BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23525_g1_i2 len=2612 path=[5950:0-332 3012:333-358 3038:359-364
3044:365-404 3084:405-414 3094:415-431 @3111@!:432-1343
4176:1344-2611]

Length=2612
                                                                      Score     E

ref|XP_009616449.1|  PREDICTED: aminomethyltransferase, mitochond...    573   0.0      
ref|XP_009780010.1|  PREDICTED: aminomethyltransferase, mitochond...    572   0.0      
ref|XP_006349373.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    566   0.0      
ref|XP_004230488.2|  PREDICTED: aminomethyltransferase, mitochond...    563   0.0      
ref|XP_009355237.1|  PREDICTED: aminomethyltransferase, mitochond...    535   8e-179   
ref|XP_008378869.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    533   4e-178   
ref|XP_006431847.1|  hypothetical protein CICLE_v10001270mg             532   8e-178   
ref|XP_009616450.1|  PREDICTED: aminomethyltransferase, mitochond...    530   1e-177   
ref|XP_003525008.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    528   2e-176   
ref|XP_007222453.1|  hypothetical protein PRUPE_ppa006188mg             528   3e-176   
gb|KDO53498.1|  hypothetical protein CISIN_1g014411mg                   527   6e-176   
ref|XP_008218780.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    526   1e-175   
ref|XP_006471110.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    526   2e-175   
ref|XP_002269147.1|  PREDICTED: aminomethyltransferase, mitochond...    523   3e-174   Vitis vinifera
ref|XP_007159583.1|  hypothetical protein PHAVU_002G249600g             522   6e-174   
gb|KDP38853.1|  hypothetical protein JCGZ_05010                         523   7e-174   
ref|XP_010268964.1|  PREDICTED: aminomethyltransferase, mitochond...    520   4e-173   
ref|XP_007042607.1|  Glycine cleavage T-protein family isoform 1        520   6e-173   
gb|KHG18257.1|  gcvT                                                    516   1e-171   
ref|XP_011087736.1|  PREDICTED: uncharacterized protein LOC105169131    507   3e-168   
ref|XP_004140110.1|  PREDICTED: aminomethyltransferase-like             507   8e-168   
ref|XP_002529546.1|  fad oxidoreductase, putative                       506   8e-168   Ricinus communis
ref|XP_003629967.1|  Aminomethyltransferase                             505   2e-167   
gb|KHG18256.1|  gcvT                                                    505   6e-167   
gb|EYU26528.1|  hypothetical protein MIMGU_mgv1a007218mg                503   7e-167   
ref|XP_010473299.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    503   3e-166   
ref|XP_010065464.1|  PREDICTED: aminomethyltransferase, mitochond...    501   4e-166   
ref|XP_010418048.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    502   4e-166   
ref|XP_010430088.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    501   8e-166   
ref|XP_009616451.1|  PREDICTED: aminomethyltransferase, mitochond...    498   8e-166   
ref|XP_009780011.1|  PREDICTED: aminomethyltransferase, mitochond...    497   1e-165   
gb|AAS99703.1|  At1g60990                                               501   1e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302280.1|  hypothetical protein CARUB_v10020323mg             501   1e-165   
ref|XP_004299925.1|  PREDICTED: aminomethyltransferase-like             500   1e-165   
emb|CDO97559.1|  unnamed protein product                                501   2e-165   
ref|NP_176295.3|  plastidial, folate dependent Fe/S cluster bioge...    501   2e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504185.1|  PREDICTED: aminomethyltransferase-like             499   4e-165   
ref|XP_006392072.1|  hypothetical protein EUTSA_v10023478mg             498   8e-165   
ref|XP_002886571.1|  At1g60990                                          498   2e-164   
ref|XP_009104262.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    497   2e-164   
emb|CDY61991.1|  BnaAnng18080D                                          494   3e-163   
gb|AAG51655.1|AC018908_21  hypothetical protein; 60474-57856            492   5e-162   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54403.1|  BnaC01g43290D                                          491   5e-162   
ref|XP_010314734.1|  PREDICTED: aminomethyltransferase, mitochond...    486   3e-161   
ref|XP_009104253.1|  PREDICTED: uncharacterized protein LOC103830...    483   1e-158   
ref|XP_006838384.1|  hypothetical protein AMTR_s00002p00065920          483   1e-158   
ref|XP_010065468.1|  PREDICTED: aminomethyltransferase, mitochond...    478   2e-157   
ref|XP_010533963.1|  PREDICTED: aminomethyltransferase, mitochond...    474   9e-155   
ref|XP_007042608.1|  Glycine cleavage T-protein family isoform 2        465   3e-152   
ref|XP_010103913.1|  hypothetical protein L484_024217                   454   8e-148   
gb|KDO53499.1|  hypothetical protein CISIN_1g014411mg                   442   2e-144   
ref|XP_009391382.1|  PREDICTED: uncharacterized protein LOC103977...    439   7e-142   
ref|XP_009391384.1|  PREDICTED: uncharacterized protein LOC103977...    432   3e-139   
ref|XP_010065469.1|  PREDICTED: aminomethyltransferase, mitochond...    409   3e-131   
ref|XP_002975902.1|  hypothetical protein SELMODRAFT_104148             364   4e-114   
ref|XP_008449402.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    360   1e-111   
ref|XP_002968581.1|  hypothetical protein SELMODRAFT_89647              358   1e-111   
ref|XP_001781977.1|  predicted protein                                  355   1e-110   
gb|KDO53501.1|  hypothetical protein CISIN_1g014411mg                   308   3e-94    
ref|WP_015205323.1|  folate-binding protein YgfZ                        311   6e-94    
ref|WP_036002252.1|  glycine cleavage system protein T                  311   7e-94    
ref|XP_008449404.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    306   1e-92    
ref|WP_016875105.1|  glycine cleavage system protein T                  306   3e-92    
ref|XP_008449403.1|  PREDICTED: dimethylglycine dehydrogenase, mi...    306   4e-92    
ref|WP_015153296.1|  folate-binding protein YgfZ                        305   3e-91    
ref|WP_007355205.1|  MULTISPECIES: glycine cleavage system protein T    303   4e-91    
ref|WP_026731600.1|  glycine cleavage system protein T                  303   4e-91    
ref|WP_016865411.1|  glycine cleavage system protein T                  302   5e-91    
ref|WP_023067070.1|  glycine cleavage T-C-terminal barrel domain ...    303   5e-91    
ref|WP_009783188.1|  glycine cleavage system protein T                  303   6e-91    
ref|WP_015178777.1|  folate-binding protein YgfZ                        303   8e-91    
ref|WP_039717450.1|  glycine cleavage system protein T                  301   1e-90    
ref|WP_015187446.1|  folate-binding protein YgfZ                        302   1e-90    
ref|WP_012412717.1|  glycine cleavage system protein T                  301   2e-90    
ref|WP_038021131.1|  glycine cleavage system protein T                  300   3e-90    
ref|WP_009768178.1|  folate-binding protein YgfZ                        300   6e-90    
ref|WP_009756834.1|  MULTISPECIES: glycine cleavage system protein T    299   7e-90    
ref|WP_008190662.1|  glycine cleavage system protein T                  300   1e-89    
ref|WP_015184414.1|  folate-binding protein YgfZ                        299   2e-89    
ref|WP_027845356.1|  glycine cleavage system protein T                  298   3e-89    
ref|WP_006196170.1|  glycine cleavage system protein T                  297   5e-89    
ref|WP_006634110.1|  glycine cleavage system protein T                  297   1e-88    
ref|WP_006105963.1|  glycine cleavage system protein T                  296   2e-88    
ref|WP_026786268.1|  MULTISPECIES: glycine cleavage system protein T    296   2e-88    
gb|KEI68493.1|  GcvT                                                    295   3e-88    
ref|WP_026098492.1|  glycine cleavage system protein T                  294   5e-88    
ref|WP_016860519.1|  glycine cleavage system protein T                  294   7e-88    
ref|WP_015137344.1|  folate-binding protein YgfZ                        293   1e-87    
ref|WP_015112357.1|  folate-binding protein YgfZ                        293   2e-87    
ref|WP_015208555.1|  folate-binding protein YgfZ                        293   3e-87    
ref|WP_011613976.1|  glycine cleavage system protein T                  293   5e-87    
ref|WP_017319504.1|  glycine cleavage system protein T                  292   6e-87    
ref|WP_028082823.1|  glycine cleavage system protein T                  291   1e-86    
ref|WP_011318464.1|  glycine cleavage system protein T                  290   3e-86    
ref|WP_026721759.1|  glycine cleavage system protein T                  289   4e-86    
ref|WP_015197122.1|  folate-binding protein YgfZ                        289   7e-86    
ref|WP_028090492.1|  glycine cleavage system protein T                  289   8e-86    
ref|WP_015120628.1|  folate-binding protein YgfZ                        290   9e-86    
ref|WP_015131775.1|  folate-binding protein YgfZ                        288   1e-85    
ref|XP_005649859.1|  Aminomethyltransferase folate-binding domain...    289   1e-85    
ref|WP_010468460.1|  glycine cleavage system protein T                  288   2e-85    
ref|WP_015143145.1|  folate-binding protein YgfZ                        288   3e-85    
ref|WP_039202492.1|  glycine cleavage system protein T                  287   4e-85    
ref|WP_019506915.1|  hypothetical protein                               286   8e-85    
ref|WP_017747221.1|  glycine cleavage system protein T                  286   1e-84    
ref|WP_017319196.1|  glycine cleavage system protein T                  285   1e-84    
ref|WP_038088245.1|  glycine cleavage system protein T                  285   2e-84    
ref|WP_017310197.1|  glycine cleavage system protein T                  284   3e-84    
ref|WP_015191973.1|  folate-binding protein YgfZ                        285   5e-84    
ref|WP_013323287.1|  glycine cleavage system protein T                  285   7e-84    
ref|WP_006275946.1|  glycine cleavage system protein T                  283   1e-83    
ref|WP_039729899.1|  glycine cleavage system protein T                  283   1e-83    
ref|WP_015173099.1|  folate-binding protein YgfZ                        283   1e-83    
ref|WP_013191720.1|  glycine cleavage system protein T                  282   2e-83    
ref|WP_019497477.1|  hypothetical protein                               282   2e-83    
ref|WP_039754780.1|  glycine cleavage system protein T                  282   2e-83    
ref|WP_017653263.1|  glycine cleavage system protein T                  281   3e-83    
ref|WP_015083308.1|  glycine cleavage T protein (aminomethyltrans...    281   4e-83    
ref|WP_015148130.1|  folate-binding protein YgfZ                        281   6e-83    
ref|WP_008235851.1|  Folate-dependent protein for Fe/S cluster sy...    280   1e-82    
ref|WP_009342110.1|  glycine cleavage system protein T                  280   2e-82    
ref|WP_010998195.1|  glycine cleavage system protein T                  280   2e-82    
ref|WP_027403395.1|  glycine cleavage system protein T                  278   5e-82    
ref|WP_008229443.1|  Folate-dependent protein for Fe/S cluster sy...    278   6e-82    
ref|WP_012161995.1|  glycine cleavage system protein T                  279   7e-82    
ref|WP_015954025.1|  glycine cleavage system protein T                  279   8e-82    
ref|WP_006625503.1|  MULTISPECIES: glycine cleavage system protein T    277   2e-81    
ref|WP_029633203.1|  glycine cleavage system protein T [                275   7e-81    
ref|WP_006619939.1|  glycine cleavage system protein T                  276   1e-80    
ref|WP_014274523.1|  glycine cleavage system T protein                  275   2e-80    
ref|WP_016953117.1|  glycine cleavage system protein T                  273   4e-80    
ref|WP_035154850.1|  glycine cleavage system protein T                  272   6e-80    
ref|WP_017663248.1|  hypothetical protein                               273   9e-80    
ref|WP_036530983.1|  glycine cleavage system protein T                  272   2e-79    
ref|WP_015215867.1|  folate-binding protein YgfZ                        269   2e-78    
ref|WP_012593447.1|  MULTISPECIES: glycine cleavage system protein T    266   3e-77    
ref|WP_036486210.1|  glycine cleavage system protein T                  263   6e-76    
ref|WP_017712259.1|  hypothetical protein                               261   5e-75    
ref|WP_035994740.1|  glycine cleavage system protein T                  259   8e-75    
ref|WP_022609105.1|  folate-binding protein YgfZ                        259   2e-74    
ref|WP_036046348.1|  glycine cleavage system protein T                  256   2e-74    
ref|WP_015160767.1|  folate-binding protein YgfZ                        258   5e-74    
ref|WP_012362338.1|  glycine cleavage system protein T                  257   1e-73    
ref|WP_009543843.1|  glycine cleavage system protein T                  256   1e-73    
ref|WP_007310805.1|  glycine cleavage system protein T                  255   3e-73    
ref|WP_026072278.1|  glycine cleavage system protein T                  255   4e-73    
ref|WP_007305555.1|  glycine cleavage system protein T                  253   1e-72    
ref|WP_012627976.1|  glycine cleavage system protein T                  251   4e-72    
ref|WP_015136124.1|  folate-binding protein YgfZ                        251   8e-72    
ref|WP_018397151.1|  hypothetical protein                               250   3e-71    
ref|WP_024544410.1|  glycine cleavage system protein T                  249   4e-71    
ref|WP_008310568.1|  folate-binding protein YgfZ                        249   1e-70    
ref|WP_012306707.1|  glycine cleavage system protein T                  246   9e-70    
ref|WP_038026794.1|  glycine cleavage system protein T                  244   3e-69    
dbj|BAP16955.1|  aminomethyl transferase, glycine cleavage T protein    244   5e-69    
ref|WP_017303017.1|  hypothetical protein                               243   1e-68    
ref|WP_015219755.1|  folate-binding protein YgfZ                        244   1e-68    
ref|WP_015229451.1|  folate-binding protein YgfZ                        236   2e-66    
ref|WP_015125707.1|  folate-binding protein YgfZ                        235   3e-66    
ref|WP_004161589.1|  glycine cleavage system protein T                  235   4e-66    
ref|WP_015226702.1|  folate-binding protein YgfZ                        234   8e-66    
ref|WP_002743672.1|  aminomethyltransferase folate-binding domain...    233   2e-65    
ref|WP_006507326.1|  folate-binding protein YgfZ                        232   4e-65    
ref|WP_002768189.1|  glycine cleavage system protein T                  232   4e-65    
ref|XP_002949337.1|  hypothetical protein VOLCADRAFT_89696              236   5e-65    
ref|WP_012266361.1|  glycine cleavage system protein T                  232   6e-65    
ref|WP_002793130.1|  glycine cleavage system protein T                  232   6e-65    
ref|WP_002783022.1|  Aminomethyltransferase                             231   9e-65    
ref|WP_002776547.1|  glycine cleavage system protein T                  231   1e-64    
ref|WP_002802890.1|  glycine cleavage system protein T                  229   4e-64    
ref|WP_002740255.1|  aminomethyltransferase folate-binding domain...    229   5e-64    
ref|WP_008200329.1|  glycine cleavage system protein T                  229   8e-64    
ref|WP_023076507.1|  hypothetical protein                               228   9e-64    
dbj|GAL95641.1|  folate-dependent protein for Fe/S cluster synthe...    228   1e-63    
ref|WP_002798205.1|  glycine cleavage system protein T                  227   3e-63    
gb|ELR98599.1|  folate-binding protein YgfZ                             226   3e-63    
ref|WP_017295817.1|  hypothetical protein                               226   4e-63    
ref|WP_016516159.1|  Aminomethyltransferase                             226   4e-63    
ref|WP_002750154.1|  glycine cleavage system protein T                  226   7e-63    
ref|WP_024968911.1|  glycine cleavage system protein T                  226   7e-63    
ref|WP_034936144.1|  glycine cleavage system protein T                  224   1e-62    
gb|KFF41656.1|  folate-binding protein YgfZ                             226   1e-62    
ref|WP_002757310.1|  glycine cleavage system protein T                  225   2e-62    
ref|WP_015222909.1|  folate-binding protein YgfZ                        224   6e-62    
ref|XP_004242035.1|  PREDICTED: dnaJ homolog subfamily B member 4       198   6e-62    
ref|WP_038016330.1|  hypothetical protein                               222   2e-61    
ref|WP_006515237.1|  folate-binding protein YgfZ                        220   6e-61    
gb|EYU26527.1|  hypothetical protein MIMGU_mgv1a0194981mg               212   3e-60    
emb|CDP10930.1|  unnamed protein product                                197   3e-59    
ref|XP_011087735.1|  PREDICTED: dnaJ protein homolog 1-like             216   5e-59    
emb|CDO97560.1|  unnamed protein product                                216   5e-59    
gb|EPS69253.1|  hypothetical protein M569_05511                         209   7e-58    
ref|WP_011057784.1|  hypothetical protein                               209   2e-57    
ref|XP_011092346.1|  PREDICTED: flocculation protein FLO11-like         214   9e-57    
ref|XP_006363886.1|  PREDICTED: dnaJ homolog subfamily B member 4...    188   1e-56    
ref|XP_009792410.1|  PREDICTED: dnaJ protein homolog 1-like             207   4e-56    
ref|XP_004140234.1|  PREDICTED: dnaJ homolog subfamily B member 4...    204   2e-55    
ref|XP_009597477.1|  PREDICTED: dnaJ homolog subfamily B member 4...    204   4e-55    
gb|KGN47935.1|  hypothetical protein Csa_6G417870                       206   4e-55    
ref|XP_003547049.1|  PREDICTED: uncharacterized protein LOC100799984    203   2e-54    
ref|XP_008449405.1|  PREDICTED: dnaJ homolog subfamily B member 1       203   3e-54    
ref|XP_010068172.1|  PREDICTED: dnaJ protein homolog 1                  202   3e-54    
ref|XP_009593286.1|  PREDICTED: dnaJ homolog subfamily B member 4...    201   4e-54    
ref|XP_006473023.1|  PREDICTED: dnaJ homolog subfamily B member 1...    199   6e-54    
ref|XP_009790113.1|  PREDICTED: uncharacterized protein LOC104237630    194   8e-54    
ref|XP_002529542.1|  heat shock protein binding protein, putative       197   8e-54    Ricinus communis
ref|XP_007042244.1|  HSP40/DnaJ peptide-binding protein, putative       201   1e-53    
ref|XP_006585485.1|  PREDICTED: dnaJ homolog subfamily B member 1...    201   1e-53    
ref|XP_011009738.1|  PREDICTED: dnaJ homolog subfamily B member 1...    169   1e-53    
gb|KDP38849.1|  hypothetical protein JCGZ_05006                         203   1e-53    
ref|WP_024124984.1|  folate-binding protein YgfZ                        197   4e-53    
ref|XP_006434230.1|  hypothetical protein CICLE_v10003769mg             199   5e-53    
ref|XP_004485492.1|  PREDICTED: uncharacterized protein LOC101514711    199   5e-53    
ref|WP_011430013.1|  aminomethyltransferase                             196   1e-52    
ref|XP_010103912.1|  DnaJ homolog subfamily B member 13                 197   1e-52    
gb|KCW62966.1|  hypothetical protein EUGRSUZ_G00563                     195   3e-52    
ref|XP_011027502.1|  PREDICTED: mitochondrial protein import prot...    196   4e-52    
ref|XP_002300977.2|  hypothetical protein POPTR_0002s08220g             196   8e-52    Populus trichocarpa [western balsam poplar]
gb|KHG30797.1|  DnaJ subfamily B member 13                              160   2e-51    
ref|XP_004142703.1|  PREDICTED: chaperone protein DnaJ-like             169   2e-51    
ref|WP_011434198.1|  aminomethyltransferase                             192   3e-51    
ref|XP_006431845.1|  hypothetical protein CICLE_v10003603mg             192   3e-51    
emb|CBI23775.3|  unnamed protein product                                192   3e-51    
ref|XP_002298168.1|  DNAJ chaperone C-terminal domain-containing ...    164   8e-51    Populus trichocarpa [western balsam poplar]
ref|XP_004250740.1|  PREDICTED: dnaJ protein homolog 1-like             192   8e-51    
ref|XP_006471113.1|  PREDICTED: A-agglutinin anchorage subunit-like     194   1e-50    
gb|KDO53503.1|  hypothetical protein CISIN_1g014837mg                   194   1e-50    
ref|XP_010269106.1|  PREDICTED: dnaJ homolog subfamily B member 1...    191   1e-50    
gb|EYU35448.1|  hypothetical protein MIMGU_mgv1a0212672mg               189   2e-50    
ref|XP_002520351.1|  Protein psi1, putative                             189   2e-50    Ricinus communis
ref|XP_010657685.1|  PREDICTED: dnaJ homolog subfamily B member 4       192   3e-50    
ref|XP_003593020.1|  DnaJ homolog subfamily B member                    191   3e-50    
ref|XP_010243531.1|  PREDICTED: dnaJ homolog subfamily B member 1...    190   3e-50    
gb|ADW83718.1|  DnaJ-like protein                                       171   3e-50    
ref|XP_007148517.1|  hypothetical protein PHAVU_006G215400g             191   4e-50    
ref|XP_004292708.1|  PREDICTED: dnaJ homolog subfamily B member 4...    191   4e-50    
ref|XP_006352130.1|  PREDICTED: dnaJ protein homolog 1-like             189   9e-50    
ref|XP_009408315.1|  PREDICTED: dnaJ homolog subfamily B member 1...    168   2e-49    
ref|XP_009597480.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    188   3e-49    
ref|XP_010681831.1|  PREDICTED: dnaJ homolog subfamily B member 1...    187   3e-49    
gb|KHN47010.1|  DnaJ like subfamily B member 13                         182   4e-49    
ref|XP_010533907.1|  PREDICTED: uncharacterized protein LOC104809...    189   6e-49    
ref|XP_006655344.1|  PREDICTED: dnaJ homolog subfamily B member 1...    169   8e-49    
gb|KDP32846.1|  hypothetical protein JCGZ_12138                         185   9e-49    
dbj|BAB86234.1|  putative heat shock protein                            166   1e-48    Oryza sativa Japonica Group [Japonica rice]
gb|KCW71250.1|  hypothetical protein EUGRSUZ_F04343                     182   2e-48    
ref|XP_007019118.1|  HSP40/DnaJ peptide-binding protein, putative       184   5e-48    
ref|XP_010095409.1|  DnaJ homolog subfamily B member 13                 184   5e-48    
ref|NP_001044965.1|  Os01g0875700                                       162   1e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003522576.2|  PREDICTED: uncharacterized protein LOC100782604    183   1e-47    
ref|XP_010065139.1|  PREDICTED: dnaJ homolog subfamily B member 1...    183   4e-47    
gb|KHN05249.1|  DnaJ like subfamily B member 13                         178   7e-47    
ref|XP_008365202.1|  PREDICTED: dnaJ homolog subfamily B member 1...    179   7e-47    
ref|XP_009379048.1|  PREDICTED: dnaJ homolog subfamily B member 1...    181   9e-47    
ref|XP_008799171.1|  PREDICTED: dnaJ homolog subfamily B member 1...    180   9e-47    
ref|XP_008799172.1|  PREDICTED: dnaJ homolog subfamily B member 1...    180   1e-46    
ref|XP_010999407.1|  PREDICTED: dnaJ homolog subfamily B member 1...    181   1e-46    
ref|XP_008219618.1|  PREDICTED: dnaJ homolog subfamily A member 2...    181   1e-46    
ref|XP_004502514.1|  PREDICTED: dnaJ homolog subfamily B member 1...    176   1e-46    
ref|XP_008378441.1|  PREDICTED: uncharacterized protein LOC103441539    179   3e-46    
ref|XP_010907799.1|  PREDICTED: dnaJ protein homolog 1-like             179   4e-46    
gb|AAS90663.1|  putative DnaJ                                           157   4e-46    Oryza sativa Japonica Group [Japonica rice]
gb|EAY98130.1|  hypothetical protein OsI_20048                          157   4e-46    Oryza sativa Indica Group [Indian rice]
ref|XP_007137427.1|  hypothetical protein PHAVU_009G126300g             179   4e-46    
ref|XP_002307444.2|  DNAJ chaperone C-terminal domain-containing ...    179   5e-46    Populus trichocarpa [western balsam poplar]
ref|NP_172571.1|  HSP40/DnaJ peptide-binding protein                    181   7e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010911134.1|  PREDICTED: dnaJ homolog subfamily B member 1...    177   7e-46    
ref|XP_006646528.1|  PREDICTED: dnaJ protein homolog 1-like             155   8e-46    
ref|XP_003568401.1|  PREDICTED: dnaJ protein homolog 1-like             158   1e-45    
ref|XP_004970753.1|  PREDICTED: dnaJ protein homolog 1-like             155   1e-45    
ref|XP_002892615.1|  predicted protein                                  180   1e-45    
gb|AAG50552.1|AC074228_7  hypothetical protein                          153   1e-45    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175080.2|  HSP40/DnaJ peptide-binding protein                    153   1e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222113.1|  hypothetical protein PRUPE_ppa007669mg             178   1e-45    
ref|XP_008218781.1|  PREDICTED: dnaJ homolog subfamily B member 13      174   2e-45    
ref|XP_008368747.1|  PREDICTED: dnaJ homolog subfamily B member 1...    174   3e-45    
gb|EMT31204.1|  hypothetical protein F775_43183                         155   3e-45    
ref|XP_003564751.1|  PREDICTED: dnaJ protein homolog 1-like             155   4e-45    
dbj|BAK06122.1|  predicted protein                                      159   5e-45    
emb|CDX97927.1|  BnaA06g06780D                                          178   5e-45    
emb|CDY67277.1|  BnaCnng54260D                                          178   5e-45    
gb|EDX85316.1|  Glycine cleavage T-protein C-terminal barrel domain     174   7e-45    
ref|XP_010492252.1|  PREDICTED: uncharacterized protein LOC104769678    177   1e-44    
emb|CDY20977.1|  BnaA08g25480D                                          176   1e-44    
ref|XP_010475989.1|  PREDICTED: uncharacterized protein LOC104755332    177   1e-44    
ref|XP_009144402.1|  PREDICTED: serine/arginine repetitive matrix...    176   1e-44    
ref|XP_009347197.1|  PREDICTED: uncharacterized protein LOC103938875    176   2e-44    
emb|CDY20589.1|  BnaC08g14690D                                          175   3e-44    
ref|XP_006417396.1|  hypothetical protein EUTSA_v10007652mg             176   4e-44    
gb|KHG12298.1|  Protein psi1                                            171   4e-44    
ref|XP_009355433.1|  PREDICTED: uncharacterized protein LOC103946451    175   4e-44    
gb|AAR12906.1|  pollen-specific DnaJ-like protein                       172   4e-44    
gb|AIE75393.1|  Folate-dependent protein for Fe/S cluster synthes...    172   5e-44    
ref|XP_002456726.1|  hypothetical protein SORBIDRAFT_03g041460          150   7e-44    
gb|EMS52477.1|  DnaJ homolog subfamily B member 13                      151   7e-44    
ref|XP_009148438.1|  PREDICTED: uncharacterized protein LOC103871873    175   7e-44    
ref|XP_006303554.1|  hypothetical protein CARUB_v10011013mg             175   9e-44    
ref|XP_003602041.1|  DnaJ homolog subfamily B member                    172   1e-43    
ref|WP_011242900.1|  glycine cleavage system protein T                  172   1e-43    
ref|WP_010873580.1|  hypothetical protein                               171   2e-43    
gb|KFK43394.1|  hypothetical protein AALP_AA1G120500                    181   2e-43    
ref|XP_010458481.1|  PREDICTED: uncharacterized protein LOC104739734    174   2e-43    
ref|XP_006306050.1|  hypothetical protein CARUB_v10011360mg             150   2e-43    
ref|XP_008338657.1|  PREDICTED: dnaJ homolog subfamily B member 1...    171   3e-43    
ref|XP_011069480.1|  PREDICTED: uncharacterized protein LOC105155301    172   4e-43    
ref|XP_004301502.1|  PREDICTED: uncharacterized protein LOC101311292    171   8e-43    
ref|XP_010674980.1|  PREDICTED: dnaJ homolog subfamily B member 1...    170   3e-42    
ref|NP_001131455.1|  hypothetical protein                               147   5e-42    
ref|NP_001131952.1|  uncharacterized protein LOC100193345               144   2e-41    
ref|XP_008444178.1|  PREDICTED: uncharacterized protein LOC103487597    166   2e-41    
ref|XP_002441136.1|  hypothetical protein SORBIDRAFT_09g021110          142   3e-41    
ref|XP_006847193.1|  hypothetical protein AMTR_s00017p00249800          165   4e-41    
ref|XP_009597478.1|  PREDICTED: dnaJ homolog subfamily B member 4...    164   4e-41    
gb|EMT20182.1|  DnaJ protein-1-like protein                             162   6e-41    
ref|XP_004961994.1|  PREDICTED: mitochondrial protein import prot...    141   9e-41    
gb|EMS66024.1|  DnaJ homolog subfamily B member 13                      159   4e-40    
ref|XP_004502511.1|  PREDICTED: dnaJ homolog subfamily B member 4...    156   5e-40    
emb|CDM85190.1|  unnamed protein product                                160   9e-40    
ref|XP_002891286.1|  DNAJ chaperone C-terminal domain-containing ...    160   2e-39    
ref|XP_005823056.1|  hypothetical protein GUITHDRAFT_90067              161   1e-38    
ref|XP_010479043.1|  PREDICTED: dnaJ homolog subfamily B member 11      158   2e-38    
ref|XP_008783328.1|  PREDICTED: dnaJ protein homolog 1-like             155   9e-38    
ref|XP_010500135.1|  PREDICTED: protein psi1-like                       155   9e-38    
ref|XP_004972770.1|  PREDICTED: dnaJ homolog subfamily B member 4...    135   1e-37    
ref|XP_006377409.1|  hypothetical protein POPTR_0011s05650g             140   2e-37    
gb|EYU31772.1|  hypothetical protein MIMGU_mgv1a022289mg                154   2e-37    
ref|XP_006659154.1|  PREDICTED: dnaJ homolog subfamily B member 4...    134   3e-37    
ref|XP_008662840.1|  PREDICTED: dnaJ homolog subfamily B member 4       136   3e-37    
ref|XP_006387784.1|  hypothetical protein POPTR_0584s00210g             139   9e-37    
ref|WP_012258471.1|  MULTISPECIES: glycine cleavage system protein T    152   1e-36    
ref|XP_010538999.1|  PREDICTED: dnaJ homolog subfamily B member 1...    152   1e-36    
ref|WP_008278965.1|  Glycine cleavage T protein (aminomethyl tran...    148   1e-36    
ref|WP_011958404.1|  glycine cleavage system protein T                  151   2e-36    
ref|XP_006647203.1|  PREDICTED: dnaJ homolog subfamily B member 4...    138   2e-36    
ref|WP_026369567.1|  hypothetical protein                               151   2e-36    
ref|XP_002445105.1|  hypothetical protein SORBIDRAFT_07g004160          133   2e-36    
gb|ACN31048.1|  unknown                                                 150   2e-36    
ref|NP_001148785.1|  dnaJ protein                                       150   3e-36    
dbj|BAC57815.1|  putative heat shock protein 40                         132   4e-36    
ref|XP_003573451.1|  PREDICTED: dnaJ homolog subfamily B member 4       135   4e-36    
ref|NP_001130118.1|  uncharacterized protein LOC100191212               135   6e-36    
ref|XP_002971272.1|  hypothetical protein SELMODRAFT_231730             141   7e-36    
ref|XP_010111177.1|  DnaJ homolog subfamily B member 13                 133   7e-36    
gb|EMT32869.1|  DnaJ homolog subfamily B member 4                       130   1e-35    
ref|WP_031459658.1|  glycine cleavage system protein T                  148   3e-35    
gb|EEE63797.1|  hypothetical protein OsJ_18621                          149   4e-35    
ref|NP_001046640.1|  Os02g0306900                                       134   4e-35    
ref|XP_005646816.1|  DnaJ-like protein                                  139   4e-35    
ref|WP_012616526.1|  glycine cleavage system protein T                  147   5e-35    
dbj|BAJ90925.1|  predicted protein                                      128   5e-35    
gb|EEC72986.1|  hypothetical protein OsI_06893                          134   5e-35    
gb|EEE56808.1|  hypothetical protein OsJ_06400                          134   5e-35    
ref|XP_011001230.1|  PREDICTED: dnaJ homolog subfamily B member 1...    133   5e-35    
ref|XP_006838799.1|  hypothetical protein AMTR_s00002p00260500          131   6e-35    
ref|XP_002509430.1|  Protein SIS1, putative                             133   8e-35    
gb|KFK24210.1|  hypothetical protein AALP_AAs42301U000300               142   1e-34    
ref|XP_006288198.1|  hypothetical protein CARUB_v10001436mg             132   1e-34    
gb|KEH39190.1|  DnaJ heat shock family protein                          128   2e-34    
emb|CDO99493.1|  unnamed protein product                                131   2e-34    
gb|AFK35648.1|  unknown                                                 128   2e-34    
ref|XP_010467799.1|  PREDICTED: dnaJ homolog subfamily B member 1...    134   2e-34    
ref|XP_002884704.1|  hypothetical protein ARALYDRAFT_897029             128   2e-34    
ref|XP_008810970.1|  PREDICTED: dnaJ homolog subfamily B member 4...    132   2e-34    
ref|XP_010532198.1|  PREDICTED: dnaJ homolog subfamily B member 4       145   3e-34    
ref|XP_009592737.1|  PREDICTED: dnaJ homolog subfamily B member 1...    135   3e-34    
ref|NP_179646.1|  DNAJ heat shock family protein                        135   3e-34    
ref|XP_004952323.1|  PREDICTED: dnaJ homolog subfamily B member 4...    134   3e-34    
gb|ADE76240.1|  unknown                                                 145   4e-34    
ref|XP_006393740.1|  hypothetical protein EUTSA_v10011600mg             145   4e-34    
ref|XP_004487195.1|  PREDICTED: dnaJ homolog subfamily B member 1...    123   4e-34    
ref|XP_002886287.1|  DNAJ heat shock family protein                     135   4e-34    
emb|CDY65077.1|  BnaA09g55990D                                          132   5e-34    
gb|KFK40429.1|  hypothetical protein AALP_AA3G372300                    135   5e-34    
ref|XP_003633023.1|  PREDICTED: dnaJ homolog subfamily B member 13      130   5e-34    
gb|KHG04540.1|  DnaJ subfamily B member 13                              128   5e-34    
ref|XP_010463209.1|  PREDICTED: protein psi1-like                       143   5e-34    
emb|CBI30610.3|  unnamed protein product                                130   6e-34    
ref|XP_001689503.1|  DnaJ-like protein                                  142   6e-34    
ref|XP_009117486.1|  PREDICTED: dnaJ homolog subfamily B member 13      132   6e-34    
ref|XP_010451993.1|  PREDICTED: dnaJ homolog subfamily B member 1...    126   6e-34    
ref|XP_006408982.1|  hypothetical protein EUTSA_v10002032mg             134   6e-34    
ref|XP_010052257.1|  PREDICTED: dnaJ protein homolog 1                  131   7e-34    
ref|XP_006470162.1|  PREDICTED: dnaJ homolog subfamily B member 1...    130   7e-34    
gb|ABR17795.1|  unknown                                                 129   8e-34    
ref|XP_001766290.1|  predicted protein                                  135   8e-34    
gb|EPS67931.1|  hypothetical protein M569_06842                         130   8e-34    
ref|NP_187503.1|  DnaJ domain-containing protein                        129   8e-34    
ref|XP_006398619.1|  hypothetical protein EUTSA_v10014043mg             129   9e-34    
ref|XP_004352966.1|  chaperone protein DnaJ, putative                   139   9e-34    
gb|EWM23155.1|  folate-binding protein                                  145   1e-33    
ref|XP_011043633.1|  PREDICTED: dnaJ homolog subfamily B member 4...    131   1e-33    
ref|XP_007025544.1|  DNAJ heat shock family protein                     128   1e-33    
ref|XP_010489020.1|  PREDICTED: dnaJ homolog subfamily B member 1...    133   1e-33    
ref|XP_010904900.1|  PREDICTED: dnaJ homolog subfamily B member 1...    130   1e-33    
gb|ABR16557.1|  unknown                                                 131   1e-33    
emb|CDY13869.1|  BnaA09g43710D                                          131   1e-33    
ref|XP_006372756.1|  hypothetical protein POPTR_0017s04750g             130   1e-33    
ref|XP_002961542.1|  hypothetical protein SELMODRAFT_230025             142   2e-33    
ref|XP_006364303.1|  PREDICTED: dnaJ homolog subfamily B member 1...    129   2e-33    
ref|XP_010464510.1|  PREDICTED: dnaJ homolog subfamily B member 1...    125   2e-33    
gb|KFK24647.1|  hypothetical protein AALP_AA8G006800                    126   2e-33    
ref|XP_006446697.1|  hypothetical protein CICLE_v10015820mg             129   2e-33    
ref|WP_028459049.1|  glycine cleavage system protein T                  142   2e-33    
ref|XP_011096356.1|  PREDICTED: dnaJ homolog subfamily B member 1...    127   2e-33    
ref|XP_004232921.1|  PREDICTED: dnaJ protein homolog 1-like             129   2e-33    
ref|XP_010052274.1|  PREDICTED: dnaJ homolog subfamily B member 1...    131   2e-33    
ref|XP_002309759.1|  DNAJ chaperone C-terminal domain-containing ...    124   2e-33    
gb|KDP21009.1|  hypothetical protein JCGZ_21480                         130   2e-33    
emb|CDY58657.1|  BnaA01g32230D                                          131   3e-33    
ref|XP_011043635.1|  PREDICTED: dnaJ homolog subfamily B member 4...    123   3e-33    
ref|XP_009392429.1|  PREDICTED: dnaJ homolog subfamily B member 4...    132   3e-33    
ref|WP_002622808.1|  Folate-dependent protein for Fe/S cluster sy...    142   3e-33    
ref|XP_010423950.1|  PREDICTED: dnaJ homolog subfamily B member 1...    126   3e-33    
ref|XP_003607513.1|  Chaperone protein dnaJ                             127   3e-33    
ref|XP_009803169.1|  PREDICTED: dnaJ homolog subfamily B member 1...    131   3e-33    
gb|AAM67147.1|  putative heat shock protein                             129   3e-33    
ref|XP_009343434.1|  PREDICTED: dnaJ homolog subfamily B member 1...    133   4e-33    
emb|CDY66166.1|  BnaCnng49750D                                          142   4e-33    
ref|NP_001148272.1|  dnaJ protein                                       142   4e-33    
ref|XP_006298073.1|  hypothetical protein CARUB_v10014117mg             132   4e-33    
emb|CDY22173.1|  BnaC01g39280D                                          130   4e-33    
ref|XP_010028663.1|  PREDICTED: dnaJ homolog subfamily B member 1       135   5e-33    
emb|CDP18422.1|  unnamed protein product                                122   5e-33    
ref|WP_022813538.1|  hypothetical protein                               142   6e-33    
ref|XP_004505540.1|  PREDICTED: dnaJ homolog subfamily B member 4...    122   6e-33    
ref|XP_010260329.1|  PREDICTED: dnaJ homolog subfamily B member 1       129   6e-33    
ref|XP_008225149.1|  PREDICTED: dnaJ homolog subfamily B member 1...    125   6e-33    
ref|NP_001147734.1|  dnaJ protein                                       141   7e-33    
ref|XP_006407734.1|  hypothetical protein EUTSA_v10021104mg             127   7e-33    
ref|NP_195759.1|  putative DNAJ heat shock protein                      125   8e-33    
ref|XP_001770678.1|  predicted protein                                  131   8e-33    
ref|XP_009621633.1|  PREDICTED: dnaJ homolog subfamily B member 1...    133   8e-33    
ref|XP_009123794.1|  PREDICTED: dnaJ homolog subfamily B member 1...    129   9e-33    
ref|XP_009145047.1|  PREDICTED: protein psi1-like                       141   9e-33    
ref|XP_010486439.1|  PREDICTED: dnaJ homolog subfamily B member 1...    127   1e-32    
gb|KFK38278.1|  hypothetical protein AALP_AA3G093400                    127   1e-32    
ref|XP_010466520.1|  PREDICTED: dnaJ homolog subfamily B member 1...    126   1e-32    
ref|XP_010555100.1|  PREDICTED: dnaJ homolog subfamily B member 1...    129   1e-32    
ref|XP_010490965.1|  PREDICTED: dnaJ homolog subfamily B member 1...    131   1e-32    
ref|XP_004960371.1|  PREDICTED: dnaJ homolog subfamily B member 4...    122   1e-32    
ref|NP_001150074.1|  LOC100283703                                       122   1e-32    
gb|AFW82745.1|  dnaJ subfamily B member 13                              122   1e-32    
ref|XP_008783136.1|  PREDICTED: dnaJ homolog subfamily B member 1...    130   1e-32    
ref|XP_009389943.1|  PREDICTED: dnaJ protein homolog 1-like             129   1e-32    
ref|XP_002870924.1|  hypothetical protein ARALYDRAFT_486937             124   1e-32    
ref|XP_006298135.1|  hypothetical protein CARUB_v10014182mg             124   1e-32    
ref|XP_010689787.1|  PREDICTED: dnaJ homolog subfamily B member 4...    123   1e-32    
ref|XP_010919404.1|  PREDICTED: dnaJ homolog subfamily B member 1...    130   1e-32    
ref|XP_008383689.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    121   1e-32    
ref|XP_010916015.1|  PREDICTED: dnaJ homolog subfamily B member 1...    129   1e-32    
ref|XP_011043634.1|  PREDICTED: dnaJ homolog subfamily B member 4...    123   1e-32    
ref|XP_010528905.1|  PREDICTED: dnaJ homolog subfamily B member 1...    123   2e-32    
ref|XP_010475895.1|  PREDICTED: dnaJ homolog subfamily B member 1...    130   2e-32    
ref|XP_009352856.1|  PREDICTED: dnaJ homolog subfamily B member 1...    121   2e-32    
ref|XP_006844883.1|  hypothetical protein AMTR_s00058p00123590          124   2e-32    
gb|KFK29392.1|  hypothetical protein AALP_AA7G127400                    127   2e-32    
ref|XP_004299626.1|  PREDICTED: dnaJ homolog subfamily B member 1...    132   2e-32    
ref|XP_010415583.1|  PREDICTED: dnaJ homolog subfamily B member 1...    134   2e-32    
ref|XP_002892561.1|  hypothetical protein ARALYDRAFT_471147             130   2e-32    
ref|XP_010490571.1|  PREDICTED: dnaJ homolog subfamily B member 1       123   2e-32    
ref|XP_006284041.1|  hypothetical protein CARUB_v10005162mg             127   2e-32    
ref|XP_008647550.1|  PREDICTED: uncharacterized protein LOC100273...    142   2e-32    
gb|EYU28012.1|  hypothetical protein MIMGU_mgv1a009202mg                127   2e-32    
ref|XP_007211510.1|  hypothetical protein PRUPE_ppa007978mg             123   2e-32    
ref|XP_006404314.1|  hypothetical protein EUTSA_v10010490mg             129   2e-32    
ref|XP_010433214.1|  PREDICTED: dnaJ homolog subfamily B member 1...    127   3e-32    
gb|AFK41649.1|  unknown                                                 124   3e-32    
ref|XP_009773811.1|  PREDICTED: dnaJ homolog subfamily B member 1...    128   3e-32    
gb|EPS71401.1|  hypothetical protein M569_03360                         117   3e-32    
ref|XP_006365599.1|  PREDICTED: dnaJ homolog subfamily B member 4...    126   3e-32    
ref|NP_194577.1|  DNAJ heat shock protein                               126   3e-32    
ref|XP_010438448.1|  PREDICTED: dnaJ homolog subfamily B member 1...    127   3e-32    
ref|XP_003737666.1|  PREDICTED: dnaJ homolog subfamily B member 4...    127   3e-32    
ref|XP_006654784.1|  PREDICTED: dnaJ homolog subfamily B member 4...    127   3e-32    
ref|XP_003737665.1|  PREDICTED: dnaJ homolog subfamily B member 4...    127   3e-32    
ref|XP_004303128.1|  PREDICTED: dnaJ homolog subfamily B member 4...    127   4e-32    
ref|XP_008811889.1|  PREDICTED: dnaJ homolog subfamily B member 1...    125   4e-32    
ref|XP_006305234.1|  hypothetical protein CARUB_v10009603mg             129   4e-32    
gb|AEE92843.1|  Potato virus X SL1 RNA interacting protein 2            129   4e-32    
ref|XP_004246761.1|  PREDICTED: dnaJ homolog subfamily B member 13      126   4e-32    
ref|NP_179645.1|  HSP40/DnaJ peptide-binding protein                    126   4e-32    
ref|XP_002439214.1|  hypothetical protein SORBIDRAFT_09g002340          122   4e-32    
ref|XP_009613462.1|  PREDICTED: dnaJ homolog subfamily B member 1...    123   5e-32    
ref|XP_009781784.1|  PREDICTED: dnaJ homolog subfamily B member 1...    123   5e-32    
ref|XP_010447976.1|  PREDICTED: dnaJ homolog subfamily B member 1...    124   5e-32    
ref|XP_007043690.1|  DNAJ heat shock family protein                     122   6e-32    
ref|XP_010044697.1|  PREDICTED: dnaJ homolog subfamily B member 4...    128   6e-32    
ref|WP_012122006.1|  glycine cleavage system protein T                  138   6e-32    
ref|XP_008798261.1|  PREDICTED: dnaJ homolog subfamily B member 1...    129   6e-32    
ref|NP_001233892.1|  DnaJ like protein                                  126   6e-32    
ref|XP_002869499.1|  DNAJ heat shock family protein                     125   7e-32    
ref|XP_008455951.1|  PREDICTED: dnaJ homolog subfamily B member 1...    124   7e-32    
emb|CDY64940.1|  BnaA05g37100D                                          126   7e-32    
ref|XP_004302588.1|  PREDICTED: dnaJ homolog subfamily B member 1...    126   7e-32    
ref|NP_001149016.1|  dnaJ subfamily B member 5                          127   7e-32    
gb|EAY99019.1|  hypothetical protein OsI_20977                          126   8e-32    
ref|NP_001056320.1|  Os05g0562300                                       126   8e-32    
ref|XP_002077731.1|  GD23083                                            121   8e-32    
ref|XP_010093957.1|  DnaJ homolog subfamily B member 13                 124   9e-32    
ref|XP_004961230.1|  PREDICTED: dnaJ homolog subfamily B member 4...    126   9e-32    



>ref|XP_009616449.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Nicotiana 
tomentosiformis]
Length=420

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/376 (81%), Positives = 333/376 (89%), Gaps = 3/376 (1%)
 Frame = +2

Query  200   PENWTRNYS---TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATE  370
             P  + R +S    AALPFDLSPPPIDHDL+DTM VAGAKV E   I T+ ND+EAL A E
Sbjct  44    PTKFKRRFSFSSAAALPFDLSPPPIDHDLLDTMTVAGAKVSEDGAIGTFDNDEEALDAVE  103

Query  371   NGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  550
             N VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW
Sbjct  104   NAVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  163

Query  551   IMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNL  730
             IMK AITLV SP T ERIT ML+KYIFF+DKVEIQDI+ QT  FVL+GPRSNQI+E LNL
Sbjct  164   IMKTAITLVISPVTKERITGMLKKYIFFADKVEIQDITGQTSLFVLIGPRSNQIMEALNL  223

Query  731   GDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGS  910
              D+VGQPYGSHKHYSVNG P+T+ VGNIISEEG+SL++SPA A+SVWKAL+ +G +PMG+
Sbjct  224   ADVVGQPYGSHKHYSVNGMPITVGVGNIISEEGYSLMMSPAAAESVWKALLGHGTIPMGT  283

Query  911   NAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  1090
             NAWE LRI+QGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL
Sbjct  284   NAWETLRILQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  343

Query  1091  WGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgv  1270
             WGIR+SS VEPGS+ISVDGKKVGK+TS T+    S+P GLGYI++KAASEGDTVIIGD V
Sbjct  344   WGIRVSSPVEPGSTISVDGKKVGKVTSFTTGIRASQPLGLGYIKRKAASEGDTVIIGDDV  403

Query  1271  vgtvvevPFLGRQLPP  1318
             VGTVVEVPFL RQ+PP
Sbjct  404   VGTVVEVPFLARQIPP  419



>ref|XP_009780010.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Nicotiana 
sylvestris]
Length=420

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/376 (81%), Positives = 331/376 (88%), Gaps = 3/376 (1%)
 Frame = +2

Query  200   PENWTRNYS---TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATE  370
             P    R +S    AALPFDLSPPPIDHDL+DTM VAGAKV E   I T+ ND+EAL A E
Sbjct  44    PAKIKRRFSFSPAAALPFDLSPPPIDHDLLDTMTVAGAKVSEDGAIGTFDNDEEALDAVE  103

Query  371   NGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  550
             N VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW
Sbjct  104   NAVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  163

Query  551   IMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNL  730
             IMK AITLV SP T ERIT ML+KYIFF+DKVEIQDI+ QT  FVL+GPRSNQI+E LNL
Sbjct  164   IMKTAITLVVSPVTKERITGMLKKYIFFADKVEIQDITGQTSLFVLIGPRSNQIMEALNL  223

Query  731   GDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGS  910
              D+VGQPYGSHKHYSVNG P+T+ VGNIISE+G+SLL+SPA A+SVWKAL+ +GA+PMGS
Sbjct  224   ADIVGQPYGSHKHYSVNGMPITVGVGNIISEDGYSLLMSPAAAESVWKALLGHGAIPMGS  283

Query  911   NAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  1090
             NAWE LRI+QGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL
Sbjct  284   NAWEILRILQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  343

Query  1091  WGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgv  1270
             WGIR+ S VEPGS+ISVDGKKVGK+TS T     S+P GLGYI++KAASEGDTVIIGD V
Sbjct  344   WGIRVPSPVEPGSTISVDGKKVGKVTSFTKGIRASQPLGLGYIKRKAASEGDTVIIGDDV  403

Query  1271  vgtvvevPFLGRQLPP  1318
             VGTVVEVPFL RQ+PP
Sbjct  404   VGTVVEVPFLARQIPP  419



>ref|XP_006349373.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
[Solanum tuberosum]
Length=414

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/363 (81%), Positives = 329/363 (91%), Gaps = 0/363 (0%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AALPFDLSPPPIDHDL+DTM +AGAKV E  +I T+ ND+EAL A ENGVAVVDLSH+GR
Sbjct  51    AALPFDLSPPPIDHDLLDTMTIAGAKVSEDGVIGTFDNDEEALDAVENGVAVVDLSHHGR  110

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSGEDRVQFLHNQSTANFE LHEGQGCDTVFVTPTARTIDIAHAW+MK AITLV SP 
Sbjct  111   IRVSGEDRVQFLHNQSTANFETLHEGQGCDTVFVTPTARTIDIAHAWVMKTAITLVVSPV  170

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T ERIT ML+KYIFF+DKVEIQDI++QT  FVLVGP SN+I+E L+L D+VGQPYGSHKH
Sbjct  171   TRERITHMLKKYIFFADKVEIQDITEQTSLFVLVGPTSNKIMEALSLADIVGQPYGSHKH  230

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             Y+VNG P+T+ VGNIISEEG+SLL+SPA A+SVWKA++ +GA+PMGSNAWE LRI+QGRP
Sbjct  231   YNVNGMPITVGVGNIISEEGYSLLMSPAAAESVWKAILGHGAIPMGSNAWETLRILQGRP  290

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR+SS VEPGS
Sbjct  291   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRVSSPVEPGS  350

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
             +ISV+GKKVGK+TS T+    S+P GLGYI++KAASEGD+VIIGD V GTVVEVPFL RQ
Sbjct  351   TISVNGKKVGKVTSFTTGKRASQPLGLGYIKRKAASEGDSVIIGDDVEGTVVEVPFLARQ  410

Query  1310  LPP  1318
             +PP
Sbjct  411   IPP  413



>ref|XP_004230488.2| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Solanum 
lycopersicum]
Length=420

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/363 (80%), Positives = 328/363 (90%), Gaps = 0/363 (0%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AALPFDLSPPPIDHDL+DTM +AGAKV E  +I T+ ND+EAL A ENGVAVVDLSHYGR
Sbjct  57    AALPFDLSPPPIDHDLLDTMTIAGAKVSEDGVIGTFDNDEEALDAVENGVAVVDLSHYGR  116

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW+MK AITLV SP 
Sbjct  117   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWVMKTAITLVVSPV  176

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T ERIT ML KYIFF+DKVEIQDI+++T  F+LVGP SN+I+E L+L D+VGQPYGSHKH
Sbjct  177   TRERITHMLEKYIFFADKVEIQDITEKTSLFLLVGPTSNKIMEALSLADIVGQPYGSHKH  236

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             Y+VNG P+T+ VGNIISEEG+ LL+SPA A+SVWKA++ +GAVPMGSNAWE LRI+QGRP
Sbjct  237   YNVNGMPITVGVGNIISEEGYLLLMSPAAAESVWKAILGHGAVPMGSNAWETLRILQGRP  296

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELTDEFNVLEANLWNAVSLNKGCYKGQETI+RLVTYDGIKQRLWGIR+SS VEPGS
Sbjct  297   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETIARLVTYDGIKQRLWGIRVSSPVEPGS  356

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
             +ISV+GKKVGK+TS T+    S+P GLGYI++KAASEGD+VIIGD V GTVVEVPFL RQ
Sbjct  357   TISVNGKKVGKVTSFTTGKRASQPLGLGYIKRKAASEGDSVIIGDDVEGTVVEVPFLARQ  416

Query  1310  LPP  1318
             +PP
Sbjct  417   IPP  419



>ref|XP_009355237.1| PREDICTED: aminomethyltransferase, mitochondrial [Pyrus x bretschneideri]
 ref|XP_009355238.1| PREDICTED: aminomethyltransferase, mitochondrial [Pyrus x bretschneideri]
Length=431

 Score =   535 bits (1378),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 266/364 (73%), Positives = 318/364 (87%), Gaps = 0/364 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             ++ALPFDLSPPPIDHDLIDT+  AGAKV +  IIET+ NDD+AL A +NGVAVVDLSH+G
Sbjct  62    SSALPFDLSPPPIDHDLIDTVATAGAKVSDDGIIETFDNDDQALDAADNGVAVVDLSHFG  121

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSGEDR+QFLHNQ+TAN E LH+GQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  122   RIRVSGEDRIQFLHNQTTANVESLHQGQGCDTVFVTPTARTIDIAHAWIMKNAVLLVVSP  181

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              TS  I+ ML+KYIFF+DKVEIQDI+KQTCFFVLVGP+SNQ+++ LNLGDLV QPYG+H+
Sbjct  182   VTSRSISEMLQKYIFFNDKVEIQDITKQTCFFVLVGPKSNQLMKELNLGDLVEQPYGTHQ  241

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             H+SV+G P+T+ VGN+ISE+GFS L+SPATA+SVWK ++  GA+PMGSNAWE+LRI QGR
Sbjct  242   HFSVDGMPITVGVGNVISEKGFSFLMSPATAESVWKTILSQGAIPMGSNAWEKLRIFQGR  301

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAP KELT+E+NVLEA LWN++SLNKGCYKGQETI+RL+TYDG+KQRLWGIRL++  E G
Sbjct  302   PAPQKELTNEYNVLEAGLWNSISLNKGCYKGQETIARLITYDGVKQRLWGIRLAAPAEVG  361

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             S ++V GKKVGKLTS TS    S   GLGYI++++ SEGDTVI+GD + GTVVE+PFL  
Sbjct  362   SILTVGGKKVGKLTSCTSGKKESGYIGLGYIKRQSVSEGDTVIVGDAITGTVVELPFLAG  421

Query  1307  QLPP  1318
             Q PP
Sbjct  422   QRPP  425



>ref|XP_008378869.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial [Malus 
domestica]
 ref|XP_008378870.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial [Malus 
domestica]
Length=432

 Score =   533 bits (1373),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 266/364 (73%), Positives = 318/364 (87%), Gaps = 0/364 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             +++LPFDLSPPPIDHDLIDT+  AGAKV +  IIET+ NDD+AL A +NGVAVVDLSH+G
Sbjct  63    SSSLPFDLSPPPIDHDLIDTVATAGAKVSDDGIIETFDNDDQALDAADNGVAVVDLSHFG  122

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSGEDR+QFLHNQ+TANFE LH+GQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  123   RIRVSGEDRIQFLHNQTTANFESLHQGQGCDTVFVTPTARTIDIAHAWIMKNAVMLVVSP  182

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              TS  I+ ML+KYIFF+DKVEIQDI+KQTCFFVLVGP+SNQ+++ LNLGDLV QPYG+H+
Sbjct  183   VTSRSISEMLQKYIFFNDKVEIQDITKQTCFFVLVGPKSNQLMKELNLGDLVEQPYGTHQ  242

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             H+SV+G P+T+ VGN+ISE+GFS L+SPATA+SVWK ++  GA+PMGSNAWE+LRI QGR
Sbjct  243   HFSVDGMPITVGVGNVISEKGFSFLMSPATAESVWKTILSQGAIPMGSNAWEKLRIFQGR  302

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAP KELT+E+NVLEA LWN++SLNKGCYKGQETI+RL+TYDG+KQRLWGI L++  E G
Sbjct  303   PAPQKELTNEYNVLEAGLWNSISLNKGCYKGQETIARLITYDGVKQRLWGICLAAPAEVG  362

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             S ++V GKKVGKLTS TS    S   GLGYI++++ SEGDTVI+GD + GTVVEVPFL  
Sbjct  363   SILTVGGKKVGKLTSCTSGKKESGYIGLGYIKRQSVSEGDTVIVGDAITGTVVEVPFLAG  422

Query  1307  QLPP  1318
             Q PP
Sbjct  423   QRPP  426



>ref|XP_006431847.1| hypothetical protein CICLE_v10001270mg [Citrus clementina]
 gb|ESR45087.1| hypothetical protein CICLE_v10001270mg [Citrus clementina]
Length=423

 Score =   532 bits (1370),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 272/361 (75%), Positives = 312/361 (86%), Gaps = 0/361 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             TA LPFDLSPPPIDHDL++T+K  GAK+ E  I+ET+GND EAL A +NGVAVVDLSH+G
Sbjct  52    TAVLPFDLSPPPIDHDLLETVKSEGAKISEEGIVETFGNDGEALDAADNGVAVVDLSHFG  111

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSG+DR+QFLHNQSTANFEIL EGQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  112   RIRVSGDDRIQFLHNQSTANFEILREGQGCDTVFVTPTARTIDIAHAWIMKNAVILVVSP  171

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              T   IT ML KY+FF+DKVEIQDI+KQTC FV+VGP+SNQ++  LNLGDLVG+ YG+H+
Sbjct  172   LTCSSITEMLNKYVFFADKVEIQDITKQTCLFVVVGPKSNQVMRDLNLGDLVGEAYGTHR  231

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             HYSVNG P+T+ VGN+ISEEGFSLL+SPA A SVW+ L+  GAVPMGSNAWE+LRII+GR
Sbjct  232   HYSVNGMPITVGVGNVISEEGFSLLMSPAAAGSVWETLLSQGAVPMGSNAWEKLRIIKGR  291

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAPGKELT+EFNVLEA LWN++SL+KGCYKGQETISRL+TYDG+KQRLWGI LS+  EPG
Sbjct  292   PAPGKELTNEFNVLEAGLWNSISLDKGCYKGQETISRLITYDGLKQRLWGICLSAPAEPG  351

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             S I VDGKKVGKLTS T     S  FGLGYI++K A  GDTV +GD +VGTVVEVPFL R
Sbjct  352   SPIIVDGKKVGKLTSYTLGRKESDHFGLGYIKRKDALGGDTVTVGDNIVGTVVEVPFLAR  411

Query  1307  Q  1309
             Q
Sbjct  412   Q  412



>ref|XP_009616450.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=371

 Score =   530 bits (1364),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/321 (82%), Positives = 286/321 (89%), Gaps = 3/321 (1%)
 Frame = +2

Query  200   PENWTRNYS---TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATE  370
             P  + R +S    AALPFDLSPPPIDHDL+DTM VAGAKV E   I T+ ND+EAL A E
Sbjct  44    PTKFKRRFSFSSAAALPFDLSPPPIDHDLLDTMTVAGAKVSEDGAIGTFDNDEEALDAVE  103

Query  371   NGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  550
             N VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW
Sbjct  104   NAVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  163

Query  551   IMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNL  730
             IMK AITLV SP T ERIT ML+KYIFF+DKVEIQDI+ QT  FVL+GPRSNQI+E LNL
Sbjct  164   IMKTAITLVISPVTKERITGMLKKYIFFADKVEIQDITGQTSLFVLIGPRSNQIMEALNL  223

Query  731   GDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGS  910
              D+VGQPYGSHKHYSVNG P+T+ VGNIISEEG+SL++SPA A+SVWKAL+ +G +PMG+
Sbjct  224   ADVVGQPYGSHKHYSVNGMPITVGVGNIISEEGYSLMMSPAAAESVWKALLGHGTIPMGT  283

Query  911   NAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  1090
             NAWE LRI+QGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL
Sbjct  284   NAWETLRILQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  343

Query  1091  WGIRLsssvepgssisVDGKK  1153
             WGIR+SS VEPGS+ISVDGKK
Sbjct  344   WGIRVSSPVEPGSTISVDGKK  364



>ref|XP_003525008.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
[Glycine max]
 gb|KHN06496.1| Aminomethyltransferase [Glycine soja]
Length=423

 Score =   528 bits (1360),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 272/360 (76%), Positives = 313/360 (87%), Gaps = 0/360 (0%)
 Frame = +2

Query  239   PFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRV  418
             PFDLSPPPIDHD +DT+K AG ++    IIET+ NDDEAL A +NGV VVDLSH+GRIRV
Sbjct  61    PFDLSPPPIDHDFLDTVKTAGGEISGEGIIETFHNDDEALAAVDNGVVVVDLSHFGRIRV  120

Query  419   SGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSE  598
             SGEDR+QFLHNQSTANFE LHEGQGCDTVFVTPTARTIDIAHAW+MKNAITLV SPET  
Sbjct  121   SGEDRIQFLHNQSTANFESLHEGQGCDTVFVTPTARTIDIAHAWLMKNAITLVVSPETCT  180

Query  599   RITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSV  778
              IT ML KYIFF+DKVEIQDI+KQT FFVLVGP+S Q++E LNLGDLVG+PYG+H H++V
Sbjct  181   TITEMLNKYIFFADKVEIQDITKQTSFFVLVGPKSGQVMENLNLGDLVGKPYGTHLHFNV  240

Query  779   NGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPG  958
             +  P+TI VGNIISE+GFSLL+SPA A S+WKA++  GA+PMGSNAW +LRII+GRP PG
Sbjct  241   DKQPITIGVGNIISEDGFSLLMSPAAAASIWKAILSQGAIPMGSNAWNKLRIIRGRPTPG  300

Query  959   KELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssis  1138
              ELT+EFNVLEA LWN+VSLNKGCYKGQETISRL+TYDGIKQRLWG  LS++ EPGS I+
Sbjct  301   MELTNEFNVLEACLWNSVSLNKGCYKGQETISRLITYDGIKQRLWGFHLSAAAEPGSIIT  360

Query  1139  VDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLPP  1318
             VDGKKVGKLTS TS    S+ FGLGYI+++AASEGDTVI+GD + GTVVEVPFL +Q PP
Sbjct  361   VDGKKVGKLTSYTSGRKQSEHFGLGYIKRRAASEGDTVIVGDNIKGTVVEVPFLLQQRPP  420



>ref|XP_007222453.1| hypothetical protein PRUPE_ppa006188mg [Prunus persica]
 gb|EMJ23652.1| hypothetical protein PRUPE_ppa006188mg [Prunus persica]
Length=423

 Score =   528 bits (1360),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 268/366 (73%), Positives = 311/366 (85%), Gaps = 0/366 (0%)
 Frame = +2

Query  212   TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVD  391
             TR     ALPFDLSPPPIDHDL+D +   GAKV +  I+ET+GNDD+A  A +NGV V D
Sbjct  49    TRKGVVLALPFDLSPPPIDHDLLDIVATEGAKVSDDGIVETFGNDDQAFDAADNGVVVAD  108

Query  392   LSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAIT  571
             LSH+GRIRVSGEDR+QFLHNQ+TANFE LHEGQGCDTVFVTPTARTIDIAHAWIMKNA+ 
Sbjct  109   LSHFGRIRVSGEDRIQFLHNQTTANFECLHEGQGCDTVFVTPTARTIDIAHAWIMKNAVL  168

Query  572   LVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQP  751
             LV SP T   I+ ML KYIFF+DKVEIQDI+KQTCFFVLVGP+SNQI+E LNLGDLVGQP
Sbjct  169   LVVSPVTLRSISEMLNKYIFFNDKVEIQDITKQTCFFVLVGPKSNQIMEELNLGDLVGQP  228

Query  752   YGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELR  931
             YG+H+H+SVNG P+T+ VGN+ISE+GFSLL+SPA A SVWK ++  GA+PMGSNAWE+LR
Sbjct  229   YGTHQHFSVNGMPITVGVGNVISEKGFSLLMSPAAAGSVWKTILSQGAIPMGSNAWEKLR  288

Query  932   IIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLss  1111
             I QGRPAP KELT+E+NVLEA LWN++SLNKGCYKGQETI+RL+TYDG+KQRLW IRLS+
Sbjct  289   IFQGRPAPQKELTNEYNVLEAGLWNSISLNKGCYKGQETIARLITYDGVKQRLWAIRLSA  348

Query  1112  svepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvev  1291
               E GS I++DGKKVGKLTS TS    +  FGLGYI+++  SEGDTVI+GD V GTVVEV
Sbjct  349   PAEVGSLITIDGKKVGKLTSCTSGRKENGYFGLGYIKRQTVSEGDTVIVGDSVPGTVVEV  408

Query  1292  PFLGRQ  1309
             PFL  Q
Sbjct  409   PFLAGQ  414



>gb|KDO53498.1| hypothetical protein CISIN_1g014411mg [Citrus sinensis]
Length=425

 Score =   527 bits (1358),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 270/361 (75%), Positives = 310/361 (86%), Gaps = 0/361 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             TA LPFDLSPPPIDHDL++T+K  GAK+    I+ET+GND EAL A +NGVA VDLSH+G
Sbjct  54    TAVLPFDLSPPPIDHDLLETVKSEGAKISGEGIVETFGNDGEALDAADNGVAAVDLSHFG  113

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSG+DR+QFLHNQSTANFEIL EGQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  114   RIRVSGDDRIQFLHNQSTANFEILREGQGCDTVFVTPTARTIDIAHAWIMKNAVILVVSP  173

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              T   IT ML KY+FF+DKVEIQDI+KQTC FV+VGP+SNQ++  LNLGDLVG+ YG+H+
Sbjct  174   LTCSSITEMLNKYVFFADKVEIQDITKQTCLFVVVGPKSNQVMRDLNLGDLVGEAYGTHR  233

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             HYSVNG P+T+ VGN+ISEEGFSLL+SPA A SVW+ L+  GAVPMGSNAWE+LRII+GR
Sbjct  234   HYSVNGMPITVGVGNVISEEGFSLLMSPAAAGSVWETLLSQGAVPMGSNAWEKLRIIKGR  293

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAPGKELT+EFNVLEA LWN++SL+KGCYKGQETISRL+TYDG+KQRLWGI LS+  EPG
Sbjct  294   PAPGKELTNEFNVLEAGLWNSISLDKGCYKGQETISRLITYDGLKQRLWGICLSAPAEPG  353

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             S I VDGKKVGKLTS T     S  FGLGYI++K A  GDTV +GD +VGTVVEVPFL R
Sbjct  354   SPIIVDGKKVGKLTSYTLGRKESDHFGLGYIKRKDALGGDTVTVGDNIVGTVVEVPFLAR  413

Query  1307  Q  1309
             Q
Sbjct  414   Q  414



>ref|XP_008218780.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial [Prunus 
mume]
Length=423

 Score =   526 bits (1355),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 267/369 (72%), Positives = 309/369 (84%), Gaps = 0/369 (0%)
 Frame = +2

Query  212   TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVD  391
             TR     ALPFDLSPPPIDHDL+D +   GAKV +  I+ET+ NDD+A     NGV V D
Sbjct  49    TRKGVVLALPFDLSPPPIDHDLLDIVATEGAKVSDDGIVETFDNDDQAFDGAYNGVVVAD  108

Query  392   LSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAIT  571
             LSH+GRIRVSGEDR+QFLHNQ+TANFE LHEGQGCDTVFVTPTARTIDIAHAWIMKNA+ 
Sbjct  109   LSHFGRIRVSGEDRIQFLHNQTTANFECLHEGQGCDTVFVTPTARTIDIAHAWIMKNAVL  168

Query  572   LVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQP  751
             LV SP TS  I+ ML KYIFF+DKVEIQDI+KQTCFFVLVGP+SNQI+E LNLGDLVGQP
Sbjct  169   LVVSPVTSRSISEMLNKYIFFNDKVEIQDITKQTCFFVLVGPKSNQIMEELNLGDLVGQP  228

Query  752   YGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELR  931
             YG+H+H+SVNG P+T+ VGN+ISE+GFSLL+SPA A SVWK ++  GA+PMGSNAWE+LR
Sbjct  229   YGTHQHFSVNGMPITVGVGNVISEKGFSLLMSPAAAGSVWKTILSQGAIPMGSNAWEKLR  288

Query  932   IIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLss  1111
             I QGRPAP KELT+E+NVLEA LWN++SLNKGCYKGQETI+RL+TYDG+KQRLW IRLS+
Sbjct  289   IFQGRPAPQKELTNEYNVLEAGLWNSISLNKGCYKGQETIARLITYDGVKQRLWAIRLSA  348

Query  1112  svepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvev  1291
               E GS I++DGKKVGKLTS TS    +  FGLGYI+++  SEGDTVI+GD V G VVEV
Sbjct  349   PAEVGSLITIDGKKVGKLTSCTSGRKENGYFGLGYIKRQTVSEGDTVIVGDAVPGRVVEV  408

Query  1292  PFLGRQLPP  1318
             PFL  Q  P
Sbjct  409   PFLAGQRSP  417



>ref|XP_006471110.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006471111.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=425

 Score =   526 bits (1355),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 269/361 (75%), Positives = 310/361 (86%), Gaps = 0/361 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             TA LPFDLSPPPIDHDL++T+K  GAK+    I+ET+GND EAL A +NGVA VDLSH+G
Sbjct  54    TAVLPFDLSPPPIDHDLLETVKSEGAKISGEGIVETFGNDGEALDAADNGVAAVDLSHFG  113

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSG+DR+QFLHNQSTANFEIL EGQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  114   RIRVSGDDRIQFLHNQSTANFEILREGQGCDTVFVTPTARTIDIAHAWIMKNAVILVVSP  173

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              T   IT ML +Y+FF+DKVEIQDI+KQTC FV+VGP+SNQ++  LNLGDLVG+ YG+H+
Sbjct  174   LTCSSITEMLNRYVFFADKVEIQDITKQTCLFVVVGPKSNQVMRDLNLGDLVGEAYGTHR  233

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             HYSVNG P+T+ VGN+ISEEGFSLL+SPA A SVW+ L+  GAVPMGSNAWE+LRII+GR
Sbjct  234   HYSVNGMPITVGVGNVISEEGFSLLMSPAAAGSVWETLLSQGAVPMGSNAWEKLRIIKGR  293

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAPGKELT+EFNVLEA LWN++SL+KGCYKGQETISRL+TYDG+KQRLWGI LS+  EPG
Sbjct  294   PAPGKELTNEFNVLEAGLWNSISLDKGCYKGQETISRLITYDGLKQRLWGICLSAPAEPG  353

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             S I VDGKKVGKLTS T     S  FGLGYI++K A  GDTV +GD +VGTVVEVPFL R
Sbjct  354   SPIIVDGKKVGKLTSYTLGRKESDHFGLGYIKRKDALGGDTVTVGDNIVGTVVEVPFLAR  413

Query  1307  Q  1309
             Q
Sbjct  414   Q  414



>ref|XP_002269147.1| PREDICTED: aminomethyltransferase, mitochondrial [Vitis vinifera]
 emb|CBI23776.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   523 bits (1347),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 273/381 (72%), Positives = 319/381 (84%), Gaps = 2/381 (1%)
 Frame = +2

Query  179   LQNNAFR-PENWTRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEA  355
             +QN+AFR PE +    + AA PFDLSPPPID DL+DT+  AGA+V E  IIET+ NDDEA
Sbjct  45    IQNHAFRSPEKFFTPLA-AASPFDLSPPPIDLDLLDTVTEAGAEVSEAGIIETFDNDDEA  103

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             L A +NGV VVDLSH+GRIRVSG+DR+QFLHNQSTANFE L EGQGCDTVFVTPTARTID
Sbjct  104   LDAVDNGVVVVDLSHFGRIRVSGDDRIQFLHNQSTANFECLQEGQGCDTVFVTPTARTID  163

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             +AHAWIMKNA+TLV SP T   I  ML KYIFF+DKVEIQDI+K+T FFVLVGP+S+Q++
Sbjct  164   VAHAWIMKNAVTLVVSPVTCGSIIEMLTKYIFFADKVEIQDITKKTSFFVLVGPKSHQVM  223

Query  716   EGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGA  895
             E LNLG LVG+PYG+H+H+ VNG P+T+ VGN ISE+GFS ++SPA A SVWKAL+  GA
Sbjct  224   EDLNLGALVGKPYGTHQHFMVNGMPITVGVGNAISEDGFSFMMSPAIAGSVWKALLSQGA  283

Query  896   VPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDG  1075
             +PMGSNAWE+LRI QGRPAPGKELT+EFNVLEA LWN++SLNKGCYKGQETISRL+TYDG
Sbjct  284   IPMGSNAWEKLRIFQGRPAPGKELTNEFNVLEAGLWNSISLNKGCYKGQETISRLITYDG  343

Query  1076  IKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtvi  1255
             +KQRLWGI LS   EPGS I+ DGKKVGKLTS       S+ FGLGYI+++AAS G+TVI
Sbjct  344   VKQRLWGISLSGPAEPGSPITADGKKVGKLTSYACGRTESEHFGLGYIKRQAASNGNTVI  403

Query  1256  igdgvvgtvvevPFLGRQLPP  1318
             +GD + GTVVEVPFL  Q PP
Sbjct  404   VGDNIAGTVVEVPFLAWQSPP  424



>ref|XP_007159583.1| hypothetical protein PHAVU_002G249600g [Phaseolus vulgaris]
 gb|ESW31577.1| hypothetical protein PHAVU_002G249600g [Phaseolus vulgaris]
Length=423

 Score =   522 bits (1344),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 268/362 (74%), Positives = 315/362 (87%), Gaps = 0/362 (0%)
 Frame = +2

Query  233   ALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRI  412
             +LPFDLSPPPIDHD +D +K AG  +    IIET+ NDDEAL A ENGV VVDLSH+GR+
Sbjct  56    SLPFDLSPPPIDHDFLDDVKTAGRDISGEGIIETFHNDDEALDAVENGVVVVDLSHFGRL  115

Query  413   RVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPET  592
             RVSGEDR++FLHNQSTANFE LHEGQGCDTVFVTPTARTIDIAHAW+MKNAITLV SP+T
Sbjct  116   RVSGEDRIKFLHNQSTANFECLHEGQGCDTVFVTPTARTIDIAHAWLMKNAITLVVSPKT  175

Query  593   SERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHY  772
                I  ML KYIFF+DKVEIQDI+KQT FF +VGP+S Q++E LNLGDLVG+PYG+H+H+
Sbjct  176   CTTIMEMLNKYIFFADKVEIQDITKQTSFFAMVGPKSGQVMENLNLGDLVGKPYGTHQHF  235

Query  773   SVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPA  952
             +V+  P+TI VGNIISE GFSLL+SPATA S+WKA++  GA+PMGSNAW +LRI++GRPA
Sbjct  236   NVDKQPITIGVGNIISEGGFSLLMSPATAPSIWKAILAQGAIPMGSNAWNKLRILRGRPA  295

Query  953   PGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgss  1132
             PG ELT+EFNVLEA LW++VSLNKGCYKGQETISRL+TYDGIKQRLWGI LS++ EPGSS
Sbjct  296   PGMELTNEFNVLEACLWSSVSLNKGCYKGQETISRLITYDGIKQRLWGINLSAAAEPGSS  355

Query  1133  isVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQL  1312
             I+VDGKKVGKLTS TS    S+ FGLGY++++AASEGDTVI+GD + GTVVEVPFL +Q 
Sbjct  356   ITVDGKKVGKLTSYTSGRKQSEHFGLGYLKRRAASEGDTVIVGDNIKGTVVEVPFLSQQR  415

Query  1313  PP  1318
             PP
Sbjct  416   PP  417



>gb|KDP38853.1| hypothetical protein JCGZ_05010 [Jatropha curcas]
Length=443

 Score =   523 bits (1346),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 257/370 (69%), Positives = 308/370 (83%), Gaps = 0/370 (0%)
 Frame = +2

Query  197   RPENWTRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENG  376
             + ++W R  ++AA PFDLSPPPIDHDL++ +   GAKV E +IIET+ NDDEAL A  NG
Sbjct  58    KTDSWRRISASAASPFDLSPPPIDHDLLEIVTADGAKVSEDEIIETFDNDDEALDAFNNG  117

Query  377   VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIM  556
             V V+D SHYGRIRVSG+DR+QFLHNQSTANFE LHEG+GCDTVFVT TARTID+AHAW+M
Sbjct  118   VVVLDCSHYGRIRVSGDDRIQFLHNQSTANFECLHEGEGCDTVFVTATARTIDLAHAWVM  177

Query  557   KNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD  736
             KN++ LV SP T   +T ML KYIFF+DKVEIQD++K+TCFF+L GP+S Q++  LNLGD
Sbjct  178   KNSVILVVSPVTCGSLTQMLNKYIFFADKVEIQDVTKKTCFFILAGPQSKQLMIDLNLGD  237

Query  737   LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNA  916
             LVGQPYG+H+HYS NG P+T+ VGN+ISEEG+SLL+SPA A SVWK L+  GA+PMGSNA
Sbjct  238   LVGQPYGTHRHYSANGMPITVGVGNVISEEGYSLLMSPAAAGSVWKTLLSQGAIPMGSNA  297

Query  917   WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWG  1096
             WE+LRIIQG PAPGKELTDEFNVLEA LWN++SLNKGCYKGQETISRL+TYDG+KQRLWG
Sbjct  298   WEKLRIIQGIPAPGKELTDEFNVLEAGLWNSISLNKGCYKGQETISRLITYDGVKQRLWG  357

Query  1097  IRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvg  1276
             I LS+  EPGS I++DG+KVGKLTS TS    S+ F LGYI+++  SEG TV + D +VG
Sbjct  358   IHLSAPAEPGSLITIDGRKVGKLTSYTSGRKESEHFALGYIKRQTVSEGSTVTVEDNIVG  417

Query  1277  tvvevPFLGR  1306
             TV   PFL R
Sbjct  418   TVANTPFLAR  427



>ref|XP_010268964.1| PREDICTED: aminomethyltransferase, mitochondrial [Nelumbo nucifera]
Length=430

 Score =   520 bits (1339),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 240/338 (71%), Positives = 293/338 (87%), Gaps = 0/338 (0%)
 Frame = +2

Query  224   STAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHY  403
             + +ALPFD+SPPPIDHDL+DT+  AGA + E   +ET+GNDDEA+ A + G  VVDL+H+
Sbjct  61    TASALPFDVSPPPIDHDLLDTLADAGAMISEVGTVETFGNDDEAVHAVDEGAVVVDLTHF  120

Query  404   GRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTS  583
             GRIRV+GED++QFLHNQSTANFE LHEGQGCDTVFVTPTARTIDIAHAWIMKNA+TL+ S
Sbjct  121   GRIRVTGEDKIQFLHNQSTANFECLHEGQGCDTVFVTPTARTIDIAHAWIMKNAVTLLVS  180

Query  584   PETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSH  763
             P T + I  ML KYIF +DKVE+ DISKQTCFFV++GP+SNQ++E LN+GDL+GQPYG+H
Sbjct  181   PLTCKSIAEMLMKYIFLADKVEVHDISKQTCFFVILGPKSNQVMEDLNVGDLIGQPYGTH  240

Query  764   KHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQG  943
             +HYSVNG P+T+ VG+++S+EGFSLL+SPA A SVWK L+  GA+PMG+NAWE LRI+QG
Sbjct  241   QHYSVNGMPITVGVGSVVSQEGFSLLLSPAAAVSVWKTLIGAGAIPMGANAWERLRILQG  300

Query  944   RPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvep  1123
             RPAPGKELT+E+NVLEA LWN++SLNKGCYKGQETISRL+TYDG+KQRLWG+ LS   EP
Sbjct  301   RPAPGKELTNEYNVLEAGLWNSISLNKGCYKGQETISRLITYDGVKQRLWGLHLSGPAEP  360

Query  1124  gssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAAS  1237
             GS I+VDGKKVGKLTS T   + ++  GLGYI++KAAS
Sbjct  361   GSLITVDGKKVGKLTSYTIGRNENEHVGLGYIKRKAAS  398



>ref|XP_007042607.1| Glycine cleavage T-protein family isoform 1 [Theobroma cacao]
 gb|EOX98438.1| Glycine cleavage T-protein family isoform 1 [Theobroma cacao]
Length=428

 Score =   520 bits (1338),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 261/363 (72%), Positives = 312/363 (86%), Gaps = 0/363 (0%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AALPF+LSPPPIDHD +DT+   GAKV E  IIET+ NDDEAL A +NGV V+DLSH+GR
Sbjct  60    AALPFELSPPPIDHDFLDTVTAEGAKVSEEGIIETFENDDEALDAFDNGVVVMDLSHFGR  119

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSG+DR+QFLHNQ+TA+FE L EGQGCDTVFVTPTARTIDIA+AWIMK A+ LV SPE
Sbjct  120   IRVSGDDRIQFLHNQTTADFECLSEGQGCDTVFVTPTARTIDIAYAWIMKKAVVLVVSPE  179

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T   IT ML KY+FF+DKVEIQDI+KQTC F L GP+SNQ++  LNL DLVGQPYG+++H
Sbjct  180   TRGNITEMLNKYVFFADKVEIQDITKQTCLFALAGPKSNQVMANLNLSDLVGQPYGTNRH  239

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             YSVNG P+T+ VGNIIS+EGFSLL+SP TA SVWK L+  GA+P+G NAWE+LR+IQGRP
Sbjct  240   YSVNGMPLTVGVGNIISQEGFSLLMSPTTAGSVWKTLLSQGAIPLGFNAWEKLRVIQGRP  299

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELT+EFNVLEA LWN++S+NKGCYKGQETISRL+TYDG+KQRLWGI LS+ VEPGS
Sbjct  300   APGKELTNEFNVLEAGLWNSISMNKGCYKGQETISRLITYDGVKQRLWGIHLSAPVEPGS  359

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
              I+V+GKKVGKLTS T+    S  F LGYI+++AAS GDTV++G+ ++GTVV+VPFL +Q
Sbjct  360   PITVNGKKVGKLTSYTTGRKESDHFALGYIKRQAASCGDTVVVGENILGTVVDVPFLSQQ  419

Query  1310  LPP  1318
              PP
Sbjct  420   SPP  422



>gb|KHG18257.1| gcvT [Gossypium arboreum]
Length=434

 Score =   516 bits (1330),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 268/389 (69%), Positives = 323/389 (83%), Gaps = 10/389 (3%)
 Frame = +2

Query  182   QNNAFRPENWTRNYST---------AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIET  334
             QN AFR +  T+N  +         AALPF+LSPPPIDHD +D++   GAKV E  IIET
Sbjct  36    QNAAFRTKKTTKNNLSSRNTSSTIAAALPFELSPPPIDHDFLDSVTGEGAKVSEEGIIET  95

Query  335   YGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVT  514
             + NDDEAL A +NGV V+DLSH+GR+RVSG+DR+QFLHNQ+TANFE L EGQGC+TVFVT
Sbjct  96    FENDDEALDAFDNGVVVMDLSHFGRLRVSGDDRIQFLHNQTTANFECLSEGQGCETVFVT  155

Query  515   PTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVG  694
             PTARTIDIA+AWIMK A+ LV SPET   IT ML KYIFF+DKVEIQDI+KQTCFF L G
Sbjct  156   PTARTIDIAYAWIMKKAVLLVLSPETCGNITEMLNKYIFFADKVEIQDITKQTCFFALSG  215

Query  695   PRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWK  874
             P+S++++  LNLGD+VGQPYG+++HY+VNG PVT+ VGNIIS+EGFSLL+SPA A SVWK
Sbjct  216   PKSSEVMANLNLGDVVGQPYGTNRHYNVNGMPVTVGVGNIISDEGFSLLMSPAAADSVWK  275

Query  875   ALVDYGAVPMGSNAWEELRIIQ-GRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
              L+  GA+P+GSNAWE+LRI Q GRPAPGKELT++FNVLEA LWN++SLNKGCYKGQETI
Sbjct  276   TLLSKGAIPLGSNAWEKLRITQGGRPAPGKELTNDFNVLEAGLWNSISLNKGCYKGQETI  335

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             SRL+TYDG+KQRLWGI LS+  EPGS I+V+GKKVGKLTS T+       F LGYI++KA
Sbjct  336   SRLITYDGVKQRLWGIHLSAPAEPGSPITVNGKKVGKLTSYTTGRKECDHFALGYIKRKA  395

Query  1232  ASegdtviigdgvvgtvvevPFLGRQLPP  1318
             AS+GDTVI+G+ ++GTVV+VPFL RQ PP
Sbjct  396   ASDGDTVIVGEKIIGTVVDVPFLSRQSPP  424



>ref|XP_011087736.1| PREDICTED: uncharacterized protein LOC105169131 [Sesamum indicum]
Length=411

 Score =   507 bits (1305),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 266/383 (69%), Positives = 312/383 (81%), Gaps = 3/383 (1%)
 Frame = +2

Query  179   LQNNAF---RPENWTRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDD  349
             L+ +AF   +  N  R     ALPFD+SPPPID D ++T+    A+       +TYGNDD
Sbjct  26    LRKDAFWCHQKRNKKRLSVACALPFDISPPPIDLDPLETIIDPEAEASGEVTADTYGNDD  85

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
             EA+ A +NGVAVVDLS+YGRIRVSGEDR+QFLHNQ+TANFE L EGQGCDTVFVTPTART
Sbjct  86    EAVDAVDNGVAVVDLSNYGRIRVSGEDRIQFLHNQTTANFECLDEGQGCDTVFVTPTART  145

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             IDI+HAW+MKNAI LV SP T   I  ML+KYIFF+DKVEIQDI++QT  F L+GP+SN+
Sbjct  146   IDISHAWVMKNAIVLVVSPMTCGSIIEMLKKYIFFADKVEIQDITEQTSMFALLGPKSNK  205

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             I+E LNLGDLVGQPYGSHKHYSV G P+T+AVG+I S EGF+ ++SPA A SVWKAL+  
Sbjct  206   IMEDLNLGDLVGQPYGSHKHYSVGGMPLTVAVGSITSVEGFTFMMSPAVAGSVWKALLGQ  265

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA+ MGS+ WE LRI++GRP PGKELTDEFNVLEA LW AVSLNKGCYKGQETISRLVTY
Sbjct  266   GAISMGSSTWETLRILRGRPTPGKELTDEFNVLEAGLWRAVSLNKGCYKGQETISRLVTY  325

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdt  1249
             DGIKQRLWGIRLSS V P S I++DGKKVGKLTS T+   +S PFGLGYI+++AASE D+
Sbjct  326   DGIKQRLWGIRLSSPVGPCSIITIDGKKVGKLTSFTAGTKSSGPFGLGYIKRRAASESDS  385

Query  1250  viigdgvvgtvvevPFLGRQLPP  1318
             V +GD V+GT+VEVPFL  QLPP
Sbjct  386   VTVGDSVIGTLVEVPFLREQLPP  408



>ref|XP_004140110.1| PREDICTED: aminomethyltransferase-like [Cucumis sativus]
 ref|XP_004164084.1| PREDICTED: aminomethyltransferase-like [Cucumis sativus]
 gb|KGN47936.1| hypothetical protein Csa_6G417880 [Cucumis sativus]
Length=445

 Score =   507 bits (1306),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 266/388 (69%), Positives = 311/388 (80%), Gaps = 8/388 (2%)
 Frame = +2

Query  176   RLQNNAFRPENWTRNY--------STAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIE  331
             RL    FRP +  + +        S +ALPFDLSPPPID DL++   V GA++ +  IIE
Sbjct  43    RLHLPPFRPPHIKKPHIKASRTRTSFSALPFDLSPPPIDEDLLEAAAVEGARISDDGIIE  102

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             T+ ND+EAL A  NGVAVVDLSH+GR+RVSG+DR QFLHNQSTANFE L +GQGC TVFV
Sbjct  103   TFHNDEEALDAANNGVAVVDLSHFGRLRVSGDDRCQFLHNQSTANFESLRQGQGCSTVFV  162

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             TPTARTIDIA AWIMKNAITL+ SP T E I  ML KYIF +DKVEIQDI+ QT   VLV
Sbjct  163   TPTARTIDIAQAWIMKNAITLIVSPVTRESIIRMLNKYIFVADKVEIQDITNQTSLLVLV  222

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP+SNQI+E LNLG + G+PYG+H+H+SVNG P+T+ VGN+ISEEGFSLL+SPA A  VW
Sbjct  223   GPKSNQIMEDLNLGSIAGEPYGTHQHFSVNGMPITVGVGNVISEEGFSLLISPAVAGPVW  282

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             KALV  GAVPMGS AWE+LRI QG PAP KELTDEFNVLEA LWN++SLNKGCYKGQETI
Sbjct  283   KALVSLGAVPMGSRAWEKLRISQGMPAPQKELTDEFNVLEAGLWNSISLNKGCYKGQETI  342

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             SRL+TYDG+KQRLWG++LS SVEPGS I++DGK+VGKLTS       S+ FGLGYI+KKA
Sbjct  343   SRLITYDGVKQRLWGLQLSDSVEPGSPITIDGKRVGKLTSYAPGRKESEHFGLGYIKKKA  402

Query  1232  ASegdtviigdgvvgtvvevPFLGRQLP  1315
             AS GD+VI+G+  +G VVEVPFL RQ P
Sbjct  403   ASVGDSVIVGENTIGKVVEVPFLARQQP  430



>ref|XP_002529546.1| fad oxidoreductase, putative [Ricinus communis]
 gb|EEF32849.1| fad oxidoreductase, putative [Ricinus communis]
Length=433

 Score =   506 bits (1304),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 256/364 (70%), Positives = 305/364 (84%), Gaps = 0/364 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             +A+ PFDLSPPPIDHD ++T+   GAKV E  IIET+ NDDEAL A  N V ++DLSH+G
Sbjct  64    SASSPFDLSPPPIDHDFLETVAADGAKVSEDGIIETFDNDDEALLAFHNSVVILDLSHFG  123

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSG+DR+QFLHNQSTANF+ LHEGQGC TVFVTPTART+DIAHAWIMKN++ LV SP
Sbjct  124   RIRVSGDDRIQFLHNQSTANFQCLHEGQGCHTVFVTPTARTLDIAHAWIMKNSVMLVVSP  183

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              T   IT ML KYIFF+D VEIQDI+K+T FF+L GP+S+Q++  LNLGD+VGQPYG+H 
Sbjct  184   VTCGSITQMLNKYIFFADNVEIQDITKKTSFFILAGPQSDQVMANLNLGDVVGQPYGTHL  243

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             HYSVNG P+T+  GNIISE G+SLL+S A A+SVWK L+  GAVPMGSNAWE+LRIIQG 
Sbjct  244   HYSVNGMPITVGAGNIISEYGYSLLMSSAAAESVWKTLLSQGAVPMGSNAWEKLRIIQGI  303

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAPGKELT+EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDG+KQRLWGI LS+  EPG
Sbjct  304   PAPGKELTNEFNVLEAGLWNSISLNKGCYKGQETIARLITYDGVKQRLWGIHLSAPAEPG  363

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             S I+VDG KVGKLTS TS  +  + +GLGYI+++  SEG TVI+GD +VGTVV+ PFL R
Sbjct  364   SLITVDGIKVGKLTSYTSGRNKPEHYGLGYIKRQTVSEGSTVIVGDKIVGTVVDPPFLAR  423

Query  1307  QLPP  1318
             Q PP
Sbjct  424   QRPP  427



>ref|XP_003629967.1| Aminomethyltransferase [Medicago truncatula]
 gb|AET04443.1| glycine cleavage T-protein aminomethyltransferase [Medicago truncatula]
Length=422

 Score =   505 bits (1301),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 258/358 (72%), Positives = 305/358 (85%), Gaps = 0/358 (0%)
 Frame = +2

Query  242   FDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVS  421
             FDLSPPPIDHD +DT+K AGA+V    I+ET+ ND+EAL A +NGV VVDLSH+GRIRVS
Sbjct  58    FDLSPPPIDHDFLDTVKTAGAEVSGEGIVETFHNDEEALDAADNGVVVVDLSHFGRIRVS  117

Query  422   GEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSER  601
             G+DRVQFLHNQSTANFE L  GQGCDTVFVTPTARTIDIAHAWIMKNAITLV S ETS  
Sbjct  118   GDDRVQFLHNQSTANFEGLQAGQGCDTVFVTPTARTIDIAHAWIMKNAITLVVSAETSRT  177

Query  602   ITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVN  781
             IT ML KYIFF+DKVEIQDI+KQT  FVL GP+S Q++E LNLGDL+G+PYG+H+H+ V+
Sbjct  178   ITEMLNKYIFFADKVEIQDITKQTSLFVLAGPKSGQVMESLNLGDLIGKPYGTHQHFYVD  237

Query  782   GNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGK  961
               P+TI VGNIISE GFSL++SPA A SVWKA++  GAV MGSNAW +LR+IQGRPAPG 
Sbjct  238   KQPITIGVGNIISEGGFSLMMSPAAAPSVWKAILAQGAVAMGSNAWNKLRVIQGRPAPGM  297

Query  962   ELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisV  1141
             ELT+EFNV+EA LWN++SLNKGCYKGQETI+RL+TYDG+KQRLWG  LS++ EPGS I+V
Sbjct  298   ELTNEFNVMEACLWNSISLNKGCYKGQETIARLITYDGVKQRLWGFHLSAAAEPGSIITV  357

Query  1142  DGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLP  1315
             DGKKVGKLTS  S    S+ FGLGYI+++ ASEGD+VI+GD ++GT+VE PFL +Q P
Sbjct  358   DGKKVGKLTSYASGRKPSEHFGLGYIKRQTASEGDSVIVGDNIIGTIVEAPFLSQQRP  415



>gb|KHG18256.1| gcvT [Gossypium arboreum]
Length=446

 Score =   505 bits (1300),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 322/401 (80%), Gaps = 22/401 (5%)
 Frame = +2

Query  182   QNNAFRPENWTRNYST---------AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIET  334
             QN AFR +  T+N  +         AALPF+LSPPPIDHD +D++   GAKV E  IIET
Sbjct  36    QNAAFRTKKTTKNNLSSRNTSSTIAAALPFELSPPPIDHDFLDSVTGEGAKVSEEGIIET  95

Query  335   YGNDDEALTATENGVAVVDLSHYGRIR------------VSGEDRVQFLHNQSTANFEIL  478
             + NDDEAL A +NGV V+DLSH+GR+R             SG+DR+QFLHNQ+TANFE L
Sbjct  96    FENDDEALDAFDNGVVVMDLSHFGRLRGWCLRLIPASINFSGDDRIQFLHNQTTANFECL  155

Query  479   HEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQD  658
              EGQGC+TVFVTPTARTIDIA+AWIMK A+ LV SPET   IT ML KYIFF+DKVEIQD
Sbjct  156   SEGQGCETVFVTPTARTIDIAYAWIMKKAVLLVLSPETCGNITEMLNKYIFFADKVEIQD  215

Query  659   ISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSL  838
             I+KQTCFF L GP+S++++  LNLGD+VGQPYG+++HY+VNG PVT+ VGNIIS+EGFSL
Sbjct  216   ITKQTCFFALSGPKSSEVMANLNLGDVVGQPYGTNRHYNVNGMPVTVGVGNIISDEGFSL  275

Query  839   LVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQ-GRPAPGKELTDEFNVLEANLWNAVS  1015
             L+SPA A SVWK L+  GA+P+GSNAWE+LRI Q GRPAPGKELT++FNVLEA LWN++S
Sbjct  276   LMSPAAADSVWKTLLSKGAIPLGSNAWEKLRITQGGRPAPGKELTNDFNVLEAGLWNSIS  335

Query  1016  LNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTS  1195
             LNKGCYKGQETISRL+TYDG+KQRLWGI LS+  EPGS I+V+GKKVGKLTS T+     
Sbjct  336   LNKGCYKGQETISRLITYDGVKQRLWGIHLSAPAEPGSPITVNGKKVGKLTSYTTGRKEC  395

Query  1196  KPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLPP  1318
               F LGYI++KAAS+GDTVI+G+ ++GTVV+VPFL RQ PP
Sbjct  396   DHFALGYIKRKAASDGDTVIVGEKIIGTVVDVPFLSRQSPP  436



>gb|EYU26528.1| hypothetical protein MIMGU_mgv1a007218mg [Erythranthe guttata]
Length=414

 Score =   503 bits (1296),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 264/364 (73%), Positives = 304/364 (84%), Gaps = 2/364 (1%)
 Frame = +2

Query  233   ALPFDLSPPPIDHDL--IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             ALPFDLSPPPID D   ++T   A  +V E     TYGNDDEAL A +NGV VVDLS YG
Sbjct  48    ALPFDLSPPPIDLDFDPLETTTTAEPEVSEDGTAITYGNDDEALDAADNGVVVVDLSDYG  107

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSGEDR+QFLHNQ+TANFE L EGQGCDTVFVTPTARTIDI+HAW+MKNA+ L+ SP
Sbjct  108   RIRVSGEDRIQFLHNQTTANFESLGEGQGCDTVFVTPTARTIDISHAWVMKNAVVLLVSP  167

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              T   IT ML KYIFFSDKVEIQDI+ QT  F L GP+S++I+E LNLGDLVGQPYGSHK
Sbjct  168   MTCGSITKMLNKYIFFSDKVEIQDITNQTSIFALSGPKSSKIMEDLNLGDLVGQPYGSHK  227

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             HYSV G P+T+AVG+IIS EGF+ ++SP  A+SVWKAL+  GA+PMGS+AWE LRI++GR
Sbjct  228   HYSVGGMPLTVAVGSIISVEGFTFMMSPTAARSVWKALLAQGAIPMGSSAWETLRILRGR  287

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepg  1126
             PAPGKELTDEFNVLEA LW A+SLNKGCYKGQETI+RLVTYDGIKQ LWGIRLSS VEP 
Sbjct  288   PAPGKELTDEFNVLEAGLWRALSLNKGCYKGQETIARLVTYDGIKQTLWGIRLSSPVEPS  347

Query  1127  ssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
             + ++VDGKKVGKLTS T+   TS PFGLGYI+++AASEGD+V +GD VVGT+VE+PFL  
Sbjct  348   TIVTVDGKKVGKLTSFTAGTKTSGPFGLGYIKRRAASEGDSVTVGDNVVGTLVELPFLRD  407

Query  1307  QLPP  1318
             Q PP
Sbjct  408   QRPP  411



>ref|XP_010473299.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial [Camelina 
sativa]
 ref|XP_010473300.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial [Camelina 
sativa]
 ref|XP_010473301.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial [Camelina 
sativa]
Length=432

 Score =   503 bits (1294),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 255/383 (67%), Positives = 310/383 (81%), Gaps = 3/383 (1%)
 Frame = +2

Query  179   LQNNAFRPENW---TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDD  349
             L+ + FR   +     + S+ +L FD SPPPIDHDL DT+ VAG KV E  ++E++ NDD
Sbjct  44    LRTSGFRERKFQLRCVSASSDSLQFDFSPPPIDHDLHDTISVAGGKVSEDGVVESFDNDD  103

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
             EAL A +NGV VVDLSH+GRIRVSG+DR  FLHNQ+TANFE L+EGQGCDTVFVTPTART
Sbjct  104   EALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLNEGQGCDTVFVTPTART  163

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             IDIAHAWIMKNAI L  SP T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SNQ
Sbjct  164   IDIAHAWIMKNAILLTVSPTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQ  223

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             I+  LNLGDL+GQPYG H+HYS +G P+T+AVG++IS+EGF++L+SP  A SVWK L+  
Sbjct  224   IMSKLNLGDLIGQPYGQHQHYSFDGMPITVAVGSLISDEGFTMLMSPGGAVSVWKTLLAE  283

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA+PMGS AWE+LRI QGRPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TY
Sbjct  284   GAIPMGSVAWEKLRITQGRPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLITY  343

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdt  1249
             DGIKQRL G+ LS+  EPGS+I+V+GKKVGKLTS T+  + S  FGLGYI+K+AAS G+T
Sbjct  344   DGIKQRLCGLNLSAPAEPGSTITVEGKKVGKLTSYTTGRNGSGHFGLGYIKKQAASVGNT  403

Query  1250  viigdgvvgtvvevPFLGRQLPP  1318
             V IG+ + G V EVP+L RQ PP
Sbjct  404   VTIGEDISGIVSEVPYLARQHPP  426



>ref|XP_010065464.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Eucalyptus 
grandis]
 ref|XP_010065465.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Eucalyptus 
grandis]
 ref|XP_010065466.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Eucalyptus 
grandis]
 ref|XP_010065467.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X1 [Eucalyptus 
grandis]
 gb|KCW62970.1| hypothetical protein EUGRSUZ_G00568 [Eucalyptus grandis]
Length=415

 Score =   501 bits (1291),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 251/362 (69%), Positives = 303/362 (84%), Gaps = 1/362 (0%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AA PFDLSPPPIDHDL ++M  AGAKV +  ++E+Y NDDEAL A +NG+AVVDLSH+GR
Sbjct  51    AATPFDLSPPPIDHDLAESMVGAGAKVSDDGVVESYDNDDEALDAADNGLAVVDLSHFGR  110

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSGEDRV FL NQ+TANFE L+EG+GCDTVFVTPTARTIDI +AWIMKNAITLV SP 
Sbjct  111   IRVSGEDRVSFLQNQTTANFECLNEGEGCDTVFVTPTARTIDIGYAWIMKNAITLVVSPV  170

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T + IT ML KYIFF+DKVEI DI+KQT FFVL+GP+SNQ++E LNL DL GQPYGSHKH
Sbjct  171   TCQSITEMLTKYIFFADKVEITDITKQTSFFVLLGPKSNQVMEHLNLKDLDGQPYGSHKH  230

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             YS+NG PVT  VGN++SEEG+S+L SPA A +VW  L  +GA+PMG+NAWE LRI++GRP
Sbjct  231   YSINGMPVTAGVGNLVSEEGYSILTSPAAATTVWDILFSHGAIPMGANAWERLRILRGRP  290

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELT E+NVLEA LWN++SL+KGCYKGQETISRL+TYDG+KQ LWG+ L +  +P S
Sbjct  291   APGKELTKEYNVLEAGLWNSISLDKGCYKGQETISRLITYDGVKQSLWGVHLDAPAKPES  350

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
              I V+GKKVGKLTS TS+ +    FGLGYI+++AASEG TV++GD + G VV +P+L +Q
Sbjct  351   PILVEGKKVGKLTSCTSTREPGY-FGLGYIKRQAASEGSTVLVGDDIAGRVVNLPYLAKQ  409

Query  1310  LP  1315
              P
Sbjct  410   RP  411



>ref|XP_010418048.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
[Camelina sativa]
 ref|XP_010418049.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
[Camelina sativa]
Length=424

 Score =   502 bits (1292),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 310/383 (81%), Gaps = 3/383 (1%)
 Frame = +2

Query  179   LQNNAFRPENW---TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDD  349
             L+N+ FR   +     + S+ +L FD SPPPIDHDL DT+ VAG KV E  ++E++ NDD
Sbjct  36    LRNSGFRERKFQLRCVSASSDSLQFDFSPPPIDHDLHDTISVAGGKVSEDGVVESFDNDD  95

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
             EAL A +NGV VVDLSH+GRIRVSG+DR  FLHNQ+TA+FE L+EGQGCDTVFVTPTART
Sbjct  96    EALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTADFESLNEGQGCDTVFVTPTART  155

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             IDIAHAWIMKNAI L  SP T + I  M+ KYIFF+DKVEI+DI+KQTC F L GP+SNQ
Sbjct  156   IDIAHAWIMKNAILLTVSPTTCQSIIEMMNKYIFFADKVEIKDITKQTCLFALAGPKSNQ  215

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             I+  LNLGDL+GQPYG H+HYS +G P+T+AVG++IS+EGF++L+SP  A SVWK L+  
Sbjct  216   IMSKLNLGDLIGQPYGQHQHYSFDGMPITVAVGSLISDEGFTMLMSPGGAVSVWKTLLAE  275

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA+PMGS AWE+LRI QGRPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TY
Sbjct  276   GAIPMGSVAWEKLRITQGRPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLITY  335

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdt  1249
             DGIKQRL G+ LS+  EPGS+I+VDGKKVGKLTS T+  + S  FGLGYI+K+AAS G+T
Sbjct  336   DGIKQRLCGLNLSAPAEPGSTITVDGKKVGKLTSYTTGRNGSGHFGLGYIKKQAASIGNT  395

Query  1250  viigdgvvgtvvevPFLGRQLPP  1318
             V +G+ + G V EVP+L RQ  P
Sbjct  396   VTVGEDISGIVSEVPYLARQHSP  418



>ref|XP_010430088.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
[Camelina sativa]
 ref|XP_010430089.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial-like 
[Camelina sativa]
Length=432

 Score =   501 bits (1291),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 253/383 (66%), Positives = 310/383 (81%), Gaps = 3/383 (1%)
 Frame = +2

Query  179   LQNNAFRPENW---TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDD  349
             L+ + FR   +     + S+ +L FD SPPPIDHDL DT+ VAG KV E  ++E++ NDD
Sbjct  44    LRTSGFRERKFQLRCVSASSDSLQFDFSPPPIDHDLHDTISVAGGKVSEDGVVESFDNDD  103

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
             EAL A +NGV VVDLSH+GRIRVSG+DR  FLHNQ+TA+FE L+EGQGCDTVFVTPTART
Sbjct  104   EALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTADFESLNEGQGCDTVFVTPTART  163

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             IDIAHAW+MKNAI L  SP T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SNQ
Sbjct  164   IDIAHAWVMKNAILLTVSPTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQ  223

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             I+  LNLGDL+GQPYG H+HYS +G P+T+AVG++IS+EGF++L+SP  A SVWK L+  
Sbjct  224   IMSKLNLGDLIGQPYGQHQHYSFDGMPITVAVGSLISDEGFTMLMSPGGAVSVWKTLLAE  283

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA+PMGS AWE+LRI QGRPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TY
Sbjct  284   GAIPMGSVAWEKLRITQGRPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLITY  343

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdt  1249
             DGIKQRL G+ LS+  EPGS+I+V+GKKVGKLTS T+  + S  FGLGYI+K+AAS G+T
Sbjct  344   DGIKQRLCGLNLSAQAEPGSTITVNGKKVGKLTSYTTGRNGSGHFGLGYIKKQAASVGNT  403

Query  1250  viigdgvvgtvvevPFLGRQLPP  1318
             V IG+ + G V EVP+L RQ PP
Sbjct  404   VTIGEDISGIVSEVPYLARQQPP  426



>ref|XP_009616451.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X3 [Nicotiana 
tomentosiformis]
Length=331

 Score =   498 bits (1281),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 262/312 (84%), Positives = 287/312 (92%), Gaps = 0/312 (0%)
 Frame = +2

Query  383   VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKN  562
             VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK 
Sbjct  19    VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKT  78

Query  563   AITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLV  742
             AITLV SP T ERIT ML+KYIFF+DKVEIQDI+ QT  FVL+GPRSNQI+E LNL D+V
Sbjct  79    AITLVISPVTKERITGMLKKYIFFADKVEIQDITGQTSLFVLIGPRSNQIMEALNLADVV  138

Query  743   GQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWE  922
             GQPYGSHKHYSVNG P+T+ VGNIISEEG+SL++SPA A+SVWKAL+ +G +PMG+NAWE
Sbjct  139   GQPYGSHKHYSVNGMPITVGVGNIISEEGYSLMMSPAAAESVWKALLGHGTIPMGTNAWE  198

Query  923   ELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  1102
              LRI+QGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR
Sbjct  199   TLRILQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  258

Query  1103  LsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtv  1282
             +SS VEPGS+ISVDGKKVGK+TS T+    S+P GLGYI++KAASEGDTVIIGD VVGTV
Sbjct  259   VSSPVEPGSTISVDGKKVGKVTSFTTGIRASQPLGLGYIKRKAASEGDTVIIGDDVVGTV  318

Query  1283  vevPFLGRQLPP  1318
             VEVPFL RQ+PP
Sbjct  319   VEVPFLARQIPP  330



>ref|XP_009780011.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X2 [Nicotiana 
sylvestris]
Length=331

 Score =   497 bits (1280),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 263/312 (84%), Positives = 286/312 (92%), Gaps = 0/312 (0%)
 Frame = +2

Query  383   VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKN  562
             VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK 
Sbjct  19    VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKT  78

Query  563   AITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLV  742
             AITLV SP T ERIT ML+KYIFF+DKVEIQDI+ QT  FVL+GPRSNQI+E LNL D+V
Sbjct  79    AITLVVSPVTKERITGMLKKYIFFADKVEIQDITGQTSLFVLIGPRSNQIMEALNLADIV  138

Query  743   GQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWE  922
             GQPYGSHKHYSVNG P+T+ VGNIISE+G+SLL+SPA A+SVWKAL+ +GA+PMGSNAWE
Sbjct  139   GQPYGSHKHYSVNGMPITVGVGNIISEDGYSLLMSPAAAESVWKALLGHGAIPMGSNAWE  198

Query  923   ELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  1102
              LRI+QGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR
Sbjct  199   ILRILQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  258

Query  1103  LsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtv  1282
             + S VEPGS+ISVDGKKVGK+TS T     S+P GLGYI++KAASEGDTVIIGD VVGTV
Sbjct  259   VPSPVEPGSTISVDGKKVGKVTSFTKGIRASQPLGLGYIKRKAASEGDTVIIGDDVVGTV  318

Query  1283  vevPFLGRQLPP  1318
             VEVPFL RQ+PP
Sbjct  319   VEVPFLARQIPP  330



>gb|AAS99703.1| At1g60990 [Arabidopsis thaliana]
Length=423

 Score =   501 bits (1289),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/365 (68%), Positives = 301/365 (82%), Gaps = 0/365 (0%)
 Frame = +2

Query  224   STAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHY  403
             S+ +L FD SPPPIDHD +DT+ V+G KV E  ++E++ NDDEAL A +NGV VVDLSH+
Sbjct  53    SSDSLQFDFSPPPIDHDFLDTISVSGGKVSEDGVVESFDNDDEALDAFDNGVVVVDLSHF  112

Query  404   GRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTS  583
             GRIRVSG+DR  FLHNQ+TANFE L+EGQGCDTVFVTPTARTIDIAHAWIMKNAI L  S
Sbjct  113   GRIRVSGDDRAHFLHNQTTANFESLYEGQGCDTVFVTPTARTIDIAHAWIMKNAILLTVS  172

Query  584   PETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSH  763
             P T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SNQI+  LNLGDL+GQPYG H
Sbjct  173   PTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQIMSKLNLGDLIGQPYGRH  232

Query  764   KHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQG  943
             +HYS +G P+T+ VG++IS+EGF++L+SP  A SVWK L+  GA+PMGS AWE+LRI QG
Sbjct  233   QHYSFDGMPITVGVGSLISDEGFTMLMSPGGAVSVWKTLLAEGAIPMGSVAWEKLRITQG  292

Query  944   RPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvep  1123
             RPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDGIKQRL G+ LS+  EP
Sbjct  293   RPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLMTYDGIKQRLCGLNLSAPSEP  352

Query  1124  gssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLG  1303
             GS+I+VDGKKVGKLTS T   + S  FGLGYI+K+AAS G+TV +G+ + G V EVP+L 
Sbjct  353   GSTITVDGKKVGKLTSYTGGKNGSGHFGLGYIKKQAASIGNTVTVGEDISGIVSEVPYLA  412

Query  1304  RQLPP  1318
             RQ PP
Sbjct  413   RQHPP  417



>ref|XP_006302280.1| hypothetical protein CARUB_v10020323mg [Capsella rubella]
 ref|XP_006302281.1| hypothetical protein CARUB_v10020323mg [Capsella rubella]
 gb|EOA35178.1| hypothetical protein CARUB_v10020323mg [Capsella rubella]
 gb|EOA35179.1| hypothetical protein CARUB_v10020323mg [Capsella rubella]
Length=431

 Score =   501 bits (1289),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 254/383 (66%), Positives = 307/383 (80%), Gaps = 3/383 (1%)
 Frame = +2

Query  179   LQNNAFRPENW---TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDD  349
             L+N+ FR   +     + S+ +L FD SPPPIDHDL DT+ VAG KV E  ++E++ NDD
Sbjct  43    LRNSGFRERKFQFRCVSASSDSLQFDFSPPPIDHDLHDTITVAGGKVSEDGVVESFDNDD  102

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
             EAL A +NGVAVVDLSH+GRIRVSG+DR  FLHNQ+TANFE L EGQGCDTVFVTPTART
Sbjct  103   EALDAFDNGVAVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLSEGQGCDTVFVTPTART  162

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             IDIAHAWIMKNAI L  SP T + I  ML KYIFF+DKVEI+DI+KQTC   LVGP+SNQ
Sbjct  163   IDIAHAWIMKNAILLTVSPTTCQSIIEMLDKYIFFADKVEIKDITKQTCLLALVGPKSNQ  222

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             I+  LNLGDL+GQPYG H+HYS +G P+T+ VG++IS+EGF++L+SP  A SVWK L+  
Sbjct  223   IMSKLNLGDLIGQPYGKHQHYSFDGMPITVGVGSLISDEGFTMLMSPGGAVSVWKTLLAE  282

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA+PMGS AWE+LRI QGRPAP +EL+ +FNVLEA LWN++SLNKGCYKGQETI+RL+TY
Sbjct  283   GAIPMGSVAWEKLRITQGRPAPERELSKDFNVLEAGLWNSISLNKGCYKGQETIARLITY  342

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdt  1249
             DGIKQ L G+ LS+   PGS+I+ DGKKVGKLTS T+  + S  FGLGYI+KKAAS G+T
Sbjct  343   DGIKQMLCGLNLSAPAGPGSAITADGKKVGKLTSYTTGKNGSGHFGLGYIKKKAASVGNT  402

Query  1250  viigdgvvgtvvevPFLGRQLPP  1318
             V IG+ + G V EVP+L RQ PP
Sbjct  403   VTIGEDISGIVSEVPYLARQHPP  425



>ref|XP_004299925.1| PREDICTED: aminomethyltransferase-like [Fragaria vesca subsp. 
vesca]
Length=416

 Score =   500 bits (1287),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 261/363 (72%), Positives = 308/363 (85%), Gaps = 3/363 (1%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGD--IIETYGNDDEALTATENGVAVVDLSH  400
             T ALPFDLSPPPIDHDL+DT+  A A     D  IIET+ NDD+AL A +NG+ VVDLSH
Sbjct  46    TRALPFDLSPPPIDHDLLDTVAAATAGATVSDDGIIETFDNDDQALDAADNGLVVVDLSH  105

Query  401   YGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVT  580
             + RIRVSG+DR+QFLHNQSTANFE LHEGQGCDTVFVTPTARTIDIAHAW+MKNA+ L+ 
Sbjct  106   FCRIRVSGDDRIQFLHNQSTANFECLHEGQGCDTVFVTPTARTIDIAHAWVMKNAVMLMV  165

Query  581   SPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGS  760
             SP  S  I+ ML+KYIFF+DKVEIQDI+KQTCFFVLVGP+SN ++E LNLGDLVGQPYG+
Sbjct  166   SP-VSRSISEMLKKYIFFNDKVEIQDITKQTCFFVLVGPKSNYVMEELNLGDLVGQPYGT  224

Query  761   HKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQ  940
             H+H+SVNG PVT+ VGN+ISE+GFSLL+SPA A SVWK ++ +GA PMGS AWE+LRI+Q
Sbjct  225   HQHFSVNGMPVTVGVGNVISEKGFSLLMSPAAAGSVWKTILSHGATPMGSIAWEKLRILQ  284

Query  941   GRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssve  1120
             G+PAP KELT+E+NVLEA LWN++SL KGCYKGQETISRL+TYDG+KQRLWGI LS+  E
Sbjct  285   GKPAPQKELTNEYNVLEAGLWNSISLTKGCYKGQETISRLITYDGVKQRLWGICLSAPAE  344

Query  1121  pgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFL  1300
             PGS I+V GKKVGKLTS TS    S+ FGLGYI+++  SEGD V++GD + GTVVEVPFL
Sbjct  345   PGSIITVGGKKVGKLTSCTSGRKESEYFGLGYIKRQNVSEGDMVVVGDAITGTVVEVPFL  404

Query  1301  GRQ  1309
               Q
Sbjct  405   AGQ  407



>emb|CDO97559.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   501 bits (1290),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 269/360 (75%), Positives = 299/360 (83%), Gaps = 5/360 (1%)
 Frame = +2

Query  233   ALPFDLSPPPIDHDL-IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             ALPF  SPPPIDHD   DT+  A  ++     IE + +DDEAL A E G  VVDLSHYGR
Sbjct  79    ALPFHPSPPPIDHDHSFDTVTNADDRI----SIEAFHSDDEALDAAEKGAVVVDLSHYGR  134

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRV GEDR+QFLHNQSTANFE L  GQGCDTVFVTPTARTIDIA AWIMKNAITLV SP 
Sbjct  135   IRVGGEDRIQFLHNQSTANFECLSVGQGCDTVFVTPTARTIDIALAWIMKNAITLVVSPV  194

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T E I+ ML KYIF SDKVEIQDI+KQTC F LVGP SNQI+E L L DL+GQPYGSH H
Sbjct  195   TCESISKMLEKYIFISDKVEIQDITKQTCMFALVGPASNQIMERLGLIDLIGQPYGSHNH  254

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             YSVNG PVT+AVGN+ISEEGFS L+S  +A +VWKALV  GA+ MGS AWE  RI+QGRP
Sbjct  255   YSVNGKPVTVAVGNVISEEGFSFLMSSDSAGTVWKALVAQGAITMGSGAWETFRILQGRP  314

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELTDEFNVLEA+LWN VSLNKGCYKGQETISRLVTYDG+KQRLWGIRLSS VE GS
Sbjct  315   APGKELTDEFNVLEAHLWNGVSLNKGCYKGQETISRLVTYDGVKQRLWGIRLSSLVEVGS  374

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
             +++VDGKKVGKLTS+T+    S+PFGLGYI++KAAS+GDTVI+G  VVGTVVEVPFL +Q
Sbjct  375   AVTVDGKKVGKLTSITAGKRASEPFGLGYIKRKAASKGDTVIVGGNVVGTVVEVPFLAQQ  434



>ref|NP_176295.3| plastidial, folate dependent Fe/S cluster biogenesis protein 
[Arabidopsis thaliana]
 ref|NP_001077748.1| plastidial, folate dependent Fe/S cluster biogenesis protein 
[Arabidopsis thaliana]
 ref|NP_001117522.1| plastidial, folate dependent Fe/S cluster biogenesis protein 
[Arabidopsis thaliana]
 dbj|BAD43247.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE33760.1| plastidial, folate dependent Fe/S cluster biogenesis protein 
[Arabidopsis thaliana]
 gb|AEE33761.1| plastidial, folate dependent Fe/S cluster biogenesis protein 
[Arabidopsis thaliana]
 gb|AEE33762.1| plastidial, folate dependent Fe/S cluster biogenesis protein 
[Arabidopsis thaliana]
Length=432

 Score =   501 bits (1289),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/365 (68%), Positives = 301/365 (82%), Gaps = 0/365 (0%)
 Frame = +2

Query  224   STAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHY  403
             S+ +L FD SPPPIDHD +DT+ V+G KV E  ++E++ NDDEAL A +NGV VVDLSH+
Sbjct  62    SSDSLQFDFSPPPIDHDFLDTISVSGGKVSEDGVVESFDNDDEALDAFDNGVVVVDLSHF  121

Query  404   GRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTS  583
             GRIRVSG+DR  FLHNQ+TANFE L+EGQGCDTVFVTPTARTIDIAHAWIMKNAI L  S
Sbjct  122   GRIRVSGDDRAHFLHNQTTANFESLYEGQGCDTVFVTPTARTIDIAHAWIMKNAILLTVS  181

Query  584   PETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSH  763
             P T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SNQI+  LNLGDL+GQPYG H
Sbjct  182   PTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQIMSKLNLGDLIGQPYGRH  241

Query  764   KHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQG  943
             +HYS +G P+T+ VG++IS+EGF++L+SP  A SVWK L+  GA+PMGS AWE+LRI QG
Sbjct  242   QHYSFDGMPITVGVGSLISDEGFTMLMSPGGAVSVWKTLLAEGAIPMGSVAWEKLRITQG  301

Query  944   RPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvep  1123
             RPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDGIKQRL G+ LS+  EP
Sbjct  302   RPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLMTYDGIKQRLCGLNLSAPSEP  361

Query  1124  gssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLG  1303
             GS+I+VDGKKVGKLTS T   + S  FGLGYI+K+AAS G+TV +G+ + G V EVP+L 
Sbjct  362   GSTITVDGKKVGKLTSYTGGKNGSGHFGLGYIKKQAASIGNTVTVGEDISGIVSEVPYLA  421

Query  1304  RQLPP  1318
             RQ PP
Sbjct  422   RQHPP  426



>ref|XP_004504185.1| PREDICTED: aminomethyltransferase-like [Cicer arietinum]
Length=420

 Score =   499 bits (1285),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 254/355 (72%), Positives = 303/355 (85%), Gaps = 0/355 (0%)
 Frame = +2

Query  254   PPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDR  433
             PPPIDHD +DT+K AGA+V    I+ET+ ND+EAL A +NGVAVVDLSH+GRIRVSG+DR
Sbjct  59    PPPIDHDFLDTVKTAGAEVSGEGIVETFHNDEEALDAADNGVAVVDLSHFGRIRVSGDDR  118

Query  434   VQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSM  613
             VQFLHNQSTANFE L  GQGCDTVFVTPTARTIDIAHAW+MKNAITLV SP+T   I+ M
Sbjct  119   VQFLHNQSTANFECLQAGQGCDTVFVTPTARTIDIAHAWVMKNAITLVVSPKTCRTISEM  178

Query  614   LRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPV  793
             L KYIFF+DKVEIQDI+K+T  FVLVGP+S Q++E LNLG+LVG+PYG+H+H+ V+  P+
Sbjct  179   LNKYIFFADKVEIQDITKKTSLFVLVGPKSGQVMENLNLGNLVGKPYGTHQHFYVDKQPI  238

Query  794   TIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTD  973
             TI VGN+ISE+GFSL++SPA A SVWKA++  GAV MGSNAW +LR+IQGRPAPG ELT 
Sbjct  239   TIGVGNLISEDGFSLMMSPAAAPSVWKAILAQGAVAMGSNAWNKLRVIQGRPAPGMELTK  298

Query  974   EFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKK  1153
             EFNVLEA LWN++SL KGCYKGQETISRL+TYDG+KQRLWG  LS + + GS+I+VDGKK
Sbjct  299   EFNVLEACLWNSISLTKGCYKGQETISRLITYDGVKQRLWGFHLSDAAQLGSTITVDGKK  358

Query  1154  VGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLPP  1318
             VGKLTS  S    S+ FGLGYI+++AASEGD VI+GD ++GTVVEVPFL +Q PP
Sbjct  359   VGKLTSYASGRKQSEHFGLGYIKRQAASEGDRVIVGDNIIGTVVEVPFLSQQRPP  413



>ref|XP_006392072.1| hypothetical protein EUTSA_v10023478mg [Eutrema salsugineum]
 gb|ESQ29358.1| hypothetical protein EUTSA_v10023478mg [Eutrema salsugineum]
Length=423

 Score =   498 bits (1283),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 249/365 (68%), Positives = 302/365 (83%), Gaps = 0/365 (0%)
 Frame = +2

Query  224   STAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHY  403
             ++ +L FD SPPPIDHDL+DT+ V+G KV E  ++E++ NDDEAL A +NGV VVDLSH+
Sbjct  53    ASDSLQFDFSPPPIDHDLLDTISVSGGKVSEDGVVESFDNDDEALDAFDNGVVVVDLSHF  112

Query  404   GRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTS  583
             GRIRVSG+DR  FLHNQ+TANFE L+EGQGCDTVFVTPTARTIDIA AWIMKNAI L+ S
Sbjct  113   GRIRVSGDDRAHFLHNQTTANFECLNEGQGCDTVFVTPTARTIDIARAWIMKNAIMLMVS  172

Query  584   PETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSH  763
             P T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SNQI+  LNLGDL+GQPYG+H
Sbjct  173   PTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQIMSKLNLGDLIGQPYGTH  232

Query  764   KHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQG  943
             KHYS +G P+T+ VG++ISEEGF++L+SP  A SVWK L+  GA+PMGS AWE+LRIIQG
Sbjct  233   KHYSFDGMPITVGVGSLISEEGFTMLMSPGGAISVWKTLLAEGAIPMGSVAWEKLRIIQG  292

Query  944   RPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvep  1123
             RPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDGIKQ+L G+ LS+  EP
Sbjct  293   RPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLITYDGIKQKLCGLDLSAPAEP  352

Query  1124  gssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLG  1303
             GS+I+ DGKKVGKLTS T   + S  FGLGYI+K+AA  G+TV IG+ + G V EVP+L 
Sbjct  353   GSTITFDGKKVGKLTSYTRGRNGSSHFGLGYIKKQAAVIGNTVTIGEDISGIVSEVPYLS  412

Query  1304  RQLPP  1318
             RQ PP
Sbjct  413   RQHPP  417



>ref|XP_002886571.1| At1g60990 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62830.1| At1g60990 [Arabidopsis lyrata subsp. lyrata]
Length=423

 Score =   498 bits (1281),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 254/383 (66%), Positives = 306/383 (80%), Gaps = 3/383 (1%)
 Frame = +2

Query  179   LQNNAFRPENW---TRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDD  349
             L+N+ FR   +     + S+ +L FD SPPPIDHD +DT+ VAG KV E  I+E++ NDD
Sbjct  35    LRNSCFRERKFQLRCVSASSDSLQFDFSPPPIDHDFLDTISVAGGKVSEDGIVESFDNDD  94

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
             EAL A +NGV VVDLSH+GRIRVSG+DR  FLHNQ+TANFE L EGQGCDTVFVTPTART
Sbjct  95    EALDAFDNGVVVVDLSHFGRIRVSGDDRAHFLHNQTTANFESLSEGQGCDTVFVTPTART  154

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             IDIAHAWIMKNAI L  SP T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SNQ
Sbjct  155   IDIAHAWIMKNAILLTVSPTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQ  214

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             I+  LNLGDL+GQPYG+H+HYS +G P+T+ VG++IS+EGF++L+SP  A SVWK L+  
Sbjct  215   IMSKLNLGDLIGQPYGNHQHYSFDGMPITVGVGSLISDEGFTMLMSPGGAVSVWKTLLAE  274

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA+PMGS AWE+LRI QGRPAP +EL+ E+NVLEA LWN++SLNKGCYKGQETI+RL+TY
Sbjct  275   GAIPMGSVAWEKLRITQGRPAPERELSKEYNVLEAGLWNSISLNKGCYKGQETIARLMTY  334

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdt  1249
             DGIKQ L G+ LS+  EPGS I VDGKKVGKLTS T   + S  FGLGYI+K+AAS G+T
Sbjct  335   DGIKQWLCGLNLSAPAEPGSPIIVDGKKVGKLTSYTRGREGSGHFGLGYIKKQAASIGNT  394

Query  1250  viigdgvvgtvvevPFLGRQLPP  1318
             V IG+ + G V EVP+L RQ PP
Sbjct  395   VTIGEDISGIVSEVPYLARQHPP  417



>ref|XP_009104262.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial isoform 
X2 [Brassica rapa]
Length=416

 Score =   497 bits (1280),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 251/381 (66%), Positives = 305/381 (80%), Gaps = 1/381 (0%)
 Frame = +2

Query  176   RLQNNAFRPENWTRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEA  355
             RL+N   R E   R    +   FD SPPPIDHDL+DT+ V G  V E  ++E++ NDDEA
Sbjct  32    RLRNGGSR-EPKLRLRCVSPSEFDFSPPPIDHDLLDTISVGGGIVSEDGVVESFDNDDEA  90

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             L A +NGV VVDLSH+GRIRVSG+DR+ FLHNQ+TANFE L+EGQGCDTVFVTPTARTID
Sbjct  91    LDAFDNGVVVVDLSHFGRIRVSGDDRLHFLHNQTTANFECLNEGQGCDTVFVTPTARTID  150

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             IAHAWIMKNAI L+ SP T + I  ML KYIFF+DKV+I+DI+KQTC F L GP+ NQI+
Sbjct  151   IAHAWIMKNAIMLMVSPTTCQSIIEMLNKYIFFADKVDIKDITKQTCLFALAGPKCNQIM  210

Query  716   EGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGA  895
               LNLGDL+GQPYG H+HY+ +G P+T+ VG++IS+EGF++L+SPA A SVWK L+  GA
Sbjct  211   SKLNLGDLIGQPYGKHQHYTFDGMPITVGVGSLISDEGFTMLMSPAGAVSVWKTLLSEGA  270

Query  896   VPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDG  1075
             VPMGS AWE+LR++QGRPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDG
Sbjct  271   VPMGSEAWEKLRVLQGRPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLITYDG  330

Query  1076  IKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtvi  1255
             IKQRL G+ LS+  EPGS+I+ DGKKVGKLTS T   + S  FGLGYI+K+AAS G TV 
Sbjct  331   IKQRLCGLELSAQAEPGSTITFDGKKVGKLTSYTRGRNGSSHFGLGYIKKQAASVGTTVT  390

Query  1256  igdgvvgtvvevPFLGRQLPP  1318
             IG+ + G V EVP+L RQ PP
Sbjct  391   IGEDISGIVAEVPYLSRQHPP  411



>emb|CDY61991.1| BnaAnng18080D [Brassica napus]
Length=416

 Score =   494 bits (1272),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 249/381 (65%), Positives = 303/381 (80%), Gaps = 1/381 (0%)
 Frame = +2

Query  176   RLQNNAFRPENWTRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEA  355
             RL+N   R E   R    +   FD SPPPIDHDL+DT+   G  V E  ++E++ NDDEA
Sbjct  32    RLRNGGSR-EPKLRLRCVSPSEFDFSPPPIDHDLLDTISAGGGIVSEDGVVESFDNDDEA  90

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             L A +NG+ VVDLSH+GRIRVSG+DR+ FLHNQ+TANFE L EGQGCDTVFVTPTARTID
Sbjct  91    LDAFDNGIVVVDLSHFGRIRVSGDDRLHFLHNQTTANFECLIEGQGCDTVFVTPTARTID  150

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             IAHAWIMKNAI L+ SP T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+ NQI+
Sbjct  151   IAHAWIMKNAIMLMVSPTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKCNQIM  210

Query  716   EGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGA  895
               LNLGDL+GQPYG H+HY+ +G P+T+ VG++IS+EGF++L+SPA A SVWK L+  GA
Sbjct  211   SKLNLGDLIGQPYGKHQHYTFDGMPITVGVGSLISDEGFTMLMSPAGAVSVWKTLLSEGA  270

Query  896   VPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDG  1075
             VPMGS AWE+LR++QGRPAP +EL+ EFNVLEA LWN++SLNKGCYKGQE+I+RL+TYDG
Sbjct  271   VPMGSEAWEKLRVLQGRPAPERELSKEFNVLEAGLWNSISLNKGCYKGQESIARLITYDG  330

Query  1076  IKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtvi  1255
             IKQRL G+ LS+  EPGS+I+ DGKKVGKLTS T   + S  FGLGYI+K+AAS G TV 
Sbjct  331   IKQRLCGLELSAQAEPGSTITFDGKKVGKLTSYTRGRNGSSHFGLGYIKKQAASVGTTVT  390

Query  1256  igdgvvgtvvevPFLGRQLPP  1318
             IG+ + G V EVP+L RQ PP
Sbjct  391   IGEDISGIVAEVPYLSRQHPP  411



>gb|AAG51655.1|AC018908_21 hypothetical protein; 60474-57856 [Arabidopsis thaliana]
Length=436

 Score =   492 bits (1266),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 249/378 (66%), Positives = 301/378 (80%), Gaps = 13/378 (3%)
 Frame = +2

Query  224   STAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHY  403
             S+ +L FD SPPPIDHD +DT+ V+G KV E  ++E++ NDDEAL A +NGV VVDLSH+
Sbjct  53    SSDSLQFDFSPPPIDHDFLDTISVSGGKVSEDGVVESFDNDDEALDAFDNGVVVVDLSHF  112

Query  404   GRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTS  583
             GRIRVSG+DR  FLHNQ+TANFE L+EGQGCDTVFVTPTARTIDIAHAWIMKNAI L  S
Sbjct  113   GRIRVSGDDRAHFLHNQTTANFESLYEGQGCDTVFVTPTARTIDIAHAWIMKNAILLTVS  172

Query  584   PETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSN-------------QIVEGL  724
             P T + I  ML KYIFF+DKVEI+DI+KQTC F L GP+SN             QI+  L
Sbjct  173   PTTCQSIIEMLNKYIFFADKVEIKDITKQTCLFALAGPKSNQLHYSYATVKNMKQIMSKL  232

Query  725   NLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPM  904
             NLGDL+GQPYG H+HYS +G P+T+ VG++IS+EGF++L+SP  A SVWK L+  GA+PM
Sbjct  233   NLGDLIGQPYGRHQHYSFDGMPITVGVGSLISDEGFTMLMSPGGAVSVWKTLLAEGAIPM  292

Query  905   GSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQ  1084
             GS AWE+LRI QGRPAP +EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDGIKQ
Sbjct  293   GSVAWEKLRITQGRPAPERELSKEFNVLEAGLWNSISLNKGCYKGQETIARLMTYDGIKQ  352

Query  1085  RLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigd  1264
             RL G+ LS+  EPGS+I+VDGKKVGKLTS T   + S  FGLGYI+K+AAS G+TV +G+
Sbjct  353   RLCGLNLSAPSEPGSTITVDGKKVGKLTSYTGGKNGSGHFGLGYIKKQAASIGNTVTVGE  412

Query  1265  gvvgtvvevPFLGRQLPP  1318
              + G V EVP+L RQ PP
Sbjct  413   DISGIVSEVPYLARQHPP  430



>emb|CDY54403.1| BnaC01g43290D [Brassica napus]
Length=417

 Score =   491 bits (1264),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 244/359 (68%), Positives = 293/359 (82%), Gaps = 0/359 (0%)
 Frame = +2

Query  242   FDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVS  421
             FD SPPPIDHDL+DT+ + G  V E  ++E++ NDDEAL A +NGV VVDLSH+GRIRVS
Sbjct  54    FDFSPPPIDHDLLDTISIGGGIVSEDGVVESFDNDDEALDAFDNGVVVVDLSHFGRIRVS  113

Query  422   GEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSER  601
             G+DRV FLHNQ+TANFE L  GQGCDTVFVTPTARTIDIAHAWIMKNAI L+ SP T + 
Sbjct  114   GDDRVHFLHNQTTANFECLSTGQGCDTVFVTPTARTIDIAHAWIMKNAIMLMVSPTTCQS  173

Query  602   ITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVN  781
             I  ML KYIFF+DKVEI+DI+KQTC F L GP+ NQI+  LNLGDL+GQPYG H+HYS +
Sbjct  174   IIEMLNKYIFFADKVEIKDITKQTCLFALAGPKCNQIMSKLNLGDLIGQPYGKHQHYSFD  233

Query  782   GNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGK  961
             G P+T+ V ++IS+EGF++L+SP  A SVWK L+  GAVPMGS AWE+LR++QGRPAP +
Sbjct  234   GMPITVGVRSLISDEGFTMLMSPGGAVSVWKTLLSEGAVPMGSEAWEKLRVLQGRPAPER  293

Query  962   ELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisV  1141
             EL+ EFNVLEA LWN++SLNKGCYKGQETI+RL+TYDGIKQRL G+ LS+  EPGS+I+ 
Sbjct  294   ELSKEFNVLEAGLWNSISLNKGCYKGQETIARLITYDGIKQRLCGLELSAQAEPGSTITF  353

Query  1142  DGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLPP  1318
             DGKKVGKLTS T   + S  FGLGYI+K+AAS G TV IG+ + G V EVP+L RQ PP
Sbjct  354   DGKKVGKLTSYTRGRNGSSHFGLGYIKKQAASVGTTVTIGEDISGIVAEVPYLSRQHPP  412



>ref|XP_010314734.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X2 [Solanum 
lycopersicum]
Length=331

 Score =   486 bits (1250),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 254/312 (81%), Positives = 285/312 (91%), Gaps = 0/312 (0%)
 Frame = +2

Query  383   VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKN  562
             VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW+MK 
Sbjct  19    VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWVMKT  78

Query  563   AITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLV  742
             AITLV SP T ERIT ML KYIFF+DKVEIQDI+++T  F+LVGP SN+I+E L+L D+V
Sbjct  79    AITLVVSPVTRERITHMLEKYIFFADKVEIQDITEKTSLFLLVGPTSNKIMEALSLADIV  138

Query  743   GQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWE  922
             GQPYGSHKHY+VNG P+T+ VGNIISEEG+ LL+SPA A+SVWKA++ +GAVPMGSNAWE
Sbjct  139   GQPYGSHKHYNVNGMPITVGVGNIISEEGYLLLMSPAAAESVWKAILGHGAVPMGSNAWE  198

Query  923   ELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  1102
              LRI+QGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI+RLVTYDGIKQRLWGIR
Sbjct  199   TLRILQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETIARLVTYDGIKQRLWGIR  258

Query  1103  LsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtv  1282
             +SS VEPGS+ISV+GKKVGK+TS T+    S+P GLGYI++KAASEGD+VIIGD V GTV
Sbjct  259   VSSPVEPGSTISVNGKKVGKVTSFTTGKRASQPLGLGYIKRKAASEGDSVIIGDDVEGTV  318

Query  1283  vevPFLGRQLPP  1318
             VEVPFL RQ+PP
Sbjct  319   VEVPFLARQIPP  330



>ref|XP_009104253.1| PREDICTED: uncharacterized protein LOC103830248 isoform X1 [Brassica 
rapa]
Length=442

 Score =   483 bits (1244),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 251/407 (62%), Positives = 305/407 (75%), Gaps = 27/407 (7%)
 Frame = +2

Query  176   RLQNNAFRPENWTRNYSTAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEA  355
             RL+N   R E   R    +   FD SPPPIDHDL+DT+ V G  V E  ++E++ NDDEA
Sbjct  32    RLRNGGSR-EPKLRLRCVSPSEFDFSPPPIDHDLLDTISVGGGIVSEDGVVESFDNDDEA  90

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQ---------------  490
             L A +NGV VVDLSH+GRIRVSG+DR+ FLHNQ+TANFE L+EGQ               
Sbjct  91    LDAFDNGVVVVDLSHFGRIRVSGDDRLHFLHNQTTANFECLNEGQVIVFIIECRLLNSSN  150

Query  491   -----------GCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
                        GCDTVFVTPTARTIDIAHAWIMKNAI L+ SP T + I  ML KYIFF+
Sbjct  151   HFCGYVCSFLKGCDTVFVTPTARTIDIAHAWIMKNAIMLMVSPTTCQSIIEMLNKYIFFA  210

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNII  817
             DKV+I+DI+KQTC F L GP+ NQI+  LNLGDL+GQPYG H+HY+ +G P+T+ VG++I
Sbjct  211   DKVDIKDITKQTCLFALAGPKCNQIMSKLNLGDLIGQPYGKHQHYTFDGMPITVGVGSLI  270

Query  818   SEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEAN  997
             S+EGF++L+SPA A SVWK L+  GAVPMGS AWE+LR++QGRPAP +EL+ EFNVLEA 
Sbjct  271   SDEGFTMLMSPAGAVSVWKTLLSEGAVPMGSEAWEKLRVLQGRPAPERELSKEFNVLEAG  330

Query  998   LWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVT  1177
             LWN++SLNKGCYKGQETI+RL+TYDGIKQRL G+ LS+  EPGS+I+ DGKKVGKLTS T
Sbjct  331   LWNSISLNKGCYKGQETIARLITYDGIKQRLCGLELSAQAEPGSTITFDGKKVGKLTSYT  390

Query  1178  SSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLPP  1318
                + S  FGLGYI+K+AAS G TV IG+ + G V EVP+L RQ PP
Sbjct  391   RGRNGSSHFGLGYIKKQAASVGTTVTIGEDISGIVAEVPYLSRQHPP  437



>ref|XP_006838384.1| hypothetical protein AMTR_s00002p00065920 [Amborella trichopoda]
 gb|ERN00953.1| hypothetical protein AMTR_s00002p00065920 [Amborella trichopoda]
Length=426

 Score =   483 bits (1242),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 280/336 (83%), Gaps = 0/336 (0%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             A+  FD+ PPPID DL D M   GAK+LE  I+ET+GND+ A+ A E+GVAVVDLSH+GR
Sbjct  60    ASSSFDIVPPPIDDDLHDVMVAEGAKLLEDGIVETFGNDEVAMKAVEDGVAVVDLSHFGR  119

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRV+GEDR+QFLHNQSTA+F++L EGQGC+TVFVTPTARTIDIA+AW+MKNAITL+ SP 
Sbjct  120   IRVTGEDRIQFLHNQSTADFQVLTEGQGCETVFVTPTARTIDIANAWVMKNAITLLVSPT  179

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T   I  ML KYIFF+DKVE+QDI+K+TCFF L+GP+S Q++E LNLGDLVG+PYG+H H
Sbjct  180   TCSSILGMLEKYIFFTDKVELQDITKKTCFFTLIGPKSIQVMEDLNLGDLVGKPYGTHLH  239

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             Y+VNG P+T  VGN++SE+ FSL++SPA+A SVWK L+  GAVPMG+N WE LR+IQGRP
Sbjct  240   YNVNGMPITAGVGNVLSEDSFSLMLSPASAGSVWKVLLSLGAVPMGANVWERLRVIQGRP  299

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             +PGKELT+EFNVLEA L  AVSLNKGCYKGQETI+RLVTYDG+KQRLWGIRL   VEPGS
Sbjct  300   SPGKELTNEFNVLEACLRKAVSLNKGCYKGQETIARLVTYDGVKQRLWGIRLDGPVEPGS  359

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAAS  1237
             +I V+GKKVGKLTS        +  GLGY+++ A S
Sbjct  360   AIIVEGKKVGKLTSYVVGNQNVEHVGLGYVKRHAGS  395



>ref|XP_010065468.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X2 [Eucalyptus 
grandis]
Length=405

 Score =   478 bits (1231),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/362 (68%), Positives = 294/362 (81%), Gaps = 11/362 (3%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AA PFDLSPPPIDHDL ++M  AGAKV +  ++E+Y NDDEAL A +NG+AVVDLSH+GR
Sbjct  51    AATPFDLSPPPIDHDLAESMVGAGAKVSDDGVVESYDNDDEALDAADNGLAVVDLSHFGR  110

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSGEDRV FL NQ+TANFE L+EG+GCDTVFVTPTARTIDI +AWIMKNAITLV SP 
Sbjct  111   IRVSGEDRVSFLQNQTTANFECLNEGEGCDTVFVTPTARTIDIGYAWIMKNAITLVVSPV  170

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T + IT ML KYIFF+DKVEI DI+KQT FFVL+GP+SNQ++E LNL DL GQPYGSHKH
Sbjct  171   TCQSITEMLTKYIFFADKVEITDITKQTSFFVLLGPKSNQVMEHLNLKDLDGQPYGSHKH  230

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             YS+NG PVT  VGN++SEEG+S+L SPA A +VW  L  +GA+PMG+NAWE LRI++GRP
Sbjct  231   YSINGMPVTAGVGNLVSEEGYSILTSPAAATTVWDILFSHGAIPMGANAWERLRILRGRP  290

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELT E+NVLEA          GCYKGQETISRL+TYDG+KQ LWG+ L +  +P S
Sbjct  291   APGKELTKEYNVLEA----------GCYKGQETISRLITYDGVKQSLWGVHLDAPAKPES  340

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
              I V+GKKVGKLTS TS+ +    FGLGYI+++AASEG TV++GD + G VV +P+L +Q
Sbjct  341   PILVEGKKVGKLTSCTSTREPGY-FGLGYIKRQAASEGSTVLVGDDIAGRVVNLPYLAKQ  399

Query  1310  LP  1315
              P
Sbjct  400   RP  401



>ref|XP_010533963.1| PREDICTED: aminomethyltransferase, mitochondrial [Tarenaya hassleriana]
Length=448

 Score =   474 bits (1219),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 299/361 (83%), Gaps = 1/361 (0%)
 Frame = +2

Query  239   PFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRV  418
             PFD SPPPIDHDL + + VAG KV    ++ET+ NDDEAL A ENG  VV LSH+GRIRV
Sbjct  76    PFDFSPPPIDHDLPEKISVAGGKVSSDGVVETFDNDDEALDAFENGAVVVYLSHFGRIRV  135

Query  419   SGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSE  598
             SG+DR+QFLHNQ+TANFE L+EGQGCDTVF++PTARTIDIA++W+MKN++ LV SP T  
Sbjct  136   SGDDRIQFLHNQTTANFECLNEGQGCDTVFISPTARTIDIAYSWVMKNSVVLVVSPTTCG  195

Query  599   RITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSV  778
              IT ML KYIFF+DKV IQDI+KQT   VL GP+SNQI+  LNL DL+GQPYG+H+HY++
Sbjct  196   SITEMLNKYIFFADKVGIQDITKQTSLLVLAGPKSNQIMANLNLDDLIGQPYGNHRHYNI  255

Query  779   NGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPG  958
             NG P+T+ VG+I+S+ GFS+L+SP+ A SVW+ L+  GA+PMGS AWE+LRI+QGRPAP 
Sbjct  256   NGMPITVGVGSIVSDVGFSMLMSPSAAVSVWETLLSQGAIPMGSVAWEKLRILQGRPAPE  315

Query  959   KELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssis  1138
             KEL  EFNVLE  LWN++SLNKGCYKGQETISRL+TYDGIKQ+L G+RLS+  EPGSSI+
Sbjct  316   KELGKEFNVLEVGLWNSISLNKGCYKGQETISRLITYDGIKQKLCGLRLSAHAEPGSSIT  375

Query  1139  V-DGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLP  1315
             + DGKKVGK+TS TS    S+ FGLGY++K+AA  G+ +++G+ +VGT+VEVP+L RQ P
Sbjct  376   LDDGKKVGKVTSCTSGRQESEYFGLGYVKKQAAWTGNRLLVGENIVGTIVEVPYLSRQSP  435

Query  1316  P  1318
             P
Sbjct  436   P  436



>ref|XP_007042608.1| Glycine cleavage T-protein family isoform 2 [Theobroma cacao]
 gb|EOX98439.1| Glycine cleavage T-protein family isoform 2 [Theobroma cacao]
Length=394

 Score =   465 bits (1196),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 240/363 (66%), Positives = 288/363 (79%), Gaps = 34/363 (9%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AALPF+LSPPPIDHD +                                  V+DLSH+GR
Sbjct  60    AALPFELSPPPIDHDFL----------------------------------VMDLSHFGR  85

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSG+DR+QFLHNQ+TA+FE L EGQGCDTVFVTPTARTIDIA+AWIMK A+ LV SPE
Sbjct  86    IRVSGDDRIQFLHNQTTADFECLSEGQGCDTVFVTPTARTIDIAYAWIMKKAVVLVVSPE  145

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T   IT ML KY+FF+DKVEIQDI+KQTC F L GP+SNQ++  LNL DLVGQPYG+++H
Sbjct  146   TRGNITEMLNKYVFFADKVEIQDITKQTCLFALAGPKSNQVMANLNLSDLVGQPYGTNRH  205

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             YSVNG P+T+ VGNIIS+EGFSLL+SP TA SVWK L+  GA+P+G NAWE+LR+IQGRP
Sbjct  206   YSVNGMPLTVGVGNIISQEGFSLLMSPTTAGSVWKTLLSQGAIPLGFNAWEKLRVIQGRP  265

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELT+EFNVLEA LWN++S+NKGCYKGQETISRL+TYDG+KQRLWGI LS+ VEPGS
Sbjct  266   APGKELTNEFNVLEAGLWNSISMNKGCYKGQETISRLITYDGVKQRLWGIHLSAPVEPGS  325

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
              I+V+GKKVGKLTS T+    S  F LGYI+++AAS GDTV++G+ ++GTVV+VPFL +Q
Sbjct  326   PITVNGKKVGKLTSYTTGRKESDHFALGYIKRQAASCGDTVVVGENILGTVVDVPFLSQQ  385

Query  1310  LPP  1318
              PP
Sbjct  386   SPP  388



>ref|XP_010103913.1| hypothetical protein L484_024217 [Morus notabilis]
 gb|EXB97354.1| hypothetical protein L484_024217 [Morus notabilis]
Length=412

 Score =   454 bits (1168),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 241/363 (66%), Positives = 294/363 (81%), Gaps = 23/363 (6%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             AA P DLSPPPIDHDL+++++ AGAKV +  ++ET+ NDDEAL A  NGV VVDLSH+GR
Sbjct  65    AAFPSDLSPPPIDHDLLESLETAGAKVSDDGVVETFDNDDEALDAAYNGVVVVDLSHFGR  124

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             IRVSGEDR+QFLHNQSTANFE+LHEGQ                      KNA+TLV SPE
Sbjct  125   IRVSGEDRIQFLHNQSTANFEVLHEGQ----------------------KNAVTLVVSPE  162

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             T   I  ML KYIFF+DKV+IQDI+K+T FFVLVGP+S+Q++E LNLG+LVGQ YG+H+H
Sbjct  163   TCRSILEMLEKYIFFADKVDIQDITKRTSFFVLVGPKSSQLMEDLNLGNLVGQSYGTHQH  222

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             +SVNG PVT+ VG+IISE+GFS+L+SPA A  VWK ++  GA+PMGSNAWE+LR++QGRP
Sbjct  223   FSVNGMPVTVGVGSIISEDGFSVLMSPAAAGIVWKTILSKGAIPMGSNAWEKLRVLQGRP  282

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             AP +ELT+EFNVLEA LWN++SL+KGCYKGQETISRL+TY+G+KQRLWGI LSS+ EPGS
Sbjct  283   APQRELTNEFNVLEAGLWNSISLDKGCYKGQETISRLITYNGVKQRLWGILLSSAAEPGS  342

Query  1130  sisVDGKKVGKLTS-VTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGR  1306
              + VDGKKVGKLTS V    D S+  GLGYI+++AAS+GDTVI+GD V GT+VEVPFL R
Sbjct  343   PLVVDGKKVGKLTSCVPGKKDGSQYVGLGYIKRQAASKGDTVIVGDNVTGTLVEVPFLAR  402

Query  1307  QLP  1315
             Q P
Sbjct  403   QQP  405



>gb|KDO53499.1| hypothetical protein CISIN_1g014411mg [Citrus sinensis]
 gb|KDO53500.1| hypothetical protein CISIN_1g014411mg [Citrus sinensis]
Length=321

 Score =   442 bits (1136),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 202/267 (76%), Positives = 235/267 (88%), Gaps = 0/267 (0%)
 Frame = +2

Query  227   TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
             TA LPFDLSPPPIDHDL++T+K  GAK+    I+ET+GND EAL A +NGVA VDLSH+G
Sbjct  54    TAVLPFDLSPPPIDHDLLETVKSEGAKISGEGIVETFGNDGEALDAADNGVAAVDLSHFG  113

Query  407   RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
             RIRVSG+DR+QFLHNQSTANFEIL EGQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  114   RIRVSGDDRIQFLHNQSTANFEILREGQGCDTVFVTPTARTIDIAHAWIMKNAVILVVSP  173

Query  587   ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
              T   IT ML KY+FF+DKVEIQDI+KQTC FV+VGP+SNQ++  LNLGDLVG+ YG+H+
Sbjct  174   LTCSSITEMLNKYVFFADKVEIQDITKQTCLFVVVGPKSNQVMRDLNLGDLVGEAYGTHR  233

Query  767   HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGR  946
             HYSVNG P+T+ VGN+ISEEGFSLL+SPA A SVW+ L+  GAVPMGSNAWE+LRII+GR
Sbjct  234   HYSVNGMPITVGVGNVISEEGFSLLMSPAAAGSVWETLLSQGAVPMGSNAWEKLRIIKGR  293

Query  947   PAPGKELTDEFNVLEANLWNAVSLNKG  1027
             PAPGKELT+EFNVLEA LWN++SL+KG
Sbjct  294   PAPGKELTNEFNVLEAGLWNSISLDKG  320



>ref|XP_009391382.1| PREDICTED: uncharacterized protein LOC103977560 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=413

 Score =   439 bits (1128),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 265/332 (80%), Gaps = 2/332 (1%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             +ALP D+SPPPID D    +K      LE    ET+G+D+ A+ A  NGVA++DLSH+GR
Sbjct  56    SALPLDVSPPPIDGD--PELKATEGAALEHCTAETFGDDNAAIDAAFNGVAIMDLSHFGR  113

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             +RV+GEDR  FLHNQSTANFE L EG+GCDTVFVT TARTIDIA+ W+MKNAI L+ SP 
Sbjct  114   LRVTGEDRFHFLHNQSTANFECLTEGEGCDTVFVTATARTIDIAYVWVMKNAILLLVSPS  173

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             TS  I  ML KYIF++DKVE+ DI++QTCFF L+GP+SNQ++E LNLG +V QPYG+H+H
Sbjct  174   TSSSIAEMLNKYIFYADKVEVHDITQQTCFFALIGPKSNQVMEALNLGHIVEQPYGTHRH  233

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             Y+VNG P+TI +G+I+S +GFS ++SPA+++SVW++L+ +GA+PMG+NAWE LR+++GRP
Sbjct  234   YNVNGAPLTIGIGSILSRDGFSFMLSPASSRSVWRSLLSHGAIPMGANAWERLRVLKGRP  293

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELT ++NVLEA L  AV L+KGCYKGQETISRL+TY+G+KQRLWGI+LS    PG+
Sbjct  294   APGKELTKDYNVLEAGLSMAVHLDKGCYKGQETISRLITYNGVKQRLWGIKLSGQAAPGT  353

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRK  1225
             SI +DGKKVG LTS        +  GLGY ++
Sbjct  354   SIMLDGKKVGVLTSYALGRRDGEHLGLGYAKR  385



>ref|XP_009391384.1| PREDICTED: uncharacterized protein LOC103977560 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=412

 Score =   432 bits (1111),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 264/332 (80%), Gaps = 3/332 (1%)
 Frame = +2

Query  230   AALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGR  409
             +ALP D+SPPPID D    +K      LE    ET+G+D+ A+ A  NGVA++DLSH+GR
Sbjct  56    SALPLDVSPPPIDGD--PELKATEGAALEHCTAETFGDDNAAIDAAFNGVAIMDLSHFGR  113

Query  410   IRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPE  589
             +RV+GEDR  FLHNQSTANFE L EG+GCDTVFVT TARTIDIA+ W+M NAI L+ SP 
Sbjct  114   LRVTGEDRFHFLHNQSTANFECLTEGEGCDTVFVTATARTIDIAYVWVM-NAILLLVSPS  172

Query  590   TSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKH  769
             TS  I  ML KYIF++DKVE+ DI++QTCFF L+GP+SNQ++E LNLG +V QPYG+H+H
Sbjct  173   TSSSIAEMLNKYIFYADKVEVHDITQQTCFFALIGPKSNQVMEALNLGHIVEQPYGTHRH  232

Query  770   YSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRP  949
             Y+VNG P+TI +G+I+S +GFS ++SPA+++SVW++L+ +GA+PMG+NAWE LR+++GRP
Sbjct  233   YNVNGAPLTIGIGSILSRDGFSFMLSPASSRSVWRSLLSHGAIPMGANAWERLRVLKGRP  292

Query  950   APGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgs  1129
             APGKELT ++NVLEA L  AV L+KGCYKGQETISRL+TY+G+KQRLWGI+LS    PG+
Sbjct  293   APGKELTKDYNVLEAGLSMAVHLDKGCYKGQETISRLITYNGVKQRLWGIKLSGQAAPGT  352

Query  1130  sisVDGKKVGKLTSVTSSGDTSKPFGLGYIRK  1225
             SI +DGKKVG LTS        +  GLGY ++
Sbjct  353   SIMLDGKKVGVLTSYALGRRDGEHLGLGYAKR  384



>ref|XP_010065469.1| PREDICTED: aminomethyltransferase, mitochondrial isoform X3 [Eucalyptus 
grandis]
Length=346

 Score =   409 bits (1050),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 251/301 (83%), Gaps = 5/301 (2%)
 Frame = +2

Query  419   SGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSE  598
             SGEDRV FL NQ+TANFE L+EG+GCDTVFVTPTARTIDI +AWIMKNAITLV SP T +
Sbjct  45    SGEDRVSFLQNQTTANFECLNEGEGCDTVFVTPTARTIDIGYAWIMKNAITLVVSPVTCQ  104

Query  599   RITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSV  778
              IT ML KYIFF+DKVEI DI+KQT FFVL+GP+SNQ++E LNL DL GQPYGSHKHYS+
Sbjct  105   SITEMLTKYIFFADKVEITDITKQTSFFVLLGPKSNQVMEHLNLKDLDGQPYGSHKHYSI  164

Query  779   NGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPG  958
             NG PVT  VGN++SEEG+S+L SPA A +VW  L  +GA+PMG+NAWE LRI++GRPAPG
Sbjct  165   NGMPVTAGVGNLVSEEGYSILTSPAAATTVWDILFSHGAIPMGANAWERLRILRGRPAPG  224

Query  959   KELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssis  1138
             KELT E+NVLEA LWN++SL+KGCYKGQETISRL+TYDG+KQ LWG+ L +  +P S I 
Sbjct  225   KELTKEYNVLEAGLWNSISLDKGCYKGQETISRLITYDGVKQSLWGVHLDAPAKPESPIL  284

Query  1139  VDGKKVGKLTSVTSSGDTSKP--FGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQL  1312
             V+GKKVGKLTS TS   T +P  FGLGYI+++AASEG TV++GD + G VV +P+L +Q 
Sbjct  285   VEGKKVGKLTSCTS---TREPGYFGLGYIKRQAASEGSTVLVGDDIAGRVVNLPYLAKQR  341

Query  1313  P  1315
             P
Sbjct  342   P  342



>ref|XP_002975902.1| hypothetical protein SELMODRAFT_104148 [Selaginella moellendorffii]
 gb|EFJ22807.1| hypothetical protein SELMODRAFT_104148 [Selaginella moellendorffii]
Length=354

 Score =   364 bits (935),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/319 (55%), Positives = 241/319 (76%), Gaps = 4/319 (1%)
 Frame = +2

Query  281   DTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQST  460
             D +   GA++ +  I++T+GND+EAL A ++G AV+++SH+GR+RV+G+DR++FLHNQST
Sbjct  4     DVLLETGAQISDNGIVQTFGNDEEALKAADSGCAVIEMSHFGRLRVTGDDRLRFLHNQST  63

Query  461   ANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSD  640
             A+F  L +G+GCDTVFVT TARTID+A AW M  A+ L+ SPET   +  +L KYIFFSD
Sbjct  64    ADFLPLKDGEGCDTVFVTNTARTIDLATAWAMNTAVILLVSPETRHDLIKLLNKYIFFSD  123

Query  641   KVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIIS  820
             KVE+ DI+++T +F +VGP+S+ ++  L L  L+ +PYG+H HY+ NG PVT+ VG+ + 
Sbjct  124   KVEVDDITEKTSYFSIVGPQSDNVMRQLKLESLIDKPYGTHVHYTANGAPVTVGVGSGLC  183

Query  821   EEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANL  1000
              +G+S LVS A A  VW +++  GA+PMGS+AWE LRI+QGRP PGKELTDEFNVLEA L
Sbjct  184   TKGYSFLVSTAAAGPVWTSILKCGALPMGSSAWERLRILQGRPVPGKELTDEFNVLEAGL  243

Query  1001  WNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisV-DGKKVGKLTSVT  1177
             W  +S  KGCY GQET++RL+TY+G+KQ L G++L+ +VEPG+ ++  DG K GKLTS T
Sbjct  244   WRTISQTKGCYIGQETVARLITYNGVKQHLHGVKLTGAVEPGTILTTRDGVKAGKLTSCT  303

Query  1178  SSGDTSKPFGLGYIRKKAA  1234
                  +  FGL YIRK+  
Sbjct  304   RE---APYFGLCYIRKQCG  319



>ref|XP_008449402.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial isoform 
X1 [Cucumis melo]
Length=412

 Score =   360 bits (923),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 212/389 (54%), Positives = 263/389 (68%), Gaps = 47/389 (12%)
 Frame = +2

Query  176   RLQNNAFRPENWTRNYSTA--------ALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIE  331
             RLQ   FRP N  + +S A        ALPFDLSPPPID DL++   V GA++ +  IIE
Sbjct  43    RLQLPPFRPPNIKKPHSNANRKSTSFSALPFDLSPPPIDEDLLEAAAVEGARISDDGIIE  102

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             T+ ND++AL A  NGVA+V++             V F   ++    ++  + +G     +
Sbjct  103   TFHNDEQALDAANNGVALVEMI-----------VVSFFITKAQLILKVYVKDKGAVLYLL  151

Query  512   TPTARTIDIAH---AWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFF  682
              P    + I H   +W                        YIF +DKVEIQDI+ QT   
Sbjct  152   HPLLGQL-ILHKHGSW------------------------YIFLADKVEIQDITNQTSLL  186

Query  683   VLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAK  862
             VLVGP+SNQI+E LNLG + G+PYG+H+H+SVNG P+T+ VG++ISEEGFSLL+SPA A 
Sbjct  187   VLVGPKSNQIMEDLNLGSIAGEPYGTHQHFSVNGMPITVGVGSVISEEGFSLLISPAVAG  246

Query  863   SVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQ  1042
              VWKALV  GAVPMGS AWE+LRI QG P+P KELTDEFNVLEA LWN++SLNKGCYKGQ
Sbjct  247   PVWKALVSLGAVPMGSRAWEKLRIFQGMPSPQKELTDEFNVLEAGLWNSISLNKGCYKGQ  306

Query  1043  ETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIR  1222
             ETISRL+TYDG+KQRLWG++LS SVEPGS I++DGK+VGKLTS       S+ FGLGYI+
Sbjct  307   ETISRLITYDGVKQRLWGLQLSDSVEPGSPITIDGKRVGKLTSYAPGRKESEHFGLGYIK  366

Query  1223  KKAASegdtviigdgvvgtvvevPFLGRQ  1309
             KKAAS GDTVI+G+   GTVVEVPFL RQ
Sbjct  367   KKAASIGDTVIVGEDTTGTVVEVPFLARQ  395



>ref|XP_002968581.1| hypothetical protein SELMODRAFT_89647 [Selaginella moellendorffii]
 gb|EFJ30835.1| hypothetical protein SELMODRAFT_89647 [Selaginella moellendorffii]
Length=354

 Score =   358 bits (918),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 239/319 (75%), Gaps = 4/319 (1%)
 Frame = +2

Query  281   DTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQST  460
             D +  +GA++ +  I++T+GND+EAL A ++G AV+++SH+GR+RV+G+DR++FLHNQST
Sbjct  4     DVLLESGAQISDNGIVQTFGNDEEALKAADSGCAVIEMSHFGRLRVTGDDRLRFLHNQST  63

Query  461   ANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSD  640
             A+   L +G+GCDTVFVT TARTID+A AW M  A+ L+ SPET   +  +L KYIFFSD
Sbjct  64    ADLLQLKDGEGCDTVFVTNTARTIDLATAWAMNTAVILLVSPETRHDLIKLLNKYIFFSD  123

Query  641   KVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIIS  820
             KVE+ DI+++T +F +VGP+S+ ++  L L  L+ +PYG+H HY+ NG PVT+ VG+ + 
Sbjct  124   KVEVDDITEKTSYFSIVGPQSDNVMRQLKLESLIDKPYGTHVHYTANGAPVTVGVGSGLC  183

Query  821   EEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANL  1000
              +G+S LVS A A  VW +++  GA+ MGS AWE LRI+QGRP PGKELTDEFNVLEA L
Sbjct  184   TKGYSFLVSTAAAGPVWTSILKCGALHMGSLAWERLRILQGRPVPGKELTDEFNVLEAGL  243

Query  1001  WNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisV-DGKKVGKLTSVT  1177
             W  +S  KGCY GQET++RL+TY+G+KQ L G++L+ +VEPG+ ++  DG K GKLTS T
Sbjct  244   WRTISQTKGCYIGQETVARLITYNGVKQHLHGVKLTGAVEPGTILTTRDGVKAGKLTSCT  303

Query  1178  SSGDTSKPFGLGYIRKKAA  1234
                  +  FGL YIRK+  
Sbjct  304   RE---APYFGLCYIRKQCG  319



>ref|XP_001781977.1| predicted protein [Physcomitrella patens]
 gb|EDQ53201.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   355 bits (911),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/331 (51%), Positives = 240/331 (73%), Gaps = 6/331 (2%)
 Frame = +2

Query  248   LSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGE  427
              +PPPID+DL   +   GA   E  ++ET+ ND +AL A EN VAVV++S  GRIRV+GE
Sbjct  1     FTPPPIDNDLHAIISEMGAIFSEDGVVETFQNDKDALAAAENDVAVVEMSQIGRIRVTGE  60

Query  428   DRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERIT  607
             DR++FLHNQ+TA+F+ L +G+GCDTVFVT T RTID+A AW+MKN++ L  SP   + + 
Sbjct  61    DRIRFLHNQTTADFQKLKDGEGCDTVFVTSTGRTIDLAKAWVMKNSVILFVSPSQRQSLC  120

Query  608   SMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV-EGLNLGDLVGQPYGSHKHYSVNG  784
             ++L KYIFF+DKVE++DI+ +T +F LVGP S+++      + D   +PYGS  HY++ G
Sbjct  121   ALLNKYIFFADKVEVEDITDKTYYFTLVGPNSSKVCFRSFTIKD---KPYGSFMHYAIEG  177

Query  785   NPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKE  964
              PVT+ VG+ ++  G+S ++S  TA  VW+A+++ GAVPMG+ AWE+LR+ QGRPAPG+E
Sbjct  178   TPVTVGVGSGLASPGYSFMLSTDTAGIVWEAILNAGAVPMGAAAWEQLRVWQGRPAPGRE  237

Query  965   LTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVD  1144
             LT E+N LEA LW+ +S+ KGCY GQETI+RL+TYDG+KQ+L+ + ++   EP + I+ +
Sbjct  238   LTSEYNALEAGLWHTISMTKGCYIGQETIARLITYDGVKQQLYTVHMNGYAEPETEITCN  297

Query  1145  GKKVGKLTSVTSS--GDTSKPFGLGYIRKKA  1231
               +VGKLTS   +  G      GL YIR+K+
Sbjct  298   EARVGKLTSCVEAKEGSEHSHVGLAYIRRKS  328



>gb|KDO53501.1| hypothetical protein CISIN_1g014411mg [Citrus sinensis]
Length=243

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = +2

Query  227  TAALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYG  406
            TA LPFDLSPPPIDHDL++T+K  GAK+    I+ET+GND EAL A +NGVA VDLSH+G
Sbjct  54   TAVLPFDLSPPPIDHDLLETVKSEGAKISGEGIVETFGNDGEALDAADNGVAAVDLSHFG  113

Query  407  RIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSP  586
            RIRVSG+DR+QFLHNQSTANFEIL EGQGCDTVFVTPTARTIDIAHAWIMKNA+ LV SP
Sbjct  114  RIRVSGDDRIQFLHNQSTANFEILREGQGCDTVFVTPTARTIDIAHAWIMKNAVILVVSP  173

Query  587  ETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK  766
             T   IT ML KY+FF+DKVEIQDI+KQTC FV+VGP+SNQ++  LNLGDLVG+ YG+H+
Sbjct  174  LTCSSITEMLNKYVFFADKVEIQDITKQTCLFVVVGPKSNQVMRDLNLGDLVGEAYGTHR  233

Query  767  HYSVN  781
            HYS+N
Sbjct  234  HYSIN  238



>ref|WP_015205323.1| folate-binding protein YgfZ [Crinalium epipsammum]
 ref|YP_007144740.1| folate-binding protein YgfZ [Crinalium epipsammum PCC 9333]
 gb|AFZ15230.1| folate-binding protein YgfZ [Crinalium epipsammum PCC 9333]
Length=352

 Score =   311 bits (797),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 216/301 (72%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND  AL A   GVAV D +H+GRI+VS +DR+ FLHNQST NF+IL  GQGCDTVFV
Sbjct  28    SFGNDSVALQAARQGVAVCDRTHWGRIQVSDDDRINFLHNQSTNNFQILKPGQGCDTVFV  87

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+A A+IM++++ L+ SP+  + +   L +YIFF+DKV++ D+S+QT  F L+
Sbjct  88    TSTARTIDLATAYIMEDSVLLLVSPQRRQYLMQWLDRYIFFADKVKLADVSEQTATFSLI  147

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G  S+ ++E L   +++GQPY +HK   +    V IAVGN ++ +G++++V   +A  VW
Sbjct  148   GSYSDLLLEKLGATEIIGQPYSNHKKIFLGDIEVRIAVGNGLAIQGYTIIVPALSAAKVW  207

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             + LVD GA+ +G   W++LRI QGRP P  ELTD++N LEA L + +S  KGCY GQETI
Sbjct  208   QLLVDNGAIALGDRLWQQLRIEQGRPVPDYELTDDYNPLEAGLLHTLSFEKGCYIGQETI  267

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWGIRL++ VEPG+ + V  +KVGKLTS T +      FGLGY+R KA
Sbjct  268   ARLNTYKGVKQQLWGIRLNAPVEPGTVLMVGDEKVGKLTSYTDT--ELGAFGLGYVRTKA  325

Query  1232  A  1234
              
Sbjct  326   G  326



>ref|WP_036002252.1| glycine cleavage system protein T [Leptolyngbya sp. JSC-1]
Length=349

 Score =   311 bits (796),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 222/312 (71%), Gaps = 3/312 (1%)
 Frame = +2

Query  296   AGAKV-LEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFE  472
             AGA V  E  +  ++GND  AL A ++GVA+ D SH+GRI+V+GEDR++FLHNQ+T NF 
Sbjct  12    AGAVVSAEAKVPTSFGNDTAALEAVQHGVALYDRSHWGRIQVTGEDRIRFLHNQTTNNFN  71

Query  473   ILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEI  652
              L  GQGCDTVFVT TART+D+  A+++ +++ L+TSP  S+ +   + ++IFF+D+VE+
Sbjct  72    DLQPGQGCDTVFVTSTARTLDLVTAYVLDDSVLLLTSPGYSQHLIDWMDRFIFFADQVEL  131

Query  653   QDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGF  832
             +D+++ T  F L+GP S+++++ L    +VGQP  SH+  S+NG  V + VG+ ++  G+
Sbjct  132   KDVTETTASFSLLGPASDELLQKLGADVIVGQPLASHRLLSLNGIEVRVGVGSGLAIPGY  191

Query  833   SLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAV  1012
             +L  S   A S+W+ L    A+PMG   W++LRI QGRP PG+ELTD++N LEA LW+ +
Sbjct  192   TLFTSTDQAASLWQTLFATTAIPMGEQLWQQLRIEQGRPVPGQELTDDYNPLEAGLWHTI  251

Query  1013  SLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDT  1192
             SL+KGCY GQETI+RL TY G+KQ+LWGIRLS  VEP + + V  +KVG+LTS   + D 
Sbjct  252   SLSKGCYIGQETIARLHTYRGVKQQLWGIRLSQPVEPEAVVMVGDEKVGRLTSCMQTTDG  311

Query  1193  SKPFGLGYIRKK  1228
              +  GL YIR K
Sbjct  312   YR--GLAYIRTK  321



>ref|XP_008449404.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial isoform 
X3 [Cucumis melo]
Length=318

 Score =   306 bits (784),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = +2

Query  623   YIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIA  802
             YIF +DKVEIQDI+ QT   VLVGP+SNQI+E LNLG + G+PYG+H+H+SVNG P+T+ 
Sbjct  73    YIFLADKVEIQDITNQTSLLVLVGPKSNQIMEDLNLGSIAGEPYGTHQHFSVNGMPITVG  132

Query  803   VGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFN  982
             VG++ISEEGFSLL+SPA A  VWKALV  GAVPMGS AWE+LRI QG P+P KELTDEFN
Sbjct  133   VGSVISEEGFSLLISPAVAGPVWKALVSLGAVPMGSRAWEKLRIFQGMPSPQKELTDEFN  192

Query  983   VLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGK  1162
             VLEA LWN++SLNKGCYKGQETISRL+TYDG+KQRLWG++LS SVEPGS I++DGK+VGK
Sbjct  193   VLEAGLWNSISLNKGCYKGQETISRLITYDGVKQRLWGLQLSDSVEPGSPITIDGKRVGK  252

Query  1163  LTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
             LTS       S+ FGLGYI+KKAAS GDTVI+G+   GTVVEVPFL RQ
Sbjct  253   LTSYAPGRKESEHFGLGYIKKKAASIGDTVIVGEDTTGTVVEVPFLARQ  301



>ref|WP_016875105.1| glycine cleavage system protein T [Chlorogloeopsis fritschii]
Length=327

 Score =   306 bits (783),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 215/300 (72%), Gaps = 6/300 (2%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             T   D  A+ A + GVA+ D SH+GRI+V+ +DR++FLHNQST +F+ L   QGCDTVFV
Sbjct  6     TNSQDTAAIQAAQEGVAICDRSHWGRIKVADDDRLRFLHNQSTNDFQTLKPNQGCDTVFV  65

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+  A++M++A+ L+ SP   E +   L +YIFF+DKV++ D++ +T  F L+
Sbjct  66    TSTARTIDLVTAYVMEDAVLLLVSPNRREFLMQWLDRYIFFADKVQLTDVTDETATFSLL  125

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP+S+ IVE L  G ++GQ YG+H  +    + + +AVG+ ++  G++L++  A  ++VW
Sbjct  126   GPKSDAIVEKLGAGTIIGQVYGNHLSF----DGIRVAVGSGLASFGYTLILPVALKETVW  181

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
               +V+ GAVPM   AWEELRI QGRPAP  ELTD++N LEA LW  +S NKGCY GQETI
Sbjct  182   NKIVELGAVPMSDRAWEELRITQGRPAPEHELTDDYNPLEAGLWQTISFNKGCYIGQETI  241

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ LWGI L++ VEPG++I+   +KVGKLTS+T + +  +  GLGYIR KA
Sbjct  242   ARLNTYKGVKQHLWGINLNAGVEPGTTITAGDEKVGKLTSITETAEGYR--GLGYIRSKA  299



>ref|XP_008449403.1| PREDICTED: dimethylglycine dehydrogenase, mitochondrial isoform 
X2 [Cucumis melo]
Length=356

 Score =   306 bits (784),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = +2

Query  623   YIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIA  802
             YIF +DKVEIQDI+ QT   VLVGP+SNQI+E LNLG + G+PYG+H+H+SVNG P+T+ 
Sbjct  111   YIFLADKVEIQDITNQTSLLVLVGPKSNQIMEDLNLGSIAGEPYGTHQHFSVNGMPITVG  170

Query  803   VGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFN  982
             VG++ISEEGFSLL+SPA A  VWKALV  GAVPMGS AWE+LRI QG P+P KELTDEFN
Sbjct  171   VGSVISEEGFSLLISPAVAGPVWKALVSLGAVPMGSRAWEKLRIFQGMPSPQKELTDEFN  230

Query  983   VLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGK  1162
             VLEA LWN++SLNKGCYKGQETISRL+TYDG+KQRLWG++LS SVEPGS I++DGK+VGK
Sbjct  231   VLEAGLWNSISLNKGCYKGQETISRLITYDGVKQRLWGLQLSDSVEPGSPITIDGKRVGK  290

Query  1163  LTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQ  1309
             LTS       S+ FGLGYI+KKAAS GDTVI+G+   GTVVEVPFL RQ
Sbjct  291   LTSYAPGRKESEHFGLGYIKKKAASIGDTVIVGEDTTGTVVEVPFLARQ  339



>ref|WP_015153296.1| folate-binding protein YgfZ [Chroococcidiopsis thermalis]
 ref|YP_007090617.1| folate-binding protein YgfZ [Chroococcidiopsis thermalis PCC 
7203]
 gb|AFY86748.1| folate-binding protein YgfZ [Chroococcidiopsis thermalis PCC 
7203]
Length=363

 Score =   305 bits (780),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 222/322 (69%), Gaps = 6/322 (2%)
 Frame = +2

Query  278   IDTMKVAGAKVLE---GDIIE-TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFL  445
             +  ++ A   V E   GD I  ++GND  A  A   GVA+ D SH+G IRV+ EDR++FL
Sbjct  6     LQVVQAAAGAVFEEIAGDKIPVSFGNDVAAKQAVREGVAICDRSHWGIIRVTDEDRIRFL  65

Query  446   HNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKY  625
             HNQST +F+IL  GQGCDTVFV+ TARTID+A A++ ++A+ L+ SP   + +   L +Y
Sbjct  66    HNQSTNDFQILKPGQGCDTVFVSSTARTIDLATAYVTEDAVLLIVSPNRRQYLIDWLDRY  125

Query  626   IFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAV  805
             IFF+D+V+++D++ +T  F L+G +S++I+  L+L  ++GQ Y +H+   +    + +AV
Sbjct  126   IFFADRVQLEDVTGETAIFSLLGTKSDEILAQLDLSSIIGQAYANHQLVQLQDVEIRVAV  185

Query  806   GNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNV  985
             G  ++  G++L+V    A  VW  L++ GAVP+G   WE+LRI QGRP P KELT+++N 
Sbjct  186   GIGLATPGYTLIVPADKAAIVWNHLIETGAVPLGDRVWEQLRIEQGRPVPDKELTEDYNP  245

Query  986   LEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKL  1165
             LEA LW  +S NKGCY GQETI+RL TY G+KQ LWGIRL++  EPGS I+V  +KVG L
Sbjct  246   LEAGLWQTISFNKGCYIGQETIARLNTYKGVKQHLWGIRLNAPAEPGSIITVGEEKVGIL  305

Query  1166  TSVTSSGDTSKPFGLGYIRKKA  1231
             TS T + + S  FGLGYIR KA
Sbjct  306   TSYTDTEEGS--FGLGYIRTKA  325



>ref|WP_007355205.1| MULTISPECIES: glycine cleavage system protein T [Kamptonema]
 emb|CBN55990.1| glycine cleavage T protein (aminomethyl transferase) [ [[Oscillatoria] 
sp. PCC 6506]
Length=353

 Score =   303 bits (777),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 222/328 (68%), Gaps = 8/328 (2%)
 Frame = +2

Query  269   HDLIDTMKVAGAK----VLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRV  436
              +L D    AGA+    V + ++  ++GND EA+ A+  GV + D +H+GR+ VSGEDR+
Sbjct  3     QELRDIQASAGAEFISSVTQANVPVSFGNDAEAILASRQGVILCDRTHWGRLEVSGEDRL  62

Query  437   QFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSML  616
             +FLHNQST NF IL  GQGCDTVFVT TARTID+A A I ++ + L+ SP   +++  +L
Sbjct  63    RFLHNQSTNNFNILQPGQGCDTVFVTSTARTIDLATAIITEDKVLLLVSPNRRQKLLELL  122

Query  617   RKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHK--HYSVNGNP  790
              +YIF  DKVE++D++  T  F L+GP SN++++ L +  + G+PYG+HK    +   + 
Sbjct  123   DRYIFPMDKVELKDVTDATATFSLIGPHSNKLLDKLGITGIEGKPYGTHKLIENTTTESS  182

Query  791   VTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELT  970
             + + VG+ ++  G++++V    A ++W  LV  GA+P G   WE LRI QGRPAP  ELT
Sbjct  183   IRVVVGSGLATSGYTIIVDGNQAANLWDKLVQNGAIPAGDRVWEHLRIEQGRPAPDFELT  242

Query  971   DEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGK  1150
             DE+N LEA L + +S +KGCY GQETI+RL TY G+KQ+LWG+RLS   E G+++++  +
Sbjct  243   DEYNPLEARLLHTISYDKGCYIGQETIARLNTYKGVKQQLWGLRLSGEAEVGAAVTIGEE  302

Query  1151  KVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             KVGKLTS   + D   PFGL YIR KA 
Sbjct  303   KVGKLTSFVVTDD--GPFGLAYIRTKAG  328



>ref|WP_026731600.1| glycine cleavage system protein T [Fischerella sp. PCC 9605]
Length=335

 Score =   303 bits (776),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/302 (52%), Positives = 214/302 (71%), Gaps = 6/302 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A +  VAV D SH+GRI+VS +DR++FLHNQST +F+ L  GQGCDTVFVT T
Sbjct  9     KDTAAIQAAQTTVAVCDRSHWGRIKVSDDDRLRFLHNQSTNDFQTLKPGQGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
              RTID+  +++M++A+ L+ SP   E +   L +YIFF+DKV++ DI+ +T  F L+GP 
Sbjct  69    GRTIDLVTSYVMEDAVLLLVSPNRREFLMQWLDRYIFFADKVQLTDITDETATFSLIGPG  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHY-SVNGNP---VTIAVGNIISEEGFSLLVSPATAKSV  868
             S+ IVE L    ++GQPYG+H    SVN      V  A+G+ ++  G++L++  +  +++
Sbjct  129   SDAIVEKLGAEAIIGQPYGNHLSIPSVNEGDKGGVIFAIGSGLASPGYTLILPASVKETI  188

Query  869   WKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
             W  +V+ GAVPM   AWE LRIIQGRPAP +ELTD++N LEA LW  +S NKGCY GQET
Sbjct  189   WNKIVELGAVPMSDRAWEVLRIIQGRPAPEQELTDDYNPLEAGLWQTISFNKGCYIGQET  248

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+KQ LWGIRLS+ VEPG++I+V  +K+GKLTS T + +  +  GLGYIR K
Sbjct  249   IARLNTYQGVKQHLWGIRLSALVEPGTTITVGDEKIGKLTSCTETAEGYR--GLGYIRTK  306

Query  1229  AA  1234
             A 
Sbjct  307   AG  308



>ref|WP_016865411.1| glycine cleavage system protein T [Fischerella muscicola]
Length=327

 Score =   302 bits (774),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 211/298 (71%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A +  VA+ D SH+GRI+VS +DR++FLHNQST +F+ L  GQGCDTVFVT T
Sbjct  9     QDKAAIQAAQTTVAICDRSHWGRIKVSDDDRLRFLHNQSTNDFQKLQPGQGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+A  ++M++A+ L+ SP   E +   L +YIFF+DKV++ D++ +T    L+GP 
Sbjct  69    ARTIDLATGYVMEDAVLLLVSPNRREYLLQWLDRYIFFADKVQLTDVTDETATLSLIGPD  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ IVE L  G ++GQPYG+H+ +    + + IAVG+ ++  G++L++  +  +SVW  +
Sbjct  129   SDTIVEKLGAGAIIGQPYGNHQVF----DDIHIAVGSGLACSGYTLILPVSIKESVWHKI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             V+ GAVPM   AWE LRI QGRP P +ELTD++N LE  LW  VS NKGCY GQETI+RL
Sbjct  185   VELGAVPMSDRAWEMLRITQGRPVPDQELTDDYNPLEVGLWQTVSFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGI LS++ EPG++I+V  +KVGKLTS   + D  +  GLGYIR KA 
Sbjct  245   NTYKGVKQHLWGINLSAAAEPGTTITVGDEKVGKLTSCIETVDGYR--GLGYIRTKAG  300



>ref|WP_023067070.1| glycine cleavage T-C-terminal barrel domain protein [Lyngbya 
aestuarii]
 gb|ERT06676.1| glycine cleavage T-C-terminal barrel domain protein [Lyngbya 
aestuarii BL J]
Length=349

 Score =   303 bits (776),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 210/301 (70%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND +A+ AT++GVA+ D SH+G +++S EDR++FLHNQST N + L  GQGCD+VFV
Sbjct  25    SFGNDSKAIAATQSGVALCDRSHWGLLQISDEDRLRFLHNQSTNNIQSLQPGQGCDSVFV  84

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             + TARTID+   ++ ++A+ ++ SP   + +   L +YIF  D+VE++DIS Q   F L+
Sbjct  85    SSTARTIDLTTFYVTEDAVLILVSPNRRQMLIDWLDRYIFPMDRVELKDISDQNAIFSLI  144

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP+S+Q++E L +  L  QPY +H+   +   PV +AVG+ ++  G++L+VS   A S+W
Sbjct  145   GPQSHQLLESLGITPLTDQPYATHQQVEIENIPVRVAVGSGLTTTGYTLIVSVDHAVSIW  204

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             K L+  GA+ MG+  WE+LRI QGRP P  ELTD++N LEA LW  +S  KGCY GQETI
Sbjct  205   KTLIGSGAIAMGNRIWEQLRIEQGRPFPDSELTDDYNPLEAGLWQTISFEKGCYIGQETI  264

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWG++L + V  G+ I V+ KK+G LTS   +   S+  GLGYIR KA
Sbjct  265   ARLNTYKGVKQKLWGLKLEAPVTVGTEIKVEDKKIGTLTSFIQT--ESEFLGLGYIRTKA  322

Query  1232  A  1234
              
Sbjct  323   G  323



>ref|WP_009783188.1| glycine cleavage system protein T [Lyngbya sp. PCC 8106]
 gb|EAW38307.1| Glycine cleavage T protein (aminomethyl transferase) [Lyngbya 
sp. PCC 8106]
Length=349

 Score =   303 bits (776),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 210/301 (70%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND EA+ AT+ GVA+ D SH+G +++S +DR++FLHNQST N + L  GQGCD+VFV
Sbjct  25    SFGNDSEAIAATQTGVALCDRSHWGLLQISDDDRLRFLHNQSTNNIQSLQPGQGCDSVFV  84

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             + TARTID+   ++ ++A+ ++ SP   + +   L +YIF  D+VE++DIS Q   F L+
Sbjct  85    SSTARTIDLTTFYVTEDAVLILVSPNRRQMLIDWLDRYIFPMDRVELKDISDQNAIFSLI  144

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP+S+Q++E L +  L  QPY +H+   +   PV +AVG+ ++  G++L+VS   A S+W
Sbjct  145   GPQSHQLLERLGITPLSDQPYATHQQVEIENIPVRVAVGSGLTTTGYTLIVSVDHAVSIW  204

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             K L+  GA+ MG+  WE+LRI QGRP P  ELTD++N LEA LW  +S  KGCY GQETI
Sbjct  205   KTLIASGAIAMGNRTWEQLRIEQGRPVPDSELTDDYNPLEAGLWKTISFEKGCYIGQETI  264

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWG++L ++V  G+ I V+ KKVGKLTS   +   +   GLGYIR KA
Sbjct  265   ARLNTYKGVKQQLWGLKLEAAVPVGTEIKVEDKKVGKLTSFIET--KAGFLGLGYIRTKA  322

Query  1232  A  1234
              
Sbjct  323   G  323



>ref|WP_015178777.1| folate-binding protein YgfZ [Oscillatoria nigro-viridis]
 ref|YP_007117980.1| folate-binding protein YgfZ [Oscillatoria nigro-viridis PCC 7112]
 gb|AFZ09564.1| folate-binding protein YgfZ [Oscillatoria nigro-viridis PCC 7112]
Length=349

 Score =   303 bits (775),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 222/325 (68%), Gaps = 6/325 (2%)
 Frame = +2

Query  269   HDLIDTMKVAGAKVLEGDIIE----TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRV  436
              +L D    AGA   E    E    ++GND EA+ AT+ GVA+ D +H+GRI++S  DR+
Sbjct  3     QELHDIQAAAGATFAELTTKEIVPVSFGNDAEAIAATKQGVALYDRTHWGRIQISDSDRL  62

Query  437   QFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSML  616
             +FLHNQST NF IL  GQGCDTVFVT TARTID+A A+  ++A+ L+ SP    ++  +L
Sbjct  63    RFLHNQSTNNFNILKPGQGCDTVFVTSTARTIDLATAYATEDAVLLLVSPNRRRQLLELL  122

Query  617   RKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVT  796
              +YIF  D+VE+ D++  T  F  +GP S Q+++ + + +L  QPY +HK     G  V 
Sbjct  123   DRYIFPMDRVELTDLTDTTVAFSFLGPESTQLLDKIGVTELENQPYATHKLIHFAGREVR  182

Query  797   IAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDE  976
             +AVG+ ++  G++L+     A ++W+ LV  GAVPMG   WE+LRI QGRPAP  ELTD+
Sbjct  183   VAVGSGLATLGYTLIAQACDAANLWQELVKAGAVPMGDRVWEQLRIEQGRPAPDFELTDD  242

Query  977   FNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKV  1156
             +N LEA L + ++ +KGCY GQETI+RL TY G+KQ+LWG++LS +VEPG++++++ +KV
Sbjct  243   YNPLEARLLHTITYDKGCYIGQETIARLNTYKGVKQQLWGVQLSGAVEPGTTVTIEEEKV  302

Query  1157  GKLTSVTSSGDTSKPFGLGYIRKKA  1231
             GKLTS T +   S  FGL YIR KA
Sbjct  303   GKLTSFTET--ESGFFGLAYIRTKA  325



>ref|WP_039717450.1| glycine cleavage system protein T [Scytonema millei]
 gb|KIF19919.1| glycine cleavage system protein T [Scytonema millei VB511283]
Length=328

 Score =   301 bits (772),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 211/301 (70%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++ ND  A+ A   GVA+ D SH+G IRV+ +DR++FLHNQST +F+IL  GQGCDTVFV
Sbjct  4     SFDNDAVAVQAVREGVAICDRSHWGVIRVTDDDRIRFLHNQSTNDFQILKPGQGCDTVFV  63

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             + TARTID+A A++ ++A+ L+ SP   + +   L +YIFF+D+V+++DI+ +T  F L+
Sbjct  64    SSTARTIDLATAYVTEDAVLLIVSPNRRQYLIDWLDRYIFFADRVQLEDITGETTIFSLL  123

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G +S++I+  L +  ++  PY SH+   +    + +AVG+ ++  G++L+V    A  VW
Sbjct  124   GTKSDEILAKLGVSSIISHPYASHQLVQLKDIEIRVAVGSGLATPGYTLIVPADKAAIVW  183

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
               LV+ GAVP+G   WE+LRI QGRP P KELT+++N LEA LW  +S NKGCY GQETI
Sbjct  184   NHLVETGAVPLGDRVWEQLRIEQGRPVPDKELTEDYNPLEAGLWQTISFNKGCYIGQETI  243

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ LWGIRL++   PGS I+V  +KVG LTS T + + S  FGLGYIR KA
Sbjct  244   ARLNTYKGVKQHLWGIRLNAPAAPGSIITVGEEKVGILTSYTDTDEGS--FGLGYIRTKA  301

Query  1232  A  1234
              
Sbjct  302   G  302



>ref|WP_015187446.1| folate-binding protein YgfZ [Gloeocapsa sp. PCC 7428]
 ref|YP_007126730.1| folate-binding protein YgfZ [Gloeocapsa sp. PCC 7428]
 gb|AFZ29570.1| folate-binding protein YgfZ [Gloeocapsa sp. PCC 7428]
Length=341

 Score =   302 bits (773),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 210/300 (70%), Gaps = 2/300 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++ +D  AL  ++    + D SH+GRI VS  DR++FLHNQST +FE L  GQGCDTVFV
Sbjct  14    SFSDDATALQVSQQKAVLYDRSHWGRIEVSDGDRLRFLHNQSTNDFEQLKPGQGCDTVFV  73

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+A A++ ++A+ L+ SP   E +   L +YIFF+D+V+++D++ +T  F L+
Sbjct  74    TSTARTIDLATAYVTEDAVLLLVSPNRREFLIEWLDRYIFFADRVQLKDVTPETAAFSLI  133

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S+ +V+ L  G ++ QPYG H    +  + V+IAVG+ ++  G++L+V  A A +VW
Sbjct  134   GPESDAVVQQLGAGTIINQPYGHHTVVQLGESEVSIAVGSGLALPGYTLIVPVAAAATVW  193

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
               +V  G  P+    WE+LRI+QGRP P  ELTD++N LEA LWNA+S NKGCY GQETI
Sbjct  194   NKIVQAGVEPISDRVWEQLRILQGRPVPECELTDDYNPLEAGLWNAISFNKGCYIGQETI  253

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWGIRL S VEPGS+I+V  +KVGKLTS   +      FGLGYIR KA
Sbjct  254   ARLNTYQGVKQKLWGIRLESLVEPGSAIAVADEKVGKLTSCIKTAQGY--FGLGYIRTKA  311



>ref|WP_012412717.1| glycine cleavage system protein T [Nostoc punctiforme]
 ref|YP_001869724.1| glycine cleavage T protein (aminomethyl transferase) [Nostoc 
punctiforme PCC 73102]
 gb|ACC84781.1| glycine cleavage T protein (aminomethyl transferase) [Nostoc 
punctiforme PCC 73102]
Length=331

 Score =   301 bits (771),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/298 (52%), Positives = 209/298 (70%), Gaps = 3/298 (1%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A   GVA+ D + +GRI+V+G+DR+ FLHNQST NF+IL  GQGCDTVFVT T
Sbjct  9     KDAAAIQAARVGVAICDRTAWGRIKVAGDDRLNFLHNQSTNNFQILKPGQGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+A A++ ++A+ L+ SP   + +   L KYIF++DKVE+ DI++ T  F L+GP 
Sbjct  69    ARTIDLATAYVREDAVILLVSPNRRQYLMEWLDKYIFYADKVELSDITEYTNTFSLIGPG  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVN-GNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
             S+ ++E L +G+L+GQPYG+H+ Y++     V IAVG+ ++  G++         SVW  
Sbjct  129   SDAVLEKLGIGELIGQPYGNHQVYTIAPAEGVRIAVGSGLAAPGYTFTFPYTDKSSVWNK  188

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             L++ GAV M   AW+ LRI+QGRPAP  ELTD++N LE  LW  +S  KGCY GQETI+R
Sbjct  189   LLEAGAVEMSDRAWDALRILQGRPAPDAELTDDYNPLEVGLWQTISFTKGCYIGQETIAR  248

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             L TY G+KQ L GIRLS+ VE GS+I+V  +KVGKLTS T + D    FGLGYIR KA
Sbjct  249   LNTYKGVKQHLLGIRLSAPVEVGSAIAVGDEKVGKLTSYTETADGY--FGLGYIRTKA  304



>ref|WP_038021131.1| glycine cleavage system protein T [Synechocystis sp. PCC 7509]
Length=324

 Score =   300 bits (768),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 206/301 (68%), Gaps = 6/301 (2%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND EAL A ++GVA+ D +H+G I V+G DR++FLHNQST NFE L  G+GCDTVFV
Sbjct  4     SFGNDSEALEAVQSGVAICDRTHWGVIEVTGGDRLRFLHNQSTNNFERLKSGEGCDTVFV  63

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+  A +  +++ L+TSP   + +  +L +YIFF+DKVE+ DI+ +T  F L+
Sbjct  64    TSTARTIDLVSAIVTDDSVLLITSPNRYKYLLELLDRYIFFADKVELTDITDKTAIFSLI  123

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G  SN +V  + L  ++GQP G+H       + V  AVG+ ++  G++L+V    A  VW
Sbjct  124   GANSNDLVSKIGLEAIIGQPVGNHLLI----DDVRTAVGSGLATPGYTLIVPAENAAKVW  179

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             K++V+  AVPMG   WE+LRI QGRP P KELTD++N LEA L   +S +KGCY GQETI
Sbjct  180   KSIVEADAVPMGDRVWEQLRIKQGRPVPDKELTDDYNPLEAGLLQTISFDKGCYIGQETI  239

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ LWGI+L+   E GS I V  +KVGKLTS+  S      FGLGYIR KA
Sbjct  240   ARLNTYKGVKQNLWGIKLNGVAEVGSVIMVGEEKVGKLTSIVES--DRGFFGLGYIRTKA  297

Query  1232  A  1234
              
Sbjct  298   G  298



>ref|WP_009768178.1| folate-binding protein YgfZ [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ67377.1| folate-binding protein YgfZ [Oscillatoriales cyanobacterium JSC-12]
Length=351

 Score =   300 bits (769),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 212/300 (71%), Gaps = 2/300 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND  AL A + GV + D SH+GR+R+S  D   FLHNQST +F     G+GCDTVFV
Sbjct  25    SFGNDAIALKAIQTGVVLCDRSHWGRLRLSDADCKTFLHNQSTNDFNTRQPGEGCDTVFV  84

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+A A+++++A+ +V SP   + +   L +YIFF DKV++QD+++QT  F L+
Sbjct  85    TSTARTIDLATAYVLEDAVIVVVSPNRRDYLMKWLDRYIFFGDKVKLQDVTEQTALFSLI  144

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S++++E L +  L  +PY SH+  ++ G  V +AVG+ ++  G++LL+   +A  VW
Sbjct  145   GPDSHRLLETLGIEPLHDRPYASHRLVNLGGQSVRVAVGSGLATAGYTLLMPAESAAQVW  204

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             ++L+  GAVPMG   WE LRI+QGRP P  ELTD++N +EA LW A+S++KGCY GQETI
Sbjct  205   ESLITAGAVPMGDRLWEHLRILQGRPKPDHELTDDYNAVEACLWQAISISKGCYIGQETI  264

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ++WG+ L  S  PG+ I+++ +KVG +TSVT +      FGLGY+R KA
Sbjct  265   ARLDTYKGVKQQIWGMWLPESAIPGTPITLEAEKVGIVTSVTQT--DMGAFGLGYVRTKA  322



>ref|WP_009756834.1| MULTISPECIES: glycine cleavage system protein T [Fischerella]
 gb|EHC15077.1| folate-binding protein YgfZ [Fischerella sp. JSC-11]
Length=327

 Score =   299 bits (766),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/298 (50%), Positives = 211/298 (71%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A +  VA+ D SH+GRI+V+  DR++FLHNQST +F+ L  GQGCDTVFVT T
Sbjct  9     QDKAAIQAAQTTVAICDRSHWGRIKVTDGDRLRFLHNQSTNDFQKLQPGQGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+A A++M++A+ L+ SP   E +   L +YIFF+DKV++ D++ +T    L+GP 
Sbjct  69    ARTIDLATAYVMEDAVLLLVSPNRREYLLQWLDRYIFFADKVQLTDVTDETATLSLIGPD  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ IVE L  G ++GQPYG+H+ +    + + +AVG+ ++  G++L++  +  ++VW  +
Sbjct  129   SDTIVEKLGAGAIIGQPYGNHQIF----DGIHVAVGSGLASPGYNLILPVSIKETVWNKI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             V+ GAVPM   AWE LRI QGRP P +ELTD++N LE  LW  VS NKGCY GQETI+RL
Sbjct  185   VELGAVPMSDRAWEMLRITQGRPVPDQELTDDYNPLEVGLWQTVSFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGI LS++ +PG++I++  +KVGKLTS   + D  +  GLGYIR KA 
Sbjct  245   NTYKGVKQHLWGINLSAAAQPGTTITIGDEKVGKLTSCIETVDGYR--GLGYIRTKAG  300



>ref|WP_008190662.1| glycine cleavage system protein T [Moorea producens]
 gb|EGJ28841.1| folate-binding protein YgfZ [Moorea producens 3L]
Length=355

 Score =   300 bits (767),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 219/322 (68%), Gaps = 7/322 (2%)
 Frame = +2

Query  275   LIDTMKVAGAK---VLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFL  445
             L+D  ++AGAK   V    I  ++GND   + A   GVA+VD  H+G I+VSG+DR+++L
Sbjct  6     LLDAQRLAGAKFESVASRMIPVSFGNDAAGIEAARQGVALVDCCHWGLIKVSGDDRLRYL  65

Query  446   HNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKY  625
             HNQST +F+    GQGC+TVFVT TARTID+A A+I+ +++ L+ SP   ++I   L +Y
Sbjct  66    HNQSTNDFQTRRPGQGCETVFVTSTARTIDLATAYILADSVLLLVSPNCRQQIMEWLDRY  125

Query  626   IFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAV  805
             IF  D+V +QD+S       L+GP S+ ++ GL + ++ G+   SH+   +  N V IAV
Sbjct  126   IFPMDQVALQDVSDHHAVLSLIGPVSDALLTGLGV-EISGED-ASHQQLMLGDNQVRIAV  183

Query  806   GNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNV  985
             G+ ++  G++++     A  VW+ L   GA+P+G   WE+LRI QGRPAPG ELT+++N 
Sbjct  184   GSCLAMPGYTVICPAENAAQVWQTLTTAGAIPIGDRVWEQLRIQQGRPAPGHELTEDYNP  243

Query  986   LEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKL  1165
             LEA LW ++S +KGCY GQETI+RL TY G+KQRLWGIRLS+  + GS I+VDG+KVGKL
Sbjct  244   LEAGLWQSISFSKGCYIGQETIARLNTYKGVKQRLWGIRLSAPTDLGSVITVDGEKVGKL  303

Query  1166  TSVTSSGDTSKPFGLGYIRKKA  1231
             TS+T +      FGL YIR KA
Sbjct  304   TSLTET--DQGVFGLAYIRTKA  323



>ref|WP_015184414.1| folate-binding protein YgfZ [Microcoleus sp. PCC 7113]
 ref|YP_007123684.1| folate-binding protein YgfZ [Microcoleus sp. PCC 7113]
 gb|AFZ20278.1| folate-binding protein YgfZ [Microcoleus sp. PCC 7113]
Length=352

 Score =   299 bits (766),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 223/325 (69%), Gaps = 5/325 (2%)
 Frame = +2

Query  269   HDLIDTMKVAGA---KVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQ  439
              +L D  + AGA    V +  I  ++GND  A+ A   GVA+VDLSH+G +++SG+DR++
Sbjct  3     QELYDVQQKAGATFESVADVTIPVSFGNDTTAIQAARQGVALVDLSHWGLLKISGDDRLR  62

Query  440   FLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLR  619
             +LHNQST +F+ L  GQGCDTVFVT TARTID+A A++ ++++ L+ SP   +++   L 
Sbjct  63    YLHNQSTNDFQKLKPGQGCDTVFVTSTARTIDLATAYVTEDSVFLLVSPNRRQQLIEWLD  122

Query  620   KYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTI  799
             +YIF  D+VE++D+S ++  F L+GP S  +++ L+   L+   Y SH+   +NG  V +
Sbjct  123   RYIFPMDQVELKDVSHESATFSLLGPGSEALLQQLSDEVLIEDAYASHQELMLNGLKVRV  182

Query  800   AVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEF  979
             AVGN ++  G++L+VS + A  +W+ L + G +PMG   WE+LRI QGRP P +ELT+++
Sbjct  183   AVGNGLALPGYTLIVSASHAARLWQVLTEAGGMPMGDRIWEQLRIQQGRPVPDRELTEDY  242

Query  980   NVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVG  1159
             N LE  LW  +S +KGCY GQETI+RL TY G+KQ+LWG+RL + VEPG+ + V  +KVG
Sbjct  243   NPLEVGLWQTISFDKGCYIGQETIARLNTYKGVKQQLWGVRLKAPVEPGTVVMVGEEKVG  302

Query  1160  KLTSVTSSGDTSKPFGLGYIRKKAA  1234
             KLTS+T +      FGL YIR KA 
Sbjct  303   KLTSLTET--DQGLFGLAYIRTKAG  325



>ref|WP_027845356.1| glycine cleavage system protein T [Mastigocoleus testarum]
Length=338

 Score =   298 bits (763),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 213/302 (71%), Gaps = 5/302 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             GND  A+     GVAV D S++GRI+VS +DR++FLHNQST +F+ L  GQGCDTVFV  
Sbjct  8     GNDTAAIQVITQGVAVCDRSNWGRIKVSDDDRLRFLHNQSTNDFQSLKSGQGCDTVFVNS  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+A A++  +A+ L+ SP+  E +   L +YIFF+DKV++ D++ +T    ++G 
Sbjct  68    TARTIDLASAYVTDDAVLLLVSPQKREFLFQWLDRYIFFADKVQLTDVTDETATLSIIGT  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVT---IAVGNIISEEGFSLLVSPATAKSV  868
              S+ I E L   +++GQP+G+H  +S+     T   IAVG+ ++  G++L++  +  +++
Sbjct  128   GSDAIAEQLGAKEIIGQPHGNHISFSLGNTDNTEGIIAVGSGLASPGYTLIIPASEKEAI  187

Query  869   WKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
             W+ +++ GAVP+  NAWE LRII+GRPAP +ELTD++N LEA LW  +S +KGCY GQET
Sbjct  188   WQKIIENGAVPLSENAWETLRIIEGRPAPEQELTDDYNPLEAGLWQTISFDKGCYIGQET  247

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+KQ LWGIRL+S VE G+ I  + +KVGKLTS T +  +   FGLGYIR K
Sbjct  248   IARLNTYKGVKQCLWGIRLNSPVEAGAVIFAEDQKVGKLTSYTET--SEGHFGLGYIRTK  305

Query  1229  AA  1234
             A 
Sbjct  306   AG  307



>ref|WP_006196170.1| glycine cleavage system protein T [Nodularia spumigena]
 gb|EAW45572.1| Glycine cleavage T protein (aminomethyl transferase) [Nodularia 
spumigena CCY9414]
 gb|AHJ29917.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Nodularia spumigena CCY9414]
Length=327

 Score =   297 bits (760),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 210/287 (73%), Gaps = 6/287 (2%)
 Frame = +2

Query  374   GVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWI  553
             GVAV D SH+GRIRVS +D ++FLHNQST +F+ L  GQGCDTV V+ TARTID+  A++
Sbjct  20    GVAVCDRSHWGRIRVSDDDHLRFLHNQSTNDFQSLKPGQGCDTVMVSSTARTIDLVSAYV  79

Query  554   MKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLG  733
             +++A+ L+TSP   E +   L +YIF++DKV++QDI+ +T  F L+G +S+ IVE L  G
Sbjct  80    LEDAVLLLTSPSRREALFQWLDRYIFYADKVQLQDITNETSTFSLIGAKSDAIVEKLGAG  139

Query  734   DLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSN  913
              ++G+PYGSH+   V+G  V +AVG+ ++E G++L++  +    +W+ +++ GAV +   
Sbjct  140   AIIGKPYGSHQQ--VDG--VMVAVGSGLAEPGYTLILPNSEKAQLWQQILELGAVELSDR  195

Query  914   AWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLW  1093
             AW+ LRI+QGRPAP  ELTD++N LE  LW  +S NKGCY GQETI+RL TY G+KQ LW
Sbjct  196   AWDMLRILQGRPAPDAELTDDYNPLEVGLWQTISFNKGCYIGQETIARLNTYKGVKQYLW  255

Query  1094  GIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             GIRL++ VE GS+I+V  +KVGKLTS T + +    FGLGYIR KA 
Sbjct  256   GIRLNAPVEVGSAITVGDEKVGKLTSYTETANGH--FGLGYIRSKAG  300



>ref|WP_006634110.1| glycine cleavage system protein T [Microcoleus vaginatus]
 gb|EGK86494.1| folate-binding protein YgfZ [Microcoleus vaginatus FGP-2]
Length=350

 Score =   297 bits (760),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 220/327 (67%), Gaps = 6/327 (2%)
 Frame = +2

Query  269   HDLIDTMKVAGAKVLEGDIIE----TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRV  436
              +L D    AGA   E    E    ++GND EA+ AT+ GVA+ D +H+GRI++S  DR+
Sbjct  4     QELHDIQAAAGATFAELTTKEIVPVSFGNDAEAIAATKKGVALYDRTHWGRIQISDSDRL  63

Query  437   QFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSML  616
             +FLHNQST NF IL  GQGCDTVFVT TARTID+A A+  ++A+ L+ S     ++  +L
Sbjct  64    RFLHNQSTNNFNILKPGQGCDTVFVTSTARTIDLATAYATEDAVLLLVSANRRRQLLELL  123

Query  617   RKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVT  796
              +YIF  D+VE+ D++  T  F  +GP S  ++E + +  L  QPY +HK  +  G  V 
Sbjct  124   DRYIFPMDRVELTDLTDTTVAFSFLGPESTHLLEKIGVTVLENQPYATHKLINFAGREVR  183

Query  797   IAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDE  976
             +AVG+ ++  G++L+   + A S+W  L+  GAVPMG   WE+LRI QGRPAP  ELTD+
Sbjct  184   VAVGSGLATPGYTLIAPASDAASLWHELLKAGAVPMGDRVWEQLRIEQGRPAPDFELTDD  243

Query  977   FNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKV  1156
             +N LEA L + ++ +KGCY GQETI+RL TY G+KQ+LWG++LS +VEPG+++++  +KV
Sbjct  244   YNPLEARLLHTITYDKGCYIGQETIARLNTYKGVKQQLWGVQLSGAVEPGTAVTIGEEKV  303

Query  1157  GKLTSVTSSGDTSKPFGLGYIRKKAAS  1237
             GKLTS T +   S  FGL YIR KA +
Sbjct  304   GKLTSFTET--ESGFFGLAYIRTKAGA  328



>ref|WP_006105963.1| glycine cleavage system protein T [Coleofasciculus chthonoplastes]
 gb|EDX71238.1| Glycine cleavage T-protein (aminomethyl transferase) [Coleofasciculus 
chthonoplastes PCC 7420]
Length=353

 Score =   296 bits (759),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 207/300 (69%), Gaps = 2/300 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND  AL A   GVA+VDLSH+G +++S EDR++FLHNQST +F+ L  GQGCDTVFV
Sbjct  26    SFGNDAAALQAARQGVALVDLSHWGLLKISDEDRLRFLHNQSTNDFQKLKPGQGCDTVFV  85

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+  A++ K A+ L+ SP   +++   L +YIF  D+VE+ DIS  +  F L+
Sbjct  86    TSTARTIDLVTAYVTKEAVLLLVSPNRRQQLLEWLDRYIFPMDRVELADISNDSAIFSLI  145

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S+ ++  L +   +G  Y SH+H ++N   V IA G+  +  G++L+V  + A ++W
Sbjct  146   GPESDTLLTKLGVQLPIGDVYASHQHLNLNDIEVRIARGSGFALPGYTLIVPASNAANLW  205

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             + L    A PMG   W++LRI QGRP P  ELT+++N LEA LWN +S +KGCY GQETI
Sbjct  206   QTLTTANATPMGDRVWQQLRIEQGRPLPDYELTEDYNPLEAGLWNTISFDKGCYIGQETI  265

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWG+RL  SVEPG+ I+VDG+KVGKLTS T +       GL YIR KA
Sbjct  266   ARLNTYKGVKQQLWGVRLPVSVEPGTVITVDGEKVGKLTSCTPT--EQGYIGLAYIRTKA  323



>ref|WP_026786268.1| MULTISPECIES: glycine cleavage system protein T [Planktothrix]
Length=352

 Score =   296 bits (759),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 209/301 (69%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GN+ EA+TAT+ GVA+ D S++G +++SG DR++FLHNQST + +    G+GCDTVFV
Sbjct  28    SFGNETEAITATKQGVAIYDRSYWGLLKISGADRLRFLHNQSTNSIQSFKPGEGCDTVFV  87

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TART+D+A A I ++AI ++ SP   +++   L +YIF  D+VE+QDI+     F L+
Sbjct  88    TSTARTLDLATALITEDAILVLVSPNRRQQLMEWLDRYIFPMDQVELQDITHDYAVFSLL  147

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G  S Q++    + DL  + YGSH+ + + G  + IAVG+ +   G++L++  + A SVW
Sbjct  148   GQESPQVLNKFGIMDLQQKSYGSHQCFEIAGYSLRIAVGSGLDTPGYTLILPTSIATSVW  207

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             + L   GA+P+G   W+ LR++ GRPAP  ELT+++N LEA LW  +S +KGCY GQETI
Sbjct  208   QVLTQAGAIPLGETVWQHLRVLAGRPAPDTELTEDYNPLEAGLWQTLSFDKGCYIGQETI  267

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWGIRL +SV  G+ I +D  KVGKLTS T+S    K FGLGYIR KA
Sbjct  268   TRLNTYKGVKQKLWGIRLKASVSAGTPILIDDVKVGKLTSYTNS--DGKHFGLGYIRTKA  325

Query  1232  A  1234
              
Sbjct  326   G  326



>gb|KEI68493.1| GcvT [Planktothrix agardhii NIVA-CYA 126/8]
Length=341

 Score =   295 bits (756),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 208/301 (69%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GN  EA+TAT+ GVA+ D S++G +++SG DR++FLHNQST + +    G+GCDTVFV
Sbjct  17    SFGNQAEAITATKQGVAIYDRSYWGLLKISGADRLRFLHNQSTNSIQSFKPGEGCDTVFV  76

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TART+D+A A I ++AI ++ SP   +++   L +YIF  D+VE+QDI+     F L+
Sbjct  77    TSTARTLDLATALITEDAILVLVSPNRRQQLMEWLDRYIFPMDQVELQDITHDYAVFSLL  136

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G  S Q++    + DL  + YGSH+ + + G  + IAVG+ +   G++L++  + A SVW
Sbjct  137   GQESPQVLNKFGIMDLQQKSYGSHQCFEIAGYSLRIAVGSGLDTPGYTLILPTSIATSVW  196

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             + L   GA+P+G   W+ LR++ GRPAP  ELT+++N LEA LW  +S +KGCY GQETI
Sbjct  197   QVLTQAGAIPLGETVWQHLRVLAGRPAPDTELTEDYNPLEAGLWQTLSFDKGCYIGQETI  256

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWGIRL +SV  G+ I +D  KVGKLTS T+S    K FGLGYIR KA
Sbjct  257   TRLNTYKGVKQKLWGIRLKASVSAGTPILIDDVKVGKLTSYTNS--DGKHFGLGYIRTKA  314

Query  1232  A  1234
              
Sbjct  315   G  315



>ref|WP_026098492.1| glycine cleavage system protein T [Oscillatoria sp. PCC 10802]
Length=329

 Score =   294 bits (753),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 210/301 (70%), Gaps = 2/301 (1%)
 Frame = +2

Query  329   ETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVF  508
             E+ GN+  AL A     AV + SH+GRI VS  DR++FLHNQST +F  L  GQGCDTVF
Sbjct  4     ESNGNEAAALGAARQSAAVANRSHWGRILVSDADRLRFLHNQSTNDFNSLKPGQGCDTVF  63

Query  509   VTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVL  688
             VT TARTID+A A+I ++ + L+ SP   +++   L KYIFF+D+V+++DI+ +T  F L
Sbjct  64    VTSTARTIDLATAYITEDTVLLLVSPNRRQQLIQWLDKYIFFADRVQLRDITGETAAFSL  123

Query  689   VGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSV  868
             +GP S+ ++E L   ++VG+P GSH+ +++ G  V +AVGN +   G++L+V   +A+++
Sbjct  124   IGPESHALLEKLGAMEMVGKPDGSHQLFNIAGAEVRVAVGNGLGIAGYTLIVPRLSAETL  183

Query  869   WKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
             W ++   GA P+    WE+LRI QGRPAP  ELT+++N LEA L + +S +KGCY GQET
Sbjct  184   WNSITAAGATPLSERGWEQLRIEQGRPAPDLELTEDYNPLEARLSHTISYSKGCYIGQET  243

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+KQ LWG+RLS+   PG+ ++V  +KVGKLTS T +     PFGL YIR K
Sbjct  244   IARLNTYKGVKQHLWGVRLSAPASPGTVVTVGEEKVGKLTSYTET--ERGPFGLAYIRTK  301

Query  1229  A  1231
             A
Sbjct  302   A  302



>ref|WP_016860519.1| glycine cleavage system protein T [Fischerella muscicola]
Length=326

 Score =   294 bits (752),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 151/298 (51%), Positives = 210/298 (70%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A +  VA+ D SH+GRI VS +DR++FLHNQST +F+ L  GQGCDTVFVT T
Sbjct  8     QDTAAIKAAKTTVAICDRSHWGRITVSDDDRLRFLHNQSTNDFQTLQPGQGCDTVFVTST  67

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+A  ++M++A+ L+ SP   E +   L +YIFF+DKV++ D++ +T    L+GP 
Sbjct  68    ARTIDLATGYVMEDAVLLLVSPNRREYLLQWLDRYIFFADKVQLTDVTDETATLSLIGPA  127

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ IVE L    ++GQPYG+H+ +    + + IAVG  ++  G++L++  +  ++V   +
Sbjct  128   SDAIVEKLGGSAIIGQPYGNHQVF----DGIDIAVGCGLASPGYTLILPTSIKETVCNKI  183

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             V++GAVPM   AWE LRI QGRP P +ELTD++N LE  LW  VS NKGCY GQETI+RL
Sbjct  184   VEFGAVPMSDRAWEVLRITQGRPVPEQELTDDYNPLEVGLWQTVSFNKGCYIGQETIARL  243

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGI+LS++VEPG++I+V  +KVGKLTS   + D  +  GLGYIR KA 
Sbjct  244   NTYKGVKQYLWGIKLSAAVEPGTAITVGDEKVGKLTSCVETVDGYR--GLGYIRTKAG  299



>ref|WP_015137344.1| folate-binding protein YgfZ [Nostoc sp. PCC 7524]
 ref|YP_007074485.1| folate-binding protein YgfZ [Nostoc sp. PCC 7524]
 gb|AFY46888.1| folate-binding protein YgfZ [Nostoc sp. PCC 7524]
Length=327

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 208/300 (69%), Gaps = 5/300 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             G D  A+ A   GVAV D S +GRIRVS  DR++FLHNQST +F+ L  GQGCDTV VT 
Sbjct  8     GKDATAIQAATAGVAVCDRSFWGRIRVSEADRLRFLHNQSTNDFQSLKPGQGCDTVMVTS  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+  A+++ +A+ L+ S +  E +   L +YIFF+D+V++ D++ +T  F L+GP
Sbjct  68    TARTIDLVSAYVLDDAVLLLVSSKRREYLIQWLDRYIFFADQVQLTDVTDETATFSLIGP  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
              S+ +V+ L  G ++GQPYG+H    V    + IAVG+ ++  G+++++  +  + VW+ 
Sbjct  128   GSDAVVKKLGAGAIIGQPYGNH---IVVDRDMIIAVGSGLAAPGYTMILPVSLKEKVWQQ  184

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             +++ GAV +   AWE LRI+QGRPAP  ELTDE+N LE  LW  +S NKGCY GQETI+R
Sbjct  185   IIELGAVELSDRAWEHLRILQGRPAPDAELTDEYNPLEVGLWQTISFNKGCYIGQETIAR  244

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAAS  1237
             L TY G+KQ LWGIRL++    G +I+V  +KVGKLTS+T++ D    FGLGYI+ KA +
Sbjct  245   LNTYKGVKQYLWGIRLNNPAVIGDTITVGDEKVGKLTSLTATPDGY--FGLGYIKSKAGN  302



>ref|WP_015112357.1| folate-binding protein YgfZ [Nostoc sp. PCC 7107]
 ref|YP_007049281.1| folate-binding protein YgfZ [Nostoc sp. PCC 7107]
 gb|AFY42131.1| folate-binding protein YgfZ [Nostoc sp. PCC 7107]
Length=328

 Score =   293 bits (750),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 208/299 (70%), Gaps = 5/299 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             G D  A+ A   GVAV D S +GRIRV+ +DR++FLHNQ+T +F+ L  GQGCDTV VTP
Sbjct  8     GKDAAAIQAAREGVAVCDRSFWGRIRVADDDRIRFLHNQTTNDFQSLKPGQGCDTVMVTP  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+  A+I+ +A+ L+ SP   E +   L +YIFF+DKV++ D++++T  F L+GP
Sbjct  68    TARTIDLVSAYILDDAVLLLVSPHRREFLMQWLDRYIFFADKVQLTDVTEETATFSLIGP  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
              S+ I+E L    ++GQP     H  V+G  V +AVG+ ++  G++L++     + VW+ 
Sbjct  128   NSDAIIEKLGARAIIGQP--DSNHLLVDGG-VIVAVGSGLASPGYTLILPATEKQKVWQQ  184

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             ++ +GAV +   AW+ LRIIQGRP P  ELTD++N LE  LW  +SLNKGCY GQETI+R
Sbjct  185   ILTFGAVELSDRAWDTLRIIQGRPTPDAELTDDYNPLEVGLWQTISLNKGCYIGQETIAR  244

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGIRLS+ VE GS+I++  +K+GKLTS T + +    FGLGYIR KA 
Sbjct  245   LNTYKGVKQNLWGIRLSAPVEVGSAIALGEEKIGKLTSYTETSEGY--FGLGYIRTKAG  301



>ref|WP_015208555.1| folate-binding protein YgfZ [Cylindrospermum stagnale]
 ref|YP_007147983.1| folate-binding protein YgfZ [Cylindrospermum stagnale PCC 7417]
 gb|AFZ25303.1| folate-binding protein YgfZ [Cylindrospermum stagnale PCC 7417]
Length=327

 Score =   293 bits (749),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 152/299 (51%), Positives = 208/299 (70%), Gaps = 5/299 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             G D  ++ A + GVAV D SH+G IRVS  DR++FLHNQST +F  L  G+GCDTV VT 
Sbjct  8     GTDALSIQAAKEGVAVCDRSHWGCIRVSDADRLRFLHNQSTNDFLRLKPGEGCDTVMVTS  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+A A+++ +A+ L+ SP   E +   L +YIFF+D+V++ D++ +T  F L+GP
Sbjct  68    TARTIDLASAYVLDDAVLLLVSPNRREFLLQWLDRYIFFADQVQLTDVTNETATFSLIGP  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
              S+ I+E L  G ++ QPYG+  H  V+G  V +AVG+ ++  G++L++  A    VW+ 
Sbjct  128   ESDAIIEKLGAGAIISQPYGN--HLLVDGK-VIVAVGSGLATPGYTLILPSAAKDKVWRQ  184

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             +++ GAV +   AW+ LRIIQGRP+P  ELTD++N LEA LW  +S +KGCY GQETI+R
Sbjct  185   ILELGAVELSDRAWDTLRIIQGRPSPDLELTDDYNPLEAGLWQTISFSKGCYIGQETIAR  244

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGIRLS  VE GS I++  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  245   LNTYKGVKQYLWGIRLSGPVEVGSVITIGDEKVGKLTSYTETADGY--FGLGYIRSKAG  301



>ref|WP_011613976.1| glycine cleavage system protein T [Trichodesmium erythraeum]
 ref|YP_724132.1| glycine cleavage T protein (aminomethyl transferase) [Trichodesmium 
erythraeum IMS101]
 gb|ABG53659.1| glycine cleavage T protein (aminomethyl transferase) [Trichodesmium 
erythraeum IMS101]
Length=349

 Score =   293 bits (749),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 212/319 (66%), Gaps = 2/319 (1%)
 Frame = +2

Query  278   IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQS  457
             +  ++++    LE  I  ++GND +A+ AT+ GVA+ D SH+G I++S ++R++FLHNQS
Sbjct  5     LQNIQISHGATLENSIPISFGNDTQAIKATKEGVALCDRSHWGLIQISDDERLRFLHNQS  64

Query  458   TANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
             T NF IL  GQ C+TVFVTPTARTID+A A++ ++ + L+ SP   +++     +Y+F  
Sbjct  65    TNNFNILQPGQSCETVFVTPTARTIDLATAYVTESLVFLLVSPSRCQKLVEWFDRYLFPM  124

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNII  817
             DKVE++D+S +   F L+G     ++  L         + SH+  S+    V +AVG+ +
Sbjct  125   DKVEVKDVSSEYAIFSLIGIEGKNLIAKLGATTPSDITHASHQLISLKNLEVRVAVGSGL  184

Query  818   SEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEAN  997
             ++EG++L+V    A  VW+ LV+ GA PMG   W++LRI QGRPAP  ELTD++N LEA 
Sbjct  185   TKEGYTLIVPVNNAAEVWQMLVEAGATPMGDRLWQQLRIEQGRPAPDYELTDDYNPLEAG  244

Query  998   LWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVT  1177
             LWN +S  KGCY GQETI+RL TY G+KQRLWG+RL+  VE G+ + +  KKVGKLTS T
Sbjct  245   LWNTISFEKGCYIGQETIARLNTYKGVKQRLWGVRLNGKVELGNVVQIGDKKVGKLTSFT  304

Query  1178  SSGDTSKPFGLGYIRKKAA  1234
              + +    FGL YI+ KA 
Sbjct  305   ETNEGY--FGLAYIKTKAG  321



>ref|WP_017319504.1| glycine cleavage system protein T [cyanobacterium PCC 7702]
Length=335

 Score =   292 bits (747),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 210/301 (70%), Gaps = 6/301 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A +  VAV D SH+GRI++S EDR++FLHNQST +F+ L  GQGCDTVFVT T
Sbjct  9     QDRAAIHAAQEQVAVCDRSHWGRIKISDEDRLRFLHNQSTNDFQKLKPGQGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             AR ID+  A+++++AI L+ SP   + +   L +YIFF+DKV++ D++K+T  F L+GP 
Sbjct  69    ARIIDLVTAYVLEDAILLLVSPNRRDFLMQWLDRYIFFADKVQLTDVTKETATFSLLGPG  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNP----VTIAVGNIISEEGFSLLVSPATAKSV  868
             S  IVE L  G ++ QPYG+H    +  +       +AVG+ ++  GF+ ++  A  ++ 
Sbjct  129   SAAIVENLGAGAIIEQPYGNHIFIPLGSDQEQQRAIVAVGSGLASPGFTFILPAACKQTF  188

Query  869   WKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
             W  ++  GAVPM   AWE LRI+QGRPA   ELT+++N LEA LW  +S +KGCY GQET
Sbjct  189   WDKIIALGAVPMSDRAWEVLRIVQGRPACEHELTEDYNPLEAGLWQTISFHKGCYIGQET  248

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+KQ LWGIRL++ VEPG++I+V+ +KVGKLTS+T + +  +  GLGYIR K
Sbjct  249   IARLNTYKGVKQHLWGIRLNAFVEPGTTITVEEEKVGKLTSITETTEGYR--GLGYIRTK  306

Query  1229  A  1231
             A
Sbjct  307   A  307



>ref|WP_028082823.1| glycine cleavage system protein T [Dolichospermum circinale]
Length=330

 Score =   291 bits (744),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 209/294 (71%), Gaps = 6/294 (2%)
 Frame = +2

Query  353   ALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTI  532
             A+   + GVA+ D SH+GRIRVSG+DR++FLHNQST NF++L  GQGCDTV VT TARTI
Sbjct  13    AIQLIKEGVAISDRSHWGRIRVSGDDRIRFLHNQSTNNFQVLKPGQGCDTVMVTSTARTI  72

Query  533   DIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQI  712
             D+  ++++ +A+ L+ SP   + +   L +YIFF+DKV++ DI+ +T  F L+GP+S+ I
Sbjct  73    DLVTSYVLDDAVLLLVSPNRRQLLAKWLDRYIFFADKVKLTDITAETATFSLMGPQSHGI  132

Query  713   VEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYG  892
             VE L  GDL+GQP G+    SVNG  V +A+G+ ++  G++L++     +++   ++ YG
Sbjct  133   VEKLGAGDLIGQPDGN--LISVNG--VIVAIGSGLATPGYTLILPVTNKETLSNEILSYG  188

Query  893   AVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYD  1072
             A  +    WE LRI+QGRPAP  E+TD++N LE  LW  +SLNKGCY GQETI+RL TY 
Sbjct  189   AGELSDQQWEMLRILQGRPAPDAEITDDYNPLEVGLWQTISLNKGCYIGQETIARLNTYK  248

Query  1073  GIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             G+KQ LWGI L ++ EPG+ I++  +KVGKLTS T++ D    FGLGYIR KA 
Sbjct  249   GVKQYLWGIHLHNAAEPGTIITIGDEKVGKLTSYTTTPDGH--FGLGYIRSKAG  300



>ref|WP_011318464.1| glycine cleavage system protein T [Anabaena variabilis]
 ref|YP_322169.1| glycine cleavage T protein [Anabaena variabilis ATCC 29413]
 gb|ABA21274.1| Glycine cleavage T protein (aminomethyl transferase) [Anabaena 
variabilis ATCC 29413]
Length=327

 Score =   290 bits (741),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 208/299 (70%), Gaps = 5/299 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             G D  A+ A    VAV D S +G IRVS +DR++FLHNQST +F+ L  GQGCDTV VT 
Sbjct  8     GKDTAAIQAATAEVAVYDRSTWGLIRVSDDDRLRFLHNQSTNDFQSLKPGQGCDTVMVTS  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+  ++++ +A+ L+ SP   E +   L +YIFF+DKV++ DI+++T  F ++GP
Sbjct  68    TARTIDLVSSYVLDDAVILLVSPSRREFLLQWLDRYIFFADKVQLTDITEETATFSIIGP  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
              S+ +VE L  G ++GQP G+  H +++G  + +AVG+ ++  G++L++  +  + VW+ 
Sbjct  128   GSDAVVEKLGAGGIIGQPQGN--HITIDGGAI-VAVGSGLASPGYTLILPVSQKQQVWQQ  184

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             ++D GAV +   AW+ LRI+QGRPAP  ELTD++N LE  LW  +S NKGCY GQETI+R
Sbjct  185   IIDSGAVELSDRAWDTLRILQGRPAPDSELTDDYNPLEVGLWQTISFNKGCYIGQETIAR  244

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGIRL++  E G +I++  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  245   LNTYKGVKQYLWGIRLNAPTEIGDTITIGDEKVGKLTSYTETPDGY--FGLGYIRSKAG  301



>ref|WP_026721759.1| glycine cleavage system protein T [Fischerella sp. PCC 9431]
Length=327

 Score =   289 bits (740),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 204/284 (72%), Gaps = 6/284 (2%)
 Frame = +2

Query  383   VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKN  562
             + D SH+GRI+VS  DR++FLHNQST +F+ L  GQGCDTVFVT TARTID+A  ++M++
Sbjct  23    ICDRSHWGRIKVSDGDRLRFLHNQSTNDFQTLQPGQGCDTVFVTSTARTIDLATGYVMED  82

Query  563   AITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLV  742
             A+ L+ SP   E +   L +YIFF+DKV++ D++  T  F L+GP S+ IVE L    ++
Sbjct  83    AVLLLVSPNRREYLLQWLDRYIFFADKVQLTDVTDATATFSLIGPASDTIVEKLGGSAII  142

Query  743   GQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWE  922
             GQPYG+H+ +    + + IAVG+ +S  G++L++  +  ++VW  +V+ GAVPM   AWE
Sbjct  143   GQPYGNHQVF----DNIHIAVGSGLSSAGYTLILPVSIKETVWNKIVELGAVPMSDRAWE  198

Query  923   ELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  1102
              LRI QGRP P +ELTD++N LE  LW  VS NKGCY GQETI+RL TY G+KQ LWG++
Sbjct  199   ALRITQGRPVPEQELTDDYNPLEVGLWQTVSFNKGCYIGQETIARLNTYKGVKQYLWGLK  258

Query  1103  LsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             LS++VEPG++I++  +K+GKLTS   + D  +  GLGYIR KA 
Sbjct  259   LSAAVEPGTAITLGDEKIGKLTSCIETVDGYR--GLGYIRTKAG  300



>ref|WP_015197122.1| folate-binding protein YgfZ [Calothrix parietina]
 ref|YP_007136445.1| folate-binding protein YgfZ [Calothrix sp. PCC 6303]
 gb|AFZ00473.1| folate-binding protein YgfZ [Calothrix sp. PCC 6303]
Length=334

 Score =   289 bits (739),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 206/301 (68%), Gaps = 4/301 (1%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A    VA+ D +H+GRI+V G+DR++FLHNQST +F+ L  G+GCDTVFVT T
Sbjct  9     QDTAAIQAAYTQVALCDRTHWGRIQVKGDDRLRFLHNQSTNDFQSLKPGEGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A++ +N + L+TSP   E +   L KYIFF+DKVE+ DIS  TC   L+G  
Sbjct  69    ARTIDLVTAYVSENEVILLTSPNRCEFLYKWLDKYIFFADKVELLDISSTTCTLSLIGTD  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNG--NPVTIAVGNIISEEGFSLLVSPATAKSVWK  874
             S+ +++ +  G+L+G+P GSH+ Y+++G    V IAVG+ ++  G++L  S     ++W 
Sbjct  129   SDAVIQKIAGGELIGKPQGSHQLYNLHGANQVVRIAVGSGLALPGYTLTFSNQDKTAIWN  188

Query  875   ALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETIS  1054
              LV+ G V M   AWE LRI QGRP P +ELTD++N LE  LW  VS +KGCY GQETI+
Sbjct  189   QLVEMGVVEMSQKAWEILRITQGRPVPEQELTDDYNPLEVGLWQTVSFSKGCYIGQETIA  248

Query  1055  RLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             RL TY G+K  LWGIRL++ VE G++++V+G+KVG +TS   + D    F LGYIR KA 
Sbjct  249   RLNTYKGVKTYLWGIRLNAPVEVGTAVTVNGEKVGVITSFAETTDGY--FALGYIRSKAG  306

Query  1235  S  1237
             +
Sbjct  307   T  307



>ref|WP_028090492.1| glycine cleavage system protein T [Dolichospermum circinale]
Length=330

 Score =   289 bits (739),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 146/294 (50%), Positives = 205/294 (70%), Gaps = 6/294 (2%)
 Frame = +2

Query  353   ALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTI  532
             A+   + GVA+ D SH+GRIRVS +DR++FLHNQST NF+IL  GQGCDTV VT TARTI
Sbjct  13    AIQLIKEGVAISDRSHWGRIRVSDDDRLRFLHNQSTNNFQILKPGQGCDTVMVTSTARTI  72

Query  533   DIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQI  712
             D+  ++++ +A+ L+ SP   + +   L +YIFF+DKV++ DI+ +T  F L+GP+S+ I
Sbjct  73    DLVTSYVLDDAVLLLVSPNRRQLLAKWLDRYIFFADKVKLTDITAETATFSLIGPQSHGI  132

Query  713   VEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYG  892
             +E L  GDL+GQP G+     ++ N +  A G+ +S  G++L++     +++W  ++ YG
Sbjct  133   IEKLGAGDLIGQPDGN----LLSVNEIIFATGSGLSIPGYTLILPVTNKETLWNEILSYG  188

Query  893   AVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYD  1072
             A  +   AWE LRI+QGRPAP  ELTD++N LE  LW  +S NKGCY GQETI+RL TY 
Sbjct  189   AGELSDRAWEMLRILQGRPAPDAELTDDYNPLEVGLWQTISFNKGCYIGQETIARLNTYK  248

Query  1073  GIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             G+KQ LWGI L  + EPG+ I++  +KVGKLTS T++ D    FGLGYI+ KA 
Sbjct  249   GVKQYLWGIHLHGAAEPGTIITIGEEKVGKLTSYTTTPDGH--FGLGYIKSKAG  300



>ref|WP_015120628.1| folate-binding protein YgfZ [Rivularia sp. PCC 7116]
 ref|YP_007057615.1| folate-binding protein YgfZ [Rivularia sp. PCC 7116]
 gb|AFY57068.1| folate-binding protein YgfZ [Rivularia sp. PCC 7116]
Length=359

 Score =   290 bits (741),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 206/299 (69%), Gaps = 6/299 (2%)
 Frame = +2

Query  347   DEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTAR  526
             + A+   E GVAV + SH+GRI+VS  DR++FLHNQST +FE L  GQGCDTVFVT TAR
Sbjct  34    ESAIQLLETGVAVYNRSHWGRIKVSDGDRLRFLHNQSTNDFESLKPGQGCDTVFVTSTAR  93

Query  527   TIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSN  706
             TID+A A++  +A+ L+ SP   E +   L KYIFF+DKV++ D++ +T  F L+G +SN
Sbjct  94    TIDLASAYVTDDAVLLLVSPNRREYLMQWLDKYIFFADKVQLTDLTDETVTFSLLGSQSN  153

Query  707   QIVEGLNLGDLVGQPYGSHKHYSVNGNPVT---IAVGNIISEEGFSLLVSPATAKSVWKA  877
              I+E L   +++G+PYGSH     N N  T   IAVG+ ++  G++L+++    + +W  
Sbjct  154   AIIEKLGASEIIGKPYGSHIQIP-NLNEETGNIIAVGSGLATPGYTLILNANHKEKIWSQ  212

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             ++  GAV +  N WE LRI+QGRP P  ELTD++N LE  LW  VS +KGCY GQETI+R
Sbjct  213   IIGSGAVEIKDNDWETLRILQGRPKPESELTDDYNPLEVGLWQTVSFDKGCYIGQETIAR  272

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGI L+S VEPG+ I+ + +KVGKLTS T  GD    FGLGYIR KA 
Sbjct  273   LNTYKGVKQNLWGISLNSFVEPGTVITANDEKVGKLTSCTQDGDNY--FGLGYIRTKAG  329



>ref|WP_015131775.1| folate-binding protein YgfZ [Calothrix sp. PCC 7507]
 ref|YP_007068819.1| folate-binding protein YgfZ [Calothrix sp. PCC 7507]
 gb|AFY35985.1| folate-binding protein YgfZ [Calothrix sp. PCC 7507]
Length=326

 Score =   288 bits (737),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/298 (50%), Positives = 200/298 (67%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D   + A   GVAV D SH+GRIRVS +DR++FLHNQST +F+ L  GQGCDTV VT T
Sbjct  9     QDAAVIQAASEGVAVCDRSHWGRIRVSDDDRLRFLHNQSTNDFQSLKPGQGCDTVMVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+++ +A+ L+ SP   E +   L +YIFF+DKV++ D++ +T  F L+GP 
Sbjct  69    ARTIDLVTAFVLDDAVLLLVSPNRREFLFQWLDRYIFFADKVQLTDVTDETATFSLIGPG  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ IV  L  G ++GQPYG+  H  V+G  V +AVG+ ++  G++L++     + +W  +
Sbjct  129   SDAIVTKLGAGAIIGQPYGN--HLLVDG--VRVAVGSGLASPGYTLILPATDKEKLWSQI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             +  GAV +    W+ LRI+QGRPAP  ELTD++N LE  LW  +S NKGCY GQETI+RL
Sbjct  185   LALGAVELSDRTWDMLRILQGRPAPESELTDDYNPLEVGLWQTISFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGI L +  E G  I+V  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  245   NTYKGVKQYLWGIHLIAPAEVGEVITVGDEKVGKLTSYTETADGY--FGLGYIRTKAG  300



>ref|XP_005649859.1| Aminomethyltransferase folate-binding domain-containing protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE25315.1| Aminomethyltransferase folate-binding domain-containing protein 
[Coccomyxa subellipsoidea C-169]
Length=363

 Score =   289 bits (740),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 162/353 (46%), Positives = 212/353 (60%), Gaps = 9/353 (3%)
 Frame = +2

Query  191   AFRPE----NWTRNYSTA--ALPFDLSPPPIDHDLIDTMKVAGAKVLEGDIIE-TYGNDD  349
             AF P+       +  STA  AL FDL  P ID DL    +  GA + EG  I  ++GND+
Sbjct  6     AFSPDIAQTASCKGVSTALNALSFDLDIPEIDCDLRTAQEDQGA-IFEGTSIPVSFGNDE  64

Query  350   EALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTART  529
              A  A ENGV +VD +H+GR+RVSG+DR++FLH QSTA+F  L  G GC TVFV    RT
Sbjct  65    AAGAALENGVVIVDRTHWGRLRVSGDDRLKFLHGQSTADFLALQPGTGCRTVFVNRNGRT  124

Query  530   IDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQ  709
             ID+A   +  ++I ++ SP     I   L +YIFF DKVE+QDIS  T  F L GP S++
Sbjct  125   IDLASCLVQGSSIMVIVSPLKRTAIKDRLEQYIFFGDKVEVQDISSSTVLFTLAGPGSDE  184

Query  710   IVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             ++  L  G LV +  GSH  +   G PV ++V   +   G+S++ S      +W+ +V  
Sbjct  185   LMTKLGAGSLVDREEGSHAVFGAAGQPVVVSVAAELGVAGYSIVASEGIGGDLWQRIVGQ  244

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GAVPMG   WE  R++ GRPA   ELTD +N LEA L +AVS+ KGCY GQET+S+L   
Sbjct  245   GAVPMGEAGWERARVLAGRPAVDHELTDLYNPLEAGLCSAVSITKGCYIGQETLSKLTNL  304

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             D +KQ+LWG+ LS+    G  IS    KVG LTS     D S PF LGYIR +
Sbjct  305   DALKQQLWGLDLSAPASVGDEISDGSTKVGVLTSTGQRWDGS-PFALGYIRAE  356



>ref|WP_010468460.1| glycine cleavage system protein T [Acaryochloris sp. CCMEE 5410]
Length=354

 Score =   288 bits (737),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/307 (46%), Positives = 208/307 (68%), Gaps = 4/307 (1%)
 Frame = +2

Query  314   EGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQG  493
             +G I+ ++GND+ AL A ++G A+ D +H+GR++ + +DR+ FLHNQ+T  F+ L  G+G
Sbjct  20    QGSIL-SFGNDESALKAAQDGAALWDRTHWGRLQFTDQDRLSFLHNQTTNTFKTLKPGEG  78

Query  494   CDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQT  673
             C++VFVT TARTID+  A++ + A+ L+ SP    ++ S   +YIFF DKV+I DI+ QT
Sbjct  79    CESVFVTSTARTIDLVSAYVTEEAVVLLVSPTRRAQLMSWCDRYIFFGDKVKIADITAQT  138

Query  674   CFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPA  853
               F L+GP S++I+  L + DL   P+  H    + G+ V +A G+ ++  G++L     
Sbjct  139   ITFSLLGPESSRILHKLGISDLPESPH-HHITTQIKGHTVRVASGSGLTTPGYTLFADTK  197

Query  854   TAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCY  1033
                 +W+AL + GA P+G  AWE+LR+ +GRP PG ELT++FN LEA LW  +S +KGCY
Sbjct  198   VGAELWQALTEQGACPLGEKAWEQLRVTEGRPKPGAELTEDFNPLEAGLWQTISFDKGCY  257

Query  1034  KGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLG  1213
              GQETI+RL TY G+KQRLWGI+LS SV   + I+++ KKVG LTS+  + +   P GLG
Sbjct  258   IGQETIARLNTYQGVKQRLWGIQLSESVSVDTPITLEDKKVGVLTSLVETAE--GPVGLG  315

Query  1214  YIRKKAA  1234
             Y++ KA 
Sbjct  316   YVKTKAG  322



>ref|WP_015143145.1| folate-binding protein YgfZ [Pleurocapsa minor]
 ref|YP_007080396.1| folate-binding protein YgfZ [Pleurocapsa sp. PCC 7327]
 gb|AFY76839.1| folate-binding protein YgfZ [Pleurocapsa sp. PCC 7327]
Length=357

 Score =   288 bits (737),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 200/298 (67%), Gaps = 2/298 (1%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             ND EA+ A + GVA+ D S +G +++ GEDR +FLHNQ+T N   L  GQGCDTVFV  T
Sbjct  29    NDREAIEAAKAGVALWDRSSWGLLQLKGEDRSRFLHNQTTNNINSLQPGQGCDTVFVNST  88

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
              RT+D+A A++ ++AI ++ SP    ++   + +YIF  DKVE+ DIS     F L+GP 
Sbjct  89    GRTLDLATAYLTEDAILILVSPNRRGQLMQWMDRYIFPMDKVELADISDDNAMFALIGPE  148

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ +V+ L    +VGQP GSH    +  N + IAVG+ ++  G++L+V    A  +W  L
Sbjct  149   SDSLVKQLAGDSIVGQPEGSHLLVQMGDNSIRIAVGSGLALPGYTLIVPVEAAAQIWSKL  208

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
                GA+P+G   WE+LRI+QGRP P KELT+++N LEA LW A+S +KGCY GQETI+RL
Sbjct  209   TQLGAIPLGDRVWEQLRILQGRPVPDKELTEDYNPLEAGLWKAISFDKGCYIGQETIARL  268

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQRLWG++L++ V  G+ ++V G KVG LTS T S DT   FGL Y+R KA 
Sbjct  269   NTYKGVKQRLWGVKLNAPVAVGTPVTVAGDKVGVLTSYTQS-DTGS-FGLAYVRTKAG  324



>ref|WP_039202492.1| glycine cleavage system protein T [Aphanizomenon flos-aquae]
 gb|KHG40790.1| glycine cleavage system protein T [Aphanizomenon flos-aquae 2012/KM/D3]
Length=330

 Score =   287 bits (734),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 211/298 (71%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ +   GV V D S +G IR+SG+DR++FLHNQST +F+    GQGCDTV VT T
Sbjct  9     KDVNAMQSVLEGVVVCDRSPWGLIRISGDDRLRFLHNQSTNDFQSRKPGQGCDTVMVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+++ +A+ L+ SP   + +   L +YIF +D+V++ D++++T    L+GP+
Sbjct  69    ARTIDLVTAYVLNDAVLLLVSPNRRQELMKWLDRYIFPADQVKLTDVTEETAILSLIGPQ  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ ++E L  GDL+GQP G+H    V+G  V +AVG+ ++  G++L+++ A  ++ W+ +
Sbjct  129   SHAVIEKLGAGDLIGQPNGTH--ILVDG--VIVAVGSGLAAPGYTLILARAEKQTWWEKI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             ++ GAV +G   WE LRI+QGRPAP  ELTD++N LE  LW AVS NKGCY GQETI+RL
Sbjct  185   LELGAVELGDRTWEMLRILQGRPAPDSELTDDYNPLEVGLWQAVSFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGIRLS++ EPG+ I++  +KVGKLTS T++ D    FGLGYIR KA 
Sbjct  245   NTYKGVKQYLWGIRLSAAAEPGTVITIGEEKVGKLTSYTTTPDGH--FGLGYIRSKAG  300



>ref|WP_019506915.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=343

 Score =   286 bits (733),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 214/315 (68%), Gaps = 2/315 (1%)
 Frame = +2

Query  290   KVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANF  469
             + AGA   E  +  ++ ND EAL A   GVA+ D SH+G ++++GEDR+++LHNQST +F
Sbjct  8     ETAGAIFDEAGVALSFNNDHEALDAVNQGVAICDRSHWGLLKITGEDRLRYLHNQSTNDF  67

Query  470   EILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVE  649
             E L  GQGCDTVFVT TART+D+A A++ ++A+ ++ SP   +++ + L ++IF  DKVE
Sbjct  68    EKLMPGQGCDTVFVTSTARTLDLATAYVTEDAVLILVSPNRRQQLLTWLDRFIFPFDKVE  127

Query  650   IQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEG  829
             + DIS ++  F L+G +S+ ++  L    +  +   +H   ++   PV +A+G+ ++  G
Sbjct  128   LTDISAESSIFSLIGNQSSTLLSQLVSETIPQKNLAAHLLVTIADVPVRVAMGSGLATPG  187

Query  830   FSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNA  1009
             ++L++ P  A  VW  L++ G+VP+G   WE LRI QGRP P +ELT+++N LEA LW  
Sbjct  188   YTLIMPPENAGIVWSKLIEQGSVPLGDRLWESLRIQQGRPIPDRELTEDYNPLEAGLWQT  247

Query  1010  VSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGD  1189
             +S  KGCY GQETI+RL TY G+KQ+LWGI+L+ SV P + I+++ KKVG LTS T + D
Sbjct  248   ISFEKGCYIGQETIARLNTYKGVKQKLWGIKLNQSVAPETPITIEDKKVGTLTSYTDTPD  307

Query  1190  TSKPFGLGYIRKKAA  1234
                 +GLGY+R KA 
Sbjct  308   GG--YGLGYVRTKAG  320



>ref|WP_017747221.1| glycine cleavage system protein T [Scytonema hofmanni]
Length=335

 Score =   286 bits (731),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 205/301 (68%), Gaps = 5/301 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             ND  A+ A + G AV D + +GRI++S +DR++FLHNQST N + L  GQGCDTVFV  T
Sbjct  9     NDAAAIKAVQEGFAVCDRTPWGRIKISDDDRLRFLHNQSTNNIQQLKPGQGCDTVFVNST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ART+D+  A++  +A+ L+ SP   E +   L +YIFF+DKV++ D++ +T  F ++G +
Sbjct  69    ARTLDLVTAYVQDDAVLLLVSPNRREFLMQWLDRYIFFADKVQLTDVTDETATFSVLGLK  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNP---VTIAVGNIISEEGFSLLVSPATAKSVW  871
             S+  +  L  G ++GQPYG+H    V+G     +T+AVG+ ++  G++L++  A  + VW
Sbjct  129   SDAAIAKLGAGAIIGQPYGTHLLIPVSGGEDKNITVAVGSGLASPGYTLILPIAEREKVW  188

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
               LV+ GA+P+   AW  LRI+QGRPAP +ELT+++N LE  LW  +SLNKGCY GQETI
Sbjct  189   IQLVENGAIPLSDRAWNMLRILQGRPAPDQELTEDYNPLEVGLWQTISLNKGCYIGQETI  248

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ LWGIRL +  EPGS I++  +KVGKLTS   +      FGLGYIR KA
Sbjct  249   ARLNTYKGVKQHLWGIRLIAPAEPGSPITIGDEKVGKLTSYAET--LEGHFGLGYIRTKA  306

Query  1232  A  1234
              
Sbjct  307   G  307



>ref|WP_017319196.1| glycine cleavage system protein T [Mastigocladopsis repens]
Length=330

 Score =   285 bits (730),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/299 (49%), Positives = 206/299 (69%), Gaps = 5/299 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             ND  A+ A + GVAV D S +GRI+VS  DR++FLHNQST + + L  GQGCDTVFV  T
Sbjct  9     NDAAAIQAAQEGVAVCDRSFWGRIKVSDSDRLRFLHNQSTNDIQSLKPGQGCDTVFVNST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+I+++A+ L+ SP   E +   L +YIFF+DKV++ D++ +T  F L+GP+
Sbjct  69    ARTIDLVTAYILEDAVLLLVSPNRREFLIQWLDRYIFFADKVQLTDVTNETATFSLIGPK  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHY-SVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
             S+ ++E L    ++GQPYG+H    +V+G    +AVG+ ++  G++ ++  +  + VW  
Sbjct  129   SDAVLEKLGAEAIIGQPYGTHISIPTVDGG--LVAVGSGLASPGYTFILPASDKEEVWSK  186

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             +++ GAV +G   WE LRI+QGRP P  ELT+++N LE  LW  +S NKGCY GQETI+R
Sbjct  187   ILEAGAVLIGEQNWEMLRILQGRPEPDHELTEDYNPLEVGLWQTISFNKGCYIGQETIAR  246

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGI LS + EP S+I+V  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  247   LNTYKGVKQYLWGIHLSGAAEPESTITVGDEKVGKLTSYTKTFDGH--FGLGYIRTKAG  303



>ref|WP_038088245.1| glycine cleavage system protein T [Tolypothrix bouteillei]
 gb|KIE08837.1| glycine cleavage system protein T [Tolypothrix bouteillei VB521301]
Length=335

 Score =   285 bits (730),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 204/300 (68%), Gaps = 5/300 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             ND  A+ A + G+AV D + +GRI++S +DR++FLHNQST N + L  GQGCDTVFV  T
Sbjct  9     NDAAAIKAVQEGLAVCDRTSWGRIKISDDDRLRFLHNQSTNNIQQLKPGQGCDTVFVNST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ART+D+   +I ++A+ L+ SP   E +   L +YIFF+DKV++ D++ +T    + GP+
Sbjct  69    ARTLDLVTVYIQEDAVLLLVSPNRREFLMQWLDRYIFFADKVQLTDVTDETASLSVFGPK  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSV---NGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             S+  +E L  G +VGQPYG+H   S+       + +AVG+ ++  G++L++  A  + VW
Sbjct  129   SDAAMEKLGAGAIVGQPYGTHILISIADREDKSLVVAVGSGLASPGYTLILPIADKEKVW  188

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
               LV+ GAV +   AW  LRI+QGRPAP +ELT+++N LE  LW  +S +KGCY GQETI
Sbjct  189   NQLVENGAVTLSDRAWNMLRILQGRPAPDQELTEDYNPLEVGLWQTISFDKGCYIGQETI  248

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ LWGIRL++  E GS I++  +KVGKLTS T + D    FGLGYIR KA
Sbjct  249   ARLNTYKGVKQHLWGIRLTAPAELGSPITIGNEKVGKLTSYTETLDGH--FGLGYIRTKA  306



>ref|WP_017310197.1| glycine cleavage system protein T [Fischerella sp. PCC 9339]
Length=327

 Score =   284 bits (727),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/284 (51%), Positives = 202/284 (71%), Gaps = 6/284 (2%)
 Frame = +2

Query  383   VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKN  562
             + D SH+GRI+VS  DR++FLHNQST +F+ L  GQGCDTVFVT TARTID+A  ++M++
Sbjct  23    ICDRSHWGRIKVSDGDRLRFLHNQSTNDFQKLQPGQGCDTVFVTSTARTIDLATGYVMED  82

Query  563   AITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLV  742
             A+ L+ SP   E +   L +YIFF+DKV++ D++ +T    L+GP S+ I+E L    ++
Sbjct  83    AVLLLVSPNRREYLLQWLDRYIFFADKVQLTDVTDETATLSLIGPASDTIIEKLGGNAII  142

Query  743   GQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWE  922
             GQ YG+H+ +    + + IAVG+ ++  G++L++  +  ++VW  +V+ GAVPM   AWE
Sbjct  143   GQSYGNHQVF----DGIDIAVGSGLASPGYTLILPASIKETVWNKIVELGAVPMSDRAWE  198

Query  923   ELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIR  1102
              LRI QGRP P +ELTD++N LE  LW  +S NKGCY GQETI+RL TY GIKQ LWG++
Sbjct  199   ALRITQGRPVPEQELTDDYNPLEVGLWQTISFNKGCYIGQETIARLNTYKGIKQYLWGLK  258

Query  1103  LsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             LS++VEPG+ I+V  +KVGKLTS   + D  +  GLGYIR KA 
Sbjct  259   LSAAVEPGTGITVGDEKVGKLTSCVETVDGYR--GLGYIRTKAG  300



>ref|WP_015191973.1| folate-binding protein YgfZ [Stanieria cyanosphaera]
 ref|YP_007131266.1| folate-binding protein YgfZ [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34300.1| folate-binding protein YgfZ [Stanieria cyanosphaera PCC 7437]
Length=349

 Score =   285 bits (728),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 212/307 (69%), Gaps = 2/307 (1%)
 Frame = +2

Query  314   EGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQG  493
             E  I  ++GND+ AL A +  V + D S++G ++++GEDR+++LHNQST NF  L  GQG
Sbjct  18    ETQIPLSFGNDERALIAAKEEVVLCDRSNWGLLKLTGEDRLRYLHNQSTNNFNQLQPGQG  77

Query  494   CDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQT  673
             CDTVFVT TART+D+A A++ ++A+ ++ SP+  +++   L ++IF  DKVE+ DIS + 
Sbjct  78    CDTVFVTSTARTLDLATAYVTEDAVLVLVSPQRRQQLLEWLDRFIFPFDKVELSDISTEY  137

Query  674   CFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPA  853
               F L+G +S+  +  L L  ++ QP  SH+  + + N + IA+GN ++  G++L++  A
Sbjct  138   AVFNLIGKQSDDFLTKLGLQSVINQPENSHQLVNFDNNIIRIAIGNGLALPGYTLIIPVA  197

Query  854   TAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCY  1033
              A + W  L+  G  P+G   W +LRI+QGRP P +ELT+++N LEA LW+A+S  KGCY
Sbjct  198   EAAACWSKLITIGVTPIGDRVWSQLRILQGRPIPDQELTEDYNPLEAGLWHAISFEKGCY  257

Query  1034  KGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLG  1213
              GQETI+RL TY G+KQ+LWGI+L++ V PG+ + ++G KVG LTS T++ + +  FGL 
Sbjct  258   IGQETIARLNTYKGVKQQLWGIKLTAPVNPGTLLILEGNKVGILTSCTNTSEGN--FGLA  315

Query  1214  YIRKKAA  1234
             Y+R KA 
Sbjct  316   YLRTKAG  322



>ref|WP_013323287.1| glycine cleavage system protein T [Cyanothece sp. PCC 7822]
 ref|YP_003888469.1| folate-binding protein YgfZ [Cyanothece sp. PCC 7822]
 gb|ADN15194.1| folate-binding protein YgfZ [Cyanothece sp. PCC 7822]
Length=357

 Score =   285 bits (728),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 210/316 (66%), Gaps = 2/316 (1%)
 Frame = +2

Query  287   MKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTAN  466
             +K+      +G    ++GND EA+ A + GVA+ D SH+G I++ G +R++FLHNQ+T N
Sbjct  10    IKLGAVISADGTFASSFGNDGEAIKAAQTGVALSDRSHWGLIQLKGNERLRFLHNQTTNN  69

Query  467   FEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKV  646
                L  GQGCDTVFV  T RT+D+A A++   +I L+ SP   + +   + +YIF  DKV
Sbjct  70    INSLKPGQGCDTVFVNSTGRTLDLATAYVTDESIYLLVSPNRRQFLLQWMDRYIFPMDKV  129

Query  647   EIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEE  826
             E++D S +   F L+GP+S+ ++  LNL  L+GQP  +H    ++ + V +A+G+ ++  
Sbjct  130   ELEDSSGKYAIFTLIGPQSHSVLAKLNLDPLIGQPLNTHIQQKIDNSLVRVALGSGLALP  189

Query  827   GFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWN  1006
             G++L+V    A +VW+ LV+ G   +G+  WE+LRI+QGRP P  ELT+++N LE+ LW 
Sbjct  190   GYTLMVPMQEALTVWEQLVNTGVTLLGNRVWEQLRILQGRPVPDYELTEDYNALESGLWK  249

Query  1007  AVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSG  1186
             A+S  KGCY GQETI+RL TY G+KQRLWG++LS  V+P + + ++ KKVG LTS T + 
Sbjct  250   AISFEKGCYIGQETIARLNTYKGVKQRLWGVKLSQCVQPHTEVILEDKKVGILTSCTETQ  309

Query  1187  DTSKPFGLGYIRKKAA  1234
             + +  FGL Y++ KA 
Sbjct  310   EGA--FGLAYVKTKAG  323



>ref|WP_006275946.1| glycine cleavage system protein T [Cylindrospermopsis raciborskii]
 gb|EFA71098.1| Glycine cleavage T protein (aminomethyl transferase) [Cylindrospermopsis 
raciborskii CS-505]
Length=327

 Score =   283 bits (723),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 199/297 (67%), Gaps = 6/297 (2%)
 Frame = +2

Query  344   DDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTA  523
             D  A+ A +   AV D SH+GRI V+GEDR++FLHNQST N E L  G GCDTV VT TA
Sbjct  10    DRAAVYAAKTKTAVCDRSHWGRIEVTGEDRLRFLHNQSTNNLESLQPGSGCDTVMVTSTA  69

Query  524   RTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRS  703
             RTID+   +++++ + L+ SP   E + S L +YIFF+D+V + DI++QT  F L+GP S
Sbjct  70    RTIDLVTGYVLEDRVLLLVSPNRREFLLSWLDRYIFFADQVTLTDITEQTATFTLLGPES  129

Query  704   NQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALV  883
             + I+  L +  L+ QP G   H S+NG  +  AVG  ++  G++L++  A  + +W+ L+
Sbjct  130   DTIISKLGVASLLSQPDG--HHISING--IIFAVGTGLAIPGYTLILPRAEKQQIWQQLL  185

Query  884   DYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLV  1063
             D+GAV +    WE LRI QGRPAP  ELTD++N LE  LW  VS NKGCY GQETI+RL 
Sbjct  186   DWGAVKLSDRHWEMLRISQGRPAPDAELTDDYNPLEVGLWQTVSFNKGCYIGQETIARLN  245

Query  1064  TYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             TY G+KQ LWGI+L +  +PG+ I++  +KVGKLTS   + +    FGLGYIR KA 
Sbjct  246   TYKGVKQHLWGIKLKNCAQPGTIITISEEKVGKLTSYIETPEGH--FGLGYIRAKAG  300



>ref|WP_039729899.1| glycine cleavage system protein T [Lyngbya confervoides]
 gb|KIF16835.1| glycine cleavage system protein T [Aphanocapsa montana BDHKU210001]
 gb|KIF41851.1| glycine cleavage system protein T [Lyngbya confervoides BDU141951]
Length=351

 Score =   283 bits (725),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 202/300 (67%), Gaps = 2/300 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             T+GND  AL A ++GVAV D SH+GRIRVS  DR++FLHNQ+T   + L  GQGCDTVFV
Sbjct  25    TFGNDAAALAAAQSGVAVCDRSHWGRIRVSDSDRLRFLHNQTTNQMQQLQPGQGCDTVFV  84

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T T RTID+  A++  +++ L+TSP  +E +   + +YIFF+DKV++ D +  T  F ++
Sbjct  85    TSTGRTIDLVTAYVDADSVLLLTSPGQAEPLMQWMDRYIFFADKVKLTDETATTVAFTII  144

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S  ++  L L +L   P  SH+  ++ G  V +A G+ ++  GF+L+ +      +W
Sbjct  145   GPDSPALLAQLGLSELATAPDHSHQVATIAGVEVQVANGSGLALPGFTLIAAADAGGPLW  204

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
              AL D GAVP+G   W+ LR+ QGRP PG ELTD++N LEA LW A+S +KGCY GQETI
Sbjct  205   SALTDAGAVPLGDRGWQTLRVEQGRPLPGTELTDDYNPLEAALWQAISFDKGCYIGQETI  264

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWG++L++ V P + I V+G KVG +TS   + + +    LGYIR KA
Sbjct  265   ARLQTYQGVKQQLWGLQLAAPVAPDTPIMVEGNKVGVVTSCVPTAEGA--IALGYIRTKA  322



>ref|WP_015173099.1| folate-binding protein YgfZ [Geitlerinema sp. PCC 7407]
 ref|YP_007110587.1| folate-binding protein YgfZ [Geitlerinema sp. PCC 7407]
 gb|AFY67535.1| folate-binding protein YgfZ [Geitlerinema sp. PCC 7407]
Length=350

 Score =   283 bits (725),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 214/317 (68%), Gaps = 5/317 (2%)
 Frame = +2

Query  287   MKVAGAKVLEGD--IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQST  460
             M+ A    L+G+  +  ++GND  A  A   GVAV D SH+GRI ++G DRV++LHNQST
Sbjct  3     MQQAAETSLQGEPPVAASFGNDSAARQAALKGVAVCDRSHWGRIEIAGGDRVRYLHNQST  62

Query  461   ANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSD  640
              +F+ L  G+GCDTVFVT TART+D+A  ++++    ++ SP+  ++I + L +YIF  D
Sbjct  63    NDFQRLQSGEGCDTVFVTSTARTLDLATVYVLETHFLVLVSPQRHQQILAWLDRYIFPMD  122

Query  641   KVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIIS  820
             +V ++D +  T    L+GP S  ++ GL L    G P+G H   ++    V +AVG+ ++
Sbjct  123   QVSLKDCTSDTAVLSLIGPESQALLAGLGLPVPDG-PHGQHLSGTLGKAEVRVAVGSGLA  181

Query  821   EEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANL  1000
               G++L+ +     ++W+ LV  GAVPMG  AWE+LRI QGRPAP  ELT+++N LEA L
Sbjct  182   APGYTLICTAQDRAALWQGLVAAGAVPMGDRAWEQLRIEQGRPAPDCELTEDYNPLEAGL  241

Query  1001  WNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTS  1180
             W+ +S NKGCY GQETI+RL TY G+KQ+LWG+RLS  VEPG+ I ++ +KVG +TSVT 
Sbjct  242   WHTISFNKGCYIGQETIARLDTYKGVKQQLWGLRLSQPVEPGTPILLNDEKVGLVTSVTE  301

Query  1181  SGDTSKPFGLGYIRKKA  1231
             + + +   GLGY+R KA
Sbjct  302   ASEGA--IGLGYVRTKA  316



>ref|WP_013191720.1| glycine cleavage system protein T [Trichormus azollae]
 ref|YP_003721827.1| folate-binding protein YgfZ ['Nostoc azollae' 0708]
 gb|ADI64704.1| folate-binding protein YgfZ ['Nostoc azollae' 0708]
Length=326

 Score =   282 bits (722),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 203/299 (68%), Gaps = 6/299 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             G D  A+     GV V D S +G IRV+ +DR++FLHNQST +F+ L  G+GCDTV VT 
Sbjct  8     GKDTAAIQTAREGVVVCDRSEWGIIRVADDDRLRFLHNQSTNDFQRLKPGEGCDTVMVTS  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+   +++ +A+ L+ SP     +   L +YIFF+DKV++ DI++ T  F L+GP
Sbjct  68    TARTIDLVTGYVLDDAVFLLVSPGRRHFLLQWLDRYIFFTDKVQLTDITEDTGTFSLIGP  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
              S+ ++E L  G L+GQPYGS  H  V+G  + +AVG+ ++  G++L+   A  + +W+ 
Sbjct  128   GSDAMIEKLGAGSLIGQPYGS--HILVDG--LRVAVGSGLALPGYTLIFPIAQKQKIWEQ  183

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             +++YG + +    WE LRI+QGRPAP  ELTD++N LE  LW  VS NKGCY GQETI+R
Sbjct  184   ILEYGGLELSDRGWEMLRILQGRPAPDLELTDDYNPLEVGLWQTVSFNKGCYIGQETIAR  243

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGIRL++ VEP + I++  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  244   LNTYKGVKQYLWGIRLNAPVEPETIITIGDEKVGKLTSYTETPDGH--FGLGYIRSKAG  300



>ref|WP_019497477.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=330

 Score =   282 bits (722),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 203/298 (68%), Gaps = 4/298 (1%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             ND  A+ A +  VAV D SH+GRI+VSG+DR++FLHNQST +F+ L  GQGCDTVFVT T
Sbjct  9     NDTTAIKAAQERVAVYDRSHWGRIKVSGDDRLRFLHNQSTNDFQSLKPGQGCDTVFVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+I ++A+ L+ SP   E +   L KYIFF+DKVE+ DI+++T  F L+GP 
Sbjct  69    ARTIDLTTAYIKEDAVLLIVSPNRREYLMQWLDKYIFFADKVELSDITEETAAFSLIGPE  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S  I++ L +  L  +   S++ Y++      IAVG+ ++  G++L+       ++W  L
Sbjct  129   SQAIIQELGVTPL--ETPNSNQVYNILTVETLIAVGSGLALPGYTLIFPVVHKDTIWNKL  186

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             ++ GAV M   AWE LRIIQGRP P KELT+++N LE  LW  +   KGCY GQETI+RL
Sbjct  187   LEIGAVAMKETAWETLRIIQGRPVPEKELTEDYNPLEVGLWQTICFTKGCYIGQETIARL  246

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+K  LWGI+L++  +PGS I ++ +KVG LTS+T  G T   +GLGYIRK+A 
Sbjct  247   NTYKGVKTYLWGIKLNNYADPGSQIYIEEEKVGTLTSIT--GTTEGYYGLGYIRKQAG  302



>ref|WP_039754780.1| glycine cleavage system protein T [Hassallia byssoidea]
 gb|KIF28533.1| glycine cleavage system protein T [Hassallia byssoidea VB512170]
Length=328

 Score =   282 bits (722),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/285 (51%), Positives = 201/285 (71%), Gaps = 5/285 (2%)
 Frame = +2

Query  377   VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIM  556
             VAV D S  G IRVS +DR++FLHNQ+T +F+ L  GQGCDTV VT TARTID+A A+I+
Sbjct  21    VAVCDRSFCGIIRVSDDDRIRFLHNQTTNDFQSLKPGQGCDTVMVTSTARTIDLATAYIL  80

Query  557   KNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD  736
             ++A+ L+ SP   E +   L KYIFF+DKV++ D++ +T  F L+G  S+ I+E L    
Sbjct  81    EDAVLLLVSPNRREFLMQWLDKYIFFADKVQLADVTNETATFNLIGSESDTILEKLGAEA  140

Query  737   LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNA  916
             ++GQPYG+H+ +      V +AVG+ ++  G++L++  +   +VW+ +V+ GA  M   A
Sbjct  141   IIGQPYGTHQLFD---GGVRVAVGSGLALPGYTLILPASLKATVWEKIVEAGAQEMSDRA  197

Query  917   WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWG  1096
             ++ LRI+QGRPAP  ELTD++N LEA LW+ +S NKGCY GQETI+RL TY G+KQ LWG
Sbjct  198   FDVLRILQGRPAPEHELTDDYNPLEAGLWHTISFNKGCYIGQETIARLNTYKGVKQHLWG  257

Query  1097  IRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             IRL++  E  S+I+V  +KVGKLTS T + D    FGLGYIR KA
Sbjct  258   IRLNAPAEIESAIAVGDEKVGKLTSYTETADGY--FGLGYIRTKA  300



>ref|WP_017653263.1| glycine cleavage system protein T [Microchaete sp. PCC 7126]
Length=326

 Score =   281 bits (720),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 200/298 (67%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ AT  GVAV D SH+GRI V   DR++FLHNQST +F+ L  GQGCDTV VT T
Sbjct  9     KDVAAIQATSVGVAVYDRSHWGRISVGDSDRLRFLHNQSTNDFQSLQPGQGCDTVMVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+++ +A+ L+TS    E +   L +YIFF+DKV++ DI+ QT  F L+GP 
Sbjct  69    ARTIDLVTAYVLDDAVLLLTSSNRREFLLQWLDRYIFFADKVQLTDITAQTATFSLIGPG  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ I+  L  G ++GQP G+H    +  + + +AVG+ ++  G++L+      + +W  +
Sbjct  129   SDAIIAHLGAGTIIGQPDGNH----ILVDKLRVAVGSGLASPGYTLIFPVGDKQQLWNQI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             +  GAV +    WE LRI+QGRPAP  ELTD++N LE  LW ++S NKGCY GQETI+RL
Sbjct  185   LALGAVELSDRTWEMLRILQGRPAPEAELTDDYNPLEVGLWQSISFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGI+LS+  E G+ I++  +K+GKLTS T + D    FGLGYIR KA 
Sbjct  245   NTYKGVKQHLWGIKLSAPAEVGTVITLGDEKIGKLTSYTPTTDGY--FGLGYIRTKAG  300



>ref|WP_015083308.1| glycine cleavage T protein (aminomethyltransferase) [Anabaena 
sp. 90]
 ref|YP_007000810.1| glycine cleavage T protein (aminomethyltransferase) [Anabaena 
sp. 90]
 gb|AFW96753.1| glycine cleavage T protein (aminomethyltransferase) [Anabaena 
sp. 90]
Length=330

 Score =   281 bits (720),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 146/298 (49%), Positives = 206/298 (69%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             ND   + A   G  V D S +GRIR+S +DR++FLHNQST +F+    GQGCDTV VT T
Sbjct  9     NDINTIQAVREGSVVRDRSDWGRIRISDDDRLRFLHNQSTNDFQSRKPGQGCDTVMVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+++ +A+ L+ SP   + + + L +YIFF+DKV++ D++++T    L+GP+
Sbjct  69    ARTIDLVTAYVLDDAVLLLVSPHRRQELMAWLDRYIFFADKVKLTDVTEETATLSLIGPQ  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ IVE L  GDL+GQP G+H    +  + V +AVG+ ++  G++L++  A  +  W+ +
Sbjct  129   SHAIVENLGAGDLIGQPDGNH----ILVDRVIVAVGSGLAAPGYTLILPIAEKQIWWEKI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             +  GAV +   AWE LRI+QGRPA   ELTD++N LE  LW  VS +KGCY GQETI+RL
Sbjct  185   LGLGAVELSDRAWEMLRILQGRPATDSELTDDYNPLEVGLWQTVSFSKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGIRLS++ EPG+ I++  +KVGKLTS T++ D    FGLGYIR KA 
Sbjct  245   NTYKGVKQYLWGIRLSATAEPGTVITIGEEKVGKLTSYTTTPDGH--FGLGYIRSKAG  300



>ref|WP_015148130.1| folate-binding protein YgfZ [Oscillatoria acuminata]
 ref|YP_007085406.1| folate-binding protein YgfZ [Oscillatoria acuminata PCC 6304]
 gb|AFY81486.1| folate-binding protein YgfZ [Oscillatoria acuminata PCC 6304]
Length=351

 Score =   281 bits (720),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 204/302 (68%), Gaps = 6/302 (2%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             +YGND  A+ +   GVA+ D SH+G I+VSG DR++FLHNQST  F+ L  GQGCDTVFV
Sbjct  28    SYGNDPGAIASAYQGVALCDRSHWGLIQVSGGDRLRFLHNQSTNEFQKLQPGQGCDTVFV  87

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TARTID+A A++ ++   L+ SP   +RI   L +Y+F +D+VE+QDI+     F L+
Sbjct  88    TSTARTIDLATAYMTEDTTLLLVSPSRRQRIMEWLDRYLFPADRVELQDITDSMATFSLI  147

Query  692   GPRSNQIVEGLNL-GDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSV  868
             GP S  ++    + GD    P+ SH+  ++   PV +AVG+ ++  G++L+     A S+
Sbjct  148   GPGSLALLAPWGVAGDW---PHASHQLLTLGEIPVRVAVGSGLALPGYTLICDRNDAASL  204

Query  869   WKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
             WK L D GAVP+G+  WE+LRI QGRPAP  ELT+++N LEA LW+ +S +KGCY GQET
Sbjct  205   WKLLTDGGAVPLGTQGWEQLRIQQGRPAPDCELTEDYNPLEAGLWHNISFDKGCYIGQET  264

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+K +LWG++L     PG+ +++  +KVG LTS T S +   PFGL YIR K
Sbjct  265   IARLNTYKGVKVQLWGVKLKGPASPGTVVTMGEEKVGTLTSYTDSPE--GPFGLAYIRTK  322

Query  1229  AA  1234
             A 
Sbjct  323   AG  324



>ref|WP_008235851.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Richelia intracellularis]
 emb|CCH68317.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Richelia intracellularis HH01]
Length=332

 Score =   280 bits (717),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 202/295 (68%), Gaps = 3/295 (1%)
 Frame = +2

Query  353   ALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTI  532
             A+ A E+  A+ D SH+G I+++  D ++FLHNQST NF  L  GQGCDT+FVTPT RTI
Sbjct  12    AMRAVESKFALYDRSHWGLIKITDRDCLRFLHNQSTNNFLSLQPGQGCDTIFVTPTGRTI  71

Query  533   DIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQI  712
             D+  A++  +AI ++ SP+  + +   L KYIFF+DK+++ DI++    F L+GP S+++
Sbjct  72    DLVTAYVHDDAIIILVSPKRHKFLMEWLDKYIFFADKIQLNDITESNAIFNLIGPGSDEL  131

Query  713   VEGLNLGDLVGQPYGSHKHYSVNG-NPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             V  L    L+G+PYG+H+ +S  G   +   VG+ ++  G++++   A   S+ + L++Y
Sbjct  132   VTKLGAETLIGKPYGTHQVFSSQGLEDLCFCVGSGLAIPGYTMIFPVAHKNSMQEILLEY  191

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GAV M  N W  LRI+QGRP P +E+T+E+N LE  LWNA+S NKGCY GQETI+RL TY
Sbjct  192   GAVKMSENTWSMLRILQGRPMPDQEITEEYNPLEVGLWNAISFNKGCYIGQETITRLNTY  251

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              G+KQ+LWGI L++   PGS I++  +KVGKLTS T++ D    FGLGYIR K  
Sbjct  252   KGVKQKLWGIHLTAPTTPGSLITIGQEKVGKLTSYTTTVDGH--FGLGYIRTKVG  304



>ref|WP_009342110.1| glycine cleavage system protein T [Raphidiopsis brookii]
 gb|EFA73746.1| Glycine cleavage T protein (aminomethyl transferase) [Raphidiopsis 
brookii D9]
Length=327

 Score =   280 bits (715),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 198/298 (66%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ A +   A+ D SH+GRI V+GEDR++FLHNQST NF+ L  G GCDTV VT T
Sbjct  9     EDRAAVYAAKTRTAICDRSHWGRIEVTGEDRLRFLHNQSTNNFQSLQPGSGCDTVMVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+   +++++ + L+ SP   E + S L +YIFF+D+V + DI+ QT  F L+GP 
Sbjct  69    ARTIDLVTGYVLEDRVLLLVSPNRREFLLSWLDRYIFFTDQVTLTDITDQTATFTLLGPE  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ ++  L    L+ QP G   H S+NG  +  AVG  ++  G++L++  A  + +W+ L
Sbjct  129   SDTLISKLGAASLLSQPDG--HHISING--IIFAVGTGLAIPGYTLILPRAEKQQIWQQL  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             +D+GAV +    WE LRI QGRPAP  ELTD++N LE  LW  VS NKGCY GQETI+RL
Sbjct  185   LDWGAVKLSDRHWEMLRISQGRPAPDAELTDDYNPLEVGLWQTVSFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGI+L S  +PG+ I++  +KVGKLTS   + +    FGLGYIR KA 
Sbjct  245   NTYKGVKQHLWGIKLKSCAQPGTIITILEEKVGKLTSYIETPEGH--FGLGYIRAKAG  300



>ref|WP_010998195.1| glycine cleavage system protein T [Nostoc sp. PCC 7120]
 ref|NP_488095.1| glycine cleavage T-protein; aminomethyltransferase [Nostoc sp. 
PCC 7120]
 dbj|BAB75754.1| glycine cleavage T-protein; aminomethyltransferase [Nostoc sp. 
PCC 7120]
Length=327

 Score =   280 bits (715),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 206/299 (69%), Gaps = 5/299 (2%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTP  517
             G D  A+ A    VAV D S++G IRVS +DR++FLHNQST +F+ L  GQGC+TV VT 
Sbjct  8     GKDTAAIQAATAEVAVYDRSNWGLIRVSDDDRLRFLHNQSTNDFQSLKPGQGCETVMVTS  67

Query  518   TARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGP  697
             TARTID+  ++++ +A+ L+ S    E +   L +YIFF+DKV++ DI+ +T    ++GP
Sbjct  68    TARTIDLVSSYVLNDAVILLVSSSRREFLLQWLDRYIFFADKVQLTDITDETATLSIIGP  127

Query  698   RSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKA  877
              S+ +VE L  G+++GQP+G+  H +++G  V  AVG+ ++  G++L++  +  + VW+ 
Sbjct  128   GSDAVVEKLGAGEIIGQPHGN--HITIDGG-VVAAVGSGLASPGYTLILPVSQKQQVWQQ  184

Query  878   LVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISR  1057
             ++D GAV +   AW+ LRI+QGRPAP  ELTD++N LE  LW  +S +KGCY GQETI+R
Sbjct  185   ILDSGAVELSDRAWDTLRILQGRPAPDAELTDDYNPLEVGLWQTISFSKGCYIGQETIAR  244

Query  1058  LVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             L TY G+KQ LWGIRL++  E G SI++  +KVGKLTS T + D    FGL YIR KA 
Sbjct  245   LNTYKGVKQHLWGIRLNAPAEIGDSINIGDEKVGKLTSYTETPDGY--FGLAYIRSKAG  301



>ref|WP_027403395.1| glycine cleavage system protein T [Aphanizomenon flos-aquae]
Length=330

 Score =   278 bits (712),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 146/298 (49%), Positives = 205/298 (69%), Gaps = 6/298 (2%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
              D  A+ +   GV V D S +G IR+SG+DR++FLHNQST +F+    GQGCDTV VT T
Sbjct  9     KDVNAMQSVREGVVVCDRSPWGLIRISGDDRLRFLHNQSTNDFKSRKPGQGCDTVMVTST  68

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+  A+++ +A+ L+ SP   + +   L +YIF SD+V++ D++++T    L+GP+
Sbjct  69    ARTIDLVTAYVLNDAVLLLVSPNRRQELMKWLDRYIFPSDQVKLTDVTEETAILSLIGPQ  128

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S+ ++E L  GDL+GQP G+  H  V G  V +AVG+ ++  G++L++  A  ++ W+ +
Sbjct  129   SHAVIEKLGAGDLIGQPNGN--HILVGG--VIVAVGSGLAAPGYTLILPRAEKQTWWEKI  184

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
                GAV +    WE LRI+QGRPAP  ELTD++N LE  LW AVS NKGCY GQETI+RL
Sbjct  185   RSLGAVELSDRTWEMLRILQGRPAPDSELTDDYNPLEVGLWQAVSFNKGCYIGQETIARL  244

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGIRLS++ EPG+ I++  +KVGKLTS T++ D    FGL YIR KA 
Sbjct  245   NTYKGVKQYLWGIRLSAAAEPGTVITIGEEKVGKLTSYTTTPDGH--FGLVYIRSKAG  300



>ref|WP_008229443.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Richelia intracellularis]
 emb|CCH65613.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Richelia intracellularis HM01]
Length=320

 Score =   278 bits (710),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/294 (47%), Positives = 201/294 (68%), Gaps = 3/294 (1%)
 Frame = +2

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             + A E+  A+ D SH+G I+++  D ++FLHNQST NF  L  GQGCDT+FVTPT RTID
Sbjct  1     MRAVESKFALYDRSHWGLIKITDRDCLRFLHNQSTNNFLSLQPGQGCDTIFVTPTGRTID  60

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             +  A++  +AI ++ SP+  + +   L KYIFF+DK+++ DI++    F L+GP S+++V
Sbjct  61    LVTAYVHDDAIIILVSPKRHKFLMEWLDKYIFFADKIQLNDITESHAIFNLIGPGSDELV  120

Query  716   EGLNLGDLVGQPYGSHKHYSVNG-NPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYG  892
               L    L+G+PYG+H+ +S  G   +   VG+ ++  G++++   A   S+ + L++YG
Sbjct  121   TKLGAEILIGKPYGTHQVFSAQGLQDLCFCVGSGLAIPGYTMIFPVAHKNSIQEILLEYG  180

Query  893   AVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYD  1072
             AV M  N W  LRI+QGRP P +E+T+E+N LE  LWNA+S NKGCY GQETI+RL TY 
Sbjct  181   AVKMSENTWSMLRILQGRPMPDQEITEEYNPLEVGLWNAISFNKGCYIGQETITRLNTYK  240

Query  1073  GIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             G+KQ+LWGI L++   PGS I++  +KVGKLTS T++ D    FGLGYIR K  
Sbjct  241   GVKQKLWGIYLTAPTTPGSLITIGQEKVGKLTSYTATVDGH--FGLGYIRTKVG  292



>ref|WP_012161995.1| glycine cleavage system protein T [Acaryochloris marina]
 ref|YP_001515778.1| glycine cleavage T protein [Acaryochloris marina MBIC11017]
 gb|ABW26464.1| glycine cleavage T protein, putative [Acaryochloris marina MBIC11017]
Length=354

 Score =   279 bits (713),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 204/307 (66%), Gaps = 4/307 (1%)
 Frame = +2

Query  314   EGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQG  493
             +G I+ ++GND  AL A +NG A+ D +H+GR++ + +DR+ FLHNQ+T  F+ L  G+G
Sbjct  20    QGSIL-SFGNDKFALKAVQNGAALWDRTHWGRLQFTDQDRLSFLHNQTTNTFKTLKPGEG  78

Query  494   CDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQT  673
             C++VFVT TARTID+  A++ + A+ L+ SP    ++ S   +YIFF DKV+I+DI+ QT
Sbjct  79    CESVFVTSTARTIDLVSAYVTEEAVLLLVSPTRRAQLMSWCDRYIFFGDKVKIEDITTQT  138

Query  674   CFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPA  853
               F L+GP S++++  L + DL   P+  H    + G+ V +A G+ ++  G++L     
Sbjct  139   ITFSLLGPESSRLLHKLGISDLPESPH-HHITTQIKGHTVRVASGSGLTTPGYTLFADAE  197

Query  854   TAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCY  1033
                 +W+AL +  A P+G   WE+LR+ +GRP P  ELT++FN LEA LW  +S +KGCY
Sbjct  198   VGADLWQALTEQDACPLGEKVWEQLRVSEGRPKPDAELTEDFNPLEAGLWQTISFDKGCY  257

Query  1034  KGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLG  1213
              GQETI+RL TY G+KQRLWGI+L  SV   + I+++ KKVG LTS+  + +   P GLG
Sbjct  258   IGQETIARLNTYQGVKQRLWGIQLGESVSVDTPITLEDKKVGVLTSLVETAE--GPVGLG  315

Query  1214  YIRKKAA  1234
             Y++ KA 
Sbjct  316   YVKTKAG  322



>ref|WP_015954025.1| glycine cleavage system protein T [Cyanothece sp. PCC 7424]
 ref|YP_002377287.1| folate-binding protein YgfZ [Cyanothece sp. PCC 7424]
 gb|ACK70419.1| folate-binding protein YgfZ [Cyanothece sp. PCC 7424]
Length=354

 Score =   279 bits (713),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 201/318 (63%), Gaps = 2/318 (1%)
 Frame = +2

Query  281   DTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQST  460
             + +K+ G    +G  I ++GND   L A + GV + D SH+G +++ GEDR +FLHNQ+T
Sbjct  9     NQIKLGGVLSPDGTKINSFGNDRAGLEAAQTGVGLYDRSHWGLLQLKGEDRSRFLHNQTT  68

Query  461   ANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSD  640
              N   L  GQGCDTVF+  T RT+D+A  ++   AI ++ SP     + + + +YIF  D
Sbjct  69    NNINSLKSGQGCDTVFINSTGRTLDLATVYVTDEAIEVLVSPNRRSFLMTWMDRYIFPMD  128

Query  641   KVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIIS  820
             KVE+ DIS+Q   F L+GP S++I+E LNL  ++GQP GSH    V    V + VG  ++
Sbjct  129   KVELTDISEQNAIFTLLGPHSDRILEKLNLKSIIGQPVGSHLTGEVANCLVRVGVGTGLT  188

Query  821   EEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANL  1000
               G++ ++    A  VW+  V+     +G N WE LRI+QGRP P +ELT+E+N LE+ L
Sbjct  189   LPGYTFIIPREKALPVWQEFVNTEVTLLGENVWEHLRILQGRPVPDRELTEEYNPLESGL  248

Query  1001  WNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTS  1180
             W  +S +KGCY GQETI+RL TY G+KQRLWG++L   VEP + I ++  K+G LTS T 
Sbjct  249   WKTISFDKGCYIGQETIARLNTYKGVKQRLWGVKLDHPVEPDTEIFLEETKIGVLTSCTE  308

Query  1181  SGDTSKPFGLGYIRKKAA  1234
             +   +  FGL Y++ KA 
Sbjct  309   T--QTGGFGLAYVKTKAG  324



>ref|WP_006625503.1| MULTISPECIES: glycine cleavage system protein T [Arthrospira]
 gb|EDZ94215.1| folate-binding protein YgfZ [Arthrospira maxima CS-328]
 emb|CCE16655.1| glycine cleavage T-protein;Tetrahydrofolate aminomethyltransferase 
[Arthrospira sp. PCC 8005]
 gb|EKD06629.1| folate-binding protein YgfZ [Arthrospira platensis C1]
 emb|CDM95329.1| glycine cleavage T-protein;Tetrahydrofolate aminomethyltransferase 
[Arthrospira sp. PCC 8005]
Length=349

 Score =   277 bits (709),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 203/306 (66%), Gaps = 2/306 (1%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
             G +  ++ ND EAL A+E  VA+ D SH+G + +SGEDR+ FLHNQST +      GQGC
Sbjct  20    GQVPLSFDNDTEALNASEETVALCDRSHWGLLELSGEDRLSFLHNQSTNSISDRQPGQGC  79

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             DTVFVT TAR ID+A A++ + A+ L+ SP   + +   L +YIF  D+V I+DIS Q  
Sbjct  80    DTVFVTSTARNIDLATAYMTEEAVLLLVSPNRRQHLLQWLDRYIFPMDRVNIKDISDQWA  139

Query  677   FFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
              F L+GP S+ ++  L          G+H    V    V +A+G+ ++ EG++L+V    
Sbjct  140   VFSLIGPESSSLLTKLGATMAENLTRGNHWVDMVANISVRVAIGSGLAREGYTLIVPTEA  199

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
             A ++W +L + GAVP+G   WE+LRI+QGRP P +ELT+++N LEA LW  +S  KGCY 
Sbjct  200   AGNLWLSLTEAGAVPLGDRIWEQLRILQGRPTPDRELTEDYNPLEAGLWGNISFEKGCYI  259

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQRLWG+RLS  VEPG+ I++  +KVGKLTS+T + +    FGLGY
Sbjct  260   GQETIARLNTYKGVKQRLWGLRLSGFVEPGTVINLKDEKVGKLTSITETQE--GWFGLGY  317

Query  1217  IRKKAA  1234
             IR KA 
Sbjct  318   IRTKAG  323



>ref|WP_029633203.1| glycine cleavage system protein T [[Scytonema hofmanni] UTEX 
B 1581]
Length=328

 Score =   275 bits (704),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 141/286 (49%), Positives = 202/286 (71%), Gaps = 5/286 (2%)
 Frame = +2

Query  377   VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIM  556
             VAV D S +G IRVS +DR++FLHNQ+T +F+ L  GQGCDTV VT TARTID+  A+++
Sbjct  21    VAVCDRSSWGIIRVSDDDRIRFLHNQTTNDFQSLKPGQGCDTVMVTSTARTIDLVTAYVL  80

Query  557   KNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD  736
             ++A+ L+ SP   E I   L KYIFF+DKV++ D++ +T  F ++G +S+ I+E L    
Sbjct  81    EDAVLLLVSPNRREFIMQWLDKYIFFADKVQLTDVTNETATFNIIGSQSDTIIEKLGAEA  140

Query  737   LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNA  916
             ++GQP G+H+ +      + +AVG+ ++  G++L++  +   +VW+ +V+ GA  M   A
Sbjct  141   IIGQPDGTHQLFD---GGMRVAVGSGLALPGYTLILPASEKATVWQKIVEAGAQEMSDRA  197

Query  917   WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWG  1096
             ++ LRI+QGRPAP  ELTD++N LEA LW+ +S +KGCY GQETI+RL TY G+KQ LWG
Sbjct  198   FDMLRILQGRPAPEHELTDDYNPLEAGLWHTISFSKGCYIGQETIARLNTYKGVKQHLWG  257

Query  1097  IRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             IRL++  E GS+I+V  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  258   IRLNAPAEIGSAIAVGDEKVGKLTSYTETADGY--FGLGYIRTKAG  301



>ref|WP_006619939.1| glycine cleavage system protein T [Arthrospira platensis]
 gb|KDR58464.1| glycine cleavage system protein T [Arthrospira platensis str. 
Paraca]
Length=349

 Score =   276 bits (705),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 202/301 (67%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND EAL A+   VA+ D SH+G + +SGEDR+ FLHNQST +      GQG DTVFV
Sbjct  25    SFGNDTEALNASGETVALCDRSHWGLLELSGEDRLSFLHNQSTNSISDRQPGQGSDTVFV  84

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TAR ID+A A++ + A+ L+ SP   + +   L +YIF  DKV ++DIS Q   F L+
Sbjct  85    TSTARNIDLATAYMTEEAVLLLVSPNRRQHLLQWLDRYIFPMDKVNLKDISDQWAVFSLI  144

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S+ ++  L          G+H    V    + +AVG+ ++ EG++L++    A ++W
Sbjct  145   GPESSSLLTKLGATIADHLTLGNHWVDQVANTSLRVAVGSGLATEGYTLIIPTEAAGNLW  204

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
              +L + GAVP+G   WE+LRI+QGRPAP +ELT+++N LEA LW  +S  KGCY GQETI
Sbjct  205   LSLTEAGAVPLGDRIWEQLRILQGRPAPDRELTEDYNPLEAGLWGDISFEKGCYIGQETI  264

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQRLWG+RLS  VEPG+ I+V+ +KVGKLTS+T + +    FGLGYIR KA
Sbjct  265   ARLNTYKGVKQRLWGLRLSGFVEPGTVINVNDEKVGKLTSITETQE--GWFGLGYIRTKA  322

Query  1232  A  1234
              
Sbjct  323   G  323



>ref|WP_014274523.1| glycine cleavage system T protein [Arthrospira platensis]
 ref|YP_005067424.1| glycine cleavage system T protein [Arthrospira platensis NIES-39]
 dbj|BAI88886.1| glycine cleavage system T protein [Arthrospira platensis NIES-39]
Length=349

 Score =   275 bits (702),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 202/301 (67%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND EAL A+   VA+ D SH+G + +SGEDR+ FLHNQST +      GQG DTVFV
Sbjct  25    SFGNDTEALNASGETVALCDRSHWGLLELSGEDRLSFLHNQSTNSISDRQPGQGSDTVFV  84

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TAR ID+A A++ + A+ L+ SP   + +   L +YIF  DKV ++DIS Q   F L+
Sbjct  85    TSTARNIDLATAYMTEEAVLLLVSPNRRQHLLQWLDRYIFPMDKVNLKDISDQWAVFSLI  144

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S+ ++  L          G+H    V    + +AVG+ ++ EG++L++    A ++W
Sbjct  145   GPESSSLLTKLGATIPDNFTLGNHWVDQVANTSLRVAVGSGLATEGYTLIIPTEAAGNLW  204

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
              +L + GAVP+G   WE+LRI+QGRPAP +ELT+++N LEA LW  +S  KGCY GQETI
Sbjct  205   LSLTEAGAVPLGDRIWEQLRILQGRPAPDRELTEDYNPLEAGLWGDISFEKGCYIGQETI  264

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQRLWG+RLS  VEPG+ I+V+ +KVGKLTS+T + +    FGLGYIR KA
Sbjct  265   ARLNTYKGVKQRLWGLRLSGFVEPGTVINVNDEKVGKLTSITETQEGW--FGLGYIRTKA  322

Query  1232  A  1234
              
Sbjct  323   G  323



>ref|WP_016953117.1| glycine cleavage system protein T [Anabaena sp. PCC 7108]
Length=327

 Score =   273 bits (698),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 200/298 (67%), Gaps = 7/298 (2%)
 Frame = +2

Query  344   DDEALTATENGVAVVDLS-HYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             D  A+ A E GVAV D   H+G IRVS +DR++FLH QST +F+ L  G GCDTV +T T
Sbjct  10    DAAAIHAAETGVAVCDNGFHWGIIRVSNDDRLRFLHGQSTNDFQGLKPGAGCDTVILTST  69

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID+   +++ +A+ L+ S    E +   L +YIFF+DKV + D++ +T    L+G +
Sbjct  70    ARTIDLVTGYVLDDAVLLLVSLNRREFLMQWLDRYIFFADKVILTDVTDETATLSLIGTQ  129

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             SN+I+  L  GDL+GQPYG+H    V+G  V  AVG+ ++  G++L++  A    +W  +
Sbjct  130   SNEIIAKLGAGDLIGQPYGNH--ILVDG--VIFAVGSGLANPGYTLILPVAEKAKLWNQI  185

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
             ++ GAV +    WE LRI+QGRPAP  ELTD++N LE  LW  VS NKGCY GQETI+RL
Sbjct  186   LELGAVELSDRTWEMLRILQGRPAPDFELTDDYNPLEVGLWQTVSFNKGCYIGQETIARL  245

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
              TY G+KQ LWGIRL ++ EPG+ I++  +KVGKLTS T + D    FGLGYIR KA 
Sbjct  246   NTYKGVKQYLWGIRLDAAAEPGTVITIGEEKVGKLTSYTETPDGH--FGLGYIRSKAG  301



>ref|WP_035154850.1| glycine cleavage system protein T [Calothrix sp. 336/3]
 gb|KFB84558.1| glycine cleavage system protein T [Calothrix sp. 336/3]
Length=318

 Score =   272 bits (696),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 201/292 (69%), Gaps = 6/292 (2%)
 Frame = +2

Query  353   ALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTI  532
             A+ + E GVAV D +H+GRI+VS  DR++FLHNQST +F+ L  G GCDTVFVT TARTI
Sbjct  5     AIESIEQGVAVCDRTHWGRIKVSDGDRLRFLHNQSTNDFQQLQPGSGCDTVFVTSTARTI  64

Query  533   DIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQI  712
             D+A A++  +A+ L+ SP   + +   L KYIFF+DKV++ D+++ T    L+G +S+ I
Sbjct  65    DLATAYVTDDAVILLVSPHRRQFLLEWLDKYIFFADKVQLSDLTQTTATISLIGSQSDAI  124

Query  713   VEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYG  892
             VE L    L+G+PYGSH    +    +  AVG+ ++  G++L++  A   ++W+ + + G
Sbjct  125   VEKLGASALIGKPYGSH----LQIGEILFAVGSGLASPGYTLILPIAEKANIWEKIQELG  180

Query  893   AVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYD  1072
             A+ +    WE LRI+QGRP P +ELTD++N LE  LW  +S NKGCY GQETI+RL TY 
Sbjct  181   AIAISEEDWEMLRILQGRPIPDQELTDDYNPLEVGLWQTISFNKGCYIGQETIARLNTYK  240

Query  1073  GIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             G+KQ LWGIRLS++ EPG++I++  +K+G +TS T++   +  F L YIR K
Sbjct  241   GVKQYLWGIRLSAATEPGTNITLGEEKIGTITSYTAT--PTGHFALAYIRSK  290



>ref|WP_017663248.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=355

 Score =   273 bits (699),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 203/300 (68%), Gaps = 4/300 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++GND +AL A   GVA+ D + +GR++++  DR++F+HNQST  F     G+ CDTVF+
Sbjct  28    SFGNDADALNAARTGVALYDRTAWGRLQLTQGDRLRFVHNQSTNEFNSRQPGEACDTVFL  87

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TART+D+A A+I  +A+ L+ SP   E +  +L +YIF +DKVE+ D +  T  F L+
Sbjct  88    TNTARTLDLATAYITDDALLLLVSPSRRETLMKLLDRYIFPADKVELSDRTDDTACFTLI  147

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G  S  ++E L + D +    G+H+  ++N + + IA G+ +S  G++L+ +   A  +W
Sbjct  148   GEESRSLLEKLGISDDISP--GTHRLVTLNTHELRIAAGSGLSLPGYTLICNADAAAELW  205

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             K L D GA P+G   W  LRI QGRPAP  ELTD++N LEA LW+ +S +KGCY GQETI
Sbjct  206   KTLYDTGATPLGETLWNRLRIEQGRPAPDAELTDDYNPLEAGLWHTISFDKGCYIGQETI  265

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWG+RL+S+ EPG+ I+++  K+GKLTS+ S+ D     GLGYIR KA
Sbjct  266   ARLNTYKGVKQQLWGLRLNSAAEPGTPITLEDSKIGKLTSIVSTEDGY--VGLGYIRTKA  323



>ref|WP_036530983.1| glycine cleavage system protein T [Neosynechococcus sphagnicola]
 gb|KGF73728.1| glycine cleavage system protein T [Neosynechococcus sphagnicola 
sy1]
Length=353

 Score =   272 bits (695),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 227/345 (66%), Gaps = 10/345 (3%)
 Frame = +2

Query  296   AGAKVLEGDIIE-----TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQST  460
             AGA +  GDI +     T+GND  A+ A +  VAV D  H+GRI +SG DR+++L NQST
Sbjct  11    AGATL--GDIADLSVPLTFGNDPVAVAAAQQQVAVCDRCHWGRIEISGADRIRYLQNQST  68

Query  461   ANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSD  640
              +F  L  G GCDTVFVT TART+D+  A+++++ + L+ SP   + + + L +YIF +D
Sbjct  69    NDFNSLQPGAGCDTVFVTSTARTLDLVTAYVLEDRVLLLVSPNRRQALLAWLDRYIFPAD  128

Query  641   KVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIIS  820
             +V IQD +     F L+GP+S++++  L    L+G   G+H    +    V +AVG+ ++
Sbjct  129   RVVIQDRTLTMATFSLIGPQSDRLLAALGGDPLLGAAPGTHCCQILANLKVRVAVGSGLA  188

Query  821   EEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANL  1000
               G++L +  + A ++W+AL   GAVP+G   WE+LRI QGRPAP +ELT+E+N LEA L
Sbjct  189   LPGYTLCLDTSDAAALWQALTTAGAVPLGEQGWEQLRIQQGRPAPDRELTEEYNPLEAGL  248

Query  1001  WNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTS  1180
             W+AVS +KGCY GQETI+RL TY G+KQ+LWGIRL   VEPGS I V  +KVGKLTSVT+
Sbjct  249   WHAVSFSKGCYIGQETIARLQTYKGVKQQLWGIRLQQPVEPGSVIRVGEEKVGKLTSVTA  308

Query  1181  SGDTSKPFGLGYIRKKAASegdtviigdgvvgtvvevPFLGRQLP  1315
             +   +   GL YIR KA    +  +      G +V+VPFL R+LP
Sbjct  309   T--PTGLVGLAYIRTKAGG-ENLSVDVGDSSGQLVDVPFLSRELP  350



>ref|WP_015215867.1| folate-binding protein YgfZ [Anabaena cylindrica]
 ref|YP_007158156.1| folate-binding protein YgfZ [Anabaena cylindrica PCC 7122]
 gb|AFZ59246.1| folate-binding protein YgfZ [Anabaena cylindrica PCC 7122]
Length=333

 Score =   269 bits (687),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 201/306 (66%), Gaps = 13/306 (4%)
 Frame = +2

Query  338   GNDDEALTATENGVAVVDL-------SHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
             G D  A+ A   GVAV D        SH G IR+S  DR++FLH QST +F+ L  G+GC
Sbjct  8     GKDATAIHAAREGVAVRDACCGRSHRSHLGIIRISDADRLRFLHGQSTNDFQRLKPGEGC  67

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             DTVF+T TARTID+   +++ +A+ L+ S    E +   L +YIFF+DKV + D++++T 
Sbjct  68    DTVFLTSTARTIDLVTGYVLDDAVLLLVSANRREFLMQWLDRYIFFADKVVLTDVTEETA  127

Query  677   FFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
                L+G +SN I+E L  G L+GQP+G+H    V+G     AVG+ ++  G++L++  A 
Sbjct  128   ILSLMGTQSNCIIEKLGAGALIGQPHGNH--ILVDG--AIFAVGSGLAAPGYTLILPIAE  183

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
              +  W+ +++ GAV +   AWE LRI+QGRPAP  ELT+++N LE  LW  VS NKGCY 
Sbjct  184   KQKWWERILELGAVELSDRAWETLRILQGRPAPDLELTEDYNPLEVGLWQTVSFNKGCYI  243

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQ LWGIRL +  EPGS I++  +KVGKLTS T + D    FGLGY
Sbjct  244   GQETIARLNTYKGVKQYLWGIRLHAPAEPGSVITIGDEKVGKLTSYTETPDGH--FGLGY  301

Query  1217  IRKKAA  1234
             IR KA 
Sbjct  302   IRSKAG  307



>ref|WP_012593447.1| MULTISPECIES: glycine cleavage system protein T [Cyanothece]
 ref|YP_002370326.1| folate-binding protein YgfZ [Cyanothece sp. PCC 8801]
 ref|YP_003135868.1| folate-binding protein YgfZ [Cyanothece sp. PCC 8802]
 gb|ACK64170.1| folate-binding protein YgfZ [Cyanothece sp. PCC 8801]
 gb|ACU99032.1| folate-binding protein YgfZ [Cyanothece sp. PCC 8802]
Length=356

 Score =   266 bits (681),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 207/325 (64%), Gaps = 5/325 (2%)
 Frame = +2

Query  269   HDLIDTMKVAGAKVLEGDI-IETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFL  445
              DL +  K +G  + E  + IE++ ND +      NG  + D +H+G ++++GEDR++FL
Sbjct  3     EDLREIQKQSGVILTENQLMIESFHNDSQGFKLAYNGAVICDRTHWGLLQLTGEDRLRFL  62

Query  446   HNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKY  625
             HNQ+T N   L  GQGC TVFV  T RT+D+A A++   AI L+ SP   + +   + +Y
Sbjct  63    HNQTTNNINALKPGQGCYTVFVNSTGRTLDLATAYVTDEAILLLVSPNRRQFLLEWMDRY  122

Query  626   IFFSDKVEIQDISKQTCFFVLVGPRSNQIVE--GLNLGDLVGQPYGSHKHYSVNGNPVTI  799
             IF  DKV+I DIS+Q   F L+G  +N+++   G+N+ +LV  P  +H   ++    +T+
Sbjct  123   IFPMDKVQISDISQQNAIFTLMGSETNKLLTQGGMNISNLVELPPENHTLVTIKNEFITV  182

Query  800   AVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEF  979
             A G+ ++  G++L+V    AK VW+ L+  G  P+G   WE+LRI QGRP P KELT+++
Sbjct  183   ANGSGLAIPGYTLIVPINQAKIVWEELIKLGITPIGDRVWEQLRIKQGRPFPDKELTEDY  242

Query  980   NVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVG  1159
               LEA LW A+S +KGCY GQETI+RL TY G+KQRLWG++L+  V+PG+ + +DG K+G
Sbjct  243   IALEAGLWQAISFDKGCYIGQETIARLNTYKGVKQRLWGVKLTQLVDPGTPVILDGNKIG  302

Query  1160  KLTSVTSSGDTSKPFGLGYIRKKAA  1234
              LTS        + +GL Y++ KA 
Sbjct  303   ILTSCIEI--EQEFWGLAYVKTKAG  325



>ref|WP_036486210.1| glycine cleavage system protein T [Myxosarcina sp. GI1]
Length=346

 Score =   263 bits (671),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 196/301 (65%), Gaps = 2/301 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             ++ ND +AL+A E+ V + D SH+G ++V GEDR+++LHNQST +F  L  GQGCDTVFV
Sbjct  24    SFNNDRQALSAIEDRVILCDRSHWGVLKVGGEDRLRYLHNQSTNDFASLQAGQGCDTVFV  83

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TART+D+A A I ++ + ++ +P    ++   L ++IF  DKVE+ D+S +   F L+
Sbjct  84    TSTARTLDLATALITEDDVLILVAPNRRRQLLEWLDRFIFPFDKVELSDVSTEYAVFSLI  143

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G +S+  +  L+L  L G   G+HK  S++   V  AVG+ +   G++L V    A  +W
Sbjct  144   GNKSSAFLAQLDLDSLEGHSNGNHKLLSIDSVAVRTAVGSGLVTPGYTLFVPSEGAAKIW  203

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
               L+  G +P G   WE LRI QGRP P  ELT+++N LEA LW  +S +KGCY GQETI
Sbjct  204   SKLMTLGVIPAGERVWETLRIQQGRPTPDLELTEDYNPLEAGLWQTISFDKGCYIGQETI  263

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQ+LWGI LS +V+PG+ +S++  K+G LTS T + +  +  GL Y+R  A
Sbjct  264   ARLNTYKGVKQKLWGIELSQAVKPGTPLSIENSKIGVLTSCTDTPNGVR--GLAYVRSVA  321

Query  1232  A  1234
              
Sbjct  322   G  322



>ref|WP_017712259.1| hypothetical protein [Prochlorothrix hollandica]
Length=365

 Score =   261 bits (666),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 139/310 (45%), Positives = 200/310 (65%), Gaps = 8/310 (3%)
 Frame = +2

Query  317   GDIIETYGNDDEALTAT--ENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQ  490
             G + +T+G + EA+ A   + GV + D SH+G + V   DR++FLHNQST NF+ L  GQ
Sbjct  23    GAVPQTFGREAEAIAAVHQDQGVVLCDRSHWGCLDVLDRDRLRFLHNQSTNNFQTLQPGQ  82

Query  491   GCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQ  670
             GC+TVFVT TART+D+A A+++ + + L+ SP   ++I   L +YIF  DKV++ D S +
Sbjct  83    GCETVFVTATARTLDLATAYVLADRVRLLLSPNRRQQIHDWLDRYIFPFDKVKLVDCSGE  142

Query  671   TCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
                F L+G      ++ L + DL   P+ SH      G+ V +A G+ ++ EG++LLV  
Sbjct  143   VGIFSLLGSHCGAWLQQLGIPDLPSAPH-SHLTTEFQGSTVHLAQGSGLATEGYTLLVPG  201

Query  851   ATAKSVWKALVDYG---AVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLN  1021
               A + W +L +     A+P+G   WE+LRI QGRP P +ELT+++N LEA LW  VS +
Sbjct  202   EQAAAAWHSLTETPGTPALPLGRQGWEQLRIQQGRPQPDRELTEDYNPLEAGLWQTVSFD  261

Query  1022  KGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKP  1201
             KGCY GQETI+RL TY G+KQRLWG+R     EPG+ ++V  ++VGK+TSV  + + S  
Sbjct  262   KGCYIGQETIARLNTYKGVKQRLWGLRFQGQPEPGTLLTVADQRVGKVTSVVPTAEGS--  319

Query  1202  FGLGYIRKKA  1231
              GLGYIR KA
Sbjct  320   LGLGYIRTKA  329



>ref|WP_035994740.1| glycine cleavage system protein T [Leptolyngbya sp. KIOST-1]
Length=350

 Score =   259 bits (663),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 138/312 (44%), Positives = 194/312 (62%), Gaps = 3/312 (1%)
 Frame = +2

Query  299   GAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEIL  478
             GA   +  I  ++GN    L A      +VD SH+G I+++G DR++F+HNQ+T  F   
Sbjct  12    GATFSDAGIPLSFGNT-SGLDAVSKDPVLVDRSHWGVIQMTGGDRLRFIHNQTTNTFTQR  70

Query  479   HEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQD  658
               G+GCDTVFVT TARTID+   +I  +A+ ++TSP   +R+   + +YIF +D+V + +
Sbjct  71    QSGEGCDTVFVTSTARTIDLTTVYITDDALLILTSPGQDQRLIEWMDRYIFPADRVSLTN  130

Query  659   ISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSL  838
             +++    F LVGP S  I++ L +      PYG H+   V    V +AVG+ +   G++L
Sbjct  131   LTQTMAVFSLVGPGSAGILKQLGIEPGADLPYGHHQSVDVRSVSVRLAVGSGLGLPGYTL  190

Query  839   LVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSL  1018
             LV       +W+ L + GA P+G   W++LRI QGRPAPG ELT+E+N LEA LW +VS 
Sbjct  191   LVPAEGVAHLWQWLTETGATPVGETEWQQLRIRQGRPAPGHELTEEYNPLEAGLWQSVSF  250

Query  1019  NKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSK  1198
             +KGCY GQETI+RL TY G+KQ+LWGI+L  S   G  I    +KVG LTSV  + D S 
Sbjct  251   DKGCYIGQETIARLNTYQGVKQQLWGIKLHGSARVGEVIRAGDEKVGLLTSVIDTPDGS-  309

Query  1199  PFGLGYIRKKAA  1234
               GLGYIR +A 
Sbjct  310   -MGLGYIRTRAG  320



>ref|WP_022609105.1| folate-binding protein YgfZ [Rubidibacter lacunae]
 gb|ERN40004.1| folate-binding protein YgfZ [Rubidibacter lacunae KORDI 51-2]
Length=364

 Score =   259 bits (662),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/317 (44%), Positives = 200/317 (63%), Gaps = 15/317 (5%)
 Frame = +2

Query  326   IETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTV  505
             + +YG D+EA+ A  NGVA+ D SH+G +RV+G+DR++FLHNQST +   L  G  C+TV
Sbjct  22    VLSYGCDEEAIAAAMNGVALTDRSHWGLLRVTGDDRLEFLHNQSTNDIRQLQPGTSCETV  81

Query  506   FVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFV  685
             FVT TARTID+A  +  ++A+ L+ SP   + + + L +Y+F +D+VEI D+S     F 
Sbjct  82    FVTSTARTIDLATVYATEDALLLLVSPSGCQTLPAWLDRYLFPADRVEIDDVSAHFAVFD  141

Query  686   LVGPRSNQIV-----EGLNLG-------DLVGQPYGSHKHYSV-NGNPVTIAVGNIISEE  826
              VGP S  ++     E LN           V  P  +H+  ++ +G  V I+ G  +   
Sbjct  142   AVGPGSRILLGRLMQESLNADADRPDAPQSVALPAATHRLLTLKSGTTVRISPGCGLELP  201

Query  827   GFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWN  1006
             GF+ +V   +A + W+  +  GA P+G  AWE LR+ QGRP PG ELTD++N LEA L  
Sbjct  202   GFTAIVPRESAWTFWECCIAVGARPLGDRAWERLRVTQGRPMPGSELTDDYNPLEAGLLR  261

Query  1007  AVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSG  1186
             A+S +KGCY GQETI+RL TYDG+KQ+LWG++L++ + PG+ I  DGKKVG  TSV  + 
Sbjct  262   AISFDKGCYIGQETIARLKTYDGVKQKLWGVQLAAPIAPGTPILQDGKKVGIATSVVPTA  321

Query  1187  DTSKPFGLGYIRKKAAS  1237
             D +    L Y+R K A+
Sbjct  322   DGA--IALAYVRTKLAA  336



>ref|WP_036046348.1| glycine cleavage system protein T, partial [Leptolyngbya boryana]
Length=293

 Score =   256 bits (655),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 194/281 (69%), Gaps = 12/281 (4%)
 Frame = +2

Query  389   DLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAI  568
             D S +GRI+VS  DR+ FLHNQST  F +   G+GCDTVFVT TARTID+A A+I+++++
Sbjct  1     DRSSWGRIQVSDADRLNFLHNQSTNTFNLRKPGEGCDTVFVTSTARTIDLATAYILEDSV  60

Query  569   TLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQ  748
              L+ SP  +E++   L +YIFF+DKV++ DI+ +T    ++G +S+ IV+ L   +L+ Q
Sbjct  61    ILLVSPGLTEKLMKFLDRYIFFADKVKLADITAETQTVSVLGSKSHDIVKELGAAELIAQ  120

Query  749   PYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEEL  928
             PYG+  H  V+G  + IAVG+ ++ EG++L+   A    +   L D GA  +   AW +L
Sbjct  121   PYGT--HCLVDG--IRIAVGSGLATEGYTLISDRAI--DLTSKLKDLGATEIDDQAWNQL  174

Query  929   RIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLs  1108
             R+ QGRP PG ELTD++N LEA LW+ +S NKGCY GQETI+RL  Y+G+KQ LWGI+L+
Sbjct  175   RVEQGRPMPGTELTDDYNPLEAGLWHTISWNKGCYIGQETIARLDAYNGVKQNLWGIKLN  234

Query  1109  ssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
              +VEPG+ +S+  +KVGK+TSV  S       GL YIR KA
Sbjct  235   QAVEPGTVVSIADEKVGKITSVVDS------IGLAYIRTKA  269



>ref|WP_015160767.1| folate-binding protein YgfZ [Chamaesiphon minutus]
 ref|YP_007098171.1| folate-binding protein YgfZ [Chamaesiphon minutus PCC 6605]
 gb|AFY94644.1| folate-binding protein YgfZ [Chamaesiphon minutus PCC 6605]
Length=360

 Score =   258 bits (659),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 190/290 (66%), Gaps = 2/290 (1%)
 Frame = +2

Query  362   ATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIA  541
             AT  G A+ D SH+G+I VS  DR++FLHNQSTA+FE    G+GCDTVFVT TARTID+A
Sbjct  45    ATPTGAAIYDSSHWGKILVSDRDRLRFLHNQSTADFEKRQAGEGCDTVFVTSTARTIDLA  104

Query  542   HAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEG  721
                I+ + + L+ SP   + +   L KYIFF+D+V+++D++     F L+G  S  I+E 
Sbjct  105   TGLILDDEVLLIVSPNRRKYLFDWLDKYIFFADRVKVKDVTDSLASFTLMGAESAAILER  164

Query  722   LNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVP  901
             L    L  +   SH+ Y + G  V IA+G  +   G+ L+V  A A ++ +AL + GAV 
Sbjct  165   LGCLKLTERSQYSHELYQLEGIEVRIAIGTELGLPGYRLIVDRANAPALQQALANLGAVT  224

Query  902   MGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIK  1081
             +  +AWE LRI QGRP P  ELT+++N LE  LW+ +S +KGCY GQETI+RL TY G+K
Sbjct  225   VDEDAWECLRIAQGRPKPDAELTEDYNPLEVGLWDTISFSKGCYIGQETIARLNTYKGVK  284

Query  1082  QRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             Q LWGI+LS SV  G++I++  +KVG LTS +      +  GLGYIR KA
Sbjct  285   QYLWGIKLSGSVAVGTTITLGDEKVGVLTSCSEIDGEVR--GLGYIRSKA  332



>ref|WP_012362338.1| glycine cleavage system protein T [Cyanothece sp. ATCC 51142]
 ref|YP_001805487.1| aminomethyl transferase, glycine cleavage T protein [Cyanothece 
sp. ATCC 51142]
 gb|ACB53421.1| aminomethyl transferase, glycine cleavage T protein [Cyanothece 
sp. ATCC 51142]
Length=368

 Score =   257 bits (656),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 209/327 (64%), Gaps = 11/327 (3%)
 Frame = +2

Query  272   DLIDTMKVAGAKVLEGD-IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLH  448
             DL ++ K +GAK+LE D IIE++ ND +   +  + V + D SH+G ++++GEDR++FLH
Sbjct  16    DLRNSQKKSGAKLLENDNIIESFNNDSQGFKSAYDDVVICDRSHWGLLQLTGEDRLRFLH  75

Query  449   NQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYI  628
             NQ+T +   L  GQ CDTVFV  T RT+D+   ++ +++I L+ SP     +   + +YI
Sbjct  76    NQTTNDINRLQCGQLCDTVFVNSTGRTLDLVTTYVTEDSILLLVSPNRRRFLYEWMDRYI  135

Query  629   FFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYG--SHKHY---SVNGNPV  793
             F  DKVEI+DIS+Q   F ++G  +    + LN  D+  Q     S + Y   +V    +
Sbjct  136   FPMDKVEIRDISEQNAIFTIIGKEA---AKKLNQWDIAAQILSELSPRKYGLLTVEEKNI  192

Query  794   TIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTD  973
              I     ++  G++L+V    AK+VW+ +++ G +P+G   W++LRI QGRP P +ELT+
Sbjct  193   MIGYDTGLNLSGYTLIVPENLAKTVWETVINLGIIPIGDRVWQQLRIKQGRPYPDQELTE  252

Query  974   EFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKK  1153
             ++N LEA LW+++S +KGCY GQETI+RL TY G+KQRLWG++L+  V+ G+++ VD KK
Sbjct  253   DYNPLEAGLWSSISFDKGCYIGQETIARLNTYQGVKQRLWGVKLTQPVKAGNTVMVDDKK  312

Query  1154  VGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             VG LTS  S     +  GL Y++ KA 
Sbjct  313   VGILTS--SIQLEEECLGLAYVKTKAG  337



>ref|WP_009543843.1| glycine cleavage system protein T [Cyanothece sp. ATCC 51472]
Length=356

 Score =   256 bits (655),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 209/327 (64%), Gaps = 11/327 (3%)
 Frame = +2

Query  272   DLIDTMKVAGAKVLEGD-IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLH  448
             DL ++ K +GAK+LE D IIE++ ND +   +  + V + D SH+G ++++GEDR++FLH
Sbjct  4     DLRNSQKKSGAKLLENDNIIESFNNDSQGFKSAYDDVVICDRSHWGLLQLTGEDRLRFLH  63

Query  449   NQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYI  628
             NQ+T +   L  GQ CDTVFV  T RT+D+   ++ +++I L+ SP     +   + +YI
Sbjct  64    NQTTNDINRLQCGQLCDTVFVNSTGRTLDLVTTYVTEDSILLLVSPNRRRFLYEWMDRYI  123

Query  629   FFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYG--SHKHY---SVNGNPV  793
             F  DKVEI+DIS+Q   F ++G  +    + LN  D+  Q     S + Y   +V    +
Sbjct  124   FPMDKVEIRDISEQNAIFTIIGKEA---AKKLNQWDIAAQILSELSPRKYGLLTVEEKNI  180

Query  794   TIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTD  973
              I     ++  G++L+V    AK+VW+ +++ G +P+G   W++LRI QGRP P +ELT+
Sbjct  181   MIGYDTGLNLSGYTLIVPENLAKTVWETVINLGIIPIGDRVWQQLRIKQGRPYPDQELTE  240

Query  974   EFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKK  1153
             ++N LEA LW+++S +KGCY GQETI+RL TY G+KQRLWG++L+  V+ G+++ VD KK
Sbjct  241   DYNPLEAGLWSSISFDKGCYIGQETIARLNTYQGVKQRLWGVKLTQPVKAGNTVMVDDKK  300

Query  1154  VGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             VG LTS  S     +  GL Y++ KA 
Sbjct  301   VGILTS--SIQLEEECLGLAYVKTKAG  325



>ref|WP_007310805.1| glycine cleavage system protein T [Crocosphaera watsonii]
 gb|EHJ12689.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Crocosphaera watsonii WH 0003]
 emb|CCQ55070.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Crocosphaera watsonii WH 0005]
 emb|CCQ69157.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Crocosphaera watsonii WH 0402]
Length=353

 Score =   255 bits (652),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/328 (41%), Positives = 203/328 (62%), Gaps = 11/328 (3%)
 Frame = +2

Query  269   HDLIDTMKVAGAKVLEGD-IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFL  445
              +L +  K +GA + E + IIE++GND +   + +N V + D SH+G ++++G DR++FL
Sbjct  3     QELRELQKKSGAILTEDESIIESFGNDSQGFNSADNDVVICDRSHWGLLQLTGSDRLRFL  62

Query  446   HNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKY  625
             HNQ+T N   L  GQ  DTVFV  T RT+D+  A++ +++I L+ SP   + +   + +Y
Sbjct  63    HNQTTNNINSLQPGQLSDTVFVNSTGRTLDLVTAYVTEDSIFLLVSPNRQQFLYEWMDRY  122

Query  626   IFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPY-----GSHKHYSVNGNP  790
             IF  DKV I+DIS +   F ++G  +      LN GD+           +HK  ++N   
Sbjct  123   IFPMDKVGIKDISDKNAIFTIIGSEA---TTKLNQGDIANNAITELSPNNHKFVTINDEK  179

Query  791   VTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELT  970
             V I  G  +   G++L+V    AK+VW+ L + G +P+G   WE+LRI QGRP P +ELT
Sbjct  180   VLIGEGTGLKLPGYTLIVPENQAKTVWETLTNLGIIPVGDRVWEQLRIKQGRPYPDQELT  239

Query  971   DEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGK  1150
             + +N LE  LW+ +S +KGCY GQETI+RL TY G+KQRLWG++L+  V+ G+++++D K
Sbjct  240   ENYNPLETGLWSTISFDKGCYIGQETIARLNTYQGVKQRLWGVKLNQEVKAGNTVTLDDK  299

Query  1151  KVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             KVG LTS     D  +  GL Y+R KA 
Sbjct  300   KVGILTSSIQIED--EYIGLAYVRTKAG  325



>ref|WP_026072278.1| glycine cleavage system protein T [Nodosilinea nodulosa]
Length=350

 Score =   255 bits (651),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 192/297 (65%), Gaps = 2/297 (1%)
 Frame = +2

Query  341   NDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPT  520
             N   AL A   G A+VD SH+G I++ G DR++F+HNQ+T  F     G+GCDT+FVT T
Sbjct  25    NTAAALEALSKGAALVDRSHWGVIQMDGGDRLRFIHNQTTNTFTQRQPGEGCDTIFVTST  84

Query  521   ARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPR  700
             ARTID++  ++ + ++ ++TSP   +R+ + + +YIF +D+V + +++ +   F L+G  
Sbjct  85    ARTIDLSTIYVTEESLLILTSPGQDQRLINWMDRYIFPADQVSLANLTGEMAVFSLIGAG  144

Query  701   SNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKAL  880
             S  I++ L +      PY  H+ +S+    + +AVG  ++  G++LL+    A SVW  L
Sbjct  145   SADILKKLGISVDSNLPYAHHQSFSLGDVSLRLAVGCGLALPGYTLLLPMEAADSVWLRL  204

Query  881   VDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRL  1060
                GAVP G + W++LR+ QGRPAP  ELT+++N LEA LW A+S +KGCY GQETI+RL
Sbjct  205   THGGAVPAGESLWQQLRVQQGRPAPDHELTEDYNPLEAGLWQAISFDKGCYIGQETIARL  264

Query  1061  VTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
              TY G+KQ+LWGI+LS    PG+ +    +KVG LTS   +   + P GLGYIR KA
Sbjct  265   NTYQGVKQQLWGIQLSQLASPGALLYAADEKVGLLTSAVDT--PNGPLGLGYIRTKA  319



>ref|WP_007305555.1| glycine cleavage system protein T [Crocosphaera watsonii]
 gb|EAM50808.1| Glycine cleavage T protein (aminomethyl transferase) [Crocosphaera 
watsonii WH 8501]
 emb|CCQ62441.1| Folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Crocosphaera watsonii WH 0401]
Length=353

 Score =   253 bits (647),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/328 (41%), Positives = 202/328 (62%), Gaps = 11/328 (3%)
 Frame = +2

Query  269   HDLIDTMKVAGAKVLEGD-IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFL  445
              +L +  K +GA + E + IIE++GND +   + +N V + D SH+G ++++G DR++FL
Sbjct  3     QELRELQKKSGAILTEDESIIESFGNDSQGFNSADNDVVICDRSHWGLLQLTGSDRLRFL  62

Query  446   HNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKY  625
             HNQ+T N   L  GQ  DTVFV  T RT+D+  A++ +++I L+ SP   + +   + +Y
Sbjct  63    HNQTTNNINSLQPGQLSDTVFVNSTGRTLDLVTAYVTEDSIFLLVSPNRQQFLYEWMDRY  122

Query  626   IFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPY-----GSHKHYSVNGNP  790
             IF  DKV I+DIS +   F ++G  +      LN GD+           +HK  ++N   
Sbjct  123   IFPMDKVGIKDISDKNAIFTIIGSEA---TTKLNQGDIANNAITELSPNNHKFVTINDEK  179

Query  791   VTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELT  970
             V I  G  +   G++L+     AK+VW+ L + G +P+G   WE+LRI QGRP P +ELT
Sbjct  180   VLIGEGTGLKLPGYTLIFPENQAKTVWETLTNLGIIPVGDRVWEQLRIKQGRPYPDQELT  239

Query  971   DEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGK  1150
             + +N LE  LW+ +S +KGCY GQETI+RL TY G+KQRLWG++L+  V+ G+++++D K
Sbjct  240   ENYNPLETGLWSTISFDKGCYIGQETIARLNTYQGVKQRLWGVKLNQEVKAGNTVTLDDK  299

Query  1151  KVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             KVG LTS     D  +  GL Y+R KA 
Sbjct  300   KVGILTSSIQIED--EYIGLAYVRTKAG  325



>ref|WP_012627976.1| glycine cleavage system protein T [Cyanothece sp. PCC 7425]
 ref|YP_002483264.1| folate-binding protein YgfZ [Cyanothece sp. PCC 7425]
 gb|ACL44903.1| folate-binding protein YgfZ [Cyanothece sp. PCC 7425]
Length=325

 Score =   251 bits (641),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 136/319 (43%), Positives = 203/319 (64%), Gaps = 3/319 (1%)
 Frame = +2

Query  362   ATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIA  541
             A   GVA+ D + +GRI+V+  DR+ FLHNQST  F++L  GQGCDTV V  TART+D+ 
Sbjct  9     AAHTGVALYDCTPWGRIQVTNSDRLAFLHNQSTNEFKLLKPGQGCDTVIVNSTARTLDLV  68

Query  542   HAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEG  721
              A++ ++A+ L+ SP+  + +   L +YIFF DKV++ DI+  T  F L+GP+S+ ++  
Sbjct  69    TAYVTEDAVILLVSPQKRDFLLKWLDRYIFFGDKVKLTDITAVTAAFSLIGPQSSALLTE  128

Query  722   LNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVP  901
             L +       YG H    + G PV + +G+ ++  G++LL     A ++   L+  GA+ 
Sbjct  129   LGVETSTLGRYGDHLLCELAGMPVRVVLGSGLALPGYTLLTDAEHAGNLNDQLIAAGAIS  188

Query  902   MGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIK  1081
             +   AW++LR+ QGRP    ELT+++N LEA LW+ +S NKGCY GQETI+RL TY G+K
Sbjct  189   LDETAWQQLRLHQGRPQADAELTEDYNPLEAGLWHTISFNKGCYIGQETIARLNTYQGVK  248

Query  1082  QRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviig  1261
             Q+LWGI+LS+ V  G++I+ +G K+G LTS   + +   PFGLGY++ KA       +  
Sbjct  249   QQLWGIQLSTLVAAGTTITQEGNKIGLLTSAILTPE--GPFGLGYVKTKAGG-AGLAVEI  305

Query  1262  dgvvgtvvevPFLGRQLPP  1318
                 G +VEVPFL R + P
Sbjct  306   GDATGELVEVPFLTRGIAP  324



>ref|WP_015136124.1| folate-binding protein YgfZ [Leptolyngbya sp. PCC 7376]
 ref|YP_007073244.1| folate-binding protein YgfZ [Leptolyngbya sp. PCC 7376]
 gb|AFY40410.1| folate-binding protein YgfZ [Leptolyngbya sp. PCC 7376]
Length=348

 Score =   251 bits (641),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 188/305 (62%), Gaps = 4/305 (1%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
             G+ + ++G DD+   A + G  V D SH+G I+ +G DR ++LHNQST   + L  GQ C
Sbjct  19    GNAVLSFGADDQITAALKTGCVVGDRSHWGLIKFTGADRQRYLHNQSTNQIQQLQPGQSC  78

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             DTV V  TARTID+A   I K+ + +  SP  +E +     +++F  DKVEI DI+ Q  
Sbjct  79    DTVLVNSTARTIDLATVHIFKDELWVSVSPSKTEFLMEWFDRFLFPMDKVEISDITGQFS  138

Query  677   FFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
                L G  S + +E L    L   P   H+  ++    +  A G  +  EGF+L V    
Sbjct  139   ILTLYGSESRKTLEQLTETPLQIFPDKGHQAIAIGEAEIICATGTDLGFEGFTLFVPIEN  198

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
             A  +W+ ++D GAVPMG  AWE+ RI QGRPAP  EL D++N LEA LW+ +S +KGCY 
Sbjct  199   AVELWQKIIDLGAVPMGETAWEKQRIHQGRPAPDTELADDYNPLEAGLWHCISFDKGCYI  258

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQRL+G++L+ +VEPG+ ++VDG++ G +TSV    D    F +GY
Sbjct  259   GQETIARLNTYKGVKQRLFGLKLAEAVEPGTKLTVDGERAGIVTSV----DAENKFAIGY  314

Query  1217  IRKKA  1231
             +R K+
Sbjct  315   VRTKS  319



>ref|WP_018397151.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=346

 Score =   250 bits (638),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 192/306 (63%), Gaps = 6/306 (2%)
 Frame = +2

Query  314   EGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQG  493
             +  I +++GND +A  A E    + D SH+G + ++  DR+QFLHNQ+T + + L  GQ 
Sbjct  19    DSTIPQSFGNDAQAFAAAETEAILCDRSHWGLLEITDSDRLQFLHNQTTNDLKTLQPGQS  78

Query  494   CDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQT  673
             C TVFV  TART+D+A A++   ++ L+ SP  +E +   L +Y+F  D+V+I+++S + 
Sbjct  79    CPTVFVNSTARTLDLAIAYVTAESVLLLLSPGQAEPLMQWLDRYLFPMDRVKIRNLSAEF  138

Query  674   CFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPA  853
               F L+GP+S+QI++  NL      P  +H       + + +A  + ++  G++L+   +
Sbjct  139   ACFTLIGPKSDQILQKANLTP----PEANHHLIPFQDSQIRLATDSGLALPGYTLIAPQS  194

Query  854   TAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCY  1033
              A  +W  L   GA+P G   WE+ RI QGRP P +ELT+++N LEA L  A+S +KGCY
Sbjct  195   HAAELWSTLHQAGAMPAGETVWEQRRIQQGRPRPHQELTEDYNPLEAGLIPAISFDKGCY  254

Query  1034  KGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLG  1213
              GQETI+RL TY G+KQRLWG+RL + V+P + + +D KKVG LTS+  + D     GL 
Sbjct  255   IGQETIARLNTYQGVKQRLWGVRLDTLVDPETPVMLDNKKVGILTSIAETPDGI--LGLA  312

Query  1214  YIRKKA  1231
             YIR KA
Sbjct  313   YIRTKA  318



>ref|WP_024544410.1| glycine cleavage system protein T [Synechococcus sp. NKBG15041c]
Length=349

 Score =   249 bits (637),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 181/306 (59%), Gaps = 4/306 (1%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
             G+ I  +GN+ E   A  +G  V D SH+G ++ +G DR ++LHNQST   + L  GQ C
Sbjct  19    GEAIALFGNEAEIKAALTHGCVVHDQSHWGLLKFTGGDRQRYLHNQSTNQIQQLQPGQSC  78

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             DTV V  TART+D+A   +++ A+ +  SP+    +     +++F  DKVEI D+S Q  
Sbjct  79    DTVLVNSTARTLDLATVHVLEEALWIQVSPQKKAFLLEWFDRFLFPLDKVEISDLSGQFN  138

Query  677   FFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
                L+GP +  I+E L    L   P G H+   +NG  +  A GN +   G++L V    
Sbjct  139   VLSLIGPAAETILEKLTGKTLASFPAGGHQRIEINGQTILCATGNSLKLPGYTLYVPTEA  198

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
                +W+AL   G +P G  AWE+LRI QGRP P  ELT+++N LEA LW+ +S +KGCY 
Sbjct  199   GVEIWQALTSLGVLPCGEEAWEQLRIHQGRPVPDHELTEDYNPLEAGLWDCISFDKGCYI  258

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQRL+GI+LS+ V     I V  ++ G LTS+    D    F LGY
Sbjct  259   GQETIARLNTYRGVKQRLFGIQLSAPVAVPCKIFVGEERAGVLTSI----DPETAFALGY  314

Query  1217  IRKKAA  1234
             IR K+ 
Sbjct  315   IRTKSG  320



>ref|WP_008310568.1| folate-binding protein YgfZ [Leptolyngbya sp. PCC 6406]
Length=356

 Score =   249 bits (635),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 189/299 (63%), Gaps = 2/299 (1%)
 Frame = +2

Query  332   TYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             +YGNDD A  A  +GVA+VD SH+GR+RVS  D ++FLHNQ+T   + L  G  CDTVFV
Sbjct  27    SYGNDDAAYGAARSGVALVDRSHWGRLRVSDRDHLRFLHNQTTNQLQTLQAGHQCDTVFV  86

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             TPT RT+D+A A++   A+ L+ SP  +  +   + +Y+FF+DKV++ D ++ T    L+
Sbjct  87    TPTGRTLDLATAYVDDGAVVLLVSPGQAAALLEWMDRYVFFADKVQLTDETETTVTLTLI  146

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             GP S  +++GL L          H      G    +A G+ +   G++L  + A A  +W
Sbjct  147   GPESANLLQGLGLSTQALPAAQRHILVDCQGISCRLAAGSGLGLPGYTLTAAAAEAAPLW  206

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
              AL+  GA+P+G   WE+LR+ QGRP  G ELT ++N LEA LW AVS +KGCY GQETI
Sbjct  207   SALIAGGAIPLGEKRWEQLRLEQGRPIAGAELTADYNPLEAGLWAAVSFDKGCYIGQETI  266

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             +RL TY G+KQ+LWG+ LS  V  G+ I+  G + G+LTSV ++    +  GLGY+R K
Sbjct  267   ARLQTYQGVKQQLWGLSLSDLVPSGTEITHGGVRAGRLTSVMATPTGVR--GLGYLRTK  323



>ref|WP_012306707.1| glycine cleavage system protein T [Synechococcus sp. PCC 7002]
 ref|YP_001734340.1| glycine cleavage T-protein (aminomethyltransferase) [Synechococcus 
sp. PCC 7002]
 gb|ACA99084.1| glycine cleavage T-protein (aminomethyltransferase) [Synechococcus 
sp. PCC 7002]
Length=352

 Score =   246 bits (627),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 183/304 (60%), Gaps = 4/304 (1%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
             G+ + T+GND +      NG  + D SH+G +  +G DR ++LHNQST   + L  GQ C
Sbjct  23    GEAVVTFGNDADISQDFSNGCLLYDQSHWGLLNFTGADRQRYLHNQSTNQIQQLQSGQSC  82

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             DTV V  TARTID+A   I+ +A+ +  SP+    +     +++F  DKVEI D+S Q  
Sbjct  83    DTVLVNSTARTIDLATVHILDDALWVQVSPQKKTFLLEWFDRFLFPMDKVEISDLSGQFN  142

Query  677   FFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
                L+G ++ +I+E L    L   P G H+   + G  +  A GN +   G++L +    
Sbjct  143   ILSLMGVQAKEILEKLTGVTLADFPAGGHQFLEIQGQNILCATGNSLKLPGYTLYIPAEA  202

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
                +W+AL++ G +P G  AWE+LRI QGRPAP +ELT+++N LEA LW+ +S +KGCY 
Sbjct  203   GVEIWQALMNLGMIPCGEAAWEKLRIHQGRPAPDQELTEDYNPLEAGLWDCISFDKGCYI  262

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQRL+GI+LS+ V     I V  ++ G +TS+    D    F LGY
Sbjct  263   GQETIARLNTYKGVKQRLFGIQLSAPVAVPCKIFVGEERAGVITSI----DPDNTFALGY  318

Query  1217  IRKK  1228
             +R K
Sbjct  319   VRTK  322



>ref|WP_038026794.1| glycine cleavage system protein T [Synechococcus sp. PCC 7336]
Length=350

 Score =   244 bits (623),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 192/313 (61%), Gaps = 8/313 (3%)
 Frame = +2

Query  290   KVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANF  469
             +VAG +V  G     +GND  AL A   G A++D SH+  + ++G DR+ +LHNQ+T N 
Sbjct  14    EVAGQQVAIG-----FGNDLAALQAAREGTALLDYSHWTLLEMTGPDRLDYLHNQTTYNI  68

Query  470   EILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVE  649
             + L  G GC+T  VTPTAR ID+  A+I   ++ L  SP     + + L + + FS+   
Sbjct  69    KALQPGSGCETCIVTPTARLIDLVTAYITPESVLLCASPRQDPAVFNCLNRLLPFSN-AR  127

Query  650   IQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEG  829
             + D+  +    VL+GP S+ ++E L L         SH         + IAVG  ++  G
Sbjct  128   LVDVGDRYTPLVLIGPHSSTVLESLGLAPPTDTSQHSHHLIPFGETDIRIAVGCGLALPG  187

Query  830   FSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNA  1009
              +LLV   +A  +W++L   GA+PMGS+ WE LRI QGRP P +ELT+++N LEA LW+A
Sbjct  188   HTLLVPTHSAPELWQSLAQAGAIPMGSHTWERLRIEQGRPLPDRELTEDYNPLEAGLWHA  247

Query  1010  VSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGD  1189
             VS +KGCY GQETI+RL TY+G+KQ+LWGI L   VEPG++I+  G + GKLTS+T +  
Sbjct  248   VSFDKGCYIGQETIARLDTYNGVKQQLWGIELGDRVEPGTTITYRGDRAGKLTSITPTDT  307

Query  1190  TSKPFGLGYIRKK  1228
               +  GL Y+R K
Sbjct  308   GYR--GLAYLRTK  318



>dbj|BAP16955.1| aminomethyl transferase, glycine cleavage T protein [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=349

 Score =   244 bits (622),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 190/306 (62%), Gaps = 8/306 (3%)
 Frame = +2

Query  326   IETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTV  505
             I ++GND E      +   + D SH+G ++++G+DR++FLHNQ+T N   L  G  CDTV
Sbjct  23    IGSFGNDSEGFETAYSKAVIYDRSHWGLLKLTGDDRLRFLHNQTTNNINKLKPGLACDTV  82

Query  506   FVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFV  685
             F+  T R ID+   ++  ++I ++ SP     +   + +YIF  DKV+I D+S Q   F 
Sbjct  83    FINSTGRIIDLVTVYVTNDSILILVSPNRRHFLMEWIDRYIFPMDKVKITDVSDQNIVFT  142

Query  686   LVGPRSNQIVE--GLN-LGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
             L+G      ++  G+N L +L+ +   SH   ++    + IAVG+ ++  G++L+V    
Sbjct  143   LIGSECTSFLKKGGINGLAELLPE---SHCLTAIGEASMRIAVGSGLAIPGYTLIVPINQ  199

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
             AK+VW+ L+  G +P+G   WE+LRI QGRP   KELT+++N LEA LW A+S  KGCY 
Sbjct  200   AKTVWEQLIQLGIIPIGDRVWEQLRIRQGRPLFDKELTEDYNPLEAGLWRAISFEKGCYI  259

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQRLWG++LS  + PG+ + +DGKKVG LTS T    +   FGL Y
Sbjct  260   GQETIARLNTYKGVKQRLWGVKLSQEIIPGTPVILDGKKVGILTSCTEINQSF--FGLAY  317

Query  1217  IRKKAA  1234
             I  KA 
Sbjct  318   ISTKAG  323



>ref|WP_017303017.1| hypothetical protein [Spirulina subsalsa]
Length=351

 Score =   243 bits (620),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/301 (45%), Positives = 190/301 (63%), Gaps = 4/301 (1%)
 Frame = +2

Query  338   GNDDEALTA--TENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFV  511
             GND EA  +  + +GV +   +  G + +S +D  QFLHNQST   + L  G GC TVFV
Sbjct  24    GNDSEAYLSIISGSGVWMYLPAQNGLLELSDQDCRQFLHNQSTNQIQTLKPGAGCQTVFV  83

Query  512   TPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLV  691
             T TART+D+A  ++ +N++  + SP   E +   L +Y+F  D+V+IQDIS +   F L 
Sbjct  84    TSTARTLDLATVYVTENSVLTLVSPSQRENLLLWLDRYLFPMDRVKIQDISAEFAVFRLF  143

Query  692   GPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G  + + ++ L L  L GQP  SH  +++ G  V +AVGN +   G++L+V  A   S+ 
Sbjct  144   GVFNEEKIKTLGLEALQGQPEASHGVFNLGGVEVRVAVGNGLGLPGYTLIVPQAHVASLG  203

Query  872   KALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETI  1051
             + L D G  P+G   WE+LRI QG PAP  ELT+++N LEA LW A+S NKGCY GQETI
Sbjct  204   ETLRDLGIQPVGEQVWEQLRIRQGCPAPELELTEDYNPLEAGLWGAISFNKGCYIGQETI  263

Query  1052  SRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             +RL TY G+KQRLWG++L+  V PG ++ V  +K+G LTS TS+ D    +GL YI+ KA
Sbjct  264   ARLNTYQGVKQRLWGVKLNQGVSPGQAVKVGEQKIGVLTSCTSTPD--GIWGLAYIKTKA  321

Query  1232  A  1234
              
Sbjct  322   G  322



>ref|WP_015219755.1| folate-binding protein YgfZ [Cyanobacterium aponinum]
 ref|YP_007162074.1| folate-binding protein YgfZ [Cyanobacterium aponinum PCC 10605]
 gb|AFZ54030.1| folate-binding protein YgfZ [Cyanobacterium aponinum PCC 10605]
Length=380

 Score =   244 bits (622),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 210/331 (63%), Gaps = 9/331 (3%)
 Frame = +2

Query  263   IDHDLIDTMK----VAGAKVLEG-DIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGE  427
             +DH++++ +K     +GA   E  ++  T+ N + +L+  E+ + + D S +G ++V+G 
Sbjct  25    LDHNIMNKLKELQIQSGAVFAENLEVPLTFNNQNFSLSQWEDNIFLCDRSDWGLLKVTGC  84

Query  428   DRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERIT  607
             DR++FLHNQST + + L  GQGCDTVFV  T R ID+   +  +  + L+TSP  ++++ 
Sbjct  85    DRLRFLHNQSTNDIQSLKSGQGCDTVFVNSTGRNIDLVSVYFKEEEVLLLTSPNQNQKLY  144

Query  608   SMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGN  787
               + +YIF  DKVE++DIS     F + G  S +++      +++ +P   H++ +++G 
Sbjct  145   QWMDRYIFPFDKVELKDISSDYKIFTIFGNNSQELLSNWVDKEILEKPEFYHQNLTIDGI  204

Query  788   PVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKEL  967
              + + VG  +  +G++L+V+   A  +W+ L++     +GS  WE LR+++GRPAP KEL
Sbjct  205   EILLTVGCNLKIKGYNLIVNQDQADIIWQKLIEKKPKLIGSKEWEILRVLRGRPAPEKEL  264

Query  968   TDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisV--  1141
             T++FN LE  LW+++S +KGCY GQETI+RL TY G+KQRLWGI+L+  + P    ++  
Sbjct  265   TEDFNPLETGLWDSISFSKGCYIGQETIARLNTYKGVKQRLWGIKLNQEINPDIENTIFL  324

Query  1142  DGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
               +K+G++TS  +    ++PF LGYIR KA 
Sbjct  325   GEEKIGRITSFINY--ENEPFALGYIRTKAG  353



>ref|WP_015229451.1| folate-binding protein YgfZ [Dactylococcopsis salina]
 ref|YP_007171811.1| folate-binding protein YgfZ [Dactylococcopsis salina PCC 8305]
 gb|AFZ50454.1| folate-binding protein YgfZ [Dactylococcopsis salina PCC 8305]
Length=321

 Score =   236 bits (601),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 185/285 (65%), Gaps = 2/285 (1%)
 Frame = +2

Query  377   VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIM  556
             VA+     YG I+++GED +QFLHNQ+T   + L   QGC TVFV  T RT+D+A  ++ 
Sbjct  15    VALYQYPDYGVIQLTGEDCLQFLHNQTTNEVKSLKPQQGCHTVFVNSTGRTLDLATVYVT  74

Query  557   KNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD  736
             +  + L+ SP+ +E + S L +Y+F  D+V ++++S+    F + G +S  + + L +  
Sbjct  75    EEKVLLLVSPQRTEFLMSWLDRYLFPMDRVTLKNVSEDYTVFTIAGEKSEAMGKQLGITI  134

Query  737   LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNA  916
                QP+ +H+  +++   V IAVG  I+  G++LLVS   ++ + + L + GA  +  +A
Sbjct  135   NWEQPFATHEKITIDAVSVRIAVGTEIALPGYTLLVSSEHSEHLKQILTNLGAASIEQSA  194

Query  917   WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWG  1096
             WEEL + QGRP P  ELT++ N LEA LWNA+S +KGCY GQETI+RL TY G+KQRLWG
Sbjct  195   WEELTLEQGRPLPDSELTEDHNPLEAGLWNAISFDKGCYIGQETIARLNTYQGVKQRLWG  254

Query  1097  IRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             I+LS  V+  + I+++GKKVGKLT +  + +  K  GL YIR KA
Sbjct  255   IKLSQPVDLETPITLEGKKVGKLTRLLETDEGIK--GLAYIRTKA  297



>ref|WP_015125707.1| folate-binding protein YgfZ [Synechococcus sp. PCC 6312]
 ref|YP_007062709.1| folate-binding protein YgfZ [Synechococcus sp. PCC 6312]
 gb|AFY62166.1| folate-binding protein YgfZ [Synechococcus sp. PCC 6312]
Length=325

 Score =   235 bits (599),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/296 (46%), Positives = 182/296 (61%), Gaps = 16/296 (5%)
 Frame = +2

Query  380   AVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK  559
             A  D SH+GRI + G DR++FLHNQS+ +  +L  GQGCDTV +T TART+D+  AW+  
Sbjct  9     ACYDCSHWGRILLRGADRLRFLHNQSSNHLNLLKPGQGCDTVILTSTARTLDLVTAWVRS  68

Query  560   NAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVE--GLNLG  733
             + I L+ SP+  E +   L KYIFF D+VE+QDI+  T  +  +G    QI    GL+L 
Sbjct  69    DDILLLVSPQRREPLQKWLDKYIFFGDQVELQDITPTTSCWRFLGTDCEQIFRNLGLDLS  128

Query  734   DLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVS-----PATAKSVWKALVDYGAV  898
             DL  Q  G H+ Y +   PV I+ G+ ++  G +L V      P  A+     L     +
Sbjct  129   DL--QQLGDHRQYHIADCPVEISFGSGLALPGLTLTVPIEYRLPVMAQI---KLAQPELM  183

Query  899   PMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGI  1078
              +    WE LRI+QGRPA   ELT+++N LEA L   +SL+KGCY GQETI+RL TY G+
Sbjct  184   ELSETDWEHLRILQGRPAVDAELTEDYNPLEARLDYTISLDKGCYIGQETIARLNTYQGV  243

Query  1079  KQRLWGIRLsssvepgssisVDGKKVGKLTSVTS----SGDTSKPFGLGYIRKKAA  1234
             KQ+LWG+ L+  VEPG+ + ++G KVG LTS TS        SK FGLGYI+ KA 
Sbjct  244   KQQLWGLALTDDVEPGTPLRLEGTKVGVLTSCTSLDHPLDHQSKAFGLGYIKTKAG  299



>ref|WP_004161589.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCI17456.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9807]
Length=337

 Score =   235 bits (600),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 195/321 (61%), Gaps = 18/321 (6%)
 Frame = +2

Query  278   IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQS  457
             +DT+K   A     + ++ Y ND ++L +      ++D SH+G + + G+DR++FLHNQ+
Sbjct  5     LDTIKAEYA----ANFLKDYSNDPQSLASQ---TILIDRSHWGLLELKGQDRLRFLHNQT  57

Query  458   TANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
             +   + L  GQGC+T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  
Sbjct  58    SNAIDRLKPGQGCETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPF  117

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGN  811
             DKVEI D++     F ++G +S Q ++ + + +  L G     H HY ++  P+ +AVG 
Sbjct  118   DKVEISDLTDNFSIFTIIGTKSGQKLQKIAIPEQILTGV---QHSHYLLSEPPLRVAVGT  174

Query  812   IISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLE  991
              +   G++L+V+ A A S+W+ L+  G  P     WE LRI QGRPA  +ELT+++N LE
Sbjct  175   GLDLPGYTLIVAAAEAGSLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLE  234

Query  992   ANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTS  1171
             A LW A   +KGCY GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTS
Sbjct  235   AGLWRATVFDKGCYIGQETIARLNTYKGVKQRLWGIKLSQPVPNNTPIILEAQKVGLLTS  294

Query  1172  VTSSGDTSKPFGLGYIRKKAA  1234
             V         FGLGY++ KA 
Sbjct  295   VLED------FGLGYVKTKAG  309



>ref|WP_015226702.1| folate-binding protein YgfZ [Halothece sp. PCC 7418]
 ref|YP_007169043.1| folate-binding protein YgfZ [Halothece sp. PCC 7418]
 gb|AFZ44829.1| folate-binding protein YgfZ [Halothece sp. PCC 7418]
Length=323

 Score =   234 bits (596),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 185/287 (64%), Gaps = 2/287 (1%)
 Frame = +2

Query  371   NGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAW  550
             N V +   SH G I ++GEDR+QFLHNQ+T + + L  GQGC+ VFV  T RT+D+A  +
Sbjct  13    NNVGLYPHSHSGIIELTGEDRLQFLHNQTTNDIKNLKAGQGCEAVFVNSTGRTLDLATVY  72

Query  551   IMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNL  730
             + +  I L+ S   ++ +   + +Y+F  D+V ++++S+      L+G +S  ++E L  
Sbjct  73    VTEEKIFLLVSAARTQFLMEWMDRYLFPMDRVSLKNVSEVYSVSSLMGEKSPALMEQLGA  132

Query  731   GDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGS  910
                + QP+ +H+  ++N  PV +AVG  ++  G++L+V+      + + L + GAV +  
Sbjct  133   TINLDQPFATHEMTTINEIPVRVAVGTELAIVGYTLIVASEQGSVLQETLTEAGAVMISE  192

Query  911   NAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRL  1090
               W+EL + QGRP P  ELT+++N LEA LW A+S +KGCY GQETI+RL TY G+KQRL
Sbjct  193   AVWDELSLEQGRPLPDYELTEDYNPLEAGLWKAISFDKGCYIGQETIARLHTYQGVKQRL  252

Query  1091  WGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             WG+ LS  V+P + I++DGKKVGKLT +  + D  K  GLGYIR KA
Sbjct  253   WGLHLSQPVDPETPITLDGKKVGKLTRLLETEDGVK--GLGYIRTKA  297



>ref|WP_002743672.1| aminomethyltransferase folate-binding domain protein [Microcystis 
aeruginosa]
 emb|CAO87544.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS48036.1| aminomethyltransferase folate-binding domain protein [Microcystis 
aeruginosa DIANCHI905]
Length=337

 Score =   233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 194/321 (60%), Gaps = 18/321 (6%)
 Frame = +2

Query  278   IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQS  457
             +DT+K   A     + ++ Y ND ++L +      ++D SH+G + + G+DR++FLHNQ+
Sbjct  5     LDTIKAEYA----ANFLKDYHNDPQSLASP---TILIDRSHWGLLELKGQDRLRFLHNQT  57

Query  458   TANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
             +   + L  GQGC+T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  
Sbjct  58    SNAIDRLKPGQGCETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPF  117

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGN  811
             DKVEI D++     F L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG 
Sbjct  118   DKVEISDLTDNFSIFTLIGTESGQYLQKIAVPEQILTGV---QHSHYLLSDPPLRVAVGT  174

Query  812   IISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLE  991
              +   G++L+V+ + A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LE
Sbjct  175   GLDIPGYTLIVAASEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLE  234

Query  992   ANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTS  1171
             A LW A+  +KGCY GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTS
Sbjct  235   AGLWRAIVFDKGCYIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTS  294

Query  1172  VTSSGDTSKPFGLGYIRKKAA  1234
             V         FGLGY++ KA 
Sbjct  295   VLED------FGLGYVKTKAG  309



>ref|WP_006507326.1| folate-binding protein YgfZ [Xenococcus sp. PCC 7305]
 gb|ELS05580.1| folate-binding protein YgfZ [Xenococcus sp. PCC 7305]
Length=331

 Score =   232 bits (592),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/296 (40%), Positives = 184/296 (62%), Gaps = 13/296 (4%)
 Frame = +2

Query  377   VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIM  556
             V + D S++G ++++GEDR+ +LHNQST +F  L  G GC+TVFVTPTARTID+A  ++ 
Sbjct  6     VVICDRSNWGLLQITGEDRLNYLHNQSTNDFNSLQPGGGCETVFVTPTARTIDLATTYVT  65

Query  557   KNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD  736
             ++A+  + +P   + +   L K+IF  D+VE+ D+S       L+G  S++I+  L + +
Sbjct  66    EDAVLAIVAPNRRKYLLEWLDKFIFPFDRVEVTDVSSDYALLTLIGTDSDRILSELGVNN  125

Query  737   LVG-QPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSN  913
             L   +PY +H+  S++G  V + VG+ ++  G++++V    A  +   +       +G  
Sbjct  126   LPELKPY-NHQLISLDGTTVRLGVGSDLALPGYNIIVPREQAAKIRDLITAQQVREIGDR  184

Query  914   AWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLW  1093
              WEELRI+QGRPAP KELT+++N LEA LW  +S  KGCY GQETI+RL TY+G+KQ+LW
Sbjct  185   EWEELRILQGRPAPDKELTEDYNPLEAGLWQTISFEKGCYIGQETIARLNTYNGVKQKLW  244

Query  1094  GIRLsssvepgssi---------sVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             G++ + S     +          +++ KKVG LTS   +    KPF L Y+R KA 
Sbjct  245   GVKFADSDLQAMTEDSLAMGTPITLEDKKVGVLTSFAIA--NQKPFALAYVRTKAG  298



>ref|WP_002768189.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCI02486.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9443]
Length=337

 Score =   232 bits (592),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 194/321 (60%), Gaps = 18/321 (6%)
 Frame = +2

Query  278   IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQS  457
             +DT+K   A     + ++ YGND ++L +      ++D S +G + + G+DR++FLHNQ+
Sbjct  5     LDTIKAEYA----ANFLKDYGNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQT  57

Query  458   TANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
             +   + L  GQGC+T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  
Sbjct  58    SNAIDRLKPGQGCETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPF  117

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGN  811
             DKVEI D++       L+G +S Q ++ + + +  L G     H HY ++  P+ +AVG 
Sbjct  118   DKVEISDLTDNFSIVTLIGTKSRQYLQKIAIPEQILTGV---EHSHYLLSEPPLRVAVGT  174

Query  812   IISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLE  991
              +   G++L+V+ A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LE
Sbjct  175   GLDLPGYTLIVAAAEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLE  234

Query  992   ANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTS  1171
             A LW A+  +KGCY GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTS
Sbjct  235   AGLWRAIVFDKGCYIGQETIARLNTYKGVKQRLWGIKLSQPVPNNTPIILEAQKVGLLTS  294

Query  1172  VTSSGDTSKPFGLGYIRKKAA  1234
             V         FGLGY++ KA 
Sbjct  295   VLED------FGLGYVKTKAG  309



>ref|XP_002949337.1| hypothetical protein VOLCADRAFT_89696 [Volvox carteri f. nagariensis]
 gb|EFJ49830.1| hypothetical protein VOLCADRAFT_89696 [Volvox carteri f. nagariensis]
Length=475

 Score =   236 bits (603),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 137/335 (41%), Positives = 195/335 (58%), Gaps = 7/335 (2%)
 Frame = +2

Query  242   FDLSPPPIDHDLIDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVS  421
               L  P ID D+       GA   +  +  T+G   +AL A E G+ +VD SH+GR+RV+
Sbjct  35    LQLDIPEIDGDIRSLQVEMGAIFNDSGLAATFGRKRQALQALETGLVLVDQSHWGRLRVT  94

Query  422   GEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITL-VTSPETSE  598
             GEDR   LHNQSTA+F+ L  GQ  DT FVT TAR +D+A A ++ ++I L V S E  E
Sbjct  95    GEDRTALLHNQSTADFQRLQPGQCADTTFVTSTARCLDLATALVLPSSILLLVDSREGGE  154

Query  599   RITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLN---LGDLVGQPYGSHKH  769
              + + L K IF  D V + DIS +T    ++GP +  ++  L    L  ++  P G H  
Sbjct  155   ALAARLDKVIFRGDNVMVHDISSRTGQIAVLGPEAEVVLRELAPDVLSGVLSGPPGRHVL  214

Query  770   YSVNGNPVTIAV--GNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQG  943
                 G PV +A   G  +S  G++L+   A A  ++ A    GA+PMG++ WE  RI+ G
Sbjct  215   VGFRGKPVFVAAVSGLGLSVPGYTLVADEAVAGDLYAAFAAKGAIPMGTDDWEAARIVAG  274

Query  944   RPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvep  1123
             RP  G ELT+ ++ LEA L+ AVSLNKGCY GQET+++L   DG+ ++LWG+RLS    P
Sbjct  275   RPTRGSELTEAYSPLEAGLYGAVSLNKGCYIGQETLAKLHLRDGVNRQLWGLRLSGPTSP  334

Query  1124  gssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             G+ I  +  KVG +TS     D  +  G+GY+R +
Sbjct  335   GAEIYSELSKVGVVTSTCQDAD-GEWVGVGYLRSR  368



>ref|WP_012266361.1| glycine cleavage system protein T [Microcystis aeruginosa]
 ref|YP_001658505.1| aminomethyltransferase [Microcystis aeruginosa NIES-843]
 dbj|BAG03313.1| aminomethyltransferase [Microcystis aeruginosa NIES-843]
Length=337

 Score =   232 bits (591),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 187/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKDYSNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYASDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
              F L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IFTLIGTESGQYLQKIAIPEQILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_002793130.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCI23676.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9808]
Length=337

 Score =   232 bits (591),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 187/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKNYSNDPQSLASP---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
              F L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IFTLIGAESGQYLQKIAIPEQILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_002783022.1| Aminomethyltransferase [Microcystis aeruginosa]
 emb|CCI12690.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9806]
Length=337

 Score =   231 bits (590),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 188/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKDYSNDPQSLASP---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYASDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFG  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
              F L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IFNLIGTESGQYLQKIAIPEQILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A S+W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGSLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_002776547.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCI06941.1| Aminomethyltransferase [Microcystis aeruginosa PCC 7941]
Length=337

 Score =   231 bits (589),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/306 (39%), Positives = 186/306 (61%), Gaps = 14/306 (5%)
 Frame = +2

Query  323   IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDT  502
              ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC+T
Sbjct  16    FLKDYSNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGCET  72

Query  503   VFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFF  682
             +F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++     F
Sbjct  73    IFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFAIF  132

Query  683   VLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPAT  856
              L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ A 
Sbjct  133   TLIGAESGQYLQKIAIPEQILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAAAE  189

Query  857   AKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYK  1036
             A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGCY 
Sbjct  190   AGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGCYI  249

Query  1037  GQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGY  1216
             GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGLGY
Sbjct  250   GQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGLGY  303

Query  1217  IRKKAA  1234
             ++ KA 
Sbjct  304   VKTKAG  309



>ref|WP_002802890.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCI37354.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9701]
Length=335

 Score =   229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 185/308 (60%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND + L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKNYSNDPQNLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
              F L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IFTLIGTESGQYLQKIAVPEQILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A   W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPFWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_002740255.1| aminomethyltransferase folate-binding domain protein [Microcystis 
aeruginosa]
 gb|ELP52471.1| aminomethyltransferase folate-binding domain protein [Microcystis 
aeruginosa TAIHU98]
Length=337

 Score =   229 bits (584),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 187/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKDYSNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
                L+G +S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IVTLIGAKSGQYLQKIAIPEHILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_008200329.1| glycine cleavage system protein T [Microcystis sp. T1-4]
 emb|CCI31931.1| Aminomethyltransferase [Microcystis sp. T1-4]
Length=337

 Score =   229 bits (583),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 187/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKDYHNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFG  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
              F L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IFSLIGTESGQYLQKIAIPEHILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_023076507.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA32621.1| hypothetical protein N836_25235 [Leptolyngbya sp. Heron Island 
J]
Length=325

 Score =   228 bits (581),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 183/286 (64%), Gaps = 5/286 (2%)
 Frame = +2

Query  380   AVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK  559
             A +D SH+GRI+++G DR++FLHNQ+T  FE L  GQG +TVFV+ TART+D+A A++  
Sbjct  8     AFIDRSHWGRIQLTGADRLRFLHNQTTNAFEQLKSGQGRETVFVSSTARTLDLASAYVDD  67

Query  560   NAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDL  739
             +++ L+ SP  +  + + + +YIFF+DKV + D +  TC   L+GP + +++  L L   
Sbjct  68    DSVLLMVSPGMAPELIAWMDRYIFFADKVTLSDQTDTTCAITLLGPDTERLLTDLGLPQP  127

Query  740   VGQPYGSH--KHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSN  913
                 Y SH    +SV    + IA    ++  G++L+    +A S+   L ++    +   
Sbjct  128   ESNAY-SHIRASWSVTNTDIQIARETGLAIPGYTLIGPKESATSLQNWLTEHQVPCLSPQ  186

Query  914   AWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLW  1093
              WE LRI QGRP PG ELTD+ N LEA LW+ VS  KGCY GQETI+RL TY G+K++LW
Sbjct  187   DWEVLRIRQGRPMPGLELTDKDNPLEAGLWHTVSFEKGCYIGQETIARLNTYQGVKKQLW  246

Query  1094  GIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKA  1231
             G +L   VEPG S+++DG  VGKLTSV ++ D    + LGY+R KA
Sbjct  247   GFKLDKLVEPGVSLTLDGTPVGKLTSVATADD--GIWALGYLRTKA  290



>dbj|GAL95641.1| folate-dependent protein for Fe/S cluster synthesis/repair in 
oxidative stress [Microcystis aeruginosa NIES-44]
Length=337

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 191/321 (60%), Gaps = 18/321 (6%)
 Frame = +2

Query  278   IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQS  457
             +DT+K   A     + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ+
Sbjct  5     LDTIKAQYA----ANFLKDYHNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQT  57

Query  458   TANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
             +   + L  GQGC+T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  
Sbjct  58    SNAIDRLKPGQGCETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPF  117

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGN  811
             DKVEI D++     F L+G  S Q ++ + + +  L G     H HY ++   + +AVG 
Sbjct  118   DKVEISDLTDNFAIFTLIGTESGQYLQKIAIPEQILTGV---QHSHYLLSQPALRVAVGT  174

Query  812   IISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLE  991
              +   G++L+V+ A A   W+ L+  G  P     WE LRI QGRPA  +ELT+++N LE
Sbjct  175   GLDLPGYTLIVAAAEAGPFWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLE  234

Query  992   ANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTS  1171
             A LW A+  +KGCY GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTS
Sbjct  235   AGLWRAIVFDKGCYIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTS  294

Query  1172  VTSSGDTSKPFGLGYIRKKAA  1234
             V         FGLGY++ KA 
Sbjct  295   VLED------FGLGYVKTKAG  309



>ref|WP_002798205.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCI27126.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9809]
Length=337

 Score =   227 bits (579),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 186/308 (60%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKDYSNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
              F L+G  S Q ++ + + +  L G     H HY ++   + +AVG  +   G++L+V+ 
Sbjct  131   IFTLIGTESGQYLQKIAIPEQILTGV---QHSHYLLSEPALRLAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>gb|ELR98599.1| folate-binding protein YgfZ [Gloeocapsa sp. PCC 73106]
Length=311

 Score =   226 bits (576),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 177/289 (61%), Gaps = 8/289 (3%)
 Frame = +2

Query  368   ENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHA  547
             E+ VA+     +G + + G DR +FLHNQ+T +   L  GQ CDTVFV    RT+D+A  
Sbjct  4     ESQVAINTRHDWGLLEIKGSDRSRFLHNQTTNDILSLQTGQTCDTVFVNSIGRTLDLATV  63

Query  548   WIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLN  727
              +   AI ++ SP   E + + + +YIF  D+VE+ DIS+    F L+GP S  ++  L 
Sbjct  64    LVTPEAILILISPNRREFLLNWMDRYIFPMDQVELTDISRDYAIFSLIGPASQSLLTELG  123

Query  728   LGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMG  907
             L +    P   H+ ++     + +A G  ++  G++LLV    ++ VW+AL+      + 
Sbjct  124   LEN--PPPSQEHQIWNYLNTSIYLASGCGLAIPGYTLLVPIEASQRVWQALIQLNTQILT  181

Query  908   SNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQR  1087
              + WE LRI+QGRP P +ELT+++N LEA LW ++S NKGCY GQETI+RL TY G+KQR
Sbjct  182   ESDWEHLRILQGRPIPDQELTEDYNPLEAGLWQSISFNKGCYIGQETIARLNTYQGVKQR  241

Query  1088  LWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             LWGIRL + V PG+ I++  KKVGKLTS + +      FGL YIR +A 
Sbjct  242   LWGIRLENPVAPGTIITIADKKVGKLTSCSGN------FGLAYIRTQAG  284



>ref|WP_017295817.1| hypothetical protein [Geminocystis herdmanii]
Length=326

 Score =   226 bits (577),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 179/295 (61%), Gaps = 4/295 (1%)
 Frame = +2

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             L    N VA++D +H+G + ++G+DR++FLHNQST N + L  G+GCDTV V  T R ID
Sbjct  4     LNFINNSVALIDRTHHGLLSITGDDRLRFLHNQSTNNIQGLKVGEGCDTVLVNSTGRNID  63

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             +  A++ +N + L+ SP  ++ +   L +YIF  DKV I+D++     F L+G +S  ++
Sbjct  64    LVSAYVQENQVLLLVSPHQNKPLYDWLDRYIFPFDKVAIKDVTNDYRIFTLIGEKSQDLL  123

Query  716   EGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGA  895
                   + +     SHK  ++    + I VG  +   G++L++    A  +W  L     
Sbjct  124   SEWVDNEFLNSSEFSHKIITIEDIELIITVGCNLKLTGYNLIIPQEKAHQIWDKLTAKNP  183

Query  896   VPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDG  1075
             + + +  +E L+I++G+P    ELTDEFN LE+ LW+A+S NKGCY GQETI+RL TY G
Sbjct  184   ILLNNEDYENLQILRGKPRVNHELTDEFNPLESGLWDAISFNKGCYIGQETIARLNTYKG  243

Query  1076  IKQRLWGIRLsssv--epgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             +KQ+LWGI+L  S+  E    I V+G+KVGK+TS   +    + F LGYIR KA 
Sbjct  244   VKQKLWGIKLKGSIDPEKDKIIMVEGEKVGKITSYLET--ELENFALGYIRTKAG  296



>ref|WP_016516159.1| Aminomethyltransferase [Microcystis aeruginosa]
 gb|EPF20937.1| Aminomethyltransferase [Microcystis aeruginosa SPC777]
Length=337

 Score =   226 bits (577),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 185/308 (60%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND + L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKNYSNDPQNLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYSGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
                L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IVTLIGTESGQYLQKIAIPEHILTGV---QHSHYLLSDPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_002750154.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCH95522.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9432]
Length=337

 Score =   226 bits (576),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 185/308 (60%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND + L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKNYSNDPQNLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYSGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
                L+G  S Q ++ + + +  L G     H HY ++  P+ +AVG  +   G++L+V+ 
Sbjct  131   IVTLIGTESGQYLQKIAVPEQILTGV---QHSHYLLSEPPLRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS  V   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQPVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_024968911.1| glycine cleavage system protein T [Microcystis aeruginosa]
Length=337

 Score =   226 bits (576),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 187/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  317   GDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGC  496
              + ++ Y ND + L +      ++D S +G + + G+DR++FLHNQ++   + L  GQGC
Sbjct  14    ANFLKNYSNDPQNLASQ---TILIDRSDWGLLELKGQDRLRFLHNQTSNAIDRLKPGQGC  70

Query  497   DTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTC  676
             +T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  DKVEI D++    
Sbjct  71    ETIFLNSTGRTLDFVTVYSGDDSLLILVSPQRRQFLLELIDRYIFPFDKVEISDLTDNFA  130

Query  677   FFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSP  850
                L+G  S Q ++ + + +  L G     H HY ++   + +AVG  +   G++L+V+ 
Sbjct  131   IVTLIGTESGQYLQKIAIPEQILTGV---QHSHYLLSEPALRVAVGTGLDLPGYTLIVAA  187

Query  851   ATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGC  1030
             A A S+W+ L+  G  P  +  WE LRI QGRPA  +ELT+++N LEA LW A+  +KGC
Sbjct  188   AEAGSLWENLIKNGVTPADAQVWEYLRIHQGRPAVDRELTEDYNPLEAGLWRAIVFDKGC  247

Query  1031  YKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGL  1210
             Y GQETI+RL TY G+KQRLWGI+LS SV   + I ++ +KVG LTSV         FGL
Sbjct  248   YIGQETIARLNTYKGVKQRLWGIKLSQSVPSNTPIILEAQKVGLLTSVLED------FGL  301

Query  1211  GYIRKKAA  1234
             GY++ KA 
Sbjct  302   GYVKTKAG  309



>ref|WP_034936144.1| glycine cleavage system protein T, partial [Gloeocapsa sp. PCC 
73106]
Length=305

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 175/286 (61%), Gaps = 8/286 (3%)
 Frame = +2

Query  377   VAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIM  556
             VA+     +G + + G DR +FLHNQ+T +   L  GQ CDTVFV    RT+D+A   + 
Sbjct  1     VAINTRHDWGLLEIKGSDRSRFLHNQTTNDILSLQTGQTCDTVFVNSIGRTLDLATVLVT  60

Query  557   KNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD  736
               AI ++ SP   E + + + +YIF  D+VE+ DIS+    F L+GP S  ++  L L +
Sbjct  61    PEAILILISPNRREFLLNWMDRYIFPMDQVELTDISRDYAIFSLIGPASQSLLTELGLEN  120

Query  737   LVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNA  916
                 P   H+ ++     + +A G  ++  G++LLV    ++ VW+AL+      +  + 
Sbjct  121   --PPPSQEHQIWNYLNTSIYLASGCGLAIPGYTLLVPIEASQRVWQALIQLNTQILTESD  178

Query  917   WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWG  1096
             WE LRI+QGRP P +ELT+++N LEA LW ++S NKGCY GQETI+RL TY G+KQRLWG
Sbjct  179   WEHLRILQGRPIPDQELTEDYNPLEAGLWQSISFNKGCYIGQETIARLNTYQGVKQRLWG  238

Query  1097  IRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             IRL + V PG+ I++  KKVGKLTS + +      FGL YIR +A 
Sbjct  239   IRLENPVAPGTIITIADKKVGKLTSCSGN------FGLAYIRTQAG  278



>gb|KFF41656.1| folate-binding protein YgfZ [Candidatus Atelocyanobacterium thalassa 
isolate SIO64986]
Length=344

 Score =   226 bits (575),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 179/300 (60%), Gaps = 4/300 (1%)
 Frame = +2

Query  335   YGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVT  514
             + N+        +   V+D+SH+G ++++GEDR++FLHN ST N + L   Q C+T+F+ 
Sbjct  12    FNNEYYