSWFANWICIILGVLL  417

Query  359   TILAPIGGLWSIVKSAKTYHFYQ  291
              +LAPIG L  I+  AK + FY 
Sbjct  418   MVLAPIGALREIIIQAKDFKFYS  440



>emb|CDP16662.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/445 (65%), Positives = 357/445 (80%), Gaps = 3/445 (1%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSE  1443
              L   D K    + A  K  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS+
Sbjct  9     HLHYDDSKTVDNRTAEEKA-IDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSK  67

Query  1442  MGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQ  1263
             +GWGPGV +M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ
Sbjct  68    LGWGPGVTVMVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQ  127

Query  1262  ALVEISLCIIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSIS  1086
              +VE+ + I+YMVTGG S+KK  +L+C   CK IK +Y+I+IF+   F+ + LPNFNSIS
Sbjct  128   LVVEVGVDIVYMVTGGKSLKKFHDLVCSKPCKDIKTTYFIMIFASVHFVLAHLPNFNSIS  187

Query  1085  FVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAG  906
              VSL AA+MS+SYSTIAWG+++ K ++   V+YG R+      VF F  ALGD+AF+YAG
Sbjct  188   GVSLAAAVMSLSYSTIAWGASVKKGVQPD-VEYGYRATTTAGTVFNFFGALGDVAFAYAG  246

Query  905   HNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLT  726
             HNVVLEIQATIPS P+ PSK  MW+GVV+AY+VVA+CY+PVAFIG+   GN V DN+L++
Sbjct  247   HNVVLEIQATIPSKPEKPSKVPMWRGVVVAYIVVALCYFPVAFIGFWMFGNSVEDNVLIS  306

Query  725   LEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVA  546
             L KP WLIA AN+FVVVHV+GSYQ+YAM +FDMIET  VK L+FKP+ TLRFV+RN++VA
Sbjct  307   LNKPTWLIAMANMFVVVHVIGSYQIYAMPVFDMIETVLVKKLRFKPSWTLRFVSRNIYVA  366

Query  545   FTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGI  366
             FT+FVGI+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP+++ LSW  NW  I++G+
Sbjct  367   FTMFVGITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRYSLSWITNWICIILGV  426

Query  365   LLTILAPIGGLWSIVKSAKTYHFYQ  291
             LL ++APIGGL  I+  AKTY FY 
Sbjct  427   LLMVIAPIGGLRQIILEAKTYKFYS  451



>ref|XP_009408762.1| PREDICTED: lysine histidine transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/431 (65%), Positives = 354/431 (82%), Gaps = 1/431 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             +  A +  +DDWLP+ S R  KWWYS FHNVTA+VGAG+LSLPYAM+++GWGPG+A++IL
Sbjct  11    EEKAREKSIDDWLPITSSRKAKWWYSAFHNVTALVGAGVLSLPYAMAQLGWGPGIAVLIL  70

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMV+MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ  VE+ + I+YM
Sbjct  71    SWVITLYTLWQMVQMHEMVPGKRFDRYHELGQQAFGDKLGLWIVVPQQLTVEVGVNIVYM  130

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  ++LC DCK IKL+Y+I+IF    F+ S LPNFNSIS VSL AA+MS SY
Sbjct  131   VTGGKSLKKFHDVLCPDCKSIKLTYFIMIFGSVHFVLSQLPNFNSISGVSLAAAVMSFSY  190

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             ST+AWG+++H+  +++ V+Y  +S    + VF F+SALGD++F+YAGHNV LEIQATIPS
Sbjct  191   STVAWGASVHRGKQAN-VEYVYKSSSTAEGVFNFLSALGDVSFAYAGHNVALEIQATIPS  249

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+NPSKK MWKGVV+AY+VVA+CY+PVAF+GY A GN V+DNIL+TL KP WLIA ANI
Sbjct  250   TPENPSKKPMWKGVVVAYIVVALCYFPVAFLGYWAFGNGVADNILITLNKPRWLIATANI  309

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
              VV+HV+GSYQ+YAM +FDMIET  VK L F P   +R + R+ +VAFT+FVG++ PFFG
Sbjct  310   MVVIHVIGSYQIYAMPVFDMIETVLVKKLHFPPGLAVRLIGRSTYVAFTMFVGMTFPFFG  369

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLLGFFGGFAFAPTTY++PC+MWL + KP++F LSW +NW  I++G+LL IL+PIGGL  
Sbjct  370   GLLGFFGGFAFAPTTYFLPCVMWLSVYKPRRFSLSWIINWICILLGVLLMILSPIGGLRQ  429

Query  326   IVKSAKTYHFY  294
             I+  AK+Y FY
Sbjct  430   IIMDAKSYEFY  440



>emb|CBI27555.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/455 (61%), Positives = 351/455 (77%), Gaps = 6/455 (1%)
 Frame = -1

Query  1655  RTPAFKMGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGA  1476
             ++ A  +   R++E    + +     A +  +DDWLP+ S R+ KWWYS FHNVTAMVGA
Sbjct  23    KSLASALNLLRKMEHNQQEKD-----AREKAIDDWLPITSSRNAKWWYSAFHNVTAMVGA  77

Query  1475  GILSLPYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGP  1296
             G+LSLPYAM+E+GWGPGV ++ILSW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG 
Sbjct  78    GVLSLPYAMAELGWGPGVVVLILSWIVTLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGE  137

Query  1295  KLGLWIVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIA  1116
             KLGLWIVVPQQ +VE+ + I YM+TGG S++K    +C  CKPIK +Y+I+IF+   F+ 
Sbjct  138   KLGLWIVVPQQVIVEVGVDIAYMITGGKSLQKFHNTVCPSCKPIKTTYFIMIFASCHFVL  197

Query  1115  SFLPNFNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSA  936
             S LPNFNSI+ VS  AA MS++YSTIAW +++HK ++   V Y   +   T  VF F SA
Sbjct  198   SHLPNFNSIAGVSFAAATMSLTYSTIAWTASVHKGVQPD-VQYTYTASTTTGRVFNFFSA  256

Query  935   LGDMAFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALG  756
             LGD+AF+YAGHNVVLEIQATIPSTP+ PSK+ MWKGV+ AY+VVA+CY+PVA IGY   G
Sbjct  257   LGDVAFAYAGHNVVLEIQATIPSTPEKPSKRPMWKGVIFAYIVVALCYFPVALIGYWMFG  316

Query  755   NQVSDNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTL  576
             N V+DNIL+TLEKP WLIAAAN+FVV+HV+GSYQ+YAM +FDM+ET  VK LKF P+  L
Sbjct  317   NSVADNILITLEKPRWLIAAANLFVVIHVIGSYQIYAMPVFDMLETLLVKKLKFTPSFRL  376

Query  575   RFVTRNLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWC  396
             R +TR L+VAFT+F+G+ +PFFG LLGF GG  FAPTTY++PCIMWL + KPK+F LSW 
Sbjct  377   RLITRTLYVAFTMFIGMLIPFFGSLLGFLGGLVFAPTTYFLPCIMWLAIYKPKRFSLSWI  436

Query  395   MNWTFIVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
              NW  I++G++L ILAPIG L  I+  AKT+  + 
Sbjct  437   TNWICIILGVILMILAPIGALRQIILQAKTFEVFS  471



>ref|XP_011073064.1| PREDICTED: lysine histidine transporter 2-like [Sesamum indicum]
Length=462

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/429 (65%), Positives = 350/429 (82%), Gaps = 2/429 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             + N+ +++DWLPV S R GKWWYS FHN+TAMVGAG+L LPYAMSE+GWGPGV +M+LSW
Sbjct  35    SKNEKDLNDWLPVTSSRKGKWWYSAFHNITAMVGAGVLGLPYAMSELGWGPGVTVMVLSW  94

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE V GKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+ + I+YMVT
Sbjct  95    IITLYTLWQMVEMHEAVAGKRFDRYHELGQHAFGEKLGLWLVVPQQLMVEVGVNIVYMVT  154

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KK+ ++L    +P++LSY+ +IF    F  S LPNFNSI+ +SL AA+MS+SYST
Sbjct  155   GGKSLKKIHDML-RPHQPMRLSYFTVIFGSVHFFLSHLPNFNSITVISLAAAVMSISYST  213

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             I W ++LHK I S  V Y PR+   +  VF F+SALGD+AF++AGHNVVLEIQATIPSTP
Sbjct  214   IGWVASLHKGI-SPEVTYLPRASTSSGRVFEFLSALGDVAFAFAGHNVVLEIQATIPSTP  272

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             +NPSKK MWKGVVIAY+VVA+CY+PVAF+GY   GN V DNIL++L+KP WLI AAN+FV
Sbjct  273   ENPSKKPMWKGVVIAYIVVALCYFPVAFVGYAIFGNTVDDNILMSLQKPAWLIIAANMFV  332

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQV+AM +FDM+E++ VK +KFKP++ LR VTR  +VA T+ +G+S PFFGGL
Sbjct  333   VVHVIGSYQVFAMPVFDMVESYLVKQMKFKPSRLLRIVTRTSYVALTMLLGVSFPFFGGL  392

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             L FFGGFAFAPT+YY+PCIMWL + KP++F LSW  NWT IV+G+LL +LAPIG L  I+
Sbjct  393   LSFFGGFAFAPTSYYLPCIMWLAIHKPRRFSLSWFANWTCIVLGVLLMVLAPIGALRQII  452

Query  320   KSAKTYHFY  294
               A+ Y F+
Sbjct  453   LQARGYKFF  461



>ref|XP_010673704.1| PREDICTED: lysine histidine transporter 2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=450

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/431 (66%), Positives = 349/431 (81%), Gaps = 4/431 (1%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + ++D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +++LSW I
Sbjct  21    KQKDIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVVILVLSWII  80

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  81    TLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVVPQQLIVEVGVNIVYMVTGG  140

Query  1214  SSIKKVVELLCHD---CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
              S++KV +++C +   C P+K +Y+I+IFS   F+ S LPNFNSI+ VSL AA+MS+SYS
Sbjct  141   RSLEKVHDIICANKTSCTPMKTTYFIMIFSSVHFVLSHLPNFNSIAGVSLAAAVMSLSYS  200

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAW ++L K ++ H V Y  R H      F F +ALGD+AF+YAGHNVVLEIQATIPST
Sbjct  201   TIAWATSLGKGVQPH-VTYTSRHHSDVGKTFGFFNALGDVAFAYAGHNVVLEIQATIPST  259

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             P+ PSK  MWKGV++AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLIA ANIF
Sbjct  260   PEKPSKGPMWKGVIVAYIVVALCYFPVALIGYYVFGNTVRDNILISLEKPGWLIAMANIF  319

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VV+HV+GSYQ+YAM +FDMIET  VK ++FKPT  LRF+ RN++VAFT+FV I+ PFFGG
Sbjct  320   VVIHVIGSYQIYAMPVFDMIETVLVKKIRFKPTWYLRFIARNIYVAFTMFVAITFPFFGG  379

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KPK+F LSWC NW  IV+G++L +LAPIGGL  I
Sbjct  380   LLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWCANWICIVLGVILMVLAPIGGLRQI  439

Query  323   VKSAKTYHFYQ  291
             +  +K Y FY 
Sbjct  440   IIDSKNYTFYS  450



>ref|XP_009616066.1| PREDICTED: lysine histidine transporter 2-like [Nicotiana tomentosiformis]
Length=443

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 351/437 (80%), Gaps = 2/437 (0%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             +  G++ ++NK +++DWLP+ S R+ KW+YS FHNVTAMVGAG+L LPYAMS++GWG G 
Sbjct  9     RGSGSEGSSNK-DLNDWLPITSSRNAKWYYSAFHNVTAMVGAGVLGLPYAMSQLGWGAGA  67

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              +M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +
Sbjct  68    TVMVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLMVEVGV  127

Query  1241  CIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
              I+YMVTGG SIKK+ +  C  C+P+K +Y+I++FS   F  S+ PNFNSI+ VS LAAI
Sbjct  128   NIVYMVTGGKSIKKIYDTACPSCRPLKTTYFIMMFSSIHFFLSYCPNFNSITLVSFLAAI  187

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTI WG+++HK I    VDY PR+      +F F+SALGD+AF++AGHNVVLEIQ
Sbjct  188   MSLSYSTIGWGASVHKGIAPE-VDYSPRASTTAGRLFGFLSALGDVAFAFAGHNVVLEIQ  246

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             AT+PS+P+ P+KK MWKGV+ AY+VVA+CY+PVAF+GY   G  V DNIL++LEKP WLI
Sbjct  247   ATMPSSPEKPAKKPMWKGVIFAYIVVALCYFPVAFVGYAVFGKSVEDNILISLEKPAWLI  306

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
               AN FVVVHV+GSYQV+AM +FDM+E++ VK  KF PTKTLRF+ R  +VA T+F+GI+
Sbjct  307   IIANAFVVVHVIGSYQVFAMGVFDMVESYLVKQRKFSPTKTLRFIVRTSYVALTMFLGIT  366

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPKKFGLSW  NW  I++G+LL ILAPI
Sbjct  367   FPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKKFGLSWFTNWICIILGVLLMILAPI  426

Query  341   GGLWSIVKSAKTYHFYQ  291
             G L  I+  AK Y FY 
Sbjct  427   GALRQIILQAKDYKFYS  443



>gb|KDP46332.1| hypothetical protein JCGZ_10172 [Jatropha curcas]
Length=449

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/428 (67%), Positives = 350/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWY+ FHNVTAMVGAG+LSLPYAMS +GWGPG  ++ILSW I
Sbjct  23    KQKAIDDWLPITSSRNAKWWYAAFHNVTAMVGAGVLSLPYAMSNLGWGPGTVILILSWVI  82

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+ + I+YMVTGG
Sbjct  83    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLICEVGVDIVYMVTGG  142

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++KV +++C DCKPIK +Y+I+IF+   F+ + LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  143   KSLQKVHDIVCKDCKPIKTTYFIMIFASVHFVLAHLPNFNSISGVSLAAAVMSLSYSTIA  202

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++HK  +   V+YG ++   +  VF F +ALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  203   WAASVHKGRQPD-VEYGYKATTTSGTVFDFFTALGDVAFAYAGHNVVLEIQATIPSTPEK  261

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVVIAY+VV +CY+PVA IGY   GN+V DNIL++LEKP WLI AAN+FVVV
Sbjct  262   PSKGPMWRGVVIAYIVVGLCYFPVALIGYYMFGNKVEDNILISLEKPTWLIVAANMFVVV  321

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L FKP+ TLRF++RNL+VAFT+FVGI  PFFGGLLG
Sbjct  322   HVIGSYQLYAMPVFDMIETVLVKKLHFKPSTTLRFISRNLYVAFTMFVGICFPFFGGLLG  381

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  I+ GILL  L+PIGGL +I+  
Sbjct  382   FFGGFAFAPTTYFLPCIMWLAVYKPKRFSLSWVTNWICIIFGILLMTLSPIGGLRNIILK  441

Query  314   AKTYHFYQ  291
             AK Y F+ 
Sbjct  442   AKDYVFFS  449



>ref|XP_009627910.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=442

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/440 (65%), Positives = 357/440 (81%), Gaps = 4/440 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D  A+G      +  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGP
Sbjct  6     DNNADGR--TEEQKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGP  63

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +M++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVPQQ +VE+
Sbjct  64    GVTVMVVSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGNKLGLWIVVPQQLVVEV  123

Query  1247  SLCIIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
              L I+YMVTGG S +K+ +L+C D CK IKL+YYI+IF+   F+ S LPNFN+IS VSL+
Sbjct  124   GLDIVYMVTGGKSFQKIHDLVCKDNCKDIKLTYYIMIFASVHFVLSHLPNFNAISGVSLV  183

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AAIMS+SY TIAWG+++ K ++   V+Y  R+    + VF F S LG++AF+YAGHNVVL
Sbjct  184   AAIMSLSYCTIAWGASIDKGVQPD-VEYEYRAENAGEGVFNFFSGLGEVAFAYAGHNVVL  242

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP+ PSK  MWKGV++AY++VA+CY+PVA IGY   GN VSDNIL++LEKP 
Sbjct  243   EIQATIPSTPEKPSKGPMWKGVLVAYIIVALCYFPVAIIGYWIFGNSVSDNILISLEKPT  302

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLI  AN FVV+H++GSYQ+YA+ +FDM+ET+ VK L+FKPT  LRF+TRNL+VAFT+FV
Sbjct  303   WLIVLANAFVVIHIIGSYQLYAIPVFDMLETYLVKKLRFKPTWYLRFITRNLYVAFTMFV  362

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
             GI  PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK++GLSW  NW  I++G++LT+L
Sbjct  363   GIIFPFFGGLLGFFGGFAFAPTTYFLPCIMWLSIYKPKRWGLSWTTNWICIIVGVMLTVL  422

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             APIGGL +I+  AK Y F+ 
Sbjct  423   APIGGLRTIIMQAKDYKFFS  442



>ref|XP_010673703.1| PREDICTED: lysine histidine transporter 2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=452

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/431 (66%), Positives = 349/431 (81%), Gaps = 4/431 (1%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + ++D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +++LSW I
Sbjct  23    KQKDIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVVILVLSWII  82

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  83    TLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVVPQQLIVEVGVNIVYMVTGG  142

Query  1214  SSIKKVVELLCHD---CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
              S++KV +++C +   C P+K +Y+I+IFS   F+ S LPNFNSI+ VSL AA+MS+SYS
Sbjct  143   RSLEKVHDIICANKTSCTPMKTTYFIMIFSSVHFVLSHLPNFNSIAGVSLAAAVMSLSYS  202

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAW ++L K ++ H V Y  R H      F F +ALGD+AF+YAGHNVVLEIQATIPST
Sbjct  203   TIAWATSLGKGVQPH-VTYTSRHHSDVGKTFGFFNALGDVAFAYAGHNVVLEIQATIPST  261

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             P+ PSK  MWKGV++AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLIA ANIF
Sbjct  262   PEKPSKGPMWKGVIVAYIVVALCYFPVALIGYYVFGNTVRDNILISLEKPGWLIAMANIF  321

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VV+HV+GSYQ+YAM +FDMIET  VK ++FKPT  LRF+ RN++VAFT+FV I+ PFFGG
Sbjct  322   VVIHVIGSYQIYAMPVFDMIETVLVKKIRFKPTWYLRFIARNIYVAFTMFVAITFPFFGG  381

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KPK+F LSWC NW  IV+G++L +LAPIGGL  I
Sbjct  382   LLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWCANWICIVLGVILMVLAPIGGLRQI  441

Query  323   VKSAKTYHFYQ  291
             +  +K Y FY 
Sbjct  442   IIDSKNYTFYS  452



>ref|XP_002270050.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera]
Length=437

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/428 (64%), Positives = 341/428 (80%), Gaps = 1/428 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+E+GWGPGV ++ILSW 
Sbjct  10    AREKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWGPGVVVLILSWI  69

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I YM+TG
Sbjct  70    VTLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVVPQQVIVEVGVDIAYMITG  129

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K    +C  CKPIK +Y+I+IF+   F+ S LPNFNSI+ VS  AA MS++YSTI
Sbjct  130   GKSLQKFHNTVCPSCKPIKTTYFIMIFASCHFVLSHLPNFNSIAGVSFAAATMSLTYSTI  189

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW +++HK ++   V Y   +   T  VF F SALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  190   AWTASVHKGVQPD-VQYTYTASTTTGRVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPE  248

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK+ MWKGV+ AY+VVA+CY+PVA IGY   GN V+DNIL+TLEKP WLIAAAN+FVV
Sbjct  249   KPSKRPMWKGVIFAYIVVALCYFPVALIGYWMFGNSVADNILITLEKPRWLIAAANLFVV  308

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK LKF P+  LR +TR L+VAFT+F+G+ +PFFG LL
Sbjct  309   IHVIGSYQIYAMPVFDMLETLLVKKLKFTPSFRLRLITRTLYVAFTMFIGMLIPFFGSLL  368

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GF GG  FAPTTY++PCIMWL + KPK+F LSW  NW  I++G++L ILAPIG L  I+ 
Sbjct  369   GFLGGLVFAPTTYFLPCIMWLAIYKPKRFSLSWITNWICIILGVILMILAPIGALRQIIL  428

Query  317   SAKTYHFY  294
              AKT+  +
Sbjct  429   QAKTFEVF  436



>ref|XP_009802948.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Nicotiana 
sylvestris]
Length=443

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/440 (65%), Positives = 357/440 (81%), Gaps = 3/440 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D  A   +    K  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGP
Sbjct  6     DNNAADGRTEEQKA-IDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGP  64

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +M++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVPQQ +VE+
Sbjct  65    GVTVMVVSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGNKLGLWIVVPQQLVVEV  124

Query  1247  SLCIIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
              L I+YMVTGG S +K+ +L+C D CK IKL+YYI+IF+   F+ S LPNFN+IS VSL+
Sbjct  125   GLDIVYMVTGGKSFQKIHDLVCKDNCKDIKLTYYIMIFASVHFVLSHLPNFNAISGVSLV  184

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AAIMS+SY TIAWG+++ K ++   V+Y  R+    + +F F S LG++AF+YAGHNVVL
Sbjct  185   AAIMSLSYCTIAWGASIDKGVQPD-VEYEYRAENTGEGIFNFFSGLGEVAFAYAGHNVVL  243

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP+ PSK  MWKGV++AY++VA+CY+PVA IGY   GN VSDNIL++LEKP 
Sbjct  244   EIQATIPSTPEKPSKGPMWKGVLVAYIIVALCYFPVAIIGYWIFGNSVSDNILISLEKPT  303

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLI  AN FVV+H++GSYQ+YA+ +FDM+ET+ VK LKFKPT  LRF+TRNL+VAFT+FV
Sbjct  304   WLIVLANAFVVIHIIGSYQLYAIPVFDMLETYLVKKLKFKPTWYLRFMTRNLYVAFTMFV  363

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
             GI  PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK++GLSW  NW  I++G++LT+L
Sbjct  364   GIIFPFFGGLLGFFGGFAFAPTTYFLPCIMWLSIYKPKRWGLSWTSNWICIIVGVMLTVL  423

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             APIGGL +I+  AK Y+F+ 
Sbjct  424   APIGGLRTIIIQAKDYNFFS  443



>ref|XP_010250839.1| PREDICTED: lysine histidine transporter 1-like [Nelumbo nucifera]
Length=444

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/427 (66%), Positives = 346/427 (81%), Gaps = 1/427 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + ++DDWLP+ S R+ KWWYSTFHNVTAMVGAG+LSLPYAMSE+GWGPGVA+++LSW I
Sbjct  18    KEKQIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLSLPYAMSELGWGPGVAVLVLSWII  77

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  78    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVNIVYMVTGG  137

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++K    +C  CK IKL+Y+I+IF+   F+ S LPN NSIS VSL AA+MS+SYSTIA
Sbjct  138   KSLQKFHNTVCSSCKDIKLTYFIMIFASVHFVLSQLPNLNSISGVSLAAAVMSLSYSTIA  197

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             WG+++ K ++ H V YG ++      VF F SALGD+AF+YAGHNVVLEIQATIPSTP+N
Sbjct  198   WGASVDKGVQ-HDVQYGYKASTTAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEN  256

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MWKGV+ AY++VA CY+PVA IGY   GN V DNILL+LEKP WLI  ANIFVV+
Sbjct  257   PSKKPMWKGVIFAYIIVAACYFPVALIGYWVFGNSVDDNILLSLEKPAWLIGMANIFVVI  316

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L F P   LR ++R+ +VA T+F+ ++ PFFGGLLG
Sbjct  317   HVIGSYQIYAMPVFDMIETVLVKKLHFTPGLRLRLISRSTYVALTMFIAMTFPFFGGLLG  376

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I++G+LL I++PIGGL  I+  
Sbjct  377   FFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWFANWICIILGVLLMIISPIGGLRQIIIQ  436

Query  314   AKTYHFY  294
             AKTY FY
Sbjct  437   AKTYKFY  443



>ref|XP_010248878.1| PREDICTED: lysine histidine transporter 1-like [Nelumbo nucifera]
Length=448

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/446 (64%), Positives = 352/446 (79%), Gaps = 5/446 (1%)
 Frame = -1

Query  1631  FDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYA  1452
             +D+   + D   E AK    + ++DDWLP+ S R+ KWWYSTFHNVTAMVGAG+LSLP+A
Sbjct  7     YDQNSTVSDKNQEPAK----EKQIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLSLPFA  62

Query  1451  MSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVV  1272
             MSE+GWGPGVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVV
Sbjct  63    MSELGWGPGVAILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVV  122

Query  1271  PQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNS  1092
             PQQ +VE+ + I+YMVTGG S+KK  + +C  CK IK SY+I+IF+   F+ S LPNFNS
Sbjct  123   PQQLVVEVGVNIVYMVTGGQSLKKFHDTVCSSCKDIKRSYFIMIFASIHFVLSQLPNFNS  182

Query  1091  ISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSY  912
             IS VSL AA+MS+SYSTIAWG+++ K +++  V YG +S      V  F SALGD+AF+Y
Sbjct  183   ISGVSLAAAVMSLSYSTIAWGASVDKGVQAD-VQYGYKSESTAGTVLNFFSALGDVAFAY  241

Query  911   AGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNIL  732
             AGHNVVLEIQATIPSTP+ PSKK MWKGV+ AY++VA CY+PVA IGY   GN V+DNIL
Sbjct  242   AGHNVVLEIQATIPSTPERPSKKPMWKGVIFAYIIVAACYFPVALIGYWMFGNSVADNIL  301

Query  731   LTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLF  552
             ++LEKP WLIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F P   LR + R  +
Sbjct  302   ISLEKPAWLIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLHFTPGLRLRLIARTSY  361

Query  551   VAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVI  372
             VA T+F+ ++ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  I++
Sbjct  362   VALTMFIAMTFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWITNWICIIL  421

Query  371   GILLTILAPIGGLWSIVKSAKTYHFY  294
             G++L I +PIGGL  I+  AKTY FY
Sbjct  422   GLMLMIFSPIGGLRQIIIQAKTYKFY  447



>ref|XP_009111561.1| PREDICTED: lysine histidine transporter 1-like [Brassica rapa]
Length=447

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 347/429 (81%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGV ++ILSW 
Sbjct  20    AREKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVVILILSWI  79

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YMVTG
Sbjct  80    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTG  139

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  +L+C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  140   GKSLKKFHDLVCKDCKSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  199

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW ++  K ++ + V+YG ++      VF F SALG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  200   AWSASAAKGVKEN-VEYGYKAKSTAGTVFNFFSALGEVAFAYAGHNVVLEIQATIPSTPE  258

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV+AY+VVA+CY+PVA +GY   GN V DNIL TLEKP WLIA AN+FVV
Sbjct  259   KPSKGPMWKGVVVAYIVVALCYFPVALVGYWMFGNSVDDNILETLEKPAWLIATANMFVV  318

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK + F+P+  LRFV RN +VA T+FVG++ PFFGGLL
Sbjct  319   IHVIGSYQIYAMPVFDMMETLLVKKMNFRPSWYLRFVVRNFYVAATMFVGMTFPFFGGLL  378

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PC+MWL + KP+++ LSW  NW  I  G+ L +L+PIGGL +I+ 
Sbjct  379   AFFGGFAFAPTTYFLPCVMWLAIYKPRRYSLSWWTNWICIAFGVCLMVLSPIGGLRTIII  438

Query  317   SAKTYHFYQ  291
              AK Y FY 
Sbjct  439   QAKDYKFYS  447



>ref|XP_010111626.1| hypothetical protein L484_017652 [Morus notabilis]
 gb|EXC31371.1| hypothetical protein L484_017652 [Morus notabilis]
Length=448

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/429 (66%), Positives = 349/429 (81%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ + R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA++ILSW 
Sbjct  21    ARQKEIDDWLPITASRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAILILSWI  80

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPG RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + ++YMVT 
Sbjct  81    ITLYTLWQMVEMHEMVPGNRFDRYHELGQYAFGEKLGLYIVVPQQLVVEVGVNVVYMVTA  140

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  + +C  CK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  141   GKSLKKFHDTVCPSCKQIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  200

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V YG +S      VF F SALG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  201   AWGASIDKGVKDD-VAYGYKSKSAAGTVFNFFSALGNVAFAYAGHNVVLEIQATIPSTPE  259

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MW+GV++AY+VVA+CY+PVA +GY   GN V D+IL+TLEKP WLIA  N+FVV
Sbjct  260   KPSKGPMWRGVIVAYIVVALCYFPVALVGYYIFGNSVDDDILITLEKPAWLIAMVNMFVV  319

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YA+ +FDMIET  VK L F+P+  LRF+TRN++VAF +F+GI+ PFF GLL
Sbjct  320   IHVIGSYQIYAIPVFDMIETVLVKKLHFRPSFMLRFITRNIYVAFVMFIGITFPFFSGLL  379

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PCIMWL + KP+K+ LSWC NW  IV+G+LL IL+PIGGL  I+ 
Sbjct  380   AFFGGFAFAPTTYFLPCIMWLAIYKPRKYSLSWCTNWICIVLGVLLMILSPIGGLRQIII  439

Query  317   SAKTYHFYQ  291
              AKTY FY 
Sbjct  440   QAKTYEFYS  448



>ref|XP_009371699.1| PREDICTED: lysine histidine transporter 1-like [Pyrus x bretschneideri]
Length=459

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 353/435 (81%), Gaps = 2/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             +  KP   K E+D+WLP+   R+ KWWYSTFHNVTAMVGAG+LSLP+AMS +GWGPG  +
Sbjct  27    DEDKPRRQK-EIDEWLPITGSRNAKWWYSTFHNVTAMVGAGVLSLPFAMSNLGWGPGCVI  85

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSWAITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I
Sbjct  86    LVLSWAITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVDI  145

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG+S++KV + +  D  PIKL+Y+I+IF+   F+ + LPNFNSIS VSL AA+MS
Sbjct  146   VYMVTGGNSLQKVYKTVKKDKDPIKLTYFIMIFASCHFVLAHLPNFNSISGVSLAAAVMS  205

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAW ++LHK ++   V YG ++      VF F +ALGD+AF+YAGHNVVLEIQAT
Sbjct  206   LSYSTIAWTASLHKGVQPD-VAYGYKASSTPGTVFNFFTALGDVAFAYAGHNVVLEIQAT  264

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP  PSKK MW+GVV+AY+VVA+CY+PVAFIGY   GN V DNIL++LEKP WLI  
Sbjct  265   IPSTPAKPSKKPMWRGVVLAYLVVALCYFPVAFIGYYTFGNAVEDNILISLEKPEWLIIT  324

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVVVHV+GSYQ+YAM +FDMIET  VK L F+PT  LRFV+RN++VAFT+FV I+ P
Sbjct  325   ANMFVVVHVIGSYQLYAMPVFDMIETLLVKKLHFRPTLILRFVSRNIYVAFTMFVAITFP  384

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGGFAF+PTTY++PCIMWL + KP+++ LSW +NW  I +G +L IL+PIGG
Sbjct  385   FFGGLLGFFGGFAFSPTTYFLPCIMWLAIKKPRRWSLSWIINWICITLGAMLMILSPIGG  444

Query  335   LWSIVKSAKTYHFYQ  291
             L SI+  A TY FY+
Sbjct  445   LRSIIIQASTYKFYK  459



>ref|XP_009802949.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Nicotiana 
sylvestris]
Length=442

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/440 (65%), Positives = 358/440 (81%), Gaps = 4/440 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D  A+G      +  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGP
Sbjct  6     DNNADGR--TEEQKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGP  63

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +M++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVPQQ +VE+
Sbjct  64    GVTVMVVSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGNKLGLWIVVPQQLVVEV  123

Query  1247  SLCIIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
              L I+YMVTGG S +K+ +L+C D CK IKL+YYI+IF+   F+ S LPNFN+IS VSL+
Sbjct  124   GLDIVYMVTGGKSFQKIHDLVCKDNCKDIKLTYYIMIFASVHFVLSHLPNFNAISGVSLV  183

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AAIMS+SY TIAWG+++ K ++   V+Y  R+    + +F F S LG++AF+YAGHNVVL
Sbjct  184   AAIMSLSYCTIAWGASIDKGVQPD-VEYEYRAENTGEGIFNFFSGLGEVAFAYAGHNVVL  242

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP+ PSK  MWKGV++AY++VA+CY+PVA IGY   GN VSDNIL++LEKP 
Sbjct  243   EIQATIPSTPEKPSKGPMWKGVLVAYIIVALCYFPVAIIGYWIFGNSVSDNILISLEKPT  302

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLI  AN FVV+H++GSYQ+YA+ +FDM+ET+ VK LKFKPT  LRF+TRNL+VAFT+FV
Sbjct  303   WLIVLANAFVVIHIIGSYQLYAIPVFDMLETYLVKKLKFKPTWYLRFMTRNLYVAFTMFV  362

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
             GI  PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK++GLSW  NW  I++G++LT+L
Sbjct  363   GIIFPFFGGLLGFFGGFAFAPTTYFLPCIMWLSIYKPKRWGLSWTSNWICIIVGVMLTVL  422

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             APIGGL +I+  AK Y+F+ 
Sbjct  423   APIGGLRTIIIQAKDYNFFS  442



>emb|CDP13304.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 355/439 (81%), Gaps = 3/439 (1%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             + +     A +  +D+WLPV S+R   WWYS FHNVTAMVGAG+L LPYAMSE+GWGPGV
Sbjct  6     QPQNDARTAEEKAIDEWLPVTSERKATWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGV  65

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              +MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+S 
Sbjct  66    TIMILSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQVVVEVST  125

Query  1241  CIIYMVTGGSSIKKVVELLCH--DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
             CI+YMVTGG S+KK  +++C    C+ I+L+++I+IF+   F+ S LPNF+S+S +SL A
Sbjct  126   CIVYMVTGGKSLKKFHDIVCPPPKCQDIRLTFFIMIFASVHFVISHLPNFHSLSLISLSA  185

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW +++ K  E+  V+YGPR    T       +ALGD+AF++AGHNVVLE
Sbjct  186   AVMSLSYSTIAWVASVTKGQEAD-VNYGPRETSTTAITLSSFNALGDVAFAFAGHNVVLE  244

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTPD PSKK MW+GV++AY+VVA+CY+PVAF GY + GN+V DNIL+TL+KP W
Sbjct  245   IQATIPSTPDKPSKKPMWRGVILAYLVVALCYFPVAFSGYYSFGNKVDDNILVTLQKPSW  304

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVVVHV+GSYQVYAM +FDM+ETF VK L+FKP+  LRF TR ++VA T+F+ 
Sbjct  305   LIATANMFVVVHVIGSYQVYAMPVFDMLETFLVKKLRFKPSTVLRFTTRTIYVAVTMFIA  364

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I+VPFFGGL+GFFGG A APTTYY+PCIMWL+L KPK+FGLSWC NW  IV+GI+L ILA
Sbjct  365   IAVPFFGGLMGFFGGLALAPTTYYLPCIMWLVLYKPKRFGLSWCANWVCIVVGIVLMILA  424

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL SI+ SAK Y  + 
Sbjct  425   PIGGLRSIILSAKNYKMFS  443



>emb|CDY00162.1| BnaC09g01390D [Brassica napus]
Length=447

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/429 (65%), Positives = 348/429 (81%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGV ++ILSW 
Sbjct  20    AREKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVVILILSWI  79

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ +CI+YMVTG
Sbjct  80    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTG  139

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  +L+C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  140   GKSLKKFHDLVCKDCKSIKLTYFIMIFASVHFVLSHLPNFNSISGVSLAAAVMSLSYSTI  199

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW ++  K ++ + V+YG ++      VF F SALG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  200   AWSASAAKGVKEN-VEYGYKAKSTAGTVFNFFSALGEVAFAYAGHNVVLEIQATIPSTPE  258

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV+AY+VVA+CY+PVA +GY   GN V DNIL TLEKP WLIA AN+FVV
Sbjct  259   KPSKGPMWKGVVVAYIVVALCYFPVALVGYWMFGNSVEDNILETLEKPAWLIATANMFVV  318

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK + F+P+  LRFV RN +VA T+FVG++ PFFGGLL
Sbjct  319   IHVIGSYQIYAMPVFDMMETVLVKKMNFRPSWYLRFVVRNFYVAATMFVGMTFPFFGGLL  378

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PC++WL + KP+++ LSW  NW  IV G+ L +L+PIGGL +I+ 
Sbjct  379   AFFGGFAFAPTTYFLPCVIWLAIYKPRRYSLSWWTNWICIVFGVCLMVLSPIGGLRTIII  438

Query  317   SAKTYHFYQ  291
              AK Y FY 
Sbjct  439   QAKDYKFYS  447



>ref|XP_008662066.1| PREDICTED: LHT1 isoform X1 [Zea mays]
 gb|AFW56868.1| LHT1 [Zea mays]
Length=446

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/448 (65%), Positives = 349/448 (78%), Gaps = 6/448 (1%)
 Frame = -1

Query  1625  RELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMS  1446
             +E ++ D    G      +  +DDWLP+ S R  KWWYS FHNVTAMVGAG+L LPYAMS
Sbjct  2     QEQDVDD--GGGRTTQQQEKSIDDWLPINSSRKAKWWYSAFHNVTAMVGAGVLGLPYAMS  59

Query  1445  EMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQ  1266
             E+GWGPG+A+MILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG +LGLWIVV Q
Sbjct  60    ELGWGPGIAVMILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGDRLGLWIVVAQ  119

Query  1265  QALVEISLCIIYMVTGGSSIKKVVELLCHDCK---PIKLSYYILIFSVGQFIASFLPNFN  1095
             Q  VE+SL IIYMVTGG S+KK  +++C   +    +KLSY+I+IF+    + S LPNFN
Sbjct  120   QLAVEVSLNIIYMVTGGQSLKKFHDVICDGGRCGGDLKLSYFIMIFASVHLVLSQLPNFN  179

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS VSL AA+MS+SYSTIAWG++LH+      VDY  R+      VF F+  LGD+AF+
Sbjct  180   SISAVSLAAAVMSLSYSTIAWGASLHRG-RREDVDYHLRATTTPGKVFGFLGGLGDVAFA  238

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             Y+GHNVVLEIQATIPSTPD PSKKAMWKG  +AYVVVA+CY+PV F+GY A G+ V +NI
Sbjct  239   YSGHNVVLEIQATIPSTPDKPSKKAMWKGAFVAYVVVAICYFPVTFVGYWAFGSGVDENI  298

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL KP WLIA AN+ VVVHV+GSYQVYAM +FDMIET  VK ++F P+ TLR + R++
Sbjct  299   LITLSKPKWLIALANMMVVVHVIGSYQVYAMPVFDMIETVLVKKMRFAPSLTLRLIARSV  358

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+F+GI+ PFFGGLL FFGG AFAPTTY++PCIMWL + KPK+FGLSW +NW  IV
Sbjct  359   YVAFTMFLGITFPFFGGLLSFFGGLAFAPTTYFLPCIMWLKVYKPKRFGLSWFINWICIV  418

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             IG+LL IL PIGGL  I+ SA TY FYQ
Sbjct  419   IGVLLLILGPIGGLRQIILSATTYKFYQ  446



>ref|XP_004489585.1| PREDICTED: lysine histidine transporter 1-like [Cicer arietinum]
Length=453

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/435 (65%), Positives = 352/435 (81%), Gaps = 5/435 (1%)
 Frame = -1

Query  1586  KPAANKGE----VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             +P   K E    +++WLP+ + RS KWWYSTFHNVTAMVGAG+L LPY+++++GWGPGV 
Sbjct  19    QPIEEKSEREKKIEEWLPINADRSAKWWYSTFHNVTAMVGAGVLGLPYSLADLGWGPGVT  78

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + 
Sbjct  79    ILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGKKLGLYIVVPQQLVVEIGVN  138

Query  1238  IIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             I+YMVTGG+S++K    +C  CK +KLS++I+IF+  QF+ S LPNFNSIS VSL+AA+M
Sbjct  139   IVYMVTGGASLQKFHNTVCPSCKHVKLSFFIMIFASSQFVLSHLPNFNSISGVSLVAAVM  198

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S  YSTI W +++HK +++  V Y  ++H  T  +F F +ALG +AF+YAGHNVVLEIQA
Sbjct  199   SFCYSTIGWTASVHKGVQN-GVQYSNKAHTTTGTLFNFFNALGSVAFAYAGHNVVLEIQA  257

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP  PSK  MW+GVV+AY+VVA+CY+PVA IGYL  GN+V DNIL++LEKP WLIA
Sbjct  258   TIPSTPQKPSKIPMWRGVVVAYIVVALCYFPVAIIGYLVFGNEVKDNILISLEKPAWLIA  317

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              AN FVV+HV+GSYQ+YAM +FDMIE   VK L F P+K LRFV RN++VAFT+F+ IS 
Sbjct  318   MANFFVVLHVIGSYQIYAMPVFDMIEGVLVKNLNFNPSKILRFVVRNVYVAFTMFIAISF  377

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+FGLSWC NW  IV+G+ + IL+PIG
Sbjct  378   PFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFGLSWCTNWICIVLGLCIMILSPIG  437

Query  338   GLWSIVKSAKTYHFY  294
              L +I+  AKTY FY
Sbjct  438   ALRNIILEAKTYKFY  452



>ref|XP_009127569.1| PREDICTED: lysine histidine transporter-like 2 [Brassica rapa]
Length=441

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/442 (66%), Positives = 360/442 (81%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPA-ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +    + A A + +VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGENQLSTHEAASARQKKVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW IT YT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTVMIMSWLITFYTIWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KK+ +LLC DCK I+ S++I+IF+   F+ S LPNFNSIS VS
Sbjct  121   VEVGVNIVYMVTGGKSLKKIHDLLCTDCKEIRTSFWIMIFASVHFVLSHLPNFNSISGVS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAWG+++ K ++   VDY  R+   +  VF FM+ALGD+AF+YAGHNV
Sbjct  181   LAAAVMSLSYSTIAWGASVKKGVQPD-VDYTFRATTSSGKVFNFMNALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAF+ Y   GN V DNIL++LEK
Sbjct  240   VLEIQATIPSTPEKPSKIPMWRGVVVAYIVVAICYFPVAFVCYYIFGNNVDDNILMSLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN FVV+HV+GSYQ++AM +FDM+ETF VK + F P+  LRF+TR  +VA T+
Sbjct  300   PTWLIVMANSFVVIHVIGSYQIFAMPVFDMLETFLVKQMMFDPSFKLRFITRTSYVALTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI +PFFGGLLGFFGGFAFAPTTYY+PCIMWLIL KPKK+GLSW +NW  IV+G++LT
Sbjct  360   FVGICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLILKKPKKYGLSWSLNWFCIVVGVILT  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             I+APIGGL +I+ SA  Y F+ 
Sbjct  420   IVAPIGGLRTIIMSASDYKFFS  441



>ref|XP_009627908.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=443

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/429 (66%), Positives = 353/429 (82%), Gaps = 2/429 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGPGV +M++SW I
Sbjct  16    EQKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGVTVMVVSWVI  75

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVPQQ +VE+ L I+YMVTGG
Sbjct  76    TLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGNKLGLWIVVPQQLVVEVGLDIVYMVTGG  135

Query  1214  SSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
              S +K+ +L+C D CK IKL+YYI+IF+   F+ S LPNFN+IS VSL+AAIMS+SY TI
Sbjct  136   KSFQKIHDLVCKDNCKDIKLTYYIMIFASVHFVLSHLPNFNAISGVSLVAAIMSLSYCTI  195

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V+Y  R+    + VF F S LG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  196   AWGASIDKGVQPD-VEYEYRAENAGEGVFNFFSGLGEVAFAYAGHNVVLEIQATIPSTPE  254

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGV++AY++VA+CY+PVA IGY   GN VSDNIL++LEKP WLI  AN FVV
Sbjct  255   KPSKGPMWKGVLVAYIIVALCYFPVAIIGYWIFGNSVSDNILISLEKPTWLIVLANAFVV  314

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +H++GSYQ+YA+ +FDM+ET+ VK L+FKPT  LRF+TRNL+VAFT+FVGI  PFFGGLL
Sbjct  315   IHIIGSYQLYAIPVFDMLETYLVKKLRFKPTWYLRFITRNLYVAFTMFVGIIFPFFGGLL  374

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PCIMWL + KPK++GLSW  NW  I++G++LT+LAPIGGL +I+ 
Sbjct  375   GFFGGFAFAPTTYFLPCIMWLSIYKPKRWGLSWTTNWICIIVGVMLTVLAPIGGLRTIIM  434

Query  317   SAKTYHFYQ  291
              AK Y F+ 
Sbjct  435   QAKDYKFFS  443



>dbj|BAJ93280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/448 (65%), Positives = 354/448 (79%), Gaps = 8/448 (2%)
 Frame = -1

Query  1613  MGDYKAEGAKPAA------NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYA  1452
             MG   AE   P A       + ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP+A
Sbjct  1     MGTQAAENVDPPAKDVRTDEQKKIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPFA  60

Query  1451  MSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVV  1272
             MSE+GWGPG+A++I+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ A G KLGLWIVV
Sbjct  61    MSELGWGPGIAVLIISWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHALGDKLGLWIVV  120

Query  1271  PQQALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFN  1095
             PQQ +VE+ + I+YMVTGG S+KK  +++C   CK IKLS++I+IF+   F+ S LPNFN
Sbjct  121   PQQLIVEVGVNIVYMVTGGRSLKKFHDVICDGKCKDIKLSFFIMIFASVHFVLSQLPNFN  180

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS VSL AA+MS+SYSTIAWG+++ K  +   VDY  R+      VF F  ALG++AF+
Sbjct  181   SISGVSLAAAVMSLSYSTIAWGASVDKG-KMVNVDYNLRATTMPGKVFGFFGALGEVAFA  239

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             YAGHNVVLEIQATIPSTP+ PSKK MWKGVV+AY+VVA+CY+PVA IGY A GN V DNI
Sbjct  240   YAGHNVVLEIQATIPSTPEKPSKKPMWKGVVVAYIVVALCYFPVALIGYWAFGNSVDDNI  299

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL KP WLIA AN+ VV+HV+GSYQ+YAM +FDMIET  VK L+F P  TLR + R+L
Sbjct  300   LITLNKPKWLIAMANMMVVIHVIGSYQIYAMPVFDMIETVLVKKLRFPPGLTLRLIARSL  359

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+FV I+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSWC NW  IV
Sbjct  360   YVAFTMFVAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWCTNWVCIV  419

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +G+ L IL+PIGGL  I+  +KTY FY 
Sbjct  420   LGVCLMILSPIGGLRQIIMDSKTYKFYS  447



>ref|XP_006663932.1| PREDICTED: lysine histidine transporter 2-like [Oryza brachyantha]
Length=441

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/442 (64%), Positives = 354/442 (80%), Gaps = 2/442 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANK-GEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             M    A     A++K  E+DDWLP+ S R+ KWW S FHNV AM+ + + SLP+AMSE+G
Sbjct  1     MAAPSAMNTSAASDKEKEIDDWLPITSSRNAKWWDSAFHNVAAMIMSWV-SLPFAMSELG  59

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPG+A++ILSW ITLYTL+QMVEMHECVPG+RFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  60    WGPGIAVLILSWIITLYTLWQMVEMHECVPGRRFDRYHELGQHAFGNKLGLWIVVPQQLI  119

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ +CI+YMVTGG S+KK  +L+  +   I+ SY+I+IF     + S LPNFNSI+ VS
Sbjct  120   VEVGVCIVYMVTGGKSLKKFHDLVAPNAPSIRTSYFIVIFGCVHLVLSQLPNFNSITGVS  179

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
               AA+MS+SYSTIAW +++HK      VDY   +   T   F F+SALGD+AF+YAGHNV
Sbjct  180   FAAAVMSLSYSTIAWVASVHKGRHPAGVDYSMTASTSTGRSFNFLSALGDVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTPD PSKK MW+GVV+AY+VVA+CY PVAF+GY   GN V DNIL+TLEK
Sbjct  240   VLEIQATIPSTPDRPSKKPMWRGVVLAYLVVAICYLPVAFLGYYIFGNAVDDNILITLEK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLIAAAN+FVVVHV+GSYQ+YAM +FDM+ET  VK L+F+P   LR + R+L+V FT+
Sbjct  300   PRWLIAAANMFVVVHVIGSYQIYAMPVFDMLETLLVKKLRFQPGMPLRLIARSLYVLFTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVGI+VPFFGGLLGFFGGFAFAPTTY++PCIMWL +MKP++F +SWC+NW  I++G+LL+
Sbjct  360   FVGIAVPFFGGLLGFFGGFAFAPTTYFLPCIMWLSIMKPRRFSMSWCINWFCIIVGVLLS  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             +LAPIGGL SI+ +A++Y F+ 
Sbjct  420   VLAPIGGLRSIIVNAQSYKFFS  441



>ref|XP_004972968.1| PREDICTED: lysine histidine transporter 2-like [Setaria italica]
Length=446

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/431 (66%), Positives = 349/431 (81%), Gaps = 2/431 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG  +++LSW
Sbjct  17    SAGEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGTVVLLLSW  76

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+   I++MVT
Sbjct  77    IITLYTMWQMVEMHEMVPGKRFDRYHELGQHAFGKKLGLWIVVPQQLIVEVGGDIVFMVT  136

Query  1220  GGSSIKKVVELLC-HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
             GG S+KK  +++C ++CK IKL+Y+I+IF+   F+ S LPNFNSIS +SL AA+MS+SYS
Sbjct  137   GGKSLKKFHDVICGNECKDIKLTYFIMIFASCHFVLSQLPNFNSISGISLAAAVMSLSYS  196

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAWG+ +HK  +   VDY  R+    + VF F  ALGD+AF+YAGHNVVLEIQATIPST
Sbjct  197   TIAWGATVHKG-KLPNVDYHVRATTTLEKVFDFFGALGDVAFAYAGHNVVLEIQATIPST  255

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             PDNPSKK MWKGV++AY++VA+CY+PV+F GY A GNQV DNIL+TL KP WLIA AN+ 
Sbjct  256   PDNPSKKPMWKGVMVAYIIVAICYFPVSFSGYWAFGNQVDDNILITLNKPKWLIALANMM  315

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VV+HV+GSYQ++AM +FDM+ET  VK L+F P   LR + R  +VAFT FV I++PFFGG
Sbjct  316   VVIHVIGSYQIFAMPVFDMMETILVKKLRFPPGLALRLIARTTYVAFTTFVAITIPFFGG  375

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  IV+G++L IL+PIG L  I
Sbjct  376   LLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWFTNWVCIVLGVILMILSPIGALRQI  435

Query  323   VKSAKTYHFYQ  291
             + SAKTY FY 
Sbjct  436   ILSAKTYQFYS  446



>ref|XP_009414682.1| PREDICTED: lysine histidine transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/427 (65%), Positives = 348/427 (81%), Gaps = 1/427 (0%)
 Frame = -1

Query  1571  KGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAIT  1392
             +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG+A+++LSW IT
Sbjct  22    EKSIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGIAVLLLSWVIT  81

Query  1391  LYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGS  1212
             LYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+   I+YMVTGG 
Sbjct  82    LYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVVEVGANIVYMVTGGK  141

Query  1211  SIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAW  1032
             S+KK  +++C DCK IKL+Y+I+I +   F+ S LPNFNSIS VSL AA+MS SYSTIAW
Sbjct  142   SLKKFHDVVCRDCKSIKLTYFIMISASAHFVLSQLPNFNSISGVSLAAAVMSFSYSTIAW  201

Query  1031  GSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNP  852
             G+++ K  + + V+YG +S   +  VF F++ALG++AF+YAGHNVVLEIQATIPSTP  P
Sbjct  202   GASVDKGKQEN-VEYGYKSASTSGTVFNFLNALGNVAFAYAGHNVVLEIQATIPSTPQKP  260

Query  851   SKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvh  672
             SKK+MW+GV+IAY++VA+CY+PVA +GY A GN V D+IL+TL KP WLIA AN+ VVVH
Sbjct  261   SKKSMWRGVIIAYIIVALCYFPVALVGYWAFGNAVDDDILITLGKPRWLIAMANMMVVVH  320

Query  671   vVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllgf  492
             ++GSYQ+YAM +FDMIET  VK L F P  +LR + R+++VAFT+F+GI+ PFF GLLGF
Sbjct  321   LMGSYQIYAMPVFDMIETVLVKKLHFPPGLSLRLIARSVYVAFTMFIGITFPFFSGLLGF  380

Query  491   fggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKSA  312
             FGGFA APTTY++PCI+WL +  P++F LSW  NW  I++G+LL IL+ IGGL  I+  A
Sbjct  381   FGGFANAPTTYFLPCIIWLAIYNPRRFSLSWITNWICIILGVLLMILSSIGGLRQIIIDA  440

Query  311   KTYHFYQ  291
             KTY+FY 
Sbjct  441   KTYYFYS  447



>ref|XP_011029638.1| PREDICTED: lysine histidine transporter 2-like [Populus euphratica]
Length=439

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/438 (62%), Positives = 348/438 (79%), Gaps = 1/438 (0%)
 Frame = -1

Query  1604  YKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPG  1425
             Y       AA +  +DDWLP+ S R  KWWYSTFHNVTAMVGAG+LSLPYAM+++GWGPG
Sbjct  3     YNESRNDAAAKEKAIDDWLPITSSRKAKWWYSTFHNVTAMVGAGVLSLPYAMAQLGWGPG  62

Query  1424  VAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEIS  1245
             +A+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVPQQ +V++ 
Sbjct  63    IAILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGDKLGLWIVVPQQLIVQVG  122

Query  1244  LCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
             + I+YMVTGG S+KK  +++C +CK I+L+Y+I+IF+  Q + + LPN NSIS +SL AA
Sbjct  123   VNIVYMVTGGKSLKKFHDVVCPNCKDIRLTYFIMIFASVQMVLAHLPNLNSISVISLAAA  182

Query  1064  IMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +MS+SYSTIAW + L+K ++   VDY  ++  +T   F F++ALGD+AF+YAGHNVVLEI
Sbjct  183   VMSLSYSTIAWAATLNKGVQPD-VDYSYKARTRTGAFFDFITALGDVAFAYAGHNVVLEI  241

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPSTP+ PSKK MW+G  +AYVVVA+CY+PVA IGY   GN V DNIL++LEKP WL
Sbjct  242   QATIPSTPEKPSKKPMWRGAFLAYVVVAICYFPVALIGYWFFGNSVEDNILISLEKPAWL  301

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             IA AN+FVV+HV+GSYQ+YA+ +FD++ET  VK L F P+  LRFVTR ++V  T+FVGI
Sbjct  302   IATANMFVVIHVIGSYQIYAIAVFDLLETALVKKLHFSPSFMLRFVTRTVYVGLTMFVGI  361

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
              +PFF GLL FFGGFAFAPTTY++PC+MWL + KPK+FG SW  NW  +++G+LL IL+P
Sbjct  362   CIPFFNGLLSFFGGFAFAPTTYFLPCVMWLSIYKPKRFGFSWTANWVCVILGVLLMILSP  421

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IG L  I+ +AK Y F+ 
Sbjct  422   IGALRHIILTAKDYEFFS  439



>ref|XP_006845127.1| hypothetical protein AMTR_s00005p00198670 [Amborella trichopoda]
 gb|ERN06802.1| hypothetical protein AMTR_s00005p00198670 [Amborella trichopoda]
Length=442

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/428 (66%), Positives = 349/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP+AM+E+GWGPGVA++++SW I
Sbjct  16    KQKAVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPFAMAELGWGPGVAILVISWII  75

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVTGG
Sbjct  76    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVDIVYMVTGG  135

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  + +C  CKPIKL+Y+ILIFS   F+ + LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  136   KSLKKFHDTVCPGCKPIKLTYFILIFSSVHFVLAQLPNFNSISGVSLAAAVMSLSYSTIA  195

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W  +L K  +   VDY  R+   +  VF F SALG++AF+YAGHNVVLEIQATIPS+P+ 
Sbjct  196   WVGSLDKGKQPD-VDYSYRASSTSSAVFNFFSALGEVAFAYAGHNVVLEIQATIPSSPEK  254

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MWKG V+AY+VVA+CY+PV+ IGY A GN+V +NILL+L KP WLIAAAN+FVVV
Sbjct  255   PSKKPMWKGCVVAYIVVALCYFPVSLIGYWAFGNKVEENILLSLNKPRWLIAAANMFVVV  314

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDM+ET  VK LK+ P+  LR +TR+ +VAFT FV IS+PFFGGLLG
Sbjct  315   HVIGSYQIYAMPVFDMLETVLVKKLKYTPSIVLRLITRSSYVAFTCFVAISLPFFGGLLG  374

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PC+MWL + KPK+F  SW  NW  I++G+LL I+APIG L  I+ +
Sbjct  375   FFGGFAFAPTTYFLPCVMWLAVYKPKRFSFSWIANWFCIILGVLLMIVAPIGALRQIILN  434

Query  314   AKTYHFYQ  291
             AK Y+FY 
Sbjct  435   AKGYNFYS  442



>ref|XP_004145678.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus]
 ref|XP_004159128.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus]
 gb|KGN58201.1| hypothetical protein Csa_3G589590 [Cucumis sativus]
Length=450

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/428 (65%), Positives = 355/428 (83%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP AM+ +GWGPGV +++LSW I
Sbjct  24    EQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPSAMANLGWGPGVTVLVLSWII  83

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +V++   I+YMVTGG
Sbjct  84    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVQVGTNIVYMVTGG  143

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  +++C  CK IKL+Y+I+IF+  QF+ S LP+FNS+S VSL AA+MS++YSTIA
Sbjct  144   QSLKKFHDIVCPSCKSIKLTYFIMIFASVQFVLSHLPSFNSMSGVSLAAAVMSLTYSTIA  203

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++ K ++   VDYG R+   T  VF F++ALGD+AF+YAGH+VVLEIQATIPSTP+ 
Sbjct  204   WTTSVAKGVQPD-VDYGFRASTTTGKVFNFLNALGDVAFAYAGHSVVLEIQATIPSTPEK  262

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK+AMW+GV++AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLIA AN+FVV+
Sbjct  263   PSKRAMWRGVLVAYIVVALCYFPVALIGYWTFGNSVKDNILISLEKPGWLIALANMFVVI  322

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+G YQ+Y+M +FDMIET  VK +  KP+  LRF+ RN++VA T+F+GI+ PFFGGLLG
Sbjct  323   HVIGGYQIYSMPVFDMIETVLVKKMHCKPSFLLRFIARNVYVALTMFIGITFPFFGGLLG  382

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY+IPC++WL++ KPK+FGLSWC NW  I++G+LLT+L+PIGGL +I+  
Sbjct  383   FFGGFAFAPTTYFIPCVIWLLMYKPKRFGLSWCTNWICIILGVLLTVLSPIGGLRNIILQ  442

Query  314   AKTYHFYQ  291
             AK YHFY 
Sbjct  443   AKNYHFYS  450



>ref|XP_003631324.1| PREDICTED: lysine histidine transporter 2 [Vitis vinifera]
 emb|CBI27569.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/449 (63%), Positives = 345/449 (77%), Gaps = 11/449 (2%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             MG DR+ E         K A +K  +DDWLP+ S R+ KWWYS FHNVTAMVGAGILSLP
Sbjct  1     MGLDRQQE---------KDARDKA-IDDWLPITSSRNAKWWYSAFHNVTAMVGAGILSLP  50

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YAM+ +GWGPGV +++LSW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI
Sbjct  51    YAMAGLGWGPGVVILVLSWIVTLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWI  110

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VE+ + I YM+TGG S++K    +C DCKPI+ +Y+I+IF+   F+ S LPNF
Sbjct  111   VVPQQVIVEVGVNIAYMITGGKSLRKFHNTVCPDCKPIRTTYFIMIFASCHFVLSHLPNF  170

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VS  AA MS++YSTIAW +++HK ++   V Y   +      VF F SALGD+AF
Sbjct  171   NSISGVSFAAAAMSLAYSTIAWTASVHKGVQPD-VQYSYTASTTAGRVFTFFSALGDVAF  229

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGVV AY+VVA+CY+PVA IGY   GN V+DN
Sbjct  230   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVVFAYIVVAICYFPVALIGYWMFGNSVADN  289

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL+TLEKP WLIAAAN+FVV+HV+GSYQ++AM MFDM+ET  VK LKF P   LR +TR 
Sbjct  290   ILITLEKPRWLIAAANMFVVIHVIGSYQIFAMPMFDMLETLLVKKLKFTPCFRLRLITRT  349

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             L+VAFT+F+G+ +PFFG LLGF GG  FAPTTY++PCIMWL + KP++  LSW  NW  I
Sbjct  350   LYVAFTMFIGMLMPFFGSLLGFLGGLVFAPTTYFLPCIMWLSVHKPRRLSLSWFANWMCI  409

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             V+GI+L ILAPIG L  I+  AKT+  + 
Sbjct  410   VLGIILMILAPIGALRQIILQAKTFKLFS  438



>ref|XP_009385141.1| PREDICTED: lysine histidine transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/439 (66%), Positives = 351/439 (80%), Gaps = 5/439 (1%)
 Frame = -1

Query  1595  EGAKPAANKGE----VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             E    ++NK E    +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  10    EAYHSSSNKTEKEKSIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  69

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+
Sbjct  70    GIAVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVVEV  129

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  +++C DCK IKL+Y+I+IF+    + S LPNFNSIS VSL A
Sbjct  130   GVNIVYMVTGGKSLKKFHDVVCPDCKSIKLTYFIMIFASVHLVLSQLPNFNSISGVSLAA  189

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAWG+++ K  ++  V+YG ++      V  F SALGD+AF+YAGHNVVLE
Sbjct  190   AVMSLSYSTIAWGASVDKGKQAK-VEYGYKARSTAGTVLNFFSALGDVAFAYAGHNVVLE  248

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSKK MWKGV++AY+ VA+CY PVA +GY A GN V DNIL+TLEKP W
Sbjct  249   IQATIPSTPEKPSKKPMWKGVIVAYIGVALCYIPVALVGYWAFGNGVDDNILITLEKPRW  308

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+ VVVHV+GSYQ+YAM +FDMIET  VK L F P  TLR + R ++VAFT+FV 
Sbjct  309   LIAMANMMVVVHVIGSYQIYAMPVFDMIETVLVKKLHFPPGLTLRLIARTVYVAFTMFVA  368

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I++G++L IL+
Sbjct  369   ITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWTTNWICILLGVMLMILS  428

Query  347   PIGGLWSIVKSAKTYHFYQ  291
              IGGL  IV  AKTY FY 
Sbjct  429   SIGGLRQIVLQAKTYRFYS  447



>gb|KHG23351.1| Lysine histidine transporter 1 -like protein [Gossypium arboreum]
Length=449

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/431 (65%), Positives = 347/431 (81%), Gaps = 7/431 (2%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +A +  +DDWLP+ S RS KWW+S FHNVTAMVGAG+LSLPYA+SE+GWGPGV +++ 
Sbjct  25    EKSAKQKAIDDWLPINSSRSRKWWFSAFHNVTAMVGAGVLSLPYALSELGWGPGVFILVF  84

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+SLCI+YM
Sbjct  85    SWIITLYTLWQMVEMHEIVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVSLCIVYM  144

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S+KK  + +C  CK IKL+Y+I+IF+  +F+ S LPNF+SIS VSL AA+MSVSY
Sbjct  145   VTGGQSLKKFHDTVCSSCKSIKLTYFIMIFASVEFVLSHLPNFDSISGVSLAAAVMSVSY  204

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW ++L K ++   V YG ++      VF F+S LGD+AF+Y+GHNVVLEIQATI S
Sbjct  205   STIAWSASLAKGVQED-VQYGYKATTTPGTVFGFLSGLGDVAFAYSGHNVVLEIQATIQS  263

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MWKGVV+AY+++A+CY+PVA IGY   GN V DNIL++LEKP WLIA AN+
Sbjct  264   TPERPSKGPMWKGVVVAYIIIALCYFPVALIGYWMFGNSVKDNILISLEKPAWLIAMANM  323

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVVV       VYAM +FDM+ET  VK L F PT+TLRF+ RN +VAFT+F+GI+ PFFG
Sbjct  324   FVVV------HVYAMPVFDMMETLLVKKLDFNPTRTLRFIVRNTYVAFTMFIGITFPFFG  377

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLLGFFGG A+APTTYY+PC++WLI+MKP+++ LSW +NW  IVIG+LL +LAPIGG+  
Sbjct  378   GLLGFFGGVAYAPTTYYLPCVIWLIVMKPRRYSLSWWINWFCIVIGVLLMVLAPIGGMRQ  437

Query  326   IVKSAKTYHFY  294
             I+  AK Y FY
Sbjct  438   IIIQAKDYKFY  448



>gb|KEH22296.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=443

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/428 (66%), Positives = 351/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPGV +++LSW I
Sbjct  17    RQKAIDDWLPISSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVTVLVLSWFI  76

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTGG
Sbjct  77    TLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGVNIVYMVTGG  136

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++K  + +C DCK IKL+Y+I+IF+   F+ S LPN NSIS VSL AA+MS+SYSTIA
Sbjct  137   KSLQKFHDTVCSDCKKIKLTYFIMIFASVHFVLSHLPNLNSISGVSLAAAVMSLSYSTIA  196

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++ HK +  + VDYG ++      VF F +ALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  197   WAASAHKGVIEN-VDYGYKATTTPGTVFGFFNALGDVAFAYAGHNVVLEIQATIPSTPEK  255

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V DNIL+TLEKP WLIA AN+FVV+
Sbjct  256   PSKGPMWRGVIVAYIVVALCYFPVALIGYWMFGNSVDDNILMTLEKPNWLIAMANMFVVI  315

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L FKPT  LRF+ RN++VAFT+F+GI+ PFFGGLLG
Sbjct  316   HVIGSYQIYAMPVFDMIETVMVKKLNFKPTTMLRFIVRNVYVAFTMFIGITFPFFGGLLG  375

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KP++F LSW  N+  IV+G+ L +L+PIGGL SI+ +
Sbjct  376   FFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWWCNYVCIVLGLCLMLLSPIGGLRSIILN  435

Query  314   AKTYHFYQ  291
             AK+Y FY 
Sbjct  436   AKSYDFYS  443



>ref|XP_009370386.1| PREDICTED: lysine histidine transporter 1-like [Pyrus x bretschneideri]
Length=545

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/434 (65%), Positives = 352/434 (81%), Gaps = 2/434 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             +  KP   K E+D+WLP+   R+ KWWYSTFHNVTAMVGAG+LSLP+AMS +GWGPG  +
Sbjct  27    DEDKPRRQK-EIDEWLPITGSRNAKWWYSTFHNVTAMVGAGVLSLPFAMSNLGWGPGCVI  85

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I
Sbjct  86    LVLSWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVDI  145

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG+S++KV + +  D  PIKL+Y+I+IF+   F+ + LPNFNSIS VSL AA+MS
Sbjct  146   VYMVTGGNSLQKVYKTVKKDKDPIKLTYFIMIFASCHFVLAHLPNFNSISGVSLAAAVMS  205

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAW ++LHK ++   V YG ++      VF F +ALGD+AF+YAGHNVVLEIQAT
Sbjct  206   LSYSTIAWTASLHKGVQPD-VAYGYKASSTPGTVFNFFTALGDVAFAYAGHNVVLEIQAT  264

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSKK MW+GVV+AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLI  
Sbjct  265   IPSTPEKPSKKPMWRGVVLAYLVVALCYFPVALIGYYTFGNAVEDNILISLEKPEWLIIT  324

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVVVHV+GSYQ+YAM +FDMIET  VK L F+PT  LRFV+RN++VAFT+FV I+ P
Sbjct  325   ANMFVVVHVIGSYQLYAMPVFDMIETLLVKKLHFRPTLILRFVSRNIYVAFTMFVAITFP  384

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGGFAF+PTTY++PCIMWL + KP+++ LSW +NW  I +G+LL I +PIGG
Sbjct  385   FFGGLLGFFGGFAFSPTTYFLPCIMWLAIKKPRRWSLSWIINWICITLGVLLMIPSPIGG  444

Query  335   LWSIVKSAKTYHFY  294
             L +I+  AK YHFY
Sbjct  445   LRNIILQAKDYHFY  458



>ref|XP_004514798.1| PREDICTED: lysine histidine transporter 1-like [Cicer arietinum]
Length=441

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/428 (66%), Positives = 346/428 (81%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  ++DWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGV +++LSW I
Sbjct  15    KQKALEDWLPISSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVTVLVLSWII  74

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTGG
Sbjct  75    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQIIVEVGVNIVYMVTGG  134

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++K    +C DCK IKL+Y+I+IFS   F+ S LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  135   KSLQKFHNTVCSDCKKIKLTYFIMIFSSVHFVLSHLPNFNSISGVSLAAAVMSLSYSTIA  194

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++ HK +    V YG +S   +  VF F +ALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  195   WAASAHKGVIED-VQYGYKSKSTSGTVFGFFNALGDVAFAYAGHNVVLEIQATIPSTPEK  253

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V DNIL+TLEKP WLIA AN+FVV+
Sbjct  254   PSKGPMWRGVIVAYIVVALCYFPVALIGYWMFGNSVDDNILVTLEKPKWLIAMANMFVVI  313

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK L FKPT TLRF+ RN +VAFT+F+ I+ PFFGGLLG
Sbjct  314   HVIGSYQIYAMPVFDMIETGMVKKLNFKPTTTLRFIVRNAYVAFTMFIAITFPFFGGLLG  373

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PC+MWL + KP++F LSW  N+  I  G+ L IL+PIGGL SI+ +
Sbjct  374   FFGGFAFAPTTYFLPCVMWLAIYKPRRFSLSWWSNYVCIAFGLCLMILSPIGGLRSIILN  433

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  434   AKNYDFYS  441



>gb|EMS65836.1| hypothetical protein TRIUR3_16273 [Triticum urartu]
Length=447

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/437 (68%), Positives = 358/437 (82%), Gaps = 8/437 (2%)
 Frame = -1

Query  1577  ANKG--EVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILS  1404
             ++KG  ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA MILS
Sbjct  11    SDKGLQDIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAAMILS  70

Query  1403  WAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMV  1224
             WAITLYTL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +CI+YMV
Sbjct  71    WAITLYTLWQMVEMHECVPGKRFDRYHELGQHAFGQKLGLWIVVPQQLVVEVGVCIVYMV  130

Query  1223  TGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             TGG S+KKV +LL  +   PI+ SY+I IF    F+ S LPNFNSI+ VSL AA+MS+SY
Sbjct  131   TGGKSLKKVHDLLRPEHSHPIRTSYFICIFGSAHFLLSQLPNFNSITGVSLAAAVMSLSY  190

Query  1046  STIAWGSALH---KWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             STIAW ++LH   K    H VDY   +       F F+SALGD+AF+YAGHNVVLEIQAT
Sbjct  191   STIAWAASLHHAGKAGPGHVVDYSMTASTTPGRTFNFLSALGDVAFAYAGHNVVLEIQAT  250

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSKK MW+GVV+AY+VVA+CY PVAF+GY   GN V DNIL+TLE+P WLIAA
Sbjct  251   IPSTPEKPSKKPMWRGVVLAYIVVAICYLPVAFLGYYVFGNAVDDNILITLERPRWLIAA  310

Query  695   ANIFvvvhvVGSY--QVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             AN+FVV+HV+GSY  Q+YAM +FDM+ETF VK L+FKP   LR + R+L+VAFT+ VGI+
Sbjct  311   ANMFVVIHVIGSYQWQIYAMPVFDMLETFLVKKLRFKPGWPLRLIARSLYVAFTMIVGIA  370

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
             +PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP +F +SWC+NW  I+IG+LL++LAPI
Sbjct  371   IPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIKKPVRFSMSWCINWICIIIGMLLSVLAPI  430

Query  341   GGLWSIVKSAKTYHFYQ  291
             GGL SI+ + KTY F+ 
Sbjct  431   GGLRSIIINYKTYQFFS  447



>ref|XP_011042297.1| PREDICTED: lysine histidine transporter 1-like [Populus euphratica]
Length=439

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 352/439 (80%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
              Y       AA +  ++DWLPV S R+ KWWYSTFHNVTAMVGAG+LSLPYAM+++GWGP
Sbjct  2     SYNESQNDEAAREKAINDWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSLPYAMAQLGWGP  61

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V++
Sbjct  62    GVAILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVQV  121

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  +L+C DCK I+L+Y+I+IF+  QF+ + LPN NSIS +SL A
Sbjct  122   GVNIVYMVTGGKSLKKFHDLVCSDCKDIRLTYFIMIFASLQFVLAHLPNLNSISVISLAA  181

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAWG+ L+K ++   VDY  ++  KT  VF F SALGD+AF+YAGHNV+LE
Sbjct  182   AVMSLSYSTIAWGATLNKGVQPD-VDYSYKASTKTGAVFDFFSALGDIAFAYAGHNVILE  240

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSKK MW+G  +AYVVVA+CY+PVA IGY   GN V DNIL++LEKP W
Sbjct  241   IQATIPSTPEKPSKKPMWRGAFLAYVVVAICYFPVALIGYWFFGNSVEDNILISLEKPAW  300

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVV+HV+GSYQ+YAM +FDM+ET  VK L F P+  LRFVTR ++V FT+ VG
Sbjct  301   LIATANMFVVIHVIGSYQIYAMAVFDMLETALVKKLHFSPSFMLRFVTRTVYVGFTMIVG  360

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I +PFFGGLL FFGGFAFAPTTY++PCIMWL + KPKKF  SW  NW  IV+GILL IL+
Sbjct  361   ICIPFFGGLLSFFGGFAFAPTTYFLPCIMWLAIYKPKKFSFSWIANWVCIVLGILLMILS  420

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIG L  I+ +AK Y F+ 
Sbjct  421   PIGALRHIILTAKDYEFFS  439



>emb|CAN75546.1| hypothetical protein VITISV_035992 [Vitis vinifera]
Length=426

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/429 (64%), Positives = 337/429 (79%), Gaps = 12/429 (3%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+E+GWGPGV ++ILSW 
Sbjct  10    AREKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAELGWGPGVVVLILSWI  69

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I YM+TG
Sbjct  70    VTLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVVPQQVIVEVGVDIAYMITG  129

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K    +C  CKPIK +Y+I+IF+   F+ S LPNFNSI+ VS  AA MS++YSTI
Sbjct  130   GKSLQKFHNTVCPSCKPIKTTYFIMIFASCHFVLSHLPNFNSIAGVSFAAATMSLTYSTI  189

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW +++HK            +   T  VF F SALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  190   AWTASVHK------------ASTTTGRVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPE  237

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK+ MWKGV+ AY+VVA+CY+PVA IGY   GN V+DNIL+TLEKP WLIAAAN+FVV
Sbjct  238   KPSKRPMWKGVIFAYIVVALCYFPVALIGYWMFGNSVADNILITLEKPRWLIAAANLFVV  297

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDM+ET  VK LKF P+  LR +TR L+VAFT+F+G+ +PFFG LL
Sbjct  298   IHVIGSYQIYAMPVFDMLETLLVKKLKFTPSFRLRLITRTLYVAFTMFIGMLIPFFGSLL  357

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GF GG  FAPTTY++PCIMWL + KPK+F LSW  NW  I++G++L ILAPIG L  I+ 
Sbjct  358   GFLGGLVFAPTTYFLPCIMWLAIYKPKRFSLSWITNWICIILGVILMILAPIGALRQIIL  417

Query  317   SAKTYHFYQ  291
              AKT+  + 
Sbjct  418   QAKTFEVFS  426



>ref|XP_007216314.1| hypothetical protein PRUPE_ppa019812mg [Prunus persica]
 gb|EMJ17513.1| hypothetical protein PRUPE_ppa019812mg [Prunus persica]
Length=451

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/428 (64%), Positives = 347/428 (81%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + E+DDWLP+ S R+ KWWYS FHNV AMVGAG+LSLP+AMS +GWGPG+ +++LSW I
Sbjct  25    RQKEIDDWLPITSSRNAKWWYSAFHNVNAMVGAGVLSLPFAMSNLGWGPGIVILVLSWVI  84

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I+YMVTGG
Sbjct  85    TLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVDIVYMVTGG  144

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++K+  +   D  PIKL+Y+I+IF+  QF+ S LPNFNSIS +SL AA+MS+SYSTIA
Sbjct  145   KSLQKIHIIARKDKDPIKLTYFIMIFASAQFVLSHLPNFNSISGISLAAAVMSLSYSTIA  204

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
               +++HK ++   V+YG  +   +   F F +ALGD+AF+Y+GHNVVLEIQA IPS+P+ 
Sbjct  205   CTASVHKGVQP-GVEYGYLAQSTSGTAFNFFTALGDIAFAYSGHNVVLEIQAIIPSSPEK  263

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MW+GVVIAY+VVA+CY+PVAFIGY   GN+V DNIL++LEKP WLI  AN+FVV+
Sbjct  264   PSKKPMWRGVVIAYIVVALCYFPVAFIGYYTFGNKVDDNILISLEKPEWLIITANMFVVI  323

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+G YQ++AM +FDMIE+  VK L F+PT  LRF+TRN +VAFT+ VGI+ PFFGGLLG
Sbjct  324   HVIGGYQLFAMPVFDMIESLLVKKLHFRPTTRLRFITRNTYVAFTMLVGITFPFFGGLLG  383

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAF+PTTY++PC++WLI+ KP+KF LSW +NW  I +G+LL IL+PIGGL +I+  
Sbjct  384   FFGGFAFSPTTYFLPCVIWLIIKKPRKFSLSWFVNWICITLGVLLMILSPIGGLRNIILQ  443

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  444   AKNYKFYD  451



>gb|EMT09875.1| hypothetical protein F775_21766 [Aegilops tauschii]
Length=463

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/447 (66%), Positives = 356/447 (80%), Gaps = 22/447 (5%)
 Frame = -1

Query  1565  EVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAITLY  1386
             ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA MILSWAITLY
Sbjct  17    DIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAAMILSWAITLY  76

Query  1385  TLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGSSI  1206
             TL+QMVEMHECVPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ +CI+YMVTGG S+
Sbjct  77    TLWQMVEMHECVPGKRFDRYHELGQHAFGQKLGLWIVVPQQLVVEVGVCIVYMVTGGKSL  136

Query  1205  KKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAWG  1029
             KKV +LL  +   PI+ SY+I IF    F+ S LPNFNSI+ VSL AA+MS+SYSTIAW 
Sbjct  137   KKVHDLLRPEHSHPIRTSYFICIFGSAHFLLSQLPNFNSITGVSLAAAVMSLSYSTIAWA  196

Query  1028  SALHKWIES---HAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             ++LHK  ++   H VDY   +       F F+SALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  197   ASLHKAGKAGPGHVVDYSMTASTTPGRTFNFLSALGDVAFAYAGHNVVLEIQATIPSTPE  256

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSKK MW+GVV+AY+VVA+CY PVAF+GY   GN V DNIL+TLEKP WLIAAAN+FVV
Sbjct  257   KPSKKPMWRGVVLAYIVVAICYLPVAFLGYYVFGNAVDDNILITLEKPRWLIAAANMFVV  316

Query  677   vhvVGSY------------------QVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLF  552
             +HV+GSY                  Q+YAM +FDM+ETF VK L+FKP   LR + R+L+
Sbjct  317   IHVIGSYQLEPTSTNRALCMARVNSQIYAMPVFDMLETFLVKKLRFKPGWPLRLIARSLY  376

Query  551   VAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVI  372
             VAFT+ VGI++PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP +F +SWC+NW  I+I
Sbjct  377   VAFTMLVGIAIPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIKKPARFSMSWCINWICIII  436

Query  371   GILLTILAPIGGLWSIVKSAKTYHFYQ  291
             G+LL++LAPIGGL SI+ + KTY F+ 
Sbjct  437   GVLLSVLAPIGGLRSIIINYKTYQFFS  463



>ref|XP_008341344.1| PREDICTED: lysine histidine transporter 1-like [Malus domestica]
Length=459

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/434 (64%), Positives = 348/434 (80%), Gaps = 1/434 (0%)
 Frame = -1

Query  1592  GAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMM  1413
             G      + E+D+WLP+   R+ KWWYSTFHNVTAMVGAG+LSLP+AMS +GWGPG  ++
Sbjct  27    GEDKLRRQKEIDEWLPITGSRNAKWWYSTFHNVTAMVGAGVLSLPFAMSNLGWGPGCVIL  86

Query  1412  ILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCII  1233
             +LSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I+
Sbjct  87    VLSWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEVGVDIV  146

Query  1232  YMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSV  1053
             YMVTGG+S++KV + +  D  PIKL+Y+I+IF+   F+ + LPNFNSIS VSL AA+MS+
Sbjct  147   YMVTGGNSLQKVYKTVKKDKDPIKLTYFIMIFASCHFVLAHLPNFNSISGVSLAAAVMSL  206

Query  1052  SYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATI  873
             SYSTIAW ++LHK ++   V YG ++      VF F +ALGD+AF+YAGHNVVLEIQATI
Sbjct  207   SYSTIAWTASLHKGVQPD-VAYGYKARSTPGTVFNFFTALGDVAFAYAGHNVVLEIQATI  265

Query  872   PSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAA  693
             PSTP+ PSKK MW+GVV AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLI  A
Sbjct  266   PSTPEKPSKKPMWRGVVFAYLVVALCYFPVALIGYYTFGNAVEDNILISLEKPEWLIITA  325

Query  692   NIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPf  513
             N+FVVVHV+GSYQ+YAM +FDMIET  VK L F+PT  LRFV+RN++VAFT+FV I+ PF
Sbjct  326   NMFVVVHVIGSYQLYAMPVFDMIETLLVKKLHFRPTLILRFVSRNIYVAFTMFVAITFPF  385

Query  512   fggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGL  333
             FGGLLGFFGGFAF+PTTY++PC+ WL + KP+++ LSW +NW  I +G++L  L+PIGGL
Sbjct  386   FGGLLGFFGGFAFSPTTYFLPCVXWLAIKKPRRWSLSWIINWICITLGVMLMTLSPIGGL  445

Query  332   WSIVKSAKTYHFYQ  291
              SI+  A TY FY+
Sbjct  446   RSIIIQASTYKFYK  459



>gb|EMT11525.1| hypothetical protein F775_27209 [Aegilops tauschii]
Length=447

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/448 (65%), Positives = 352/448 (79%), Gaps = 8/448 (2%)
 Frame = -1

Query  1613  MGDYKAEGAKPAA------NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYA  1452
             MG   AE  +P A       + ++DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYA
Sbjct  1     MGTQAAENFEPPAKDVRTDEQKKIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYA  60

Query  1451  MSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVV  1272
             MSE+GWGPG+A++I+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVV
Sbjct  61    MSELGWGPGIAVLIISWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVV  120

Query  1271  PQQALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFN  1095
             PQQ +VE+ + I+YMVTGG S+KK  +++C   CK IKL+++I+IF+   F+ S LPN N
Sbjct  121   PQQLIVEVGVNIVYMVTGGRSLKKFHDVICDGKCKDIKLTFFIMIFASVHFVLSQLPNLN  180

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS VSL AA+MS+SYSTIAWG+++ K  +   VDY  R+      VF F  ALG++AF+
Sbjct  181   SISGVSLAAAVMSLSYSTIAWGASVDKG-KMVDVDYNLRATTTPGKVFGFFGALGEVAFA  239

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             YAGHNVVLEIQATIPSTP+ PSKK MWKGVV+AY+VVA+CY+PVA IGY A  N V DNI
Sbjct  240   YAGHNVVLEIQATIPSTPEKPSKKPMWKGVVVAYIVVALCYFPVALIGYWAFANSVDDNI  299

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL KP WLIA AN+ VV+HV+GSYQ+YAM +FDMIET  VK LKF P  TLR + R L
Sbjct  300   LITLNKPTWLIATANMMVVIHVIGSYQIYAMPVFDMIETVLVKKLKFPPGLTLRLIARTL  359

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+FV I+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  IV
Sbjct  360   YVAFTMFVAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWFTNWVCIV  419

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +G+ L IL+PIGGL  I+  +KTY FY 
Sbjct  420   LGVCLMILSPIGGLRQIILDSKTYKFYS  447



>gb|KEH25437.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=463

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/453 (62%), Positives = 360/453 (79%), Gaps = 3/453 (1%)
 Frame = -1

Query  1646  AFKMGFDRELEMGDYKAEG--AKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAG  1473
             AF  G   +   G+ ++ G   K +  + +++DWLPV S+R+ KWWYS+FHNVTAMVGAG
Sbjct  11    AFNSGPHNQTVEGNPQSAGKRGKSSEREKQIEDWLPVSSERNAKWWYSSFHNVTAMVGAG  70

Query  1472  ILSLPYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPK  1293
             +L LP++M+ +GWGPG+ +++LSW ITLYTL+QMVEMHE +PGKRFDRYHELGQ AFG K
Sbjct  71    VLGLPFSMAYLGWGPGLTILLLSWTITLYTLWQMVEMHEMIPGKRFDRYHELGQHAFGEK  130

Query  1292  LGLWIVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIAS  1113
             LGL+IVVPQQ +VE+   I+YMVTGG+S++K    +C  CK IKL+Y+I+IF+  QF+  
Sbjct  131   LGLYIVVPQQLIVEVGGDIVYMVTGGASLRKFHNTVCSSCKNIKLTYFIMIFASAQFVLC  190

Query  1112  FLPNFNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSAL  933
              LPN NSIS VSL+AA+MS+ YSTIAW +++HK ++ + V Y  ++    ++VF F +AL
Sbjct  191   HLPNLNSISGVSLVAAVMSICYSTIAWTTSVHKGVQEN-VQYSSKATNTAESVFNFFNAL  249

Query  932   GDMAFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGN  753
             G +AF+YAGHNVVLEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN
Sbjct  250   GSVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVAIIGYWVFGN  309

Query  752   QVSDNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLR  573
             +V DN+L++LEKPVWLIA +N+FVV+HV+GSYQ++AM +FDMIE   VK L FKP+K LR
Sbjct  310   EVKDNVLISLEKPVWLIAISNLFVVLHVIGSYQIFAMPVFDMIEGVLVKKLNFKPSKILR  369

Query  572   FVTRNLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCM  393
             FV RN +VAFT+F+ I+ PFFGGLLGFFGGFAFAPTTY++PCIMWLIL KPK+F  SW  
Sbjct  370   FVARNSYVAFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLILYKPKRFSFSWWT  429

Query  392   NWTFIVIGILLTILAPIGGLWSIVKSAKTYHFY  294
             NW  IVIG+ + ILAPIG L SI+  AKTY FY
Sbjct  430   NWISIVIGLCIMILAPIGALRSIILEAKTYQFY  462



>ref|XP_010034655.1| PREDICTED: lysine histidine transporter 1-like, partial [Eucalyptus 
grandis]
Length=436

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/429 (66%), Positives = 348/429 (81%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ + R  KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+++LSW 
Sbjct  9     AKQKEIDDWLPITASRKAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAVLVLSWV  68

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE +PG+RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTG
Sbjct  69    ITLYTLWQMVEMHEMIPGRRFDRYHELGQYAFGEKLGLYIVVPQQLVVEVGVNIVYMVTG  128

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K  + +C  CK +  +Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  129   GKSLQKFHDTVCSKCKKLNTTYFIMIFASVHFVLSHLPNFNSISGVSLTAAVMSLSYSTI  188

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V+YG RS      VF F SA+GD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  189   AWGASVDKGVQQR-VNYGYRSSTTPGKVFDFFSAMGDVAFAYAGHNVVLEIQATIPSTPE  247

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGV++AY+VVA+CY+PVA IGY   GN V D+IL++L KP WLIA AN+FVV
Sbjct  248   KPSKGPMWKGVIVAYIVVALCYFPVALIGYWMFGNSVEDDILISLNKPKWLIALANMFVV  307

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQVYAM +FDMIET  VK L FKPT TLRFV RN++VAFT+FV I+ PFFG LL
Sbjct  308   IHVIGSYQVYAMPVFDMIETVLVKKLHFKPTGTLRFVARNVYVAFTMFVAITFPFFGSLL  367

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PCIMWL + KP+KF LSW  NW  I++G+LL IL+PIGGL  I+ 
Sbjct  368   SFFGGFAFAPTTYFLPCIMWLAIYKPRKFSLSWWSNWVCIILGLLLMILSPIGGLRQIII  427

Query  317   SAKTYHFYQ  291
              AKTY FY 
Sbjct  428   KAKTYQFYS  436



>ref|XP_010033379.1| PREDICTED: lysine histidine transporter 1-like [Eucalyptus grandis]
 gb|KCW53002.1| hypothetical protein EUGRSUZ_J02302 [Eucalyptus grandis]
Length=442

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/429 (67%), Positives = 350/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+++LSW 
Sbjct  15    AKQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAVLVLSWI  74

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTG
Sbjct  75    ITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLVVEVGVNIVYMVTG  134

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K  + +C DCK +K +Y+I+IF+   F+ S LPNFNSI+ VSL AAIMS+SYSTI
Sbjct  135   GKSLQKFHDTVCPDCKKLKTTYFIMIFASVHFVLSHLPNFNSIAGVSLAAAIMSLSYSTI  194

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++ + V Y  RS      VF F SALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  195   AWGASVEKGVQPN-VKYSYRSSTTAGKVFDFFSALGDVAFAYAGHNVVLEIQATIPSTPE  253

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V DNIL++L KP WLIA AN+FVV
Sbjct  254   KPSKGPMWRGVIVAYIVVALCYFPVALIGYWVFGNSVEDNILMSLNKPRWLIALANMFVV  313

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDMIET  VK L FKPT  LRFV R ++VAFT+F+ I+ PFFGGLL
Sbjct  314   IHVIGSYQIYAMPVFDMIETVLVKKLHFKPTGMLRFVARTVYVAFTMFIAITFPFFGGLL  373

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PCIMWL + KP+KF LSW  NW  I++G+LL ILAPIGGL  I+ 
Sbjct  374   SFFGGFAFAPTTYFLPCIMWLAIYKPRKFSLSWWSNWVCIILGLLLMILAPIGGLRQIIL  433

Query  317   SAKTYHFYQ  291
             +AKTY FY 
Sbjct  434   AAKTYKFYS  442



>gb|KCW52997.1| hypothetical protein EUGRSUZ_J02297 [Eucalyptus grandis]
Length=449

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/429 (66%), Positives = 348/429 (81%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ + R  KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+++LSW 
Sbjct  22    AKQKEIDDWLPITASRKAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAVLVLSWV  81

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE +PG+RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTG
Sbjct  82    ITLYTLWQMVEMHEMIPGRRFDRYHELGQYAFGEKLGLYIVVPQQLVVEVGVNIVYMVTG  141

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K  + +C  CK +  +Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  142   GKSLQKFHDTVCSKCKKLNTTYFIMIFASVHFVLSHLPNFNSISGVSLTAAVMSLSYSTI  201

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG+++ K ++   V+YG RS      VF F SA+GD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  202   AWGASVDKGVQQR-VNYGYRSSTTPGKVFDFFSAMGDVAFAYAGHNVVLEIQATIPSTPE  260

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGV++AY+VVA+CY+PVA IGY   GN V D+IL++L KP WLIA AN+FVV
Sbjct  261   KPSKGPMWKGVIVAYIVVALCYFPVALIGYWMFGNSVEDDILISLNKPKWLIALANMFVV  320

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQVYAM +FDMIET  VK L FKPT TLRFV RN++VAFT+FV I+ PFFG LL
Sbjct  321   IHVIGSYQVYAMPVFDMIETVLVKKLHFKPTGTLRFVARNVYVAFTMFVAITFPFFGSLL  380

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
              FFGGFAFAPTTY++PCIMWL + KP+KF LSW  NW  I++G+LL IL+PIGGL  I+ 
Sbjct  381   SFFGGFAFAPTTYFLPCIMWLAIYKPRKFSLSWWSNWVCIILGLLLMILSPIGGLRQIII  440

Query  317   SAKTYHFYQ  291
              AKTY FY 
Sbjct  441   KAKTYQFYS  449



>ref|XP_011041568.1| PREDICTED: lysine histidine transporter 1-like [Populus euphratica]
Length=439

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 352/439 (80%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
              Y       AA +  ++DWLPV S R+ KWWYSTFHNVTAMVGAG+LSLPYAM+++GWGP
Sbjct  2     SYNESQNDEAAREKAINDWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSLPYAMAQLGWGP  61

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GVA+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V++
Sbjct  62    GVAILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVQV  121

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  +L+C DCK I+L+Y+I+IF+  QF+ + LPN NSIS +SL A
Sbjct  122   GVNIVYMVTGGKSLKKFHDLVCSDCKDIRLTYFIMIFASLQFVLAHLPNLNSISVISLAA  181

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAWG+ L+K ++   VDY  ++  KT  VF F SALGD+AF+YAGHNV+LE
Sbjct  182   AVMSLSYSTIAWGATLNKGVQPD-VDYSYKASTKTGAVFDFFSALGDIAFAYAGHNVILE  240

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSKK MW+G  +AYVVVA+CY+PVA IGY   GN V DNIL++LEKP W
Sbjct  241   IQATIPSTPEKPSKKPMWRGAFLAYVVVAICYFPVALIGYWFFGNSVEDNILISLEKPAW  300

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVV+HV+GSYQ+YA+ +FDM+ET  VK L F P+  LRFVTR ++V FT+ VG
Sbjct  301   LIATANMFVVIHVIGSYQIYAIAVFDMLETALVKKLHFSPSFMLRFVTRTVYVGFTMIVG  360

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I +PFFGGLL FFGGFAFAPTTY++PCIMWL + KPKKF  SW  NW  IV+GILL IL+
Sbjct  361   ICIPFFGGLLSFFGGFAFAPTTYFLPCIMWLAIYKPKKFSFSWIANWVCIVLGILLMILS  420

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIG L  I+ +AK Y F+ 
Sbjct  421   PIGALRHIILTAKDYEFFS  439



>ref|XP_010550273.1| PREDICTED: lysine histidine transporter 1-like [Tarenaya hassleriana]
Length=448

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/438 (62%), Positives = 348/438 (79%), Gaps = 2/438 (0%)
 Frame = -1

Query  1604  YKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPG  1425
             Y  +G K    K E+++WLP+   R+ KWWYS FHNVTAMVGAG+LSLPYAM+++GWGPG
Sbjct  13    YHRQGEKTEREK-EIEEWLPITGSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPG  71

Query  1424  VAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEIS  1245
             V +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+IVVPQQ +VE+ 
Sbjct  72    VVVLVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGERLGLYIVVPQQLVVEVG  131

Query  1244  LCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
             +CI+YMVTGG S++K   L+C  CK IKL+Y+I++F+   F+ S LPN NSIS VSL AA
Sbjct  132   VCIVYMVTGGKSLEKFHNLVCQGCKNIKLTYFIMMFASVHFVLSHLPNLNSISGVSLAAA  191

Query  1064  IMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +MS+SYSTIAW ++  K ++ + V+YG +S      VF F SA+GD+AF+YAGHNVVLEI
Sbjct  192   VMSLSYSTIAWTASAAKGVKGN-VEYGYKSKTTAGTVFNFFSAMGDVAFAYAGHNVVLEI  250

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPSTP+ PSK  MW+GV++AY VVA+CY+PVA +GY   GN V DNIL+TLEKP WL
Sbjct  251   QATIPSTPEKPSKGPMWRGVLVAYAVVALCYFPVALVGYWMFGNTVDDNILITLEKPAWL  310

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             IA AN+FVVVHV+GSYQ+YAM +FDM+E+  V+ L F P++TLRF+TRNL+V  T+F+ I
Sbjct  311   IALANLFVVVHVIGSYQIYAMPVFDMMESLLVRRLYFNPSRTLRFITRNLYVGVTMFIAI  370

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
             ++PFFG LL FFGGFAFAPTTY++PCIMWL++ +P +  LSW  NW  I +G++L  ++ 
Sbjct  371   TIPFFGSLLAFFGGFAFAPTTYFLPCIMWLLMRRPARLSLSWWCNWMCITLGVVLMFVSA  430

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IGGL SI+  AK YHFY 
Sbjct  431   IGGLRSIILKAKDYHFYS  448



>ref|XP_004146646.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus]
 gb|KGN64659.1| hypothetical protein Csa_1G073670 [Cucumis sativus]
Length=447

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/446 (63%), Positives = 360/446 (81%), Gaps = 4/446 (1%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAAN---KGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYA  1452
             E+       +  KP  +   K +++DWLP+   R+G WWYS FHNVTAMVGAG+L LPYA
Sbjct  2     EINHNGEDQQQIKPTTDQVKKVDLNDWLPITQSRNGNWWYSAFHNVTAMVGAGVLGLPYA  61

Query  1451  MSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVV  1272
             MS++GWGPGVA++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG K+GLW+VV
Sbjct  62    MSQLGWGPGVAVIILSWIITLYTLWQMVEMHEEVPGKRFDRYHELGQRAFGEKMGLWVVV  121

Query  1271  PQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNS  1092
             PQQ +VE+ + I+YM+TGG+S+KK+ +L C DCKPIK +Y+I+IF+   F  S LP+F+S
Sbjct  122   PQQLMVEVGVNIVYMITGGNSLKKIHDLACPDCKPIKTTYFIMIFASVHFFLSHLPSFDS  181

Query  1091  ISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSY  912
             I+ VSL AA+MS+SYSTIAW ++ HK +    V YG R+     NVF F+S LGD+AF+Y
Sbjct  182   ITLVSLAAAVMSLSYSTIAWAASAHKGVVPD-VSYGHRATTTAGNVFNFLSGLGDVAFAY  240

Query  911   AGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNIL  732
             AGHNVVLEIQATIPSTPD PSKK MWKGVV+AY+VVA+CY+PVAF+GYL  G+ V DNIL
Sbjct  241   AGHNVVLEIQATIPSTPDCPSKKPMWKGVVVAYLVVALCYFPVAFVGYLVFGDSVQDNIL  300

Query  731   LTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLF  552
             ++L +PVWLI AAN+FVV+HV+GSYQ++AM +FDM+E+F VK +KF+P++ LRFVTR  +
Sbjct  301   ISLNRPVWLIIAANLFVVIHVIGSYQIFAMPVFDMLESFLVKQMKFQPSRCLRFVTRTTY  360

Query  551   VAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVI  372
             VA T+ V ++ PFFGGLL FFGGFAFAPTTYY+PCIMWL + KPK++ LSW +NW  I+I
Sbjct  361   VALTMLVAMTFPFFGGLLSFFGGFAFAPTTYYLPCIMWLAIKKPKRYSLSWFINWICIII  420

Query  371   GILLTILAPIGGLWSIVKSAKTYHFY  294
             G+LL +LAPIG L +I+  AKT++F+
Sbjct  421   GVLLMVLAPIGALRNIILQAKTFNFF  446



>ref|XP_004305931.1| PREDICTED: lysine histidine transporter 1-like [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/445 (61%), Positives = 352/445 (79%), Gaps = 7/445 (2%)
 Frame = -1

Query  1625  RELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMS  1446
              E    D K E  K      ++DDWLP+ S R+  WW+S FHNV +MVG G+LSLPYAMS
Sbjct  2     EEQSQTDEKLERQK------QIDDWLPITSSRNATWWHSAFHNVNSMVGVGVLSLPYAMS  55

Query  1445  EMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQ  1266
              +GWGPGV +++LSW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQ
Sbjct  56    NLGWGPGVVILVLSWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQ  115

Query  1265  QALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSIS  1086
             Q + E+ + I+YMV+GG +++KV  ++     PIKL+Y+I+I++  QF+ + LP+F SI+
Sbjct  116   QLVCEVGVNIVYMVSGGKTLQKVHSIVRKGKNPIKLTYFIMIYASAQFVLAHLPSFGSIT  175

Query  1085  FVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAG  906
              VSL AA+M +SYSTIAW S++HK +++  V+YG ++H  +   F F +ALGD+AF+YAG
Sbjct  176   GVSLTAAVMCLSYSTIAWTSSVHKGVQAD-VEYGYKAHTASGTAFNFFTALGDVAFAYAG  234

Query  905   HNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLT  726
             HNVVLEIQAT+PS+PD PSKK MW+GV+IAY VVA+CY+PVA IGY   GN+V DNIL++
Sbjct  235   HNVVLEIQATLPSSPDKPSKKLMWRGVIIAYTVVALCYFPVALIGYYTFGNKVEDNILIS  294

Query  725   LEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVA  546
             LEKP WLI  AN+FVV+H++G YQ++AM +FDMIET  VK L F+PT+TLRF+TRN++VA
Sbjct  295   LEKPAWLIITANMFVVIHIIGGYQLFAMPVFDMIETVLVKKLHFRPTQTLRFITRNVYVA  354

Query  545   FTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGI  366
             FT+FVGIS PFFGGLLGFFGGFAF+PTTY++PC++WL + KP+KF LSW +NW  I +G+
Sbjct  355   FTMFVGISFPFFGGLLGFFGGFAFSPTTYFLPCVIWLAIKKPRKFSLSWFINWICITLGV  414

Query  365   LLTILAPIGGLWSIVKSAKTYHFYQ  291
             LL +L+PIGGL  I+  AK Y FY 
Sbjct  415   LLMLLSPIGGLRHIILQAKDYDFYN  439



>ref|XP_002312642.1| hypothetical protein POPTR_0008s17910g [Populus trichocarpa]
 gb|EEE90009.1| hypothetical protein POPTR_0008s17910g [Populus trichocarpa]
Length=439

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/438 (62%), Positives = 347/438 (79%), Gaps = 1/438 (0%)
 Frame = -1

Query  1604  YKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPG  1425
             Y       AA +  +DDWLP+ S R  KWWYSTFHNVTAMVGAG+LSLPYAM+++GWGPG
Sbjct  3     YNESRNDAAAKEKAIDDWLPITSSRKAKWWYSTFHNVTAMVGAGVLSLPYAMAQLGWGPG  62

Query  1424  VAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEIS  1245
             +A+++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGLWIVVPQQ +V++ 
Sbjct  63    IAILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGDKLGLWIVVPQQLIVQVG  122

Query  1244  LCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
             + I+YMVTGG S+KK  +++C +CK I+L+Y+I+IF+  Q + + LPN NSIS +SL AA
Sbjct  123   VNIVYMVTGGKSLKKFHDVVCPNCKDIRLTYFIMIFASVQMVLAHLPNLNSISVISLAAA  182

Query  1064  IMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEI  885
             +MS+SYSTIAW   L+K ++   VDY  ++  +T   F F++ALGD+AF+YAGHNVVLEI
Sbjct  183   VMSLSYSTIAWAVTLNKGVQPD-VDYSYKARTRTGAFFDFITALGDVAFAYAGHNVVLEI  241

Query  884   QATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWL  705
             QATIPS+P+ PSKK MW+G  +AY+VVA CY+PVA IGY   GN V DNIL++L+KP WL
Sbjct  242   QATIPSSPEKPSKKPMWRGAFLAYLVVAFCYFPVALIGYWCYGNSVDDNILISLQKPSWL  301

Query  704   IAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGI  525
             IAAAN+FVV+HV+GSYQ+YA+ +FD++ET  VK L F P+  LRFVTR ++V  T+FVGI
Sbjct  302   IAAANMFVVIHVIGSYQIYAIAVFDLLETALVKKLHFSPSFMLRFVTRTVYVGLTMFVGI  361

Query  524   SVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAP  345
              +PFF GLL FFGGFAFAPTTY++PC+MWL + KPK+FG SW  NW  +++G+LL IL+P
Sbjct  362   CIPFFNGLLSFFGGFAFAPTTYFLPCVMWLSIYKPKRFGFSWTANWVCVILGVLLMILSP  421

Query  344   IGGLWSIVKSAKTYHFYQ  291
             IG L  I+ +AK Y F+ 
Sbjct  422   IGALRHIILTAKDYEFFS  439



>ref|XP_004489582.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Cicer 
arietinum]
Length=461

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/428 (64%), Positives = 343/428 (80%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +D+WLP+ S+R+ KWWYS FHN+TAMVGAG+L LPYAMS++GWGPGV ++ +SW I
Sbjct  28    REKRIDEWLPITSKRNAKWWYSAFHNITAMVGAGVLGLPYAMSKLGWGPGVTILTISWII  87

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE +PGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + I+YMVTGG
Sbjct  88    TLYTLWQMVEMHEMIPGKRFDRYHELGQHAFGKKLGLYIVVPQQLVVEIGVNIVYMVTGG  147

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
             +S++K    +C  CK IKL+Y+I+IF+   F+ S LPNFNSIS +SL A++MS SYSTI+
Sbjct  148   TSLQKFHNTVCSSCKKIKLTYFIMIFASVHFVLSHLPNFNSISGLSLAASVMSFSYSTIS  207

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++ K I+ + V YG +SH K    F F +ALG +AF+YAGHNVVLEIQATIPSTP  
Sbjct  208   WAASIDKGIQEN-VQYGYKSHSKAGTTFDFFNALGTIAFAYAGHNVVLEIQATIPSTPQK  266

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVV+AY++VA CY+PVA IGYL  GN+V DNIL++LEKP WLIA AN+FVV+
Sbjct  267   PSKVPMWRGVVVAYIIVAFCYFPVAIIGYLVFGNEVKDNILISLEKPKWLIATANLFVVI  326

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  VK  KF+P K +RFV RN++VAFT+F+ I+ PFF GLLG
Sbjct  327   HVIGSYQIYAMPVFDMIETLLVKKFKFEPNKLVRFVVRNVYVAFTMFIAITFPFFDGLLG  386

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGF FAPTTY++PCI+W+ + KPKKFGLSW  NW  I +G+ L IL+ +GGL  I+  
Sbjct  387   FFGGFVFAPTTYFLPCILWMAIKKPKKFGLSWWTNWICIALGLCLMILSSLGGLRRIIIE  446

Query  314   AKTYHFYQ  291
             AKTY FY 
Sbjct  447   AKTYKFYS  454



>ref|XP_008341345.1| PREDICTED: lysine histidine transporter 1-like [Malus domestica]
Length=442

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/435 (64%), Positives = 354/435 (81%), Gaps = 1/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             E  +  A + ++++WLP+ + R+ KWWYS FHNVTAMVGAG+LSLPYAM+ +GWGPGV +
Sbjct  9     EIKEKLAKQKKIEEWLPITASRNAKWWYSAFHNVTAMVGAGVLSLPYAMANLGWGPGVVI  68

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I
Sbjct  69    LVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLIVEVGVNI  128

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG S++KV   +C DCK IKL+Y+I IF+   F+ S LPNFNSIS VSL AA+MS
Sbjct  129   VYMVTGGKSLQKVHNSVCSDCKKIKLTYFIXIFASVHFVLSHLPNFNSISGVSLAAAVMS  188

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAWG+++ K +  + V YG ++   +  V  F ++LG +AF+YAGHNVVLEIQAT
Sbjct  189   LSYSTIAWGASVDKGVVDN-VAYGYKATSTSGTVLNFFTSLGHVAFAYAGHNVVLEIQAT  247

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSK  MW+GV++AY+VVA+CY+PVA +G+   GN V DNIL++LEKP WLIA 
Sbjct  248   IPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALVGFYMFGNTVEDNILISLEKPAWLIAV  307

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+GSYQ+YAM +FDMIE   VK L F PT+TLRF++RN++VAFT+F+GI+ P
Sbjct  308   ANMFVVIHVIGSYQIYAMPVFDMIEAVLVKKLNFAPTRTLRFISRNIYVAFTMFIGITFP  367

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGGFAFAPTTY++PC+MWL + KP+KF LSW  N+T I +G+LL +L+PIGG
Sbjct  368   FFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPRKFSLSWWCNYTCIFLGVLLMVLSPIGG  427

Query  335   LWSIVKSAKTYHFYQ  291
             L SI+  AKTY FY 
Sbjct  428   LRSIIIQAKTYKFYS  442



>ref|XP_009601838.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana tomentosiformis]
Length=435

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/431 (67%), Positives = 355/431 (82%), Gaps = 2/431 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +A + ++D+WLP+ S R+ KWWYSTFHNVT+MVGAG+LSLPYAMSE+GWGPGV +++LSW
Sbjct  6     SAEQKKIDEWLPITSSRNAKWWYSTFHNVTSMVGAGVLSLPYAMSELGWGPGVTVLVLSW  65

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  66    IITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQVIVEVGVDIVYMVT  125

Query  1220  GGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
             GG S+KK+ +LLC D C  +KLS++I+IF+   F    LPNFNSIS +SL AA+MS+SYS
Sbjct  126   GGKSLKKIHDLLCKDNCTNMKLSHFIMIFASVHFCLVHLPNFNSISSISLAAAVMSLSYS  185

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             TIAWG+++ K ++   VDYG  +      VF F SALGD+AF+YAGHNVVLEIQATIPST
Sbjct  186   TIAWGASIKKGVQPD-VDYGYNAKTNMGAVFNFFSALGDVAFAYAGHNVVLEIQATIPST  244

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
              + PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN V DNIL++LEKP WLI  AN F
Sbjct  245   SEKPSKGPMWRGVVVAYIVVAVCYFPVALIGYWVFGNSVQDNILISLEKPTWLIVMANFF  304

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VVVHV+GSYQ+YAM +FDMIET  VK LKFKPT  LRF+TRNL+VAFT+FVGI++PFFGG
Sbjct  305   VVVHVIGSYQIYAMPVFDMIETVLVKKLKFKPTWYLRFITRNLYVAFTMFVGIAIPFFGG  364

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             LLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW +NW  I++G+LL ++APIG L SI
Sbjct  365   LLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWIINWICIILGLLLMVIAPIGALRSI  424

Query  323   VKSAKTYHFYQ  291
             + SAK+  F+ 
Sbjct  425   ILSAKSLKFFS  435



>ref|XP_002315629.1| hypothetical protein POPTR_0010s06590g [Populus trichocarpa]
 gb|EEF01800.1| hypothetical protein POPTR_0010s06590g [Populus trichocarpa]
Length=439

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/430 (67%), Positives = 350/430 (81%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA +  ++DWLPV S R+ KWWYSTFHNVTAMVGAG+LSLPYAM+++GWGPGVA++ LSW
Sbjct  11    AAREKAINDWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSLPYAMAQLGWGPGVAILFLSW  70

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V++ + I+YMVT
Sbjct  71    VITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVQVGVNIVYMVT  130

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KK  +L+C DCK I+L+Y+I+IF+  QF+ + LPN NSIS +SL AA+MS+SYST
Sbjct  131   GGKSLKKFHDLVCSDCKDIRLTYFIMIFASLQFVLAHLPNLNSISVISLAAAVMSLSYST  190

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAWG+ L+K ++   VDY  ++  KT  VF F SALGD+AF+YAGHNV+LEIQATIPSTP
Sbjct  191   IAWGATLNKGVQPD-VDYSYKASTKTGAVFDFFSALGDIAFAYAGHNVILEIQATIPSTP  249

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSKK MW+G  +AYVVVA+CY+PVA IGY   GN V DNIL++LEKP WLIA AN+FV
Sbjct  250   EKPSKKPMWRGAFLAYVVVAICYFPVALIGYWFFGNSVEDNILISLEKPAWLIATANMFV  309

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             V+HV+GSYQ+YAM +FDM+ET  VK L F P+  LRFVTR ++V FT+ VGI +PFFGGL
Sbjct  310   VIHVIGSYQIYAMAVFDMLETALVKKLHFSPSFMLRFVTRTVYVGFTMIVGICIPFFGGL  369

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             L FFGGFAFAPTTY++PCIMWL + KPKKF  SW  NW  IV+GILL IL+PIG L  I+
Sbjct  370   LSFFGGFAFAPTTYFLPCIMWLAIYKPKKFSFSWIANWVCIVLGILLMILSPIGALRHII  429

Query  320   KSAKTYHFYQ  291
              +AK Y F+ 
Sbjct  430   LTAKDYEFFS  439



>gb|KCW53000.1| hypothetical protein EUGRSUZ_J02300 [Eucalyptus grandis]
Length=443

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/435 (65%), Positives = 349/435 (80%), Gaps = 1/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             E  +  A + E+DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPGVA+
Sbjct  10    EIEEKLAKQKEIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGVAV  69

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSW ITLYTL+QMVEMHE +PG+RFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I
Sbjct  70    LVLSWLITLYTLWQMVEMHEMIPGRRFDRYHELGQYAFGEKLGLYIVVPQQLVVEVGVNI  129

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG S++K    +C  CK +K +Y+I+IF+  QF+ S LPNFNSIS VSL AA+MS
Sbjct  130   VYMVTGGKSLQKFHHTVCSSCKKLKTTYFIMIFASVQFVLSHLPNFNSISGVSLTAAVMS  189

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAWG+++   ++   V Y  RS      V  F SA+GD+AF+YAGHNVVLEIQAT
Sbjct  190   LSYSTIAWGASIENGVQPD-VKYSYRSSTTAGKVLDFFSAMGDVAFAYAGHNVVLEIQAT  248

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V D+IL++L+KP WLIA 
Sbjct  249   IPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALIGYRMFGNSVEDDILISLKKPKWLIAM  308

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+GSYQVYAM +FDMIET  VK L FKPT TLRFV RN++VAFT+FV I+ P
Sbjct  309   ANMFVVIHVIGSYQVYAMPVFDMIETVLVKKLHFKPTGTLRFVARNVYVAFTMFVAITFP  368

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFG LL FFGGFAFAPTTY++PCIMWL + KP+KF LSW  NW  I++G+LL IL+PIGG
Sbjct  369   FFGSLLSFFGGFAFAPTTYFLPCIMWLAIYKPRKFSLSWWSNWVCIILGLLLMILSPIGG  428

Query  335   LWSIVKSAKTYHFYQ  291
             L  I+  AKTY FY 
Sbjct  429   LRQIIIKAKTYQFYS  443



>ref|XP_010930433.1| PREDICTED: lysine histidine transporter 1-like [Elaeis guineensis]
Length=431

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/428 (66%), Positives = 349/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+ +GWGPGV +++LSW I
Sbjct  5     QEKSLDDWLPITSNRNAKWWYSAFHNVTAMVGAGVLSLPYAMAHLGWGPGVVVLVLSWVI  64

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+  CI+YMVTGG
Sbjct  65    TLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQVVVEVGTCIVYMVTGG  124

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++K   ++C DCK IKLSY+I+IF+   F+ S LPNFNS+S VSL AA+MS+SYSTIA
Sbjct  125   KSLQKFHNVVCPDCKSIKLSYFIMIFASVHFVLSQLPNFNSMSGVSLAAAVMSLSYSTIA  184

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             WG+A+ K  +   VDY  +    +  VF F+SALGD+AF++AGHNVVLEIQATIPSTP+ 
Sbjct  185   WGAAVDKG-QQEGVDYSFKDSTTSGVVFGFVSALGDVAFAFAGHNVVLEIQATIPSTPEK  243

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKK MWKGV++AY++VA+CY+PVA IGY + GN V DNIL++LE+P WLIAAAN+FVV+
Sbjct  244   PSKKPMWKGVIVAYIIVAICYFPVALIGYWSFGNAVDDNILISLERPRWLIAAANMFVVI  303

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+G YQ+YAM +FDM+ET  VK L F P+  LR V R LFVA T+F+GI +PFFGGLLG
Sbjct  304   HVIGGYQIYAMPVFDMMETMLVKKLHFSPSIALRLVARTLFVALTMFIGICIPFFGGLLG  363

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFA APTTYY+PCIMWL++ KP+KF LSW  NW  I++G++L ILAPIGGL +I+ +
Sbjct  364   FFGGFALAPTTYYLPCIMWLVIYKPRKFSLSWITNWICIILGVILMILAPIGGLRTIILN  423

Query  314   AKTYHFYQ  291
             AK Y F+ 
Sbjct  424   AKNYQFFS  431



>ref|XP_002265948.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera]
Length=438

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/449 (62%), Positives = 344/449 (77%), Gaps = 11/449 (2%)
 Frame = -1

Query  1637  MGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLP  1458
             MG D + E         K A ++  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLP
Sbjct  1     MGLDSQQE---------KDARDRA-IDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLP  50

Query  1457  YAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWI  1278
             YA++ +GWGPGV +++LSW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWI
Sbjct  51    YAVAGLGWGPGVVILVLSWIVTLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWI  110

Query  1277  VVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNF  1098
             VVPQQ +VE+ + I YM+TGG S++K+   +C DCKPI+ +Y+I+IF+   F+ S LPNF
Sbjct  111   VVPQQVIVEVGVNIAYMITGGKSLRKLHNTVCPDCKPIRTTYFIMIFASCHFVLSHLPNF  170

Query  1097  NSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAF  918
             NSIS VS  AA MS++YSTIAW +++HK ++   V Y   +      VF F SALGD+AF
Sbjct  171   NSISGVSFAAAAMSLTYSTIAWTASVHKGVQPD-VQYSYTASTTAGRVFTFFSALGDVAF  229

Query  917   SYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDN  738
             +YAGHNVVLEIQATIPSTP+ PSK  MWKGVV AY+VVA+CY+PVA IGY   GN V+DN
Sbjct  230   AYAGHNVVLEIQATIPSTPEKPSKGPMWKGVVFAYIVVAICYFPVALIGYWMFGNSVADN  289

Query  737   ILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRN  558
             IL+TLE P WLIAAAN+FVV+HV+GSYQ+YAM MFD++ET  VK LKF P   LR +TR 
Sbjct  290   ILITLENPRWLIAAANMFVVIHVIGSYQIYAMPMFDLLETLLVKKLKFTPCFRLRLITRT  349

Query  557   LFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFI  378
             L+VAFT+F+G+ +PFFG LLGF GG  FAPTTY++PCIMWL + KP++  LSW  NW  I
Sbjct  350   LYVAFTMFIGMLIPFFGSLLGFLGGLVFAPTTYFLPCIMWLAVYKPRRLSLSWFANWMCI  409

Query  377   VIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             V+GI+L ILAPIG L  I+  AKT+  + 
Sbjct  410   VMGIILMILAPIGALRQIILQAKTFKLFS  438



>ref|XP_006476987.1| PREDICTED: lysine histidine transporter 1-like [Citrus sinensis]
Length=440

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/441 (64%), Positives = 352/441 (80%), Gaps = 1/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M + +        N  E++DWLP+   R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GW
Sbjct  1     MAETQKRKEAAPENGKELNDWLPITKSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSEIGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPG+A+++LSW ITLYTL+QMVEMHE VPGKRFDRY+ELGQ AFG KLGLWI+VPQQ LV
Sbjct  61    GPGIAVIVLSWIITLYTLWQMVEMHEMVPGKRFDRYYELGQHAFGEKLGLWIIVPQQLLV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YM+TGG  +KK  + +C  CK I+L+Y+I+IF+   F+ S LP+FNS++ VSL
Sbjct  121   EVGVDIMYMLTGGQCLKKFHDTVCPSCKDIRLTYFIMIFASVHFVLSHLPSFNSVAVVSL  180

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS+SYS IAW S LHK    + VDYG R+ K T NVF F SALGD+AF++AGHNVV
Sbjct  181   AAAVMSISYSVIAWVSCLHKGALPN-VDYGLRASKTTGNVFNFFSALGDVAFAFAGHNVV  239

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQA+IPSTP+ PSKK MWKGVVIAY++VA CY+PVA +GY A GNQV DN+L++LEKP
Sbjct  240   LEIQASIPSTPEKPSKKPMWKGVVIAYLLVAFCYFPVAMVGYWAFGNQVEDNVLMSLEKP  299

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
              WLIAAAN+FVVVHV+GSYQVYAM +FDM+E F VK L FKPT  LRF+TR ++V FT+F
Sbjct  300   RWLIAAANLFVVVHVIGSYQVYAMPVFDMLEAFLVKKLHFKPTMILRFLTRTIYVGFTMF  359

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             + ++ PFFGGLL FFGG AFAPTTYYIPCI+WL + KP++F LSW  NW  I++G+ L I
Sbjct  360   IAMTFPFFGGLLSFFGGLAFAPTTYYIPCIIWLAIYKPRRFSLSWITNWFCIIVGVALMI  419

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             LAPIGGL +++  AK++ FY 
Sbjct  420   LAPIGGLRALILEAKSFKFYS  440



>ref|XP_004236350.1| PREDICTED: lysine histidine transporter 2-like [Solanum lycopersicum]
Length=440

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/424 (66%), Positives = 344/424 (81%), Gaps = 1/424 (0%)
 Frame = -1

Query  1562  VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAITLYT  1383
             +++WLP+ S R+ KW+YS FHNVTAMVGAG+L LPYAMS++GWG GV +M+L+W ITLYT
Sbjct  18    INNWLPITSSRNAKWYYSAFHNVTAMVGAGVLGLPYAMSQLGWGVGVTVMVLAWVITLYT  77

Query  1382  LYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGSSIK  1203
             L+QMV+MHE V GKRFDRYHELGQ AFG KLGLWIVVPQQ LVE+ + I+YMVTGG S++
Sbjct  78    LWQMVQMHEMVAGKRFDRYHELGQEAFGEKLGLWIVVPQQLLVEVGVNIVYMVTGGKSLE  137

Query  1202  KVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAWGSA  1023
             K+ +  C +C P++ SY+IL+F   QF  SF PNFNSI+F+S LAA+MS+SYSTI WG++
Sbjct  138   KIYQTCCPNCYPLRTSYFILMFGSVQFFLSFCPNFNSITFISFLAAVMSLSYSTIGWGAS  197

Query  1022  LHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNPSKK  843
             LHK I S  VDY PR+   T  VF  +SALGD+AF++AGHNVVLEIQAT+PSTP+ PSKK
Sbjct  198   LHKGI-SPEVDYSPRASTSTGRVFGSLSALGDIAFAFAGHNVVLEIQATMPSTPEKPSKK  256

Query  842   AMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvhvVG  663
              MW+GVVIAY+VVAMCY+PVAF+GY   GN V DNIL++L KP WLI  AN FVV+HV+G
Sbjct  257   PMWRGVVIAYMVVAMCYFPVAFVGYRVFGNGVEDNILISLRKPAWLIIMANAFVVIHVIG  316

Query  662   SYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllgffgg  483
             SYQV+AM +FDMIE++ VK   F PTKTLR + R  +VA T+F+ IS PFFGGLLGFFGG
Sbjct  317   SYQVFAMGVFDMIESYLVKQRNFNPTKTLRVIVRTGYVALTMFLAISFPFFGGLLGFFGG  376

Query  482   fafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKSAKTY  303
             FAFAPTTY++PCI+WLIL KPK+FGLSW +NW  I++G++L ILAPIG L  I+  AK Y
Sbjct  377   FAFAPTTYFLPCIIWLILRKPKRFGLSWFINWICIILGVVLMILAPIGALRQIILQAKGY  436

Query  302   HFYQ  291
              F+ 
Sbjct  437   KFFS  440



>ref|XP_004158062.1| PREDICTED: lysine histidine transporter 1-like [Cucumis sativus]
Length=472

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/445 (63%), Positives = 359/445 (81%), Gaps = 4/445 (1%)
 Frame = -1

Query  1622  ELEMGDYKAEGAKPAAN---KGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYA  1452
             E+       +  KP  +   K +++DWLP+   R+G WWYS FHNVTAMVGAG+L LPYA
Sbjct  2     EINHNGEDQQQIKPTTDQVKKVDLNDWLPITQSRNGNWWYSAFHNVTAMVGAGVLGLPYA  61

Query  1451  MSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVV  1272
             MS++GWGPGVA++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG K+GLW+VV
Sbjct  62    MSQLGWGPGVAVIILSWIITLYTLWQMVEMHEEVPGKRFDRYHELGQRAFGEKMGLWVVV  121

Query  1271  PQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNS  1092
             PQQ +VE+ + I+YM+TGG+S+KK+ +L C DCKPIK +Y+I+IF+   F  S LP+F+S
Sbjct  122   PQQLMVEVGVNIVYMITGGNSLKKIHDLACPDCKPIKTTYFIMIFASVHFFLSHLPSFDS  181

Query  1091  ISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSY  912
             I+ VSL AA+MS+SYSTIAW ++ HK +    V YG R+     NVF F+S LGD+AF+Y
Sbjct  182   ITLVSLAAAVMSLSYSTIAWAASAHKGVVPD-VSYGHRATTTAGNVFNFLSGLGDVAFAY  240

Query  911   AGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNIL  732
             AGHNVVLEIQATIPSTPD PSKK MWKGVV+AY+VVA+CY+PVAF+GYL  G+ V DNIL
Sbjct  241   AGHNVVLEIQATIPSTPDCPSKKPMWKGVVVAYLVVALCYFPVAFVGYLVFGDSVQDNIL  300

Query  731   LTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLF  552
             ++L +PVWLI AAN+FVV+HV+GSYQ++AM +FDM+E+F VK +KF+P++ LRFVTR  +
Sbjct  301   ISLNRPVWLIIAANLFVVIHVIGSYQIFAMPVFDMLESFLVKQMKFQPSRCLRFVTRTTY  360

Query  551   VAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVI  372
             VA T+ V ++ PFFGGLL FFGGFAFAPTTYY+PCIMWL + KPK++ LSW +NW  I+I
Sbjct  361   VALTMLVAMTFPFFGGLLSFFGGFAFAPTTYYLPCIMWLAIKKPKRYSLSWFINWICIII  420

Query  371   GILLTILAPIGGLWSIVKSAKTYHF  297
             G+LL +LAPIG L +I+  AKT++F
Sbjct  421   GVLLMVLAPIGALRNIILQAKTFNF  445



>ref|XP_006440052.1| hypothetical protein CICLE_v10024278mg [Citrus clementina]
 gb|ESR53292.1| hypothetical protein CICLE_v10024278mg [Citrus clementina]
Length=440

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/441 (63%), Positives = 353/441 (80%), Gaps = 1/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M + +        N+  ++DWLP+   R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GW
Sbjct  1     MAETQKRKEAAPENEKALNDWLPITKSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSEIGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPG+A+++LSW ITLYTL+QMVEMHE VPGKRFDRY+ELGQ AFG KLGLWI+VPQQ LV
Sbjct  61    GPGIAVIVLSWIITLYTLWQMVEMHEMVPGKRFDRYYELGQHAFGEKLGLWIIVPQQLLV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YM+TGG  +KK  + +C  CK I+L+Y+I+IF+   F+ S LP+FNS++ VSL
Sbjct  121   EVGVDIMYMLTGGQCLKKFHDTVCPSCKDIRLTYFIMIFASVHFVLSHLPSFNSVAVVSL  180

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AA+MS+SYS IAW + LHK    + VDYG R+ K T NVF F SALGD+AF++AGHNVV
Sbjct  181   AAAVMSISYSVIAWVACLHKGALPN-VDYGLRASKTTGNVFNFFSALGDVAFAFAGHNVV  239

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQA+IPSTP+ PSKK MWKGVVIAY++VA CY+PVA +GY A GNQV DN+L++LEKP
Sbjct  240   LEIQASIPSTPEKPSKKPMWKGVVIAYLLVAFCYFPVAMVGYWAFGNQVEDNVLMSLEKP  299

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
              WLIAAAN+FVVVHV+GSYQVYAM +FDM+E F VK L FKPT+ LRF+TR ++V FT+F
Sbjct  300   RWLIAAANLFVVVHVIGSYQVYAMPVFDMLEAFLVKKLHFKPTRILRFLTRTIYVGFTMF  359

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             + ++ PFFGGLL FFGG AFAPTTYYIPCI+WL + KP++F LSW  NW  I++G+ L I
Sbjct  360   IAMTFPFFGGLLSFFGGLAFAPTTYYIPCIIWLAIYKPRRFSLSWITNWFCIIVGVALMI  419

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             LAPIGGL +++  AK++ FY 
Sbjct  420   LAPIGGLRALILEAKSFKFYS  440



>ref|XP_002443796.1| hypothetical protein SORBIDRAFT_07g002240 [Sorghum bicolor]
 gb|EES13291.1| hypothetical protein SORBIDRAFT_07g002240 [Sorghum bicolor]
Length=446

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/447 (64%), Positives = 349/447 (78%), Gaps = 7/447 (2%)
 Frame = -1

Query  1613  MGDYKAEGAKP-----AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAM  1449
             MG    E   P     +A    +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM
Sbjct  1     MGTQAPENHSPTKDERSAGDKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAM  60

Query  1448  SEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVP  1269
             S++GWGPG+ ++ILSW ITLYT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVP
Sbjct  61    SKLGWGPGIVVLILSWIITLYTMWQMVEMHEMVPGKRFDRYHELGQHAFGQKLGLWIVVP  120

Query  1268  QQALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNS  1092
             QQ +VE+   I++MVTGG S+KK  +++C   CK IKL+Y+I+IF+   F+ S LPNFNS
Sbjct  121   QQLIVEVGGDIVFMVTGGKSLKKFHDVICDGKCKDIKLTYFIMIFASCHFVLSQLPNFNS  180

Query  1091  ISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSY  912
             IS VSL AA+MS+SYSTIAWG +LHK  +   VDY   +   ++  F +  ALGD+AF+Y
Sbjct  181   ISGVSLAAAVMSLSYSTIAWGVSLHKG-KLPDVDYHVLAATTSEKAFNYFGALGDVAFAY  239

Query  911   AGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNIL  732
             AGHNVVLEIQATIPSTP+NPSKK MWKGVV+AY++VA+CY+PV+F GY A GNQV DNIL
Sbjct  240   AGHNVVLEIQATIPSTPENPSKKPMWKGVVVAYIMVAVCYFPVSFFGYWAFGNQVDDNIL  299

Query  731   LTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLF  552
             +TL KP WLIA AN+ VV+HV+GSYQ++AM +FDMIET  VK L F P   LR + R+ +
Sbjct  300   ITLNKPKWLIALANMMVVIHVIGSYQIFAMPVFDMIETVLVKKLHFPPGLALRLIARSTY  359

Query  551   VAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVI  372
             VA T FV I++PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  I++
Sbjct  360   VALTTFVAITIPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWFTNWVCILL  419

Query  371   GILLTILAPIGGLWSIVKSAKTYHFYQ  291
             G++L ILAPIG L  I+ SAKTY FY 
Sbjct  420   GVVLMILAPIGALRQIILSAKTYRFYS  446



>gb|KFK36072.1| hypothetical protein AALP_AA4G073800 [Arabis alpina]
Length=453

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/428 (64%), Positives = 342/428 (80%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + E+DDWLP+ S R+ KWWYSTFHNVTAMVGAG+L LPY+M+++GWGPGV ++ILSW I
Sbjct  27    KQKEIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLGLPYSMAQLGWGPGVTVLILSWII  86

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+I+VPQQ +VE+ +CI+YMVTGG
Sbjct  87    TLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIIVEVGVCIVYMVTGG  146

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  EL+C DC  IKL+Y+I+IF+   F+ S LPNFNSIS VSL+AA+MS+SYSTIA
Sbjct  147   QSLKKFHELVCSDCSRIKLTYFIMIFASSHFVLSHLPNFNSISIVSLVAAVMSLSYSTIA  206

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +   K ++   V YG +S      V  F + LG +AF+YAGHNVVLEIQATIPS+P  
Sbjct  207   WTATAAKGVQED-VQYGYKSGTTGSTVLSFFTGLGGIAFAYAGHNVVLEIQATIPSSPST  265

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MWKGV +AYVVVA+CY+PVA +GY   GN V+DN+L++L+ PVW IA AN+FVV+
Sbjct  266   PSKGPMWKGVKVAYVVVALCYFPVALVGYAVFGNAVADNLLISLKTPVWAIAIANLFVVM  325

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQV+AM +FDM+ETF VK L FKP+  LRF+ RN++VA T+F+ I +PFFGGLL 
Sbjct  326   HVIGSYQVFAMPVFDMVETFLVKKLNFKPSTFLRFIVRNVYVALTMFIAIMIPFFGGLLA  385

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL++ KPK+F LSW  NW  IV+GILL IL+ IGGL  I+  
Sbjct  386   FFGGFAFAPTTYFLPCIMWLLIYKPKRFSLSWWTNWVCIVLGILLMILSTIGGLRQIILE  445

Query  314   AKTYHFYQ  291
             +K Y  + 
Sbjct  446   SKDYTLFS  453



>emb|CDP13303.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/431 (63%), Positives = 347/431 (81%), Gaps = 3/431 (1%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  ++DWLPV S R  KWWYS FHNVTAMVGAG+L LPYA+S++GWGPGV M+ +SW 
Sbjct  10    AEEKAIEDWLPVSSVRKSKWWYSAFHNVTAMVGAGVLGLPYALSQLGWGPGVTMLAISWM  69

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ LV++S CI+YMVTG
Sbjct  70    ITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLLVQVSTCIVYMVTG  129

Query  1217  GSSIKKVVELLCH--DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYS  1044
             G S+KK  +++C    C+ I+L+Y+ILIF+   F+ S LPNF+S++ +S  AA+MS+SYS
Sbjct  130   GKSLKKFHDIVCPPPRCQDIRLTYFILIFASVHFVISHLPNFHSLAIISFSAAVMSLSYS  189

Query  1043  TIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPST  864
             T+AW ++L K  +   V Y PR        F F++ALGD+AF+YAGHNVVLEIQATIPST
Sbjct  190   TVAWMTSLFKG-QIPNVSYVPRGSTAAGKTFNFLNALGDVAFAYAGHNVVLEIQATIPST  248

Query  863   PDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIF  684
             PD PSK+ MWKGVV+AY VVA+CY+PVA  GY A GN+V DN+L+TL+KP WLIAAAN+F
Sbjct  249   PDKPSKRPMWKGVVLAYFVVALCYFPVAICGYYAYGNEVEDNVLITLQKPSWLIAAANMF  308

Query  683   vvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffgg  504
             VV+HV+GSYQVYAM +FD +E+  VK+L+FKP+  LRF+TR L+VA T+  G+++PFFGG
Sbjct  309   VVIHVIGSYQVYAMPVFDSLESVLVKSLRFKPSNKLRFITRMLYVAVTMLTGMAIPFFGG  368

Query  503   llgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSI  324
             L+GFFGGFA APT++Y+PCI+WLIL KPK+F  SW +NW  IV G+LL +L+PIGGL SI
Sbjct  369   LMGFFGGFALAPTSFYLPCIIWLILYKPKRFSFSWIINWILIVFGVLLMLLSPIGGLRSI  428

Query  323   VKSAKTYHFYQ  291
             + SAK+Y  + 
Sbjct  429   ILSAKSYKMFS  439



>ref|XP_003637320.1| Lysine/histidine transporter, partial [Medicago truncatula]
Length=433

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/430 (65%), Positives = 337/430 (78%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA +  +DDWLPV + R  KWWYS FHN+TAMVGAG+L+LPYAMS+MGWGPG  ++I+SW
Sbjct  5     AARQKAIDDWLPVTASRKAKWWYSAFHNITAMVGAGVLTLPYAMSKMGWGPGSVILIMSW  64

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITL+TL+QMVEMHE VPG RFDRYHELGQ AFGPKLGL+I+VPQQ LVE+  CI YMVT
Sbjct  65    IITLFTLWQMVEMHEMVPGTRFDRYHELGQHAFGPKLGLYIIVPQQLLVEVGTCIAYMVT  124

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KKV E +C  C  I+ SY+I+IF+   F+    P+FNSIS VSL AA+MS++YST
Sbjct  125   GGKSLKKVQESICPTCTKIRTSYWIVIFASVNFVLCQCPSFNSISAVSLAAAVMSIAYST  184

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW ++L K      VDY  ++H   D +F FM A+G++AFSYAGHNVVLEIQATIPSTP
Sbjct  185   IAWVASLQKG-RQPGVDYSYKAHSLPDGMFNFMLAMGEVAFSYAGHNVVLEIQATIPSTP  243

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             D PSK AMWKGVV+AY+ VA+CY PVAF+GY   GN V DNIL+TL++P WLI  ANIFV
Sbjct  244   DQPSKIAMWKGVVVAYLGVAICYLPVAFVGYYIFGNTVDDNILITLQRPTWLIVTANIFV  303

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             +VHV+G YQV++M +FDM+ETF VK L F P  TLRFV R  FVAFT+ VGI +PFFG L
Sbjct  304   IVHVIGGYQVFSMPVFDMLETFLVKKLNFPPCFTLRFVARTTFVAFTMVVGICIPFFGSL  363

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGF GGFAFAPT+Y+IPCI+WL L KPK+FGLSW +NW  IV+G+LL +LAPIG L  I+
Sbjct  364   LGFLGGFAFAPTSYFIPCIIWLKLYKPKRFGLSWIINWVCIVLGVLLMVLAPIGSLRQII  423

Query  320   KSAKTYHFYQ  291
                K Y F+ 
Sbjct  424   LQFKDYKFFS  433



>ref|XP_004972971.1| PREDICTED: lysine histidine transporter 1-like isoform X3 [Setaria 
italica]
Length=446

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/440 (64%), Positives = 349/440 (79%), Gaps = 2/440 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
              Y     + +A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  8     SYSPAKDERSAKEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  67

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A++I+SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+
Sbjct  68    GIAVLIISWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEV  127

Query  1247  SLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
              + I+YMVTGG S+KK  +++C   CK IK +Y+I+IF+   F+ S LPNFNSIS VSL 
Sbjct  128   GVNIVYMVTGGKSLKKFHDVICDGKCKDIKTTYFIMIFASVHFVLSQLPNFNSISGVSLA  187

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AA+MS+SYSTIAWG+++ K  +   VDY  R+      VF F  ALGD+AF+YAGHNVVL
Sbjct  188   AAVMSLSYSTIAWGASVDKG-KLPDVDYHVRATTTPGKVFGFFGALGDVAFAYAGHNVVL  246

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP+ PSKK MWKGV++AY+VVA+CY+PVA IGY A GN+V DNIL+TL  P 
Sbjct  247   EIQATIPSTPEQPSKKPMWKGVIVAYIVVALCYFPVALIGYWAFGNKVDDNILITLNNPK  306

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLIA AN+ VV+HV+GSYQ+YAM +FDM+ET  VK L F P  TLR + R ++VAFT+F+
Sbjct  307   WLIALANMMVVIHVIGSYQIYAMPVFDMMETVLVKKLHFPPGLTLRLIARTIYVAFTMFI  366

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
              I+ PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I++G+LL IL
Sbjct  367   AITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMIL  426

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             +PIGGL  I+  +KTY FY 
Sbjct  427   SPIGGLRQIIMDSKTYKFYS  446



>gb|KFK41172.1| hypothetical protein AALP_AA2G095000 [Arabis alpina]
Length=441

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/430 (66%), Positives = 350/430 (81%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +  +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV +MI+SW
Sbjct  13    SKQQKNVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVTVMIMSW  72

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              IT YT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YMVT
Sbjct  73    VITFYTIWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVEVGVNIVYMVT  132

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KK+ +LLC DCK I+ +Y+I+IFS   F+ S LPNFNS+S VSL AA+MS+SYST
Sbjct  133   GGKSLKKIHDLLCTDCKNIRTTYWIMIFSSIHFVLSHLPNFNSMSIVSLAAAVMSLSYST  192

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW ++++K ++   VDY  R+   +  VF F++ALGD+AF+YAGHNVVLEIQATIPSTP
Sbjct  193   IAWTASVNKGLQPD-VDYSFRATTSSGKVFNFLNALGDVAFAYAGHNVVLEIQATIPSTP  251

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MW+GVV+AY+VVA+CY+PVAF+ Y   GN V DNIL+TL  P WLI  AN FV
Sbjct  252   EKPSKIPMWRGVVVAYIVVAICYFPVAFVCYYIFGNNVDDNILMTLHNPKWLIVMANAFV  311

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             VVHV+GSYQ+YAM +FDM+ETF VK + F P   LRF+TR L+V FT+FV I +PFFGGL
Sbjct  312   VVHVIGSYQIYAMPVFDMLETFLVKKMMFPPCFQLRFITRTLYVGFTMFVAICIPFFGGL  371

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTYY+PCIMWLI+ KPKK+GLSW +NW  I++G++LTI+APIGG  +I+
Sbjct  372   LGFFGGFAFAPTTYYLPCIMWLIVKKPKKYGLSWSINWFCIIVGVILTIIAPIGGFRTII  431

Query  320   KSAKTYHFYQ  291
              SAK Y F+ 
Sbjct  432   ISAKDYKFFS  441



>ref|XP_009412996.1| PREDICTED: lysine histidine transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=449

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/429 (65%), Positives = 345/429 (80%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GW PG+ ++++SW 
Sbjct  22    AQEKSIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWAPGIVVLVVSWI  81

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V++ + I+YMVTG
Sbjct  82    ITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVVDVGVDIVYMVTG  141

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  EL+C DC PIK +Y+I+IF+    + S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  142   GKSLKKFHELVCPDCTPIKQTYFIIIFASVHLVLSQLPNFNSISGVSLAAAVMSLSYSTI  201

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AWG++  K  ++  V+YG R+      VF F+SALG++AF+YAGHNVVLEIQATIPSTP+
Sbjct  202   AWGASADKGKQAD-VEYGYRASSTAGTVFNFLSALGNVAFAYAGHNVVLEIQATIPSTPE  260

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSKK MWKGV++AY+VVA+CY+PVA +GY A GN V DNIL+TL KP WLIA AN+FVV
Sbjct  261   KPSKKPMWKGVIVAYIVVALCYFPVALVGYWAFGNAVKDNILITLNKPRWLIAMANMFVV  320

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             VHV+GSYQ+YAM +FDM+ET  VK L F P  TLR + R ++VAFT+F+ I+ PFFGGLL
Sbjct  321   VHVIGSYQIYAMPVFDMMETVLVKKLHFPPGLTLRLIARTVYVAFTMFIAITFPFFGGLL  380

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PC +WL + KP++F  SW  NW  I++GI+L IL+PIGGL  I+ 
Sbjct  381   GFFGGFAFAPTTYFVPCTIWLAIYKPRRFSFSWITNWICIILGIMLMILSPIGGLRQIIL  440

Query  317   SAKTYHFYQ  291
              A+ Y FY 
Sbjct  441   EAQDYSFYS  449



>gb|KEH20551.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=436

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/430 (65%), Positives = 337/430 (78%), Gaps = 1/430 (0%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             AA +  +DDWLPV + R  KWWYS FHN+TAMVGAG+L+LPYAMS+MGWGPG  ++I+SW
Sbjct  8     AARQKAIDDWLPVTASRKAKWWYSAFHNITAMVGAGVLTLPYAMSKMGWGPGSVILIMSW  67

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITL+TL+QMVEMHE VPG RFDRYHELGQ AFGPKLGL+I+VPQQ LVE+  CI YMVT
Sbjct  68    IITLFTLWQMVEMHEMVPGTRFDRYHELGQHAFGPKLGLYIIVPQQLLVEVGTCIAYMVT  127

Query  1220  GGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
             GG S+KKV E +C  C  I+ SY+I+IF+   F+    P+FNSIS VSL AA+MS++YST
Sbjct  128   GGKSLKKVQESICPTCTKIRTSYWIVIFASVNFVLCQCPSFNSISAVSLAAAVMSIAYST  187

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW ++L K      VDY  ++H   D +F FM A+G++AFSYAGHNVVLEIQATIPSTP
Sbjct  188   IAWVASLQKG-RQPGVDYSYKAHSLPDGMFNFMLAMGEVAFSYAGHNVVLEIQATIPSTP  246

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             D PSK AMWKGVV+AY+ VA+CY PVAF+GY   GN V DNIL+TL++P WLI  ANIFV
Sbjct  247   DQPSKIAMWKGVVVAYLGVAICYLPVAFVGYYIFGNTVDDNILITLQRPTWLIVTANIFV  306

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             +VHV+G YQV++M +FDM+ETF VK L F P  TLRFV R  FVAFT+ VGI +PFFG L
Sbjct  307   IVHVIGGYQVFSMPVFDMLETFLVKKLNFPPCFTLRFVARTTFVAFTMVVGICIPFFGSL  366

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGF GGFAFAPT+Y+IPCI+WL L KPK+FGLSW +NW  IV+G+LL +LAPIG L  I+
Sbjct  367   LGFLGGFAFAPTSYFIPCIIWLKLYKPKRFGLSWIINWVCIVLGVLLMVLAPIGSLRQII  426

Query  320   KSAKTYHFYQ  291
                K Y F+ 
Sbjct  427   LQFKDYKFFS  436



>ref|XP_006469985.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Citrus 
sinensis]
Length=450

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/428 (67%), Positives = 353/428 (82%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV ++ILSW I
Sbjct  24    KQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVVILILSWTI  83

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             T YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+ + I+YMVTGG
Sbjct  84    TFYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLICEVGVDIVYMVTGG  143

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++KV +L+C+  KPIK +Y+I+IF+   F+ + LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  144   KSLQKVHDLVCNGRKPIKTTYFIMIFASVHFVLAHLPNFNSISGVSLAAAVMSLSYSTIA  203

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++HK  + + V+YG ++   +  VF F +ALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  204   WSASVHKGKQPN-VEYGYKATTTSGTVFDFFTALGDVAFAYAGHNVVLEIQATIPSTPEK  262

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVVIAY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLI AAN+FVVV
Sbjct  263   PSKGPMWRGVVIAYIVVALCYFPVALVGYYVFGNIVEDNILISLDKPTWLIVAANMFVVV  322

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  V  L FKP+  LRF+TRNL+VAFT+FV I+ PFFGGLLG
Sbjct  323   HVIGSYQLYAMPVFDMIETVMVTKLHFKPSGLLRFITRNLYVAFTMFVAITFPFFGGLLG  382

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KPKKF LSWC NW  I++G+LL IL+PIGGL +I+KS
Sbjct  383   FFGGFAFAPTTYFLPCIMWLAIYKPKKFSLSWCTNWICIILGLLLMILSPIGGLRNIIKS  442

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  443   AKHYKFYS  450



>ref|XP_006469984.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Citrus 
sinensis]
Length=453

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/427 (67%), Positives = 353/427 (83%), Gaps = 1/427 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV ++ILSW I
Sbjct  27    KQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVVILILSWTI  86

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             T YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+ + I+YMVTGG
Sbjct  87    TFYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLICEVGVDIVYMVTGG  146

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++KV +L+C+  KPIK +Y+I+IF+   F+ + LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  147   KSLQKVHDLVCNGRKPIKTTYFIMIFASVHFVLAHLPNFNSISGVSLAAAVMSLSYSTIA  206

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++HK  + + V+YG ++   +  VF F +ALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  207   WSASVHKGKQPN-VEYGYKATTTSGTVFDFFTALGDVAFAYAGHNVVLEIQATIPSTPEK  265

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVVIAY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLI AAN+FVVV
Sbjct  266   PSKGPMWRGVVIAYIVVALCYFPVALVGYYVFGNIVEDNILISLDKPTWLIVAANMFVVV  325

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  V  L FKP+  LRF+TRNL+VAFT+FV I+ PFFGGLLG
Sbjct  326   HVIGSYQLYAMPVFDMIETVMVTKLHFKPSGLLRFITRNLYVAFTMFVAITFPFFGGLLG  385

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KPKKF LSWC NW  I++G+LL IL+PIGGL +I+KS
Sbjct  386   FFGGFAFAPTTYFLPCIMWLAIYKPKKFSLSWCTNWICIILGLLLMILSPIGGLRNIIKS  445

Query  314   AKTYHFY  294
             AK Y FY
Sbjct  446   AKHYKFY  452



>ref|XP_010034657.1| PREDICTED: lysine histidine transporter 1-like [Eucalyptus grandis]
 gb|KCW53003.1| hypothetical protein EUGRSUZ_J02303 [Eucalyptus grandis]
Length=442

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/429 (67%), Positives = 351/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ S R+ KWW STFHNVTAMVGAG+LSLPYAM+ +GWGPGV ++ILSW 
Sbjct  15    AKQKEIDDWLPITSSRNAKWWSSTFHNVTAMVGAGVLSLPYAMAHLGWGPGVVILILSWI  74

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+ + I+YMVTG
Sbjct  75    ITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLVVEVGVDIVYMVTG  134

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K+  L   + K IK SY+I+IF+  QF+ + LPNFNSIS VSL AA+MS+SYS I
Sbjct  135   GKSLQKIYNLAQPNGKYIKTSYFIMIFASAQFVLAHLPNFNSISMVSLAAAVMSLSYSII  194

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             A G+++ K +E H VDYGP S      VF F++ALGD+AF+YAGHNVVLEIQAT+PSTP+
Sbjct  195   ASGASISKGVE-HNVDYGPPSSTTPGKVFGFLTALGDVAFAYAGHNVVLEIQATLPSTPE  253

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSK  MWKGVV AY+VVA+CY+PVA IGY   GN+V DNIL++LEKP WLI  AN FVV
Sbjct  254   KPSKGPMWKGVVFAYIVVALCYFPVALIGYWVFGNKVKDNILISLEKPTWLIIVANAFVV  313

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             +HV+GSYQ+YAM +FDMIET  VK L FKP++ LRFV+RN +VAFT+FVGI+ PFFGGLL
Sbjct  314   IHVIGSYQLYAMPVFDMIETVLVKKLHFKPSRMLRFVSRNTYVAFTMFVGITFPFFGGLL  373

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFAFAPTTY++PC+MWL + KP++F LSW  NW  IV+G+LL +LAPIG L SI+ 
Sbjct  374   GFFGGFAFAPTTYFLPCVMWLAIYKPRRFSLSWYANWICIVLGVLLVVLAPIGALRSIII  433

Query  317   SAKTYHFYQ  291
             SAKTY FY 
Sbjct  434   SAKTYKFYS  442



>gb|KEH25432.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=455

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/436 (63%), Positives = 351/436 (81%), Gaps = 5/436 (1%)
 Frame = -1

Query  1586  KPAANKGE----VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             +P   K E    +D+WLP+ S+R+ KWWYS FHNVTAMVGAG+L LP+AM+++GWGPG+ 
Sbjct  21    RPIEEKSERDKRIDEWLPITSKRNAKWWYSAFHNVTAMVGAGVLGLPHAMAQLGWGPGIT  80

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             +++LSW IT YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + 
Sbjct  81    LLVLSWIITFYTLWQMVEMHEMVPGKRFDRYHELGQHAFGKKLGLYIVVPQQLVVEIGVN  140

Query  1238  IIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             I+YMVTGG+S++K  +++C  CK IKL+Y+I+IF+   F+ S LP+FNSIS VSL AA+M
Sbjct  141   IVYMVTGGTSLQKFHDIVCPSCKKIKLTYFIMIFASVHFVLSHLPDFNSISGVSLAAAVM  200

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S SYSTI+W ++L K  + + V YG ++H     VF F +ALG +AF+YAGHNVVLEIQA
Sbjct  201   SFSYSTISWAASLDKGKQEN-VQYGYKAHSTAGTVFDFFNALGTIAFAYAGHNVVLEIQA  259

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN+V  +IL++L+KP WLIA
Sbjct  260   TIPSTPEKPSKVPMWRGVVVAYIVVALCYFPVALIGYWIFGNEVDGDILISLQKPAWLIA  319

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              AN+FVV+HV+GSYQ+YAM +FDMIET  VK + F+P+  LRF+ RN++VAFT+F+ I+ 
Sbjct  320   TANMFVVIHVIGSYQIYAMPVFDMIETLLVKKMNFEPSTMLRFIVRNVYVAFTMFIAITF  379

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFF GLLGFFGGFAFAPTTY++PCIMWL + KP+KFGLSW  NW  IV+G+ L IL+PIG
Sbjct  380   PFFDGLLGFFGGFAFAPTTYFLPCIMWLSIYKPRKFGLSWWANWICIVLGVCLMILSPIG  439

Query  338   GLWSIVKSAKTYHFYQ  291
             GL +I+  AKTY FY 
Sbjct  440   GLRTIIIKAKTYKFYS  455



>ref|XP_004972966.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Setaria 
italica]
Length=480

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/437 (65%), Positives = 340/437 (78%), Gaps = 2/437 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             EG      K  V+DW  + S+R+ KWWY+ FHNVTAMVGAG+LSLP+AMSE+GWG G+ +
Sbjct  31    EGRWRPPEKPVVEDWRAINSRRNAKWWYAAFHNVTAMVGAGVLSLPFAMSELGWGVGITV  90

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSW IT+YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ L I
Sbjct  91    LVLSWIITVYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLWIVVPQQLVVEVGLNI  150

Query  1235  IYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             +YMVTGG S+KK  +++CHD CK IKL Y+I+IF+  QF+ S LPNF+SIS +SL+AA+M
Sbjct  151   VYMVTGGQSLKKFHDMVCHDRCKSIKLPYFIMIFASVQFVLSQLPNFHSISSISLVAAVM  210

Query  1058  SVSYSTIAW-GSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             SVSYS IAW  SA H    S  VDY  R+      VF F+  LGD+AF+YAGHNVVLEIQ
Sbjct  211   SVSYSAIAWIASADHHKKNSAEVDYNLRATTTPGKVFDFLGGLGDVAFTYAGHNVVLEIQ  270

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTPD PSKK MWKGVV+AY+++A CY+PVA +GY A GNQV +NIL+TL KP WLI
Sbjct  271   ATIPSTPDKPSKKPMWKGVVVAYIIIAACYFPVALVGYWAFGNQVDENILITLNKPKWLI  330

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
             A AN+ VVVHVVGSYQVYAM +FDMIET  VK   F P   LR + R ++VAFT+F+ ++
Sbjct  331   ALANMMVVVHVVGSYQVYAMPVFDMIETVLVKKFWFTPNLRLRLIARTVYVAFTMFIAMT  390

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
              PFF  LL FFGGFA+APTTY++PCI+WLI+ KPK+F LSW  NWT I IG+ L ILAPI
Sbjct  391   FPFFSELLSFFGGFAYAPTTYFLPCIIWLIICKPKRFSLSWFANWTCIFIGVPLMILAPI  450

Query  341   GGLWSIVKSAKTYHFYQ  291
             GGL  I+   KTY FYQ
Sbjct  451   GGLRQIILKVKTYKFYQ  467



>ref|XP_008379141.1| PREDICTED: lysine histidine transporter 1-like [Malus domestica]
Length=461

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/432 (61%), Positives = 350/432 (81%), Gaps = 1/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + A  + E++DWLP+ S R+  WWY+ FHNV +MVGAG+L LP+AMS +GWGPG  +M+L
Sbjct  31    EKARKQKEINDWLPITSSRNANWWYAAFHNVNSMVGAGVLGLPFAMSNLGWGPGCVVMVL  90

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITL+TL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I+YM
Sbjct  91    SWVITLFTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVCEVGVNILYM  150

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             VTGG S++K+ +++  D  PIKL+Y+I+IF+  +F+ S LPNFNSIS +SL AA+MS+SY
Sbjct  151   VTGGQSLQKIHKIVKKDKDPIKLTYFIMIFASVEFVLSHLPNFNSISGISLAAAVMSLSY  210

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             STIAW +++HK ++   V+YG  +   +  VF F +ALG +AF+YAGHNVVLEIQAT+P+
Sbjct  211   STIAWTTSIHKGVQPD-VEYGYIARSTSGTVFNFFNALGQVAFAYAGHNVVLEIQATLPT  269

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             +P+ PSK AMW+GVVIAY+VVA+CY+PVAFIGY   GN V DNIL++LEKP WLI  AN+
Sbjct  270   SPEKPSKYAMWRGVVIAYIVVALCYFPVAFIGYYTFGNTVEDNILISLEKPGWLIVTANM  329

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FV++H++G YQ++AM +FDM+ET  VK L F+PT  LRF+TRN++VAFT+ VG++ PFFG
Sbjct  330   FVIIHIIGGYQLFAMPVFDMMETVLVKKLNFRPTTKLRFITRNIYVAFTMVVGMTFPFFG  389

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             G++GF GGFA++PT+YY+PCI+WL + KP+KF LSW +NW  I++G+LL I++PIGGL +
Sbjct  390   GIMGFLGGFAYSPTSYYLPCIIWLAIKKPRKFSLSWFINWICIILGVLLMIVSPIGGLRN  449

Query  326   IVKSAKTYHFYQ  291
             I+  AK YHFY 
Sbjct  450   IILQAKEYHFYN  461



>ref|XP_006338803.1| PREDICTED: lysine histidine transporter 1-like [Solanum tuberosum]
Length=445

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/430 (66%), Positives = 348/430 (81%), Gaps = 3/430 (1%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + ++D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAM+E+GWGPGVA+M +SW I
Sbjct  17    EERKIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMAELGWGPGVAVMFISWVI  76

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGL+IVVPQQ +VE+ L I+YMVTGG
Sbjct  77    TLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGKKLGLYIVVPQQLVVEVGLDIVYMVTGG  136

Query  1214  SSIKKVVELLCH--DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
              S +K+ +L+C   +C  IKL+YYI+IF+   F+ S LPNFN+IS VSL+AAIMS+SY T
Sbjct  137   KSFQKIHDLVCTPGNCVEIKLTYYIMIFASVHFVLSHLPNFNAISGVSLIAAIMSLSYCT  196

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW ++L K ++   VDYG ++    + +F F   LG++AF+YAGHNVVLEIQATIPSTP
Sbjct  197   IAWVASLEKGVQPD-VDYGYKAKNTGEAIFNFFGGLGEVAFAYAGHNVVLEIQATIPSTP  255

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             D PSK  MWKGVV+AY VVA+CY+PVA IGY   GN VSDNIL++L KP WLI  AN FV
Sbjct  256   DKPSKGPMWKGVVVAYTVVALCYFPVALIGYYTFGNSVSDNILISLNKPTWLIVLANAFV  315

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             V+H++GSYQ+YA+ +FDM+ET+ VK  +FKPT  LRFVTRNL+VAFT+ VGI  PFFGGL
Sbjct  316   VIHIIGSYQLYAIPVFDMVETYLVKKRRFKPTWYLRFVTRNLYVAFTMIVGIIFPFFGGL  375

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTY++PCIMWL + KPKK+GLSW  NW  I++G+LLT+LAPIGGL +I+
Sbjct  376   LGFFGGFAFAPTTYFLPCIMWLSIYKPKKWGLSWTTNWICIILGVLLTVLAPIGGLRTII  435

Query  320   KSAKTYHFYQ  291
               AK Y F+ 
Sbjct  436   IQAKDYEFFS  445



>ref|XP_008799990.1| PREDICTED: lysine histidine transporter 1-like [Phoenix dactylifera]
Length=439

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/439 (64%), Positives = 345/439 (79%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D         A +  VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  2     DAGEHDKSQDAKEKSVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  61

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+
Sbjct  62    GVVVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLVVEV  121

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  +++C DCK IK++Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  122   GVNIVYMVTGGKSLKKFHDVVCPDCKNIKVTYFIMIFASLHFVLSQLPNFNSISGVSLAA  181

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAWG++  K      V+YG +        F F+SALGD+AF+YAGHNVVLE
Sbjct  182   AVMSLSYSTIAWGASAAKG-RQEDVEYGYKPSSTAGTFFNFLSALGDVAFAYAGHNVVLE  240

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPST + PSKK MWKGV++AY++VA+CY+PVA +GY A GN V DNIL+TLEKP W
Sbjct  241   IQATIPSTAEKPSKKPMWKGVIVAYIIVAICYFPVALVGYWAFGNGVEDNILITLEKPRW  300

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F P+  LR + R+++VAFT+F+ 
Sbjct  301   LIAMANMFVVIHVIGSYQIYAMPVFDMIETVLVKKLHFPPSLMLRLIARSVYVAFTMFIA  360

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I  PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP+    SW  NW  I++G+LL IL+
Sbjct  361   ICFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAICKPRPGSFSWITNWFCIILGVLLMILS  420

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL  I+  AKTY F+ 
Sbjct  421   PIGGLRQIIIQAKTYQFFS  439



>ref|XP_011071191.1| PREDICTED: lysine histidine transporter-like 2 [Sesamum indicum]
Length=437

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/429 (66%), Positives = 350/429 (82%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A +  +D+WLP+ + R+ KWW+S FHNVTAMVGAG+LSLPYA+S MGWGPGV ++ILSW+
Sbjct  10    AEERAIDEWLPITASRTAKWWHSAFHNVTAMVGAGVLSLPYAISNMGWGPGVVILILSWS  69

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITL+TL+QMVE+HE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VE+S CIIYMVTG
Sbjct  70    ITLFTLWQMVELHESVPGKRFDRYHELGQYAFGHKLGLYIVVPQQVVVEVSTCIIYMVTG  129

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S+KK  EL+C DC  I+L+Y+ILIF+   F+ S LPNF+SI+ +SL AA+MS+ YSTI
Sbjct  130   GKSLKKFHELVCPDCNEIRLTYFILIFASVHFVLSHLPNFHSITIISLAAAVMSLLYSTI  189

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW ++L +    + V Y  +    + NV  F SALGD+AF+YAGHNVVLEIQATIPSTP+
Sbjct  190   AWTASLAEGPRPN-VSYELKGRSTSANVLNFFSALGDIAFAYAGHNVVLEIQATIPSTPE  248

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
              PSKK MWKGVV AY++VA+CY P++   Y   GN V DN+LLTL+KP WLIAAANIFV+
Sbjct  249   KPSKKPMWKGVVFAYIIVAICYLPISLACYYVFGNSVDDNVLLTLQKPTWLIAAANIFVL  308

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             VHV+GSYQVYAM +FDM+ETF VK +KF P+  LRF TR L+VA T+F+G++ PFFGGLL
Sbjct  309   VHVIGSYQVYAMPVFDMMETFLVKKMKFSPSFLLRFTTRTLYVAITMFLGMTFPFFGGLL  368

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GFFGGFA APTTYY+PCI+WLI+ KP+KF LSW +NW  IVIGI+L ILAPIGGL +I+ 
Sbjct  369   GFFGGFALAPTTYYLPCIIWLIIRKPRKFSLSWWINWILIVIGIVLMILAPIGGLRNIII  428

Query  317   SAKTYHFYQ  291
             SAKTY FYQ
Sbjct  429   SAKTYKFYQ  437



>ref|XP_010105172.1| hypothetical protein L484_006910 [Morus notabilis]
 gb|EXC04018.1| hypothetical protein L484_006910 [Morus notabilis]
Length=450

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/434 (64%), Positives = 353/434 (81%), Gaps = 6/434 (1%)
 Frame = -1

Query  1580  AANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSW  1401
             +  + +++ WLP+ S R+ KWWYS FHNVTAMVGAG+L LP+AMSE+GWGPGV M+ILSW
Sbjct  17    SKEEEDLNKWLPITSNRNAKWWYSAFHNVTAMVGAGVLGLPFAMSELGWGPGVTMLILSW  76

Query  1400  AITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVT  1221
              ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+ + ++YM+T
Sbjct  77    LITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQLVVEVGVNVVYMIT  136

Query  1220  GGSSIKKVVELLCH-----DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             GG+SIKK+ ++LC+      CKP++ +Y+ +IF+   F+ S  PNFN+I+ +S+LAA+MS
Sbjct  137   GGNSIKKLHDILCNRFTNLHCKPMRGTYFTMIFAGVHFLLSHFPNFNAIASISVLAAVMS  196

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTI W ++LHK I    V YG R+   T NVF F+SALGD+AF++AGHNVVLEIQAT
Sbjct  197   LSYSTIGWAASLHKGIAPD-VQYGHRASTTTGNVFNFLSALGDVAFAFAGHNVVLEIQAT  255

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSKK MWKGV++AY VVA+CY+PVA IGYL  G++V DNIL++LEKP WLIA 
Sbjct  256   IPSTPEKPSKKPMWKGVLVAYAVVALCYFPVALIGYLVFGDKVEDNILISLEKPWWLIAI  315

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+GSYQVYAM +FDM+E+F V  +KFKP+  LRFVTR  +VAFT+F+ I+ P
Sbjct  316   ANLFVVIHVIGSYQVYAMPVFDMMESFLVLRMKFKPSFMLRFVTRTGYVAFTMFIAITFP  375

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFGGLLGFFGG AFAPTTY++PCIMWL + KPKK+GLSW  NW  I+ G+LL +LAPIG 
Sbjct  376   FFGGLLGFFGGLAFAPTTYFLPCIMWLAIYKPKKYGLSWITNWFCIIFGVLLMVLAPIGA  435

Query  335   LWSIVKSAKTYHFY  294
             L  I+  AK++ FY
Sbjct  436   LRQIILQAKSFKFY  449



>emb|CBI27567.3| unnamed protein product [Vitis vinifera]
Length=643

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/450 (62%), Positives = 345/450 (77%), Gaps = 11/450 (2%)
 Frame = -1

Query  1640  KMGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSL  1461
             KMG D + E         K A ++  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSL
Sbjct  205   KMGLDSQQE---------KDARDRA-IDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL  254

Query  1460  PYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLW  1281
             PYA++ +GWGPGV +++LSW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW
Sbjct  255   PYAVAGLGWGPGVVILVLSWIVTLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLW  314

Query  1280  IVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPN  1101
             IVVPQQ +VE+ + I YM+TGG S++K+   +C DCKPI+ +Y+I+IF+   F+ S LPN
Sbjct  315   IVVPQQVIVEVGVNIAYMITGGKSLRKLHNTVCPDCKPIRTTYFIMIFASCHFVLSHLPN  374

Query  1100  FNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMA  921
             FNSIS VS  AA MS++YSTIAW +++HK ++   V Y   +      VF F SALGD+A
Sbjct  375   FNSISGVSFAAAAMSLTYSTIAWTASVHKGVQPD-VQYSYTASTTAGRVFTFFSALGDVA  433

Query  920   FSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSD  741
             F+YAGHNVVLEIQATIPSTP+ PSK  MWKGVV AY+VVA+CY+PVA IGY   GN V+D
Sbjct  434   FAYAGHNVVLEIQATIPSTPEKPSKGPMWKGVVFAYIVVAICYFPVALIGYWMFGNSVAD  493

Query  740   NILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTR  561
             NIL+TLE P WLIAAAN+FVV+HV+GSYQ+YAM MFD++ET  VK LKF P   LR +TR
Sbjct  494   NILITLENPRWLIAAANMFVVIHVIGSYQIYAMPMFDLLETLLVKKLKFTPCFRLRLITR  553

Query  560   NLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTF  381
              L+VAFT+F+G+ +PFFG LLGF GG  FAPTTY++PCIMWL + KP++  LSW  NW  
Sbjct  554   TLYVAFTMFIGMLIPFFGSLLGFLGGLVFAPTTYFLPCIMWLAVYKPRRLSLSWFANWMC  613

Query  380   IVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             IV+GI+L ILAPIG L  I+  AKT+  + 
Sbjct  614   IVMGIILMILAPIGALRQIILQAKTFKLFS  643


 Score = 97.8 bits (242),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 100/207 (48%), Gaps = 54/207 (26%)
 Frame = -1

Query  1157  SYYILIFSVGQFIASFLPNFNSISFVSL----LAAIMSVSYSTIAWGSALHKWIESHAVD  990
              Y++L      FI S L +F SI+ VS     L  +   +YSTIAW + +HK ++   V 
Sbjct  28    EYFLLTNRSKSFIKSCL-SFESIAGVSKVDEWLRLLSICNYSTIAWTALVHKGVQPD-VQ  85

Query  989   YGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYV  810
             Y   +   T  VF F S LGD+AF+ AGHNVV                            
Sbjct  86    YTYTALTTTGRVFTFFSTLGDVAFANAGHNVV----------------------------  117

Query  809   VVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFD  630
                                 ++DNIL+TLEKP WLIAAAN+FV++HV+G Y   A  +FD
Sbjct  118   --------------------IADNILITLEKPCWLIAAANMFVIIHVIGRYHFAATPVFD  157

Query  629   MIETFCVKTLKFKPTKTLRFVTRNLFV  549
             M+ET  VK L F+P   L  +T  L+V
Sbjct  158   MLETLLVKKLNFRPCFRLPLITHTLYV  184



>ref|XP_004972969.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Setaria 
italica]
Length=492

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/433 (65%), Positives = 348/433 (80%), Gaps = 2/433 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGPG+A++I+
Sbjct  61    ERSAKEKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGPGIAVLII  120

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YM
Sbjct  121   SWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVNIVYM  180

Query  1226  VTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVS  1050
             VTGG S+KK  +++C   CK IK +Y+I+IF+   F+ S LPNFNSIS VSL AA+MS+S
Sbjct  181   VTGGKSLKKFHDVICDGKCKDIKTTYFIMIFASVHFVLSQLPNFNSISGVSLAAAVMSLS  240

Query  1049  YSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIP  870
             YSTIAWG+++ K  +   VDY  R+      VF F  ALGD+AF+YAGHNVVLEIQATIP
Sbjct  241   YSTIAWGASVDKG-KLPDVDYHVRATTTPGKVFGFFGALGDVAFAYAGHNVVLEIQATIP  299

Query  869   STPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAAN  690
             STP+ PSKK MWKGV++AY+VVA+CY+PVA IGY A GN+V DNIL+TL  P WLIA AN
Sbjct  300   STPEQPSKKPMWKGVIVAYIVVALCYFPVALIGYWAFGNKVDDNILITLNNPKWLIALAN  359

Query  689   IFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPff  510
             + VV+HV+GSYQ+YAM +FDM+ET  VK L F P  TLR + R ++VAFT+F+ I+ PFF
Sbjct  360   MMVVIHVIGSYQIYAMPVFDMMETVLVKKLHFPPGLTLRLIARTIYVAFTMFIAITFPFF  419

Query  509   ggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLW  330
             GGLLGFFGGFAFAPTTY++PCIMWL + KP++F LSW  NW  I++G+LL IL+PIGGL 
Sbjct  420   GGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRRFSLSWFTNWICIILGVLLMILSPIGGLR  479

Query  329   SIVKSAKTYHFYQ  291
              I+  +KTY FY 
Sbjct  480   QIIMDSKTYKFYS  492



>ref|XP_010033378.1| PREDICTED: lysine histidine transporter 1-like [Eucalyptus grandis]
 gb|KCW52999.1| hypothetical protein EUGRSUZ_J02299 [Eucalyptus grandis]
Length=466

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/435 (64%), Positives = 345/435 (79%), Gaps = 7/435 (2%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A + E+DDWLP+ + R  KWWYS FHNVTA+VGAG+LSLPYAMSE+GWGPGV +++LSW 
Sbjct  22    AKQKEIDDWLPITASRKAKWWYSAFHNVTAIVGAGVLSLPYAMSELGWGPGVGVLVLSWV  81

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITLYTL+QMVEMHE +PG+RFDRYHELGQ  FG KLGL+I+VPQQ +V++ + I+YMVTG
Sbjct  82    ITLYTLWQMVEMHEMIPGRRFDRYHELGQYVFGEKLGLYIMVPQQLVVQVGVNIVYMVTG  141

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G S++K    +C  CK +K +Y+I+IF+  QF+ S LPNFNSIS VSL AA+MS+SYSTI
Sbjct  142   GQSLEKFHNTVCPCCKKLKTTYFIMIFASVQFVLSHLPNFNSISGVSLTAAVMSLSYSTI  201

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNV------FMFMSALGDMAFSYAGHNVVLEIQAT  876
             AWG+++ K +    V Y  RS      V      F F SALG++AF+YAGHNVVLEIQAT
Sbjct  202   AWGASIEKGVLPD-VKYSYRSSTTAGKVTTAGKVFHFFSALGNVAFAYAGHNVVLEIQAT  260

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V DNIL++L+KP WLIA 
Sbjct  261   IPSTPEKPSKGPMWRGVIVAYIVVALCYFPVALIGYWVFGNSVDDNILVSLDKPRWLIAL  320

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+GS+QVYAM +FDMIE+  VK L FKPT TLRFV RN++VAFT+FV I+ P
Sbjct  321   ANMFVVIHVIGSFQVYAMPVFDMIESVLVKKLHFKPTGTLRFVARNVYVAFTMFVAITFP  380

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFG LL FFGGFAFAP+TY++PCIMWL + KP+KF LSW  NW  I++G+LL IL+PIGG
Sbjct  381   FFGELLSFFGGFAFAPSTYFLPCIMWLAIYKPRKFSLSWWSNWVCIIVGLLLMILSPIGG  440

Query  335   LWSIVKSAKTYHFYQ  291
             L  I+  AK YHFY 
Sbjct  441   LRQIIIKAKGYHFYS  455



>ref|XP_011097401.1| PREDICTED: lysine histidine transporter 1-like [Sesamum indicum]
Length=454

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/431 (62%), Positives = 344/431 (80%), Gaps = 1/431 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             + +  +  +DDWLP+ S R+ KWWYS+FHNVTA+VGAG+LSLPYAMS++GWGPGVA++++
Sbjct  22    ERSVEERAIDDWLPITSSRTAKWWYSSFHNVTAIVGAGVLSLPYAMSQLGWGPGVAVLVI  81

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW +TLY+L+QMVEMHE  PGKR DRYHELGQ AFG KLGLWIVVPQQ +VE+ + I+YM
Sbjct  82    SWIVTLYSLWQMVEMHEIAPGKRLDRYHELGQHAFGQKLGLWIVVPQQLIVEVGVDIVYM  141

Query  1226  VTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSY  1047
             +TGG S+KK  +L+C DCK I+L+Y+I+IF+   FI S LP+FNSIS VSL AA+MSVSY
Sbjct  142   ITGGQSLKKFHDLVCQDCKDIRLTYFIMIFASVHFILSQLPSFNSISGVSLAAAVMSVSY  201

Query  1046  STIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPS  867
             S IAWG+++ K ++   V YG +     D VF F SALG + F+Y GHNV +EIQAT+PS
Sbjct  202   SAIAWGASVDKGVQPD-VQYGYKPGSTADTVFDFFSALGIVVFAYGGHNVEMEIQATMPS  260

Query  866   TPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANI  687
             TP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V+DNIL+TLEKP WLIA AN+
Sbjct  261   TPEIPSKVPMWRGVIVAYIVVALCYFPVAIIGYWTFGNTVADNILITLEKPKWLIAMANM  320

Query  686   FvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffg  507
             FVV+H++GSYQVYAM +FDM+ET  VK LKF+PT  LRF++R+ +VAFT+F+ I+ PFF 
Sbjct  321   FVVIHLIGSYQVYAMAVFDMMETLLVKKLKFRPTWRLRFISRSTYVAFTMFIAITFPFFN  380

Query  506   gllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWS  327
             GLL FFGGFAFAPTTY++PCI+WL + KP++F LSW  NW  I+ G+LL I  PIGGL  
Sbjct  381   GLLAFFGGFAFAPTTYFLPCILWLAICKPRRFSLSWFTNWVCIIFGVLLMIAGPIGGLRQ  440

Query  326   IVKSAKTYHFY  294
             I+  AKTY  Y
Sbjct  441   IILQAKTYKIY  451



>ref|XP_007158719.1| hypothetical protein PHAVU_002G176400g [Phaseolus vulgaris]
 gb|ESW30713.1| hypothetical protein PHAVU_002G176400g [Phaseolus vulgaris]
Length=445

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/429 (64%), Positives = 340/429 (79%), Gaps = 1/429 (0%)
 Frame = -1

Query  1577  ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWA  1398
             A+   ++DWLPV + R+ KWWYS FHN+TAMVGAG+L+LPYAMS MGWGPG  +++LSW 
Sbjct  18    ADNNAINDWLPVTASRNAKWWYSAFHNLTAMVGAGVLTLPYAMSMMGWGPGTVILLLSWI  77

Query  1397  ITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTG  1218
             ITL+TL+QMVEMHE VPG RFDRYHELGQ AFG KLGL+IVVPQQ LVE+  CI+YMVTG
Sbjct  78    ITLFTLWQMVEMHEMVPGVRFDRYHELGQHAFGEKLGLYIVVPQQLLVEVGTCIVYMVTG  137

Query  1217  GSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTI  1038
             G+S+KK  + +C  C  I+ SY+I+IF       S  PNFNSIS VSL AA+MS++YSTI
Sbjct  138   GTSLKKFHQTVCPSCTNIRSSYWIVIFGSVNLALSLCPNFNSISAVSLAAAVMSITYSTI  197

Query  1037  AWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPD  858
             AW ++L + +    VDY  +++  TD VF FM A+GD+AFSYAGHNVV+EIQATIPSTP+
Sbjct  198   AWAASLKRGVLPD-VDYSFKANSDTDAVFNFMCAMGDVAFSYAGHNVVMEIQATIPSTPE  256

Query  857   NPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvv  678
             NPSKKAMWKGV++AY+ V  CY+PVAFIGY   GN V DNIL+TL+KP WLIAAAN+FV+
Sbjct  257   NPSKKAMWKGVIVAYLGVGFCYFPVAFIGYYVFGNTVDDNILITLDKPFWLIAAANMFVI  316

Query  677   vhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggll  498
             VHV+G YQV++M +FDM+ET  VK  KF P+ TLRFV R LFV  T+ +GI +PFFG LL
Sbjct  317   VHVIGGYQVFSMPVFDMMETLLVKQFKFPPSFTLRFVARTLFVVMTMLIGICIPFFGSLL  376

Query  497   gffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVK  318
             GF GGFAFAPT+Y++PCI+WL L KPK+F LSW +NWT IV+G++L ILAPIG L  I+ 
Sbjct  377   GFLGGFAFAPTSYFLPCIIWLKLYKPKRFRLSWIINWTCIVLGVMLMILAPIGALRKIII  436

Query  317   SAKTYHFYQ  291
             SA+ Y F+ 
Sbjct  437   SAEHYKFFS  445



>gb|KDP30960.1| hypothetical protein JCGZ_11336 [Jatropha curcas]
Length=442

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 345/442 (78%), Gaps = 1/442 (0%)
 Frame = -1

Query  1619  LEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEM  1440
             +E    + E +     +  ++DWLP+   R  KWWYS FHNVTAMVGAG+L LPYAMS++
Sbjct  1     MEEIQVEKEMSSEKQVEKTLNDWLPITKSRKAKWWYSAFHNVTAMVGAGVLGLPYAMSQL  60

Query  1439  GWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQA  1260
             GWGPG  +M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ 
Sbjct  61    GWGPGAVVMVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQL  120

Query  1259  LVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFV  1080
             +VE+ + I+YMVTGG S+KK  + +C DCK IK +Y+I+IF    F+ S LP+FNSI+ V
Sbjct  121   MVEVGVNIVYMVTGGKSLKKFHDTVCPDCKQIKTTYFIMIFGSVHFVLSHLPSFNSITAV  180

Query  1079  SLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHN  900
             S  AA+MS+SYSTI W ++ HK ++   V Y PR+   T  +F F SALGD+AF++AGHN
Sbjct  181   SFAAAVMSLSYSTIGWVASAHKGVQP-GVQYEPRASTSTGQLFGFFSALGDVAFAFAGHN  239

Query  899   VVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLE  720
             VVLEIQATIPSTP+ PSKK MWKGV+IAY+VVA+CY+PVAFIGYL  GN+V DNIL++LE
Sbjct  240   VVLEIQATIPSTPEKPSKKPMWKGVIIAYLVVALCYFPVAFIGYLVFGNKVEDNILISLE  299

Query  719   KPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFT  540
             KP WLIA AN+FVV+HV+GSYQ++A+ +FDM+E+F V  +K KP+  LRF+TR  +VA T
Sbjct  300   KPWWLIAVANLFVVIHVIGSYQIFAVPVFDMLESFLVLRMKLKPSLILRFMTRTSYVALT  359

Query  539   LFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILL  360
             +F+ ++ PFFGGLL FFGGFAFAPTTYY+PCIMWL + KP++F LSW  NW  I +G++L
Sbjct  360   MFLAMTFPFFGGLLSFFGGFAFAPTTYYLPCIMWLAIYKPRRFSLSWFANWVCISLGVIL  419

Query  359   TILAPIGGLWSIVKSAKTYHFY  294
              +LAPIG L  ++  AK + FY
Sbjct  420   MVLAPIGALRQLILQAKDFKFY  441



>ref|XP_007151556.1| hypothetical protein PHAVU_004G056700g [Phaseolus vulgaris]
 gb|ESW23550.1| hypothetical protein PHAVU_004G056700g [Phaseolus vulgaris]
Length=451

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/435 (64%), Positives = 357/435 (82%), Gaps = 1/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             +  + +  + ++DDWLP+ S+R+GKWWYS FHNVTAMVGAG+L LPYAMSE+GWGPGV +
Sbjct  18    KNTEKSEREKKIDDWLPITSKRNGKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGVTI  77

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             +ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + I
Sbjct  78    LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLVVEIGVNI  137

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG+S++K  + +C DCK IKL+Y+I+IF+   F+ S LP+FNSI+ VSL AA+MS
Sbjct  138   VYMVTGGTSLQKFHDTVCSDCKKIKLTYFIMIFASVHFVLSHLPDFNSITGVSLAAAVMS  197

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             +SYSTIAW +++ K ++ + V YG ++   +  VF F +ALG +AF+YAGHNVVLEIQAT
Sbjct  198   LSYSTIAWAASIEKGVQEN-VQYGYKAQSTSGTVFNFFNALGTVAFAYAGHNVVLEIQAT  256

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSK  MW+GVVIAY+VVA+CY+PVA IGY   GN+V  +IL++LEKP WLIA 
Sbjct  257   IPSTPEKPSKVPMWRGVVIAYIVVAVCYFPVALIGYWMFGNEVDSDILISLEKPAWLIAM  316

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             AN+FVV+HV+GSYQ+YAM +FDMIET  VK L F+P+  LRFV RN++VAFT+F+ I+ P
Sbjct  317   ANLFVVIHVIGSYQIYAMPVFDMIETVMVKKLNFEPSTMLRFVVRNVYVAFTMFIAITFP  376

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FF GLLGFFGGFAFAPTTY++PCIMWL++ KP++F LSW +NW  I++G+ L IL+PIGG
Sbjct  377   FFDGLLGFFGGFAFAPTTYFLPCIMWLVIHKPRRFSLSWFINWICIILGLCLMILSPIGG  436

Query  335   LWSIVKSAKTYHFYQ  291
             L +I+  AKTY FY 
Sbjct  437   LRTIIIKAKTYKFYS  451



>dbj|BAJ99236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/451 (63%), Positives = 350/451 (78%), Gaps = 16/451 (4%)
 Frame = -1

Query  1598  AEGAKPAAN--------------KGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSL  1461
             A G +PA N              + ++DDWLPV + R+GKWWYS FHNVTAMVGAG+L+L
Sbjct  7     AMGTRPAENHPHLPPKQDWRTVEERKIDDWLPVTASRNGKWWYSAFHNVTAMVGAGVLTL  66

Query  1460  PYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLW  1281
             PYAMSE+GWGPGVA+M LSW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG  LGLW
Sbjct  67    PYAMSELGWGPGVAVMTLSWIMTLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGETLGLW  126

Query  1280  IVVPQQALVEISLCIIYMVTGGSSIKKVVELLCHD-CKPIKLSYYILIFSVGQFIASFLP  1104
             IVVPQQ +VE+SL I+YM+TGG S+KK  +L+C D CK IKLSY+I+IF+  QF+ S LP
Sbjct  127   IVVPQQLVVEVSLDIVYMITGGKSLKKFHDLVCDDRCKDIKLSYFIMIFASAQFVISQLP  186

Query  1103  NFNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDM  924
             NF+SI+ +SL AA+MS+ YSTIAWG+++ K  ++  VDY  R+   +  VF F+  LG M
Sbjct  187   NFDSIATISLAAALMSICYSTIAWGASVGKG-KAEDVDYSLRASTTSGMVFDFLGGLGQM  245

Query  923   AFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVS  744
             AFS++GHNVVLEIQA+IPST + PSKK MWKGVV+AY +V +CY+PVAF+ Y A GN V 
Sbjct  246   AFSFSGHNVVLEIQASIPSTAETPSKKPMWKGVVVAYTIVLLCYFPVAFVCYWAFGNSVD  305

Query  743   DNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVT  564
             DNIL+TL  P WLIAAAN+ VVVHV+GSYQVYAM +FDM+E   V+ ++F P   LR V+
Sbjct  306   DNILITLNTPKWLIAAANMMVVVHVIGSYQVYAMPVFDMMEMVLVRKMRFSPGWKLRLVS  365

Query  563   RNLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWT  384
             R+LFVAFT+F+GI+ PFFGGL+GFFGG +FAPTTY++PCI+WL + KP+ F LSWC NW 
Sbjct  366   RSLFVAFTMFIGITFPFFGGLIGFFGGLSFAPTTYFLPCIIWLTVYKPRVFSLSWCANWF  425

Query  383   FIVIGILLTILAPIGGLWSIVKSAKTYHFYQ  291
              IV G+LL +L PIGGL  I+  AK Y FY 
Sbjct  426   CIVGGVLLMVLGPIGGLRQIIMEAKIYRFYS  456



>ref|XP_006351492.1| PREDICTED: lysine histidine transporter 2-like [Solanum tuberosum]
Length=439

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/442 (63%), Positives = 347/442 (79%), Gaps = 5/442 (1%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             EM   K E +K +     +  WLP+ S R+ KW+YS FHNVTAMVGAG+L LPYAMS++G
Sbjct  3     EMVKKKIESSKESI----ISAWLPITSSRNAKWYYSAFHNVTAMVGAGVLGLPYAMSQLG  58

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WG GV +M+L+W I+LYTL+QMV+MHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ L
Sbjct  59    WGVGVTVMVLAWVISLYTLWQMVQMHEMVPGKRFDRYHELGQEAFGEKLGLWIVVPQQLL  118

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S++K+ E  C +C P+K  Y+IL+F    F  SF PNFNSI+ +S
Sbjct  119   VEVGVNIVYMVTGGKSLQKIYETGCPNCHPLKTGYFILMFGCVHFFLSFCPNFNSITLIS  178

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
              LAA+MS+SYSTI WG+++HK I S  VDY PR+   T  VF  +SALGD+AF++AGHNV
Sbjct  179   FLAAVMSLSYSTIGWGASVHKGI-SPEVDYSPRASTSTGRVFGSLSALGDIAFAFAGHNV  237

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQAT+PSTP+ PSKK MWKGV+IAY+VVA+CY+PVAF+GY   GN V DNIL++L+K
Sbjct  238   VLEIQATMPSTPEKPSKKPMWKGVIIAYIVVAICYFPVAFVGYRVFGNSVEDNILISLQK  297

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN FVVVHV+GSYQV+AM +FDMIE++ VK   F PTKTLR + R  +VA T+
Sbjct  298   PAWLIIMANAFVVVHVIGSYQVFAMGVFDMIESYLVKQRNFNPTKTLRVIVRTGYVALTM  357

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             F+ IS PFFGGLLGFFGGFAFAPTTY++PCI+WLI+ KPK+FGLSW  NW  I++G+LL 
Sbjct  358   FLAISFPFFGGLLGFFGGFAFAPTTYFLPCIIWLIIYKPKRFGLSWFTNWICIILGVLLM  417

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             +L+PIG L  I+  AK Y F+ 
Sbjct  418   VLSPIGALRQIILQAKGYKFFS  439



>ref|XP_006304414.1| hypothetical protein CARUB_v10010989mg [Capsella rubella]
 gb|EOA37312.1| hypothetical protein CARUB_v10010989mg [Capsella rubella]
Length=453

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/439 (63%), Positives = 353/439 (80%), Gaps = 4/439 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D++ E  +    + E+DDWLP+ S R+ KWWYSTFHNVTAMVGAG+L LPY+M+++GWGP
Sbjct  19    DHRIEELE---RQKEIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLGLPYSMAQLGWGP  75

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+ ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+I+VPQQ +VE+
Sbjct  76    GITVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIVVEV  135

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+KK  EL+C DC PI+LS++++IF+   F+ S LPNF+SIS VSL+A
Sbjct  136   GVCIVYMVTGGQSLKKFHELVCKDCSPIRLSFFVMIFASSHFVLSHLPNFDSISGVSLVA  195

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW +   K ++   V YG +S      V  F + LG +AF+YAGHNVVLE
Sbjct  196   AVMSLSYSTIAWTATAAKGVQED-VQYGYKSGTPASTVLSFFTGLGGIAFAYAGHNVVLE  254

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+NPSK  MW+GVV+AYVVVA+CY+PVA +GY   GN V DN+L++LE PVW
Sbjct  255   IQATIPSTPNNPSKGPMWRGVVVAYVVVALCYFPVALVGYGVFGNAVLDNVLMSLETPVW  314

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
              IAAAN+FVV+HV+GSYQ++AM +FDM+ET+ VK L FKPT  LRFV RN++VA T+F+ 
Sbjct  315   AIAAANLFVVMHVIGSYQIFAMPVFDMVETYLVKKLNFKPTTILRFVVRNVYVALTMFIA  374

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I +PFFGGLL FFGGFAFAPTTY++PCIMWLI+ KPKKF LSW MNW  IV+G++L IL+
Sbjct  375   IMIPFFGGLLAFFGGFAFAPTTYFLPCIMWLIIYKPKKFSLSWWMNWVCIVLGVILMILS  434

Query  347   PIGGLWSIVKSAKTYHFYQ  291
              IGGL  I+  +K Y F+ 
Sbjct  435   SIGGLRQIIIQSKDYSFFS  453



>ref|XP_004233593.1| PREDICTED: lysine histidine transporter 1-like [Solanum lycopersicum]
Length=445

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/430 (65%), Positives = 347/430 (81%), Gaps = 3/430 (1%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + ++D+WLP+ S R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWGPGVA+M +SW I
Sbjct  17    EQKKIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGVAVMFISWVI  76

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ  FG KLGL+IVVPQQ +VE+ L I+YMVTGG
Sbjct  77    TLYTLWQMVEMHEMVPGKRFDRYHELGQHVFGKKLGLYIVVPQQLVVEVGLDIVYMVTGG  136

Query  1214  SSIKKVVELLCH--DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYST  1041
              S +K+  L+C   +C  IKL+YYI+IF+   F+ S LPNFN+IS VSL+AAIMS+SY T
Sbjct  137   KSFQKIHNLVCTPGNCIEIKLTYYIMIFASVHFVLSHLPNFNAISGVSLIAAIMSLSYCT  196

Query  1040  IAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTP  861
             IAW ++L K +++  V+Y  R+    + +F F   LG++AF+YAGHNVVLEIQATIPSTP
Sbjct  197   IAWAASLEKGVQAD-VNYEYRAKNTGEAIFNFFGGLGEVAFAYAGHNVVLEIQATIPSTP  255

Query  860   DNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFv  681
             + PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN VSDNIL++L KP WLI  AN FV
Sbjct  256   EKPSKGPMWKGVVVAYIVVALCYFPVALIGYYTFGNSVSDNILISLNKPTWLIVLANAFV  315

Query  680   vvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggl  501
             V+H++GSYQ+YA+ +FDM+ET+ VK  +FKPT  LRF +RNL+VAFT+ VGI  PFFGGL
Sbjct  316   VIHIIGSYQLYAIPVFDMLETYLVKKRRFKPTWYLRFASRNLYVAFTMIVGIIFPFFGGL  375

Query  500   lgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIV  321
             LGFFGGFAFAPTTY++PCIMWL + KPKK+GLSW  NW  I++G+LLT+LAPIGGL +I+
Sbjct  376   LGFFGGFAFAPTTYFLPCIMWLSIYKPKKWGLSWTTNWICIILGVLLTVLAPIGGLRNII  435

Query  320   KSAKTYHFYQ  291
               AK Y F+ 
Sbjct  436   IQAKDYEFFS  445



>ref|XP_003553873.1| PREDICTED: lysine histidine transporter 1-like [Glycine max]
Length=451

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/433 (64%), Positives = 356/433 (82%), Gaps = 1/433 (0%)
 Frame = -1

Query  1589  AKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMI  1410
              + +  +  +D+WLP+ S+R+GKWWYS FHNVTAMVGAG+L LPYAMSE+GWGPGV ++I
Sbjct  20    TEKSERERRIDEWLPITSKRNGKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGPGVTILI  79

Query  1409  LSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIY  1230
             LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + I+Y
Sbjct  80    LSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGEKLGLYIVVPQQLVVEIGVNIVY  139

Query  1229  MVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVS  1050
             MVTGG+S+KK  + +C +CK IKL+++I+IF+   F+ S LP+FNSI+ VSL AA+MS+S
Sbjct  140   MVTGGTSLKKFHDTVCSNCKNIKLTFFIMIFASVHFVLSHLPDFNSITGVSLAAAVMSLS  199

Query  1049  YSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIP  870
             YSTIAW +++HK ++ + V YG ++   +  VF F +ALG +AF+YAGHNVVLEIQATIP
Sbjct  200   YSTIAWVASVHKGVQEN-VQYGYKAKSTSGTVFNFFNALGTVAFAYAGHNVVLEIQATIP  258

Query  869   STPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAAN  690
             STP+ PSK  MW+GVV+AY+VVA+CY+PVA IGY   GN+V  +IL++LEKP WLIA AN
Sbjct  259   STPEKPSKVPMWRGVVVAYIVVAICYFPVALIGYWMFGNEVDSDILISLEKPTWLIAMAN  318

Query  689   IFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPff  510
             +FVV+HV+GSYQ+YAM +FDMIET  VK L F+P++ LRFV RN++VAFT+F+ I+ PFF
Sbjct  319   LFVVIHVIGSYQIYAMPVFDMIETVMVKKLNFEPSRMLRFVVRNVYVAFTMFIAITFPFF  378

Query  509   ggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLW  330
              GLLGFFGGFAFAPTTY++PCIMWL + KPK++ LSW +NW  IV+G+ L IL+PIGGL 
Sbjct  379   DGLLGFFGGFAFAPTTYFLPCIMWLAIHKPKRYSLSWFINWICIVLGLCLMILSPIGGLR  438

Query  329   SIVKSAKTYHFYQ  291
             +I+  AKTY FY 
Sbjct  439   TIIIKAKTYEFYS  451



>ref|XP_010103180.1| hypothetical protein L484_006730 [Morus notabilis]
 gb|EXB94966.1| hypothetical protein L484_006730 [Morus notabilis]
Length=439

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/441 (63%), Positives = 348/441 (79%), Gaps = 2/441 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M D     ++   +K ++++WLP+ S R+ KWW+S FHNVTAMVGAG+LSLPYAMSE+GW
Sbjct  1     MTDTNEANSQSEKDK-KIENWLPITSSRNAKWWFSAFHNVTAMVGAGVLSLPYAMSELGW  59

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPGV ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +V
Sbjct  60    GPGVVILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVV  119

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YMVTGG S+KK  E +  +   +K SY+I+ F+   F+ + LPNF+SI  VS 
Sbjct  120   EVGVNIVYMVTGGKSMKKAHETIFPNIPHMKTSYWIVFFACIHFVLAHLPNFHSIRGVSF  179

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
             LAAIMS+SYSTIAW ++L K ++   VDY  RS  +      F + LG++AF+YAGHNVV
Sbjct  180   LAAIMSLSYSTIAWVASLDKGVQDD-VDYSYRSSTQAGTALNFFAGLGEVAFAYAGHNVV  238

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP+ PSK  MWKGV++AY+VVA+CY+PVA IGY   GN+V DNIL+TLE+P
Sbjct  239   LEIQATIPSTPEKPSKGPMWKGVMVAYIVVALCYFPVALIGYYIFGNKVDDNILITLEQP  298

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
              WLIAAANIFVVVHV+GSYQ+YAM +FDMIET  VK L FKP   LRF+TR L+VA T+ 
Sbjct  299   AWLIAAANIFVVVHVIGSYQIYAMPVFDMIETVLVKKLDFKPCFRLRFITRTLYVALTMI  358

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             + IS+PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  I++G++L +
Sbjct  359   IAISIPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWFANWICIILGLMLMV  418

Query  353   LAPIGGLWSIVKSAKTYHFYQ  291
             LAPIG L +I+ +AK+Y F+ 
Sbjct  419   LAPIGALRTIILNAKSYKFFS  439



>gb|AES68006.2| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=461

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/432 (65%), Positives = 351/432 (81%), Gaps = 2/432 (0%)
 Frame = -1

Query  1586  KPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMIL  1407
             K  A +  +DDWLP+ S R+ KWWY+ FHNVTAMVGAG+LSLP AM+ +GWGPGV ++IL
Sbjct  30    KRTAEQKAIDDWLPITSSRNAKWWYAAFHNVTAMVGAGVLSLPSAMASLGWGPGVVILIL  89

Query  1406  SWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYM  1227
             SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + E+ + I+YM
Sbjct  90    SWIITLYTLWQMVEMHEMVPGKRFDRYHELGQEAFGEKLGLWIVVPQQLICEVGVDIVYM  149

Query  1226  VTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVS  1050
             VTGG S++K+ +L+C  +CK +K +Y+I+IF+   FI + LPNFNSI+ +SL AAIMS+S
Sbjct  150   VTGGKSLQKIHDLVCKKNCKSMKTTYFIMIFASVHFILAHLPNFNSIAGISLAAAIMSLS  209

Query  1049  YSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIP  870
             YSTIAW ++L K ++   V YG ++   T  VF F SALGD+AF+YAGHNVVLEIQATIP
Sbjct  210   YSTIAWVASLKKGVQPD-VAYGYKATTPTGTVFNFFSALGDVAFAYAGHNVVLEIQATIP  268

Query  869   STPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAAN  690
             STP+ PSK  MW+GV++AY+VVA+CY+PVA IGY   GN V+DNIL +L KP WLI AAN
Sbjct  269   STPEKPSKGPMWRGVLLAYIVVALCYFPVALIGYWMFGNSVADNILTSLNKPTWLIVAAN  328

Query  689   IFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPff  510
             +FVV+HV+GSYQ+YAM +FDMIET  VK L+FKPT+ LRFV RN++VAFT+FVGI+ PFF
Sbjct  329   MFVVIHVIGSYQLYAMPVFDMIETVMVKKLRFKPTRLLRFVVRNVYVAFTMFVGITFPFF  388

Query  509   ggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLW  330
             G LLGFFGG AFAPTTY++PCIMWL + KPK+F LSW  NW  I++G+LL IL+PIGGL 
Sbjct  389   GALLGFFGGLAFAPTTYFLPCIMWLAIYKPKRFSLSWFTNWICIILGLLLMILSPIGGLR  448

Query  329   SIVKSAKTYHFY  294
              I+ +AK+Y FY
Sbjct  449   LIILNAKSYGFY  460



>ref|XP_004514799.1| PREDICTED: lysine histidine transporter 1-like [Cicer arietinum]
Length=451

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/435 (64%), Positives = 352/435 (81%), Gaps = 2/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             E  K +A +  +DDWLP+ S R+ KWWY+ FHNVTAMVGAG+LSLP AM+ +GWGPGVA+
Sbjct  17    EKEKRSAEQKAIDDWLPITSSRNAKWWYAAFHNVTAMVGAGVLSLPSAMANLGWGPGVAI  76

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             ++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + EI + +
Sbjct  77    LVLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQEAFGEKLGLWIVVPQQLICEIGVDV  136

Query  1235  IYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIM  1059
             +YMVTGG S++K+ +L+C  +C  +K +Y+I+IF+   F+ + LPNFNSI+ +SL AAIM
Sbjct  137   VYMVTGGKSLQKIHDLVCKKNCNSMKTTYFIMIFASVHFVLAHLPNFNSIAGISLAAAIM  196

Query  1058  SVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQA  879
             S+SYSTIAW +++ K ++   V YG ++      VF F SALGD+AF+YAGHNVVLEIQA
Sbjct  197   SLSYSTIAWVASVKKGVQQD-VQYGYKATTTPGTVFNFFSALGDVAFAYAGHNVVLEIQA  255

Query  878   TIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIA  699
             TIPSTP+ PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN V+DNIL +L KP WLI 
Sbjct  256   TIPSTPEKPSKGPMWKGVVLAYIVVALCYFPVALIGYWMFGNTVADNILTSLNKPTWLIV  315

Query  698   AANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISV  519
              AN+FVV+HV+GSYQ+YAM +FDMIET  VK ++FKPT+ LRFV RN++VAFT+FVGI+ 
Sbjct  316   TANMFVVIHVIGSYQLYAMPVFDMIETVMVKKMRFKPTRLLRFVVRNIYVAFTMFVGITF  375

Query  518   PffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIG  339
             PFFG LLGFFGGFAFAPTTY++PC+MWL + KPK+F LSW  NW  I++G+LL IL+PIG
Sbjct  376   PFFGALLGFFGGFAFAPTTYFLPCVMWLSIYKPKRFSLSWFTNWICIILGLLLMILSPIG  435

Query  338   GLWSIVKSAKTYHFY  294
             GL  I+ +AKTY FY
Sbjct  436   GLRQIILNAKTYGFY  450



>ref|XP_010479290.1| PREDICTED: lysine histidine transporter-like 1 [Camelina sativa]
Length=453

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/427 (64%), Positives = 347/427 (81%), Gaps = 1/427 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + E+DDWLP+ S R+ KWWYSTFHNVTAMVGAG+L LPY+M+++GWGPG+ ++ILSW I
Sbjct  27    RQKEIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLGLPYSMAQLGWGPGITVLILSWVI  86

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+I+VPQQ +VE+ +CI+YMVTGG
Sbjct  87    TLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIVVEVGVCIVYMVTGG  146

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  EL+C DC PI+LS++++IF+   F+ S LPNFNSIS VSL+AA+MS+SYSTIA
Sbjct  147   QSLKKFHELVCQDCSPIRLSFFVMIFASSHFVLSHLPNFNSISGVSLVAAVMSLSYSTIA  206

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +   K ++   V YG +S   +  V  F + LG +AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  207   WTTTAAKGVQED-VQYGYKSGTPSSTVLSFFTGLGGIAFAYAGHNVVLEIQATIPSTPNK  265

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVV+AYVVVA+CY+PVA +GY   GN V DN+L++LE PVW IAAAN+FVV+
Sbjct  266   PSKGPMWRGVVVAYVVVALCYFPVALVGYGVFGNAVLDNVLMSLETPVWTIAAANLFVVM  325

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ++AM +FDM+ETF VK L FKP+  LRF+ RN++VA T+F+ I +PFFGGLL 
Sbjct  326   HVIGSYQIFAMPVFDMVETFLVKKLNFKPSTILRFIVRNVYVALTMFIAIMIPFFGGLLA  385

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWLI+ KPK+F LSW  NW  IV+G++L IL+ IGGL  I+  
Sbjct  386   FFGGFAFAPTTYFLPCIMWLIIYKPKRFSLSWWTNWVCIVLGVILMILSSIGGLRQIIIQ  445

Query  314   AKTYHFY  294
             +K Y F+
Sbjct  446   SKDYTFF  452



>ref|XP_006338802.1| PREDICTED: lysine histidine transporter 1-like [Solanum tuberosum]
Length=437

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/437 (65%), Positives = 354/437 (81%), Gaps = 2/437 (0%)
 Frame = -1

Query  1598  AEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVA  1419
             ++G + +A + ++D+WLPV S R+ KWWYSTFHNVTAMVGAG+LSLPYAMS++GWGPGV 
Sbjct  2     SKGDERSAEERKIDEWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSLPYAMSQLGWGPGVT  61

Query  1418  MMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLC  1239
             ++++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+ + 
Sbjct  62    VLVISWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLIVEVGVD  121

Query  1238  IIYMVTGGSSIKKVVELLC-HDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAI  1062
             I+YMVTGG S+ K+ +L+C +DC  IKL Y+I+IF+   F  + LPN +SIS VSL AA+
Sbjct  122   IVYMVTGGRSLMKIHDLVCKNDCIKIKLKYFIMIFASVHFFLAQLPNLDSISSVSLAAAV  181

Query  1061  MSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQ  882
             MS+SYSTI W ++  K +E   VDY   +      VF F SALGD+AF+YAGHNVVLEIQ
Sbjct  182   MSLSYSTIGWAASAKKGVEPD-VDYSFTAKTNLGVVFNFFSALGDVAFAYAGHNVVLEIQ  240

Query  881   ATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLI  702
             ATIPSTPD  SK  MWKGVV+AY+VVA+CY+PVA +GY A GN V DNIL++LEKP WLI
Sbjct  241   ATIPSTPDKHSKGPMWKGVVVAYIVVAVCYFPVALVGYWAFGNSVEDNILISLEKPTWLI  300

Query  701   AAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGIS  522
               AN+FVV+HV+GSYQ+YAM +FDMIET  VK L+FKPT  LR +TR+++VAFT+FVGI+
Sbjct  301   VMANLFVVIHVIGSYQIYAMPVFDMIETLLVKKLRFKPTWYLRLITRSIYVAFTMFVGIA  360

Query  521   VPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPI  342
             +PFFGGLLGFFGGFAFAPTTY++PCIMWL + KPK+F LSW +NW  I++G+LL ILAPI
Sbjct  361   IPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPKRFSLSWMVNWICIILGVLLMILAPI  420

Query  341   GGLWSIVKSAKTYHFYQ  291
             G L SI+  AK Y F+ 
Sbjct  421   GALRSIILKAKGYKFFD  437



>ref|XP_002266410.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera]
 emb|CAN63351.1| hypothetical protein VITISV_024450 [Vitis vinifera]
 emb|CBI27552.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/435 (62%), Positives = 337/435 (77%), Gaps = 1/435 (0%)
 Frame = -1

Query  1595  EGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAM  1416
             E  + A+   ++D+WLP+ S R  KWWYS FHNVTAMVG+G+L+LPYAM+ +GWGPGV +
Sbjct  3     EDEQKASRGKDIDNWLPITSSRDAKWWYSAFHNVTAMVGSGVLALPYAMAGLGWGPGVVI  62

Query  1415  MILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCI  1236
             +ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+ + I
Sbjct  63    LILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQLVVEVGVDI  122

Query  1235  IYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMS  1056
             +YMVTGG S++K   ++C DC+ ++ +Y+I+IF+   F+ S LPNFNSIS VS  AA MS
Sbjct  123   VYMVTGGKSLQKFYNIVCSDCRRLRTTYFIMIFASCHFVLSHLPNFNSISGVSFSAAAMS  182

Query  1055  VSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQAT  876
             ++YSTIAW  + HK + +  VDY  +    T   F F  ALG++AF+YAGHNVVLEIQAT
Sbjct  183   LTYSTIAWIGSAHKGVVAD-VDYKYKDSTTTGKFFHFCHALGEVAFAYAGHNVVLEIQAT  241

Query  875   IPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAA  696
             IPSTP+ PSK  MWKGV+ AY++VA+CY+PVA +GY   GN V+DNIL+TLEKP WLIAA
Sbjct  242   IPSTPEKPSKGPMWKGVMFAYMIVAICYFPVALVGYRVFGNSVADNILITLEKPGWLIAA  301

Query  695   ANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVP  516
             ANIFVV+HVVGSYQ+YA+ +FDM+ET  VK LKF P   LR +TR  +VAFT+F+ + +P
Sbjct  302   ANIFVVIHVVGSYQIYAIPVFDMMETLLVKKLKFTPCFRLRLITRTSYVAFTMFIAMMIP  361

Query  515   ffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGG  336
             FFG L+ F GG AFAPTTY++PCIMWL + KPK F LSWC NW  IV+G++L ILAPIG 
Sbjct  362   FFGSLMAFLGGLAFAPTTYFLPCIMWLAVYKPKMFSLSWCSNWICIVLGVVLMILAPIGA  421

Query  335   LWSIVKSAKTYHFYQ  291
             L  I+  AKTY  + 
Sbjct  422   LRQIILQAKTYKLFS  436



>ref|XP_006447151.1| hypothetical protein CICLE_v10018030mg, partial [Citrus clementina]
 gb|ESR60391.1| hypothetical protein CICLE_v10018030mg, partial [Citrus clementina]
Length=443

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/435 (66%), Positives = 353/435 (81%), Gaps = 8/435 (2%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +GWGPGV ++ILSW I
Sbjct  10    KQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLGWGPGVVILILSWTI  69

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             T YTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ + E+ + I+YMVTGG
Sbjct  70    TFYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLICEVGVDIVYMVTGG  129

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S++KV +L+C+  KPIK +Y+I+IF+   F+ + LPNFNSIS VSL AA+MS+SYSTIA
Sbjct  130   KSLQKVHDLVCNGRKPIKTTYFIMIFASVHFVLAHLPNFNSISGVSLAAAVMSLSYSTIA  189

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +++HK  + + V+YG ++   +  VF F +ALGD+AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  190   WSASVHKGKQPN-VEYGYKATTTSGTVFDFFTALGDVAFAYAGHNVVLEIQATIPSTPEK  248

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVVIAY+VVA+CY+PVA +GY   GN V DNIL++L+KP WLI AAN+FVVV
Sbjct  249   PSKGPMWRGVVIAYIVVALCYFPVALVGYYVFGNIVEDNILISLDKPTWLIVAANMFVVV  308

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ+YAM +FDMIET  V  L FKP+  LRF+TRNL+VAFT+FV I+ PFFGGLLG
Sbjct  309   HVIGSYQLYAMPVFDMIETVMVTKLHFKPSGLLRFITRNLYVAFTMFVAITFPFFGGLLG  368

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWL + KPKKF LSWC NW  I++G+LL IL+PIGGL +I+KS
Sbjct  369   FFGGFAFAPTTYFLPCIMWLAIYKPKKFSLSWCTNWICIILGLLLMILSPIGGLRNIIKS  428

Query  314   -------AKTYHFYQ  291
                    AK Y FY 
Sbjct  429   LRTIIRNAKHYKFYS  443



>ref|XP_004972964.1| PREDICTED: lysine histidine transporter 1-like isoform X2 [Setaria 
italica]
Length=462

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/440 (62%), Positives = 341/440 (78%), Gaps = 1/440 (0%)
 Frame = -1

Query  1610  GDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWG  1431
             G   ++  +  A +  +DDWLP+ ++R+ KWWY+ FHNVTAMVGAG+LSLPYAMSE+GW 
Sbjct  24    GRTDSQEGRWRAQEKSIDDWLPINAKRNAKWWYAAFHNVTAMVGAGVLSLPYAMSELGWS  83

Query  1430  PGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVE  1251
              G+ ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE
Sbjct  84    AGITVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVE  143

Query  1250  ISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
             + L I+YMVTGG S++K  +++C DCK IKL+Y+I+IF+    + S LPNF+SIS VSL 
Sbjct  144   VGLNIVYMVTGGQSLQKFHDVVCPDCKHIKLTYFIMIFASAHLVLSQLPNFHSISGVSLA  203

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AA+MS+ YSTIAW ++  K  +S  VDY  R+      VF F  ALGD+AF+YAGHNVVL
Sbjct  204   AAVMSLCYSTIAWIASAAKG-KSAEVDYHLRATTTPGKVFGFFGALGDVAFAYAGHNVVL  262

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP  PSKK MWKGVV+AY+++A+CY+P + +GY A GNQV+DNIL+TL KP 
Sbjct  263   EIQATIPSTPGKPSKKPMWKGVVVAYIIIAICYFPASLVGYWAFGNQVNDNILITLNKPK  322

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLIA AN+ VVVH++G YQ+YAM +FDM+ET  V+   F P   LR + R  +VAFT+FV
Sbjct  323   WLIALANMMVVVHLLGGYQIYAMPVFDMLETVLVRKFWFPPGLMLRLIARTAYVAFTMFV  382

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
              I+ PFF  LL FFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  IV+G+LL +L
Sbjct  383   AITFPFFNELLSFFGGFAFAPTTYFLPCIMWLTVYKPKRFSLSWFTNWICIVLGVLLMVL  442

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             +PIGGL  I+  A+TY FYQ
Sbjct  443   SPIGGLRQIILKARTYKFYQ  462



>ref|XP_010500403.1| PREDICTED: lysine histidine transporter-like 1 [Camelina sativa]
Length=453

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/427 (64%), Positives = 346/427 (81%), Gaps = 1/427 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + E+DDWLP+ S R+ KWWYSTFHNVTAMVGAG+L LPY+M+++GWGPG+ ++ILSW I
Sbjct  27    RQKEIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLGLPYSMAQLGWGPGITVLILSWVI  86

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+I+VPQQ +VE+ +CI+YMVTGG
Sbjct  87    TLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIVVEVGVCIVYMVTGG  146

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  EL+C DC PI+LS++++IF+   F+ S LPNFNSIS +SL+AAIMS+SYSTIA
Sbjct  147   QSLKKFHELVCQDCSPIRLSFFVMIFASSHFVLSHLPNFNSISGISLVAAIMSLSYSTIA  206

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +   K ++   V YG +S      V  F + LG +AF+YAGHNVVLEIQATIPSTP+ 
Sbjct  207   WTATAAKGVQED-VQYGYKSGTPASTVLSFFTGLGGIAFAYAGHNVVLEIQATIPSTPNK  265

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVV+AYVVVA+CY+PVA +GY   GN V DN+L++LE PVW IAAAN+FVV+
Sbjct  266   PSKGPMWRGVVVAYVVVALCYFPVALVGYGVFGNAVLDNVLMSLETPVWAIAAANLFVVM  325

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ++AM +FDM+ETF VK L FKP+  LRF+ RN++VA T+F+ I +PFFGGLL 
Sbjct  326   HVIGSYQIFAMPVFDMVETFLVKKLNFKPSTILRFIVRNVYVALTMFIAIMIPFFGGLLA  385

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPTTY++PCIMWLI+ KPK+F LSW  NW  IV+G++L IL+ IGGL  I+  
Sbjct  386   FFGGFAFAPTTYFLPCIMWLIIYKPKRFSLSWWTNWVCIVLGVILMILSSIGGLRQIIIQ  445

Query  314   AKTYHFY  294
             +K Y F+
Sbjct  446   SKDYTFF  452



>gb|EMS62880.1| hypothetical protein TRIUR3_08614 [Triticum urartu]
Length=516

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/450 (62%), Positives = 348/450 (77%), Gaps = 2/450 (0%)
 Frame = -1

Query  1640  KMGFDRELEMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSL  1461
             + G  +  E   +K         + ++DDWLPV + R+GKWWYS FHNVTAMVGAG+L+L
Sbjct  67    EAGESQRREDDRFKDALDWRTVEERKIDDWLPVTASRNGKWWYSAFHNVTAMVGAGVLTL  126

Query  1460  PYAMSEMGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLW  1281
             PYAMSE+GWGPGVA+M LSW +TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG  LGLW
Sbjct  127   PYAMSELGWGPGVAVMTLSWMMTLYTLWQMVEMHEMVPGKRFDRYHELGQYAFGETLGLW  186

Query  1280  IVVPQQALVEISLCIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLP  1104
             IVVPQQ +VEISL I+YM+TGG S+KK  +L+C   CK IKLSY+I+IF+  QF+ S LP
Sbjct  187   IVVPQQLVVEISLDIVYMITGGKSLKKFHDLVCDGRCKDIKLSYFIMIFASAQFVISQLP  246

Query  1103  NFNSISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDM  924
             NF+SI+ +SL AA+MS+ YSTIAWG+++ K  ++  VDY  R+   +  VF F+  LG M
Sbjct  247   NFDSIATISLAAALMSICYSTIAWGASVDKG-KADDVDYSLRASTTSGMVFDFLGGLGQM  305

Query  923   AFSYAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVS  744
             AFS++GHNVVLEIQA+IPST + PSKK MWKG + AY +V +CY+PVAF+GY A GN V 
Sbjct  306   AFSFSGHNVVLEIQASIPSTEETPSKKPMWKGEIGAYTIVLLCYFPVAFVGYWAFGNSVD  365

Query  743   DNILLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVT  564
             DNIL+ L  P WLIAAAN+ VVVHV+GSYQVYAM +FDM+E   V+ ++F P   LR V+
Sbjct  366   DNILIPLNTPKWLIAAANMMVVVHVIGSYQVYAMPVFDMMEMVLVRKMRFSPGWKLRLVS  425

Query  563   RNLFVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWT  384
             R+LFVAFT+FVGI+ PFFGGL+GFFGG AFAPTTY++PCI+WL + KP+ F LSWC NW 
Sbjct  426   RSLFVAFTMFVGITFPFFGGLIGFFGGLAFAPTTYFLPCIIWLTVYKPRVFSLSWCANWF  485

Query  383   FIVIGILLTILAPIGGLWSIVKSAKTYHFY  294
              IV G+LL +L PIGGL  I+  AKTY FY
Sbjct  486   CIVGGVLLMVLGPIGGLRQIIMEAKTYQFY  515



>ref|XP_007037907.1| Lysine histidine transporter 1 [Theobroma cacao]
 gb|EOY22408.1| Lysine histidine transporter 1 [Theobroma cacao]
Length=472

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/438 (61%), Positives = 344/438 (79%), Gaps = 1/438 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             + + E    ++    ++DWLP+   R+ KWWYS FHNVTAMVGAG+L LPYAMSE+GWG 
Sbjct  35    ETQPETQDSSSKAETLNDWLPITKSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSELGWGA  94

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G  +M+LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ +VE+
Sbjct  95    GTVIMVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWVVVPQQLMVEV  154

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  + +C +C  I+ +Y+I+IF+   F+ S LP+FNSI+ VS  A
Sbjct  155   GVNIVYMVTGGKSLKKFHDTVCPNCTDIRTTYFIMIFASVHFVLSHLPSFNSITAVSFAA  214

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             AIMS SYSTIAW +++HK ++  +V+Y  R+      VF F SALGD+AF++AGHNVVLE
Sbjct  215   AIMSFSYSTIAWVASIHKGVQP-SVEYIERASTSAGQVFGFFSALGDVAFAFAGHNVVLE  273

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSKK MWKGV++AY+VVA+CY+PV+FIGY   GN V DNIL++LEKP W
Sbjct  274   IQATIPSTPEKPSKKPMWKGVIVAYIVVALCYFPVSFIGYWVFGNSVEDNILISLEKPAW  333

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             L+A AN+FVV+HV+GSYQV+AM +FDM E++ VK + F P+  LR +TR  +VA T+F+G
Sbjct  334   LVATANLFVVIHVIGSYQVFAMPVFDMAESYLVKRMHFTPSLMLRIITRTSYVALTMFLG  393

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             ++ PFFGGLL FFGGFAFAPT+YY+PCI+WL + KPK+F LSW  NWT I++G+LL ILA
Sbjct  394   MTFPFFGGLLSFFGGFAFAPTSYYLPCIIWLAIYKPKRFSLSWITNWTCIIVGVLLMILA  453

Query  347   PIGGLWSIVKSAKTYHFY  294
             PIG L  ++  +K + FY
Sbjct  454   PIGALRQLILQSKNFKFY  471



>ref|NP_001141364.1| uncharacterized protein LOC100273455 [Zea mays]
 gb|ACF86179.1| unknown [Zea mays]
 gb|ACF87692.1| unknown [Zea mays]
 gb|ACN28751.1| unknown [Zea mays]
 gb|AFW74416.1| LHT1 [Zea mays]
Length=452

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/446 (65%), Positives = 351/446 (79%), Gaps = 8/446 (2%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             +Y AE    +A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  8     NYPAEKDARSAREKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  67

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A++++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGLWIVVPQQ +VE+
Sbjct  68    GIAVLVVSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDRLGLWIVVPQQLVVEV  127

Query  1247  SLCIIYMVTGGSSIKKVVELL-------CHDCKPIKLSYYILIFSVGQFIASFLPNFNSI  1089
              + I+YMVTGG S+KK  ++L       C     IK +Y+I+IF+   F+ S LPNFNSI
Sbjct  128   GVNIVYMVTGGKSLKKFHDVLVCGDTGVCEGKDNIKTTYFIMIFASVHFVLSQLPNFNSI  187

Query  1088  SFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYA  909
             S VSL AA+MS+SYSTIAWG+++HK   S  VDY  R+      VF F  ALGD+AF+YA
Sbjct  188   SGVSLAAAVMSLSYSTIAWGASVHKGRMS-GVDYHLRATTTPGKVFGFFGALGDVAFAYA  246

Query  908   GHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILL  729
             GHNVVLEIQATIPSTPD PSKK MWKGVV+AYVVVA+CY+PVA IGY A GN V DNIL+
Sbjct  247   GHNVVLEIQATIPSTPDKPSKKPMWKGVVVAYVVVALCYFPVALIGYWAFGNTVEDNILI  306

Query  728   TLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFV  549
             TL KP WLIA AN+ VVVHV+GSYQ+YAM +FDMIET  VK L+F P  TLR + R L+V
Sbjct  307   TLSKPKWLIALANMMVVVHVIGSYQIYAMPVFDMIETVLVKKLRFPPGLTLRLIARTLYV  366

Query  548   AFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIG  369
             AFT+F+ I+ PFFGGLLGFFGGFAFAPTTY++PC+MWL + KPK+F LSW  NW  I++G
Sbjct  367   AFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPKRFSLSWLTNWMCIILG  426

Query  368   ILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +LL IL+PIGGL  I+  AKTY FY 
Sbjct  427   VLLMILSPIGGLRQIIMDAKTYQFYS  452



>ref|XP_007155522.1| hypothetical protein PHAVU_003G208900g [Phaseolus vulgaris]
 gb|ESW27516.1| hypothetical protein PHAVU_003G208900g [Phaseolus vulgaris]
Length=432

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/428 (62%), Positives = 335/428 (78%), Gaps = 1/428 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              +  ++DWLP+   R+ KWWYS FHNVTA+VGAG+L  PYAMSE+GWGPGV ++ILSW  
Sbjct  6     ERKNINDWLPITKSRNAKWWYSAFHNVTAVVGAGVLGFPYAMSELGWGPGVTILILSWIC  65

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYT +QM+EMHE  PGKR DRYHELGQ AFG KLGLWIVVPQQ +V+I + ++YM+TGG
Sbjct  66    TLYTAWQMIEMHEPEPGKRLDRYHELGQYAFGEKLGLWIVVPQQLMVQIGVNVVYMITGG  125

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
             +S+KK+ ++LC  C PI+ +Y+I+IF+  QF+ S LP+FNSI+ +S  AA+MS+SYSTIA
Sbjct  126   NSLKKIHDILCDGCSPIRRTYFIMIFAAVQFLLSHLPSFNSITVISFAAAVMSLSYSTIA  185

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W ++LH+ ++   V YG R      NVF F SALG +AF YAGHNVVLEIQATIPSTP+ 
Sbjct  186   WITSLHRGVQ-EGVQYGSRFSTDAGNVFGFFSALGTIAFGYAGHNVVLEIQATIPSTPEE  244

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSKKAMWKG+++AY+VVA+CY PVA  GY A GN V DNILL+LEKP WLI AANIFV V
Sbjct  245   PSKKAMWKGMIVAYIVVALCYIPVAVFGYWAFGNGVDDNILLSLEKPRWLIVAANIFVFV  304

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV GSYQV+ + +FD  E+F VK +KF+PT  LRF+TRN++V  TLF+G++ PFFGGLLG
Sbjct  305   HVTGSYQVFGVPVFDTCESFLVKKMKFQPTWYLRFITRNIYVLLTLFLGVTFPFFGGLLG  364

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGF FAPTTY++PC+MWL++  PK+F LSW  NW  I+ G+ L +LAPIG L  I+  
Sbjct  365   FFGGFVFAPTTYFLPCVMWLVIYTPKRFSLSWFANWFCIMFGMFLMVLAPIGALRQIIIE  424

Query  314   AKTYHFYQ  291
             AK Y FY 
Sbjct  425   AKDYKFYS  432



>ref|XP_004972963.1| PREDICTED: lysine histidine transporter 1-like isoform X1 [Setaria 
italica]
Length=467

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/440 (62%), Positives = 340/440 (77%), Gaps = 1/440 (0%)
 Frame = -1

Query  1610  GDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWG  1431
             G   ++  +  A +  +DDWLP+ ++R+ KWWY+ FHNVTAMVGAG+LSLPYAMSE+GW 
Sbjct  24    GRTDSQEGRWRAQEKSIDDWLPINAKRNAKWWYAAFHNVTAMVGAGVLSLPYAMSELGWE  83

Query  1430  PGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVE  1251
              G+ ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE
Sbjct  84    AGITVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLVVE  143

Query  1250  ISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLL  1071
             + L I+YMVTGG S++K  +++C DCK IKL+Y+I+IF+    + S LPNF+SIS VSL 
Sbjct  144   VGLNIVYMVTGGQSLQKFHDVVCPDCKHIKLTYFIMIFASAHLVLSQLPNFHSISGVSLA  203

Query  1070  AAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             AA+MS+ YSTIAW ++  K  +S  VDY  R+      VF F  ALGD+AF+YAGHNVVL
Sbjct  204   AAVMSLCYSTIAWIASAAKG-KSAEVDYHLRATTTPGKVFGFFGALGDVAFAYAGHNVVL  262

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPSTP  PSKK MWKGVV+AY+++A+CY+P + +GY A GNQV+DNIL+TL KP 
Sbjct  263   EIQATIPSTPGKPSKKPMWKGVVVAYIIIAICYFPASLVGYWAFGNQVNDNILITLNKPK  322

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLIA AN+ VVVH++G YQ+YAM +FDM+ET  V+   F P   LR + R  +VAFT+FV
Sbjct  323   WLIALANMMVVVHLLGGYQIYAMPVFDMLETVLVRKFWFPPGLMLRLIARTAYVAFTMFV  382

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
              I+ PFF  LL FFGGFAFAPTTY++PCIMWL + KPK+F LSW  NW  IVIG+LL +L
Sbjct  383   AITFPFFNELLSFFGGFAFAPTTYFLPCIMWLTVYKPKRFSLSWFTNWACIVIGVLLMVL  442

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             +PIGGL  I+   KTY FYQ
Sbjct  443   SPIGGLRQIILKIKTYKFYQ  462



>ref|NP_175297.2| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
 sp|Q9C733.2|LHTL1_ARATH RecName: Full=Lysine histidine transporter-like 1 [Arabidopsis 
thaliana]
 gb|AEE32332.1| transmembrane amino acid transporter family protein [Arabidopsis 
thaliana]
Length=453

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/427 (64%), Positives = 345/427 (81%), Gaps = 1/427 (0%)
 Frame = -1

Query  1574  NKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAI  1395
              + E+DDWLP+ S R+ KWWYSTFHNVTAMVGAG+L LP+ M+++GWGPG+A++ILSW I
Sbjct  27    RQKEIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLGLPFFMAQLGWGPGIAVLILSWII  86

Query  1394  TLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGG  1215
             TLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+I+VPQQ +VE+ +CI+YMVTGG
Sbjct  87    TLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIIVEVGVCIVYMVTGG  146

Query  1214  SSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIA  1035
              S+KK  E+ C DC PI+LS++I+IF+   F+ S LPNFNSIS VSL+AA+MS+SYSTIA
Sbjct  147   QSLKKFHEIACQDCSPIRLSFFIMIFASSHFVLSHLPNFNSISGVSLVAAVMSLSYSTIA  206

Query  1034  WGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDN  855
             W +   K ++   V YG +S      V  F + LG +AF+YAGHNVVLEIQATIPSTP N
Sbjct  207   WTATAAKGVQED-VQYGYKSGTTASTVLSFFTGLGGIAFAYAGHNVVLEIQATIPSTPSN  265

Query  854   PSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvv  675
             PSK  MW+GVV+AYVVVA+CY+PVA +GY   GN V DN+L++LE PVW IA AN+FVV+
Sbjct  266   PSKGPMWRGVVVAYVVVALCYFPVALVGYGVFGNAVLDNVLMSLETPVWAIATANLFVVM  325

Query  674   hvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllg  495
             HV+GSYQ++AM +FDM+ETF VK L FKP+  LRF+ RN++VA T+F+GI +PFFGGLL 
Sbjct  326   HVIGSYQIFAMPVFDMVETFLVKKLNFKPSTVLRFIVRNVYVALTMFIGIMIPFFGGLLA  385

Query  494   ffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKS  315
             FFGGFAFAPT+Y++PCIMWL++ KPK+F LSW  NW  IV+G++L IL+ IGGL  I+  
Sbjct  386   FFGGFAFAPTSYFLPCIMWLLIYKPKRFSLSWWTNWVCIVLGVVLMILSSIGGLRQIIIQ  445

Query  314   AKTYHFY  294
             +K Y F+
Sbjct  446   SKDYSFF  452



>ref|XP_002511233.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF51835.1| amino acid transporter, putative [Ricinus communis]
Length=440

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/440 (62%), Positives = 342/440 (78%), Gaps = 1/440 (0%)
 Frame = -1

Query  1613  MGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             M + + E +    +   ++DWLP+   R+ KWWYS FHNVTAMVGAG+L LPYAMS++GW
Sbjct  1     MAETQLEKSASTQHVKALNDWLPITKSRNAKWWYSAFHNVTAMVGAGVLGLPYAMSQLGW  60

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPG A+M+LSW ITLYTL+QMVEMHE   GKR DRYHELGQ AFG KLGLW+VVPQQ +V
Sbjct  61    GPGAAVMVLSWLITLYTLWQMVEMHETKEGKRLDRYHELGQHAFGEKLGLWVVVPQQLMV  120

Query  1253  EISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSL  1074
             E+ + I+YM+TGG S+KK V+ +  +   IK +Y+IL+F     + S LP+FNSI+ VSL
Sbjct  121   EVGVNIVYMITGGKSLKKFVDTVRPNGPDIKTTYFILMFGCVHLVLSHLPSFNSITGVSL  180

Query  1073  LAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVV  894
              AAIMS+SYSTIAW +++HK ++ H V Y PR    T  +F F SALGD+AF++AGHNVV
Sbjct  181   AAAIMSLSYSTIAWVASVHKGVQ-HDVQYTPRVSTSTGQMFSFFSALGDVAFAFAGHNVV  239

Query  893   LEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKP  714
             LEIQATIPSTP+ PSKK MWKGVV AY+VVA+CY+PVAF GY   GN+V DNIL++LEKP
Sbjct  240   LEIQATIPSTPEKPSKKPMWKGVVFAYIVVALCYFPVAFAGYWVFGNKVEDNILISLEKP  299

Query  713   VWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLF  534
              WL+AAANIFVVVHV+GSYQ++AM +FDM+E   V  + FKPT  LR VTR L+VA T+F
Sbjct  300   RWLVAAANIFVVVHVIGSYQIFAMPVFDMVEACLVLKMNFKPTMMLRIVTRTLYVALTMF  359

Query  533   VGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTI  354
             +G++ PFFGGLL FFGGFAFAPTTYY+PCI+WL + KPK+F LSW +NW  I +G++L +
Sbjct  360   LGMTFPFFGGLLSFFGGFAFAPTTYYLPCIIWLAIRKPKRFSLSWSINWICITVGVILMV  419

Query  353   LAPIGGLWSIVKSAKTYHFY  294
             LAPIG L  ++  AK + FY
Sbjct  420   LAPIGALRQLILQAKDFKFY  439



>ref|XP_004502326.1| PREDICTED: lysine histidine transporter 2-like [Cicer arietinum]
Length=446

 Score =   530 bits (1365),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 278/444 (63%), Positives = 348/444 (78%), Gaps = 5/444 (1%)
 Frame = -1

Query  1610  GDYKAEGAKPA----ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSE  1443
             GD K    K +    A +  +DDWLP+ + R+ KWWYS FHN+TAMVGAG+LSLPYAMS 
Sbjct  4     GDEKGHPEKCSSDVDARQKAIDDWLPITASRNAKWWYSAFHNLTAMVGAGVLSLPYAMSN  63

Query  1442  MGWGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQ  1263
             MGWGPG+ +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ
Sbjct  64    MGWGPGIVILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQEAFGEKLGLWIVVPQQ  123

Query  1262  ALVEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISF  1083
              +V++  CI+YMVTGG S+KKV + LC DCK I+ SY+I+IF+   F+ +  P+FNSIS 
Sbjct  124   VVVDVGTCIVYMVTGGKSLKKVHDTLCPDCKEIRTSYWIIIFASVNFVLAQSPDFNSISA  183

Query  1082  VSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGH  903
             +S  AA MS++YSTIAW +++ K +  + VDYGPRS   +DNVF F+SALGD+AF+YAGH
Sbjct  184   ISFSAAAMSLTYSTIAWTASVKKGVVPN-VDYGPRSTSTSDNVFNFLSALGDVAFAYAGH  242

Query  902   NVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTL  723
             NVVLEIQAT+PSTP+ PSKK MW+GV+ AY+ VA CY+PVA IGY   GN V DNIL+TL
Sbjct  243   NVVLEIQATMPSTPEVPSKKPMWRGVIFAYIGVAFCYFPVAVIGYYMFGNSVDDNILITL  302

Query  722   EKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAF  543
             + P WLIAAAN FVV+HV+G YQV+AM +FDM+ET  VK L F PT +LR + R ++VA 
Sbjct  303   KHPTWLIAAANFFVVIHVIGGYQVFAMPVFDMLETVLVKELDFAPTFSLRLIVRTIYVAL  362

Query  542   TLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGIL  363
             T+F GI +PFFG LLGF GGFAFAPTTY++PC++WL L KPKKFGLSW +NW  IV+G++
Sbjct  363   TMFTGICIPFFGSLLGFLGGFAFAPTTYFLPCVIWLKLKKPKKFGLSWIINWVCIVLGVI  422

Query  362   LTILAPIGGLWSIVKSAKTYHFYQ  291
             L  L+PIG + +I+  AK Y F+ 
Sbjct  423   LMTLSPIGAMRNIILQAKDYKFFS  446



>emb|CDY32547.1| BnaC02g17400D [Brassica napus]
Length=436

 Score =   529 bits (1363),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 284/442 (64%), Positives = 351/442 (79%), Gaps = 7/442 (2%)
 Frame = -1

Query  1613  MGDYKAEGAKPA-ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             MG+ +    + A A + +VDDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMS +G
Sbjct  1     MGENQLSTHEAASARQKKVDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSNLG  60

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +MI+SW IT YT++QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +
Sbjct  61    WGPGVTVMIMSWLITFYTIWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ + I+YMVTGG S+KK+ +LLC DCK I+ S++I+IF+   F+ S LPNFNSIS   
Sbjct  121   VEVGVNIVYMVTGGKSLKKIHDLLCTDCKEIRTSFWIMIFASVHFVLSHLPNFNSISVSP  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
              L       YSTIAWG+++ K ++   VDY  R+   +  VF FM+ALGD+AF+YAGHNV
Sbjct  181   SLQP-----YSTIAWGASVKKGVQPD-VDYTFRATTSSGKVFNFMNALGDVAFAYAGHNV  234

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTP+ PSK  MW+GVV+AY+VVA+CY+PVAF+ Y   GN V DNIL++LEK
Sbjct  235   VLEIQATIPSTPEKPSKVPMWRGVVVAYIVVAICYFPVAFVCYYIFGNTVDDNILMSLEK  294

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             P WLI  AN FVV+HV+GSYQ++AM +FDM+ETF VK + F P+  LRF+TR  +VA T+
Sbjct  295   PTWLIVMANSFVVIHVIGSYQIFAMPVFDMLETFLVKQMMFDPSFKLRFITRTSYVALTM  354

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             F+GI +PFFGGLLGFFGGFAFAPTTYY+PCIMWLIL KPKK+GLSW +NW  IV+G+LLT
Sbjct  355   FIGICIPFFGGLLGFFGGFAFAPTTYYLPCIMWLILKKPKKYGLSWSLNWFCIVVGVLLT  414

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             I+APIGGL +I+ SA  Y F+ 
Sbjct  415   IVAPIGGLRTIIMSASDYKFFS  436



>ref|NP_001150973.1| LHT1 [Zea mays]
 gb|ACG41128.1| LHT1 [Zea mays]
Length=452

 Score =   530 bits (1364),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 291/446 (65%), Positives = 351/446 (79%), Gaps = 8/446 (2%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             +Y AE    +A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  8     NYPAEKDARSAREKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  67

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G+A++++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGLWIVVPQQ +VE+
Sbjct  68    GIAVLVVSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDRLGLWIVVPQQLVVEV  127

Query  1247  SLCIIYMVTGGSSIKKVVELL-------CHDCKPIKLSYYILIFSVGQFIASFLPNFNSI  1089
              + I+YMVTGG S+KK  ++L       C     IK +Y+I+IF+   F+ S LPNFNSI
Sbjct  128   GVNIVYMVTGGKSLKKFHDVLVCGDTGVCEGKDNIKTTYFIMIFASVHFVLSQLPNFNSI  187

Query  1088  SFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYA  909
             S VSL AA+MS+SYSTIAWG+++HK   S  VDY  R+      VF F  ALGD+AF+YA
Sbjct  188   SGVSLAAAVMSLSYSTIAWGASVHKGRMS-GVDYHLRATTTPGKVFGFFGALGDVAFAYA  246

Query  908   GHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILL  729
             GHNVVLEIQATIPSTPD PSKK MWKGVV+AYVVVA+CY+PVA IGY A G+ V DNIL+
Sbjct  247   GHNVVLEIQATIPSTPDKPSKKPMWKGVVVAYVVVALCYFPVALIGYWAFGSTVEDNILI  306

Query  728   TLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFV  549
             TL KP WLIA AN+ VVVHV+GSYQ+YAM +FDMIET  VK L+F P  TLR + R L+V
Sbjct  307   TLSKPKWLIALANMMVVVHVIGSYQIYAMPVFDMIETVLVKKLRFPPGLTLRLIARTLYV  366

Query  548   AFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIG  369
             AFT+F+ I+ PFFGGLLGFFGGFAFAPTTY++PC+MWL + KPK+F LSW  NW  I++G
Sbjct  367   AFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPKRFSLSWLTNWMCIILG  426

Query  368   ILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +LL IL+PIGGL  I+  AKTY FY 
Sbjct  427   VLLMILSPIGGLRQIIMEAKTYQFYS  452



>ref|XP_008647549.1| PREDICTED: uncharacterized protein LOC100273455 isoform X2 [Zea 
mays]
 gb|AFW74415.1| hypothetical protein ZEAMMB73_547648 [Zea mays]
Length=454

 Score =   530 bits (1364),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 293/448 (65%), Positives = 352/448 (79%), Gaps = 10/448 (2%)
 Frame = -1

Query  1607  DYKAEGAKPA--ANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGW  1434
             +Y AE  + A  A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GW
Sbjct  8     NYPAEKVQDARSAREKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGW  67

Query  1433  GPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALV  1254
             GPG+A++++SW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGLWIVVPQQ +V
Sbjct  68    GPGIAVLVVSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDRLGLWIVVPQQLVV  127

Query  1253  EISLCIIYMVTGGSSIKKVVELL-------CHDCKPIKLSYYILIFSVGQFIASFLPNFN  1095
             E+ + I+YMVTGG S+KK  ++L       C     IK +Y+I+IF+   F+ S LPNFN
Sbjct  128   EVGVNIVYMVTGGKSLKKFHDVLVCGDTGVCEGKDNIKTTYFIMIFASVHFVLSQLPNFN  187

Query  1094  SISFVSLLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFS  915
             SIS VSL AA+MS+SYSTIAWG+++HK   S  VDY  R+      VF F  ALGD+AF+
Sbjct  188   SISGVSLAAAVMSLSYSTIAWGASVHKGRMS-GVDYHLRATTTPGKVFGFFGALGDVAFA  246

Query  914   YAGHNVVLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNI  735
             YAGHNVVLEIQATIPSTPD PSKK MWKGVV+AYVVVA+CY+PVA IGY A GN V DNI
Sbjct  247   YAGHNVVLEIQATIPSTPDKPSKKPMWKGVVVAYVVVALCYFPVALIGYWAFGNTVEDNI  306

Query  734   LLTLEKPVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNL  555
             L+TL KP WLIA AN+ VVVHV+GSYQ+YAM +FDMIET  VK L+F P  TLR + R L
Sbjct  307   LITLSKPKWLIALANMMVVVHVIGSYQIYAMPVFDMIETVLVKKLRFPPGLTLRLIARTL  366

Query  554   FVAFTLFVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIV  375
             +VAFT+F+ I+ PFFGGLLGFFGGFAFAPTTY++PC+MWL + KPK+F LSW  NW  I+
Sbjct  367   YVAFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCVMWLAIYKPKRFSLSWLTNWMCII  426

Query  374   IGILLTILAPIGGLWSIVKSAKTYHFYQ  291
             +G+LL IL+PIGGL  I+  AKTY FY 
Sbjct  427   LGVLLMILSPIGGLRQIIMDAKTYQFYS  454



>ref|XP_006393375.1| hypothetical protein EUTSA_v10011468mg [Eutrema salsugineum]
 gb|ESQ30661.1| hypothetical protein EUTSA_v10011468mg [Eutrema salsugineum]
Length=453

 Score =   530 bits (1364),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 274/438 (63%), Positives = 349/438 (80%), Gaps = 4/438 (1%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D++ E  +    + E+DDWLP+ S R+ KWWYSTFHNVTAMVGAG+L+LPY+M+++GWGP
Sbjct  19    DHRIEELE---RQKEIDDWLPITSSRNAKWWYSTFHNVTAMVGAGVLALPYSMAQLGWGP  75

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             GV +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG +LGL+I+VPQQ +VE+
Sbjct  76    GVTVLLLSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQFAFGERLGLYIIVPQQIVVEV  135

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              +CI+YMVTGG S+K   EL+C DC PI+L+++I+IF+   F+ S LPN NSIS VSL+A
Sbjct  136   GVCIVYMVTGGQSLKNFHELVCQDCSPIRLTFFIMIFASSHFVLSHLPNLNSISLVSLVA  195

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAW +   K ++   V YG +       V  F + LG +AFSYAGHNVVLE
Sbjct  196   AVMSLSYSTIAWTATAAKGVQED-VQYGYKGSTIAATVLNFFTGLGGIAFSYAGHNVVLE  254

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP NPSK  MWKGVV+AYVVVA+CY+P+A +GY   GN VSDN+L++L+ PVW
Sbjct  255   IQATIPSTPSNPSKGPMWKGVVVAYVVVALCYFPLALVGYGVFGNDVSDNVLISLKTPVW  314

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
              IA AN+FVV+HV+GSYQ++AM +FDM+ETF VK L FKP+  LRFV RN++VA T+F+ 
Sbjct  315   AIALANLFVVMHVIGSYQIFAMPVFDMVETFLVKKLNFKPSSILRFVVRNVYVALTMFIA  374

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             I VPFFGGLL FFGGFAFAPTTY++PCIMWLI+ KPK+F LSW  NW  IV+G++L IL+
Sbjct  375   IMVPFFGGLLAFFGGFAFAPTTYFLPCIMWLIIYKPKRFSLSWWTNWVCIVLGVILMILS  434

Query  347   PIGGLWSIVKSAKTYHFY  294
              +GGL  I+  +K Y F+
Sbjct  435   SLGGLRQIIIQSKDYSFF  452



>ref|XP_007140887.1| hypothetical protein PHAVU_008G149800g [Phaseolus vulgaris]
 gb|ESW12881.1| hypothetical protein PHAVU_008G149800g [Phaseolus vulgaris]
Length=463

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 286/440 (65%), Positives = 350/440 (80%), Gaps = 3/440 (1%)
 Frame = -1

Query  1601  KAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGV  1422
             + E  K  A +  +DDWLP+ S R+GKWWYS FHNVTAMVGAG+LSLP AM+ +GWGPGV
Sbjct  24    EPEIDKRTAEQKAIDDWLPITSSRNGKWWYSAFHNVTAMVGAGVLSLPSAMANLGWGPGV  83

Query  1421  AMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISL  1242
              +++LSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ + EIS+
Sbjct  84    VILVLSWVITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLWIVVPQQLICEISV  143

Query  1241  CIIYMVTGGSSIKKVVELLCH-DCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAA  1065
              I+YMVTGG S++KV +LLC  +C  +K +Y+I+IF    F+ S LPNFN+IS +SL AA
Sbjct  144   DIVYMVTGGKSLQKVHDLLCKKNCNNMKTTYFIIIFGSVHFVLSHLPNFNAISGISLAAA  203

Query  1064  IMSVSYSTIAWGSALHKWIES--HAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVL  891
             IMS+SYSTIAW +++ K IE+    V+YG +        F F++ALGD+AF+YAGHNVVL
Sbjct  204   IMSLSYSTIAWVASVDKHIENPHREVEYGYKGSTSAGTFFNFLNALGDVAFAYAGHNVVL  263

Query  890   EIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPV  711
             EIQATIPS+P+ PSK  MW GV++AY VVA+CY+PVA IGY   GN V DNIL +L+KP 
Sbjct  264   EIQATIPSSPEKPSKGPMWWGVLVAYFVVALCYFPVALIGYWVFGNSVEDNILTSLDKPT  323

Query  710   WLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFV  531
             WLI  AN+FVVVHV+GSYQ+YAM +FDMIET  VK L+FKP+  LRFV RN++VAFTLFV
Sbjct  324   WLIVTANMFVVVHVIGSYQLYAMPVFDMIETLMVKQLRFKPSWWLRFVERNVYVAFTLFV  383

Query  530   GISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTIL  351
              I+ PFFG LLGFFGGFAFAPTTY++PC+MWL + KP+KF LSW  NW  I++G+LL IL
Sbjct  384   AITFPFFGSLLGFFGGFAFAPTTYFLPCVMWLAVYKPRKFSLSWITNWICIILGLLLMIL  443

Query  350   APIGGLWSIVKSAKTYHFYQ  291
             APIGGL SI+ +AK Y FYQ
Sbjct  444   APIGGLRSIILNAKAYGFYQ  463



>ref|XP_004236736.1| PREDICTED: lysine histidine transporter 2-like [Solanum lycopersicum]
Length=439

 Score =   529 bits (1362),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 269/424 (63%), Positives = 337/424 (79%), Gaps = 1/424 (0%)
 Frame = -1

Query  1562  VDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAITLYT  1383
             VDDWLP+ S R+ KW+YSTFHNVTAMVGAG+LSLPYAMS+MGW  G  +++ SW +TLYT
Sbjct  17    VDDWLPITSNRTAKWYYSTFHNVTAMVGAGVLSLPYAMSQMGWYWGGVVLLTSWVVTLYT  76

Query  1382  LYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGSSIK  1203
             L+QMVEMHE VPGKRFDRYHELGQ AFG KLGLW+VVPQQ  VE+ + I+YMVTGG S+K
Sbjct  77    LWQMVEMHEMVPGKRFDRYHELGQEAFGEKLGLWVVVPQQLTVEVGVNILYMVTGGKSLK  136

Query  1202  KVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAWGSA  1023
             K+ +  C  C P++ +Y+I+IF    F  S  PNFNSISFVS LAA+ S+SYSTI WG++
Sbjct  137   KIYDTACPTCSPLRTTYFIMIFGSVHFFLSHCPNFNSISFVSFLAAVTSLSYSTIGWGAS  196

Query  1022  LHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNPSKK  843
             +HK I S  V+YGPR+  +   +F    ALG++AF+YAGHNVVLEIQAT+PST + P KK
Sbjct  197   VHKGI-SPEVEYGPRASTQIGRMFNGFQALGEVAFAYAGHNVVLEIQATMPSTQEKPCKK  255

Query  842   AMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvhvVG  663
              MWKGV+ AY++VA+CY+PVAF+GY A GN V DNIL++LEKP WLI  AN FVV+HV+G
Sbjct  256   PMWKGVIGAYIIVAICYFPVAFVGYAAFGNTVEDNILISLEKPAWLIIMANAFVVIHVIG  315

Query  662   SYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllgffgg  483
             SYQ++AM +FDM+E++ VK LKF P+K LRF  R ++VA TLF+G++ PFFGGLL FFGG
Sbjct  316   SYQIFAMGVFDMVESYMVKGLKFAPSKILRFTVRTVYVALTLFLGMTFPFFGGLLSFFGG  375

Query  482   fafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKSAKTY  303
             FAFAPTTY++PCIMWL + KP++F LSW  NW  I+IG+LL +LAPIG L  ++  AKTY
Sbjct  376   FAFAPTTYFLPCIMWLAIYKPRRFSLSWWTNWICILIGVLLMVLAPIGALRHLILQAKTY  435

Query  302   HFYQ  291
              FY 
Sbjct  436   KFYS  439



>ref|XP_004489581.1| PREDICTED: uncharacterized protein LOC101496478 [Cicer arietinum]
Length=893

 Score =   545 bits (1403),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 276/426 (65%), Positives = 347/426 (81%), Gaps = 1/426 (0%)
 Frame = -1

Query  1571  KGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGPGVAMMILSWAIT  1392
             +  +D+WLP+ S+R+ KWWYS FHN+TAMVGAG+L LP+AMS++GWGPGV ++ILSW IT
Sbjct  468   EKRIDEWLPITSKRNAKWWYSAFHNITAMVGAGVLGLPHAMSQLGWGPGVTILILSWIIT  527

Query  1391  LYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEISLCIIYMVTGGS  1212
             LYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGL+IVVPQQ +VEI + I+YMVTGG+
Sbjct  528   LYTLWQMVEMHEMVPGKRFDRYHELGQHAFGKKLGLYIVVPQQLVVEIGVNIVYMVTGGT  587

Query  1211  SIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLAAIMSVSYSTIAW  1032
             S+KK  + +C +CK IKL+++I+IF+   F+ S LP+FNSIS VSL AAIMS SYSTI+W
Sbjct  588   SLKKFHDTVCPNCKNIKLTFFIMIFASVHFVLSHLPDFNSISGVSLAAAIMSFSYSTISW  647

Query  1031  GSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLEIQATIPSTPDNP  852
              +++ K ++   V+YG + H     VF F +ALG +AF+YAGHNVVLEIQATIPSTP  P
Sbjct  648   AASIDKGVQKD-VEYGYKPHSTAGTVFEFFNALGTIAFAYAGHNVVLEIQATIPSTPQKP  706

Query  851   SKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVWLIAAANIFvvvh  672
             SK  MW+GVV+AY+VVA+CY+PVA IGY   GN V  +IL++L+KP WLIA AN+FVV+H
Sbjct  707   SKVPMWRGVVVAYIVVALCYFPVALIGYWMFGNNVDSDILISLKKPTWLIAMANLFVVIH  766

Query  671   vVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVGISVPffggllgf  492
             V+GSYQ+YAM +FDMIET  VK LKF+P+K LRF+ RN++VA T+F+ I+ PFF GLLGF
Sbjct  767   VIGSYQIYAMPVFDMIETLLVKKLKFEPSKMLRFIVRNVYVALTMFIAITFPFFDGLLGF  826

Query  491   fggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILAPIGGLWSIVKSA  312
             FGGFAFAPTTY++PCIMWL + KPKKFGLSW  NW  I +G+ L IL+PIGGL +I+  A
Sbjct  827   FGGFAFAPTTYFLPCIMWLSIYKPKKFGLSWWCNWICIALGLCLMILSPIGGLRTIIIQA  886

Query  311   KTYHFY  294
             KTY FY
Sbjct  887   KTYKFY  892



>ref|XP_010932713.1| PREDICTED: lysine histidine transporter 1-like [Elaeis guineensis]
Length=439

 Score =   528 bits (1361),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 289/439 (66%), Positives = 346/439 (79%), Gaps = 1/439 (0%)
 Frame = -1

Query  1607  DYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMGWGP  1428
             D         A +  +DDWLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAMSE+GWGP
Sbjct  2     DAGVRDKPQEAKEKSIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGWGP  61

Query  1427  GVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQALVEI  1248
             G  ++ILSW ITLYTL+QMVEMHE VPGKRFDRYHELGQ AFG KLGLWIVVPQQ +VE+
Sbjct  62    GTVVLILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGDKLGLWIVVPQQLIVEV  121

Query  1247  SLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVSLLA  1068
              + I+YMVTGG S+KK  +++C DCK IKL+Y+I+IF+   F+ S LPNFNSIS VSL A
Sbjct  122   GVNIVYMVTGGKSLKKFHDVVCPDCKNIKLTYFIMIFASLHFVLSQLPNFNSISGVSLAA  181

Query  1067  AIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNVVLE  888
             A+MS+SYSTIAWG++  K  + H V+YG ++       F F+SALGD+AF+YAGHNVVLE
Sbjct  182   AVMSLSYSTIAWGASAAKGKQEH-VEYGYKASSTAGTFFNFLSALGDVAFAYAGHNVVLE  240

Query  887   IQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEKPVW  708
             IQATIPSTP+ PSKK MWKGVV+AY+VVA+CY+PVA IGY   GN V DNIL+TLEKP W
Sbjct  241   IQATIPSTPEKPSKKPMWKGVVVAYIVVAICYFPVALIGYWVFGNVVDDNILITLEKPRW  300

Query  707   LIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTLFVG  528
             LIA AN+ VVVHV+GSYQ+YAM +FDMIET  VK L F P   LR + R+++VAFT+FV 
Sbjct  301   LIAMANMMVVVHVIGSYQIYAMPVFDMIETVLVKKLHFPPGLMLRLIARSVYVAFTMFVA  360

Query  527   ISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLTILA  348
             IS PFFGGLLGFFGGFAFAPTTY++PCIMWL + KP+   LSW  NW  I+IG+LL IL+
Sbjct  361   ISFPFFGGLLGFFGGFAFAPTTYFLPCIMWLAIYKPRPGSLSWITNWFCIIIGVLLMILS  420

Query  347   PIGGLWSIVKSAKTYHFYQ  291
             PIGGL  I+  AK Y F+ 
Sbjct  421   PIGGLRQIIIQAKNYQFFS  439



>ref|XP_010425472.1| PREDICTED: lysine histidine transporter 1-like [Camelina sativa]
Length=441

 Score =   528 bits (1361),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 274/442 (62%), Positives = 345/442 (78%), Gaps = 7/442 (2%)
 Frame = -1

Query  1616  EMGDYKAEGAKPAANKGEVDDWLPVGSQRSGKWWYSTFHNVTAMVGAGILSLPYAMSEMG  1437
             ++  +  +  +  A + E+D WLP+ S R+ KWWYS FHNVTAMVGAG+LSLPYAM+++G
Sbjct  7     DVDSHTKDMDEKTAREKEIDAWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLG  66

Query  1436  WGPGVAMMILSWAITLYTLYQMVEMHECVPGKRFDRYHELGQAAFGPKLGLWIVVPQQAL  1257
             WGPGV +++LSW ITLYTL+QMVEM      +RFD YHELGQ AFG KLGL+IVVPQQ +
Sbjct  67    WGPGVVILVLSWIITLYTLWQMVEM------QRFDCYHELGQHAFGEKLGLYIVVPQQLI  120

Query  1256  VEISLCIIYMVTGGSSIKKVVELLCHDCKPIKLSYYILIFSVGQFIASFLPNFNSISFVS  1077
             VE+ +CI+YMVTGG S+KK  EL+C DCKPIKL+Y+I+IF+   F+ S LPNFNSIS VS
Sbjct  121   VEVGVCIVYMVTGGKSLKKFHELVCEDCKPIKLTYFIMIFASVHFVLSHLPNFNSISGVS  180

Query  1076  LLAAIMSVSYSTIAWGSALHKWIESHAVDYGPRSHKKTDNVFMFMSALGDMAFSYAGHNV  897
             L AA+MS+SYSTIAW ++  K ++ + V+YG ++      VF F S LG++AF+YAGHNV
Sbjct  181   LAAAVMSLSYSTIAWSASAAKGVQEN-VEYGYKAKSAAGTVFNFFSGLGEVAFAYAGHNV  239

Query  896   VLEIQATIPSTPDNPSKKAMWKGVVIAYVVVAMCYWPVAFIGYLALGNQVSDNILLTLEK  717
             VLEIQATIPSTPD PSK  MWKGVV+AY+VVA+CY+PVA IGY   GN V DNIL TL+K
Sbjct  240   VLEIQATIPSTPDKPSKGPMWKGVVVAYIVVALCYFPVALIGYWMFGNDVDDNILGTLKK  299

Query  716   PVWLIAAANIFvvvhvVGSYQVYAMLMFDMIETFCVKTLKFKPTKTLRFVTRNLFVAFTL  537
             PVWLIA AN+FVV+HV+GSYQ+YAM +FDM+ET  VK + F+P   LRFV RN +V  T+
Sbjct  300   PVWLIATANMFVVIHVIGSYQIYAMPVFDMMETLLVKKMNFRPNWFLRFVVRNFYVGKTM  359

Query  536   FVGISVPffggllgffggfafAPTTYYIPCIMWLILMKPKKFGLSWCMNWTFIVIGILLT  357
             FVG++ PFFGGLL FFGGFAFAPTTY++PC++WL + KP+++  SW  NW  IV GI L 
Sbjct  360   FVGMTFPFFGGLLAFFGGFAFAPTTYFLPCVIWLKIYKPRRYSFSWWTNWICIVFGIFLM  419

Query  356   ILAPIGGLWSIVKSAKTYHFYQ  291
             +L+PIGGL +IV  AK Y FY 
Sbjct  420   VLSPIGGLRTIVIQAKDYKFYS  441



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5038884546152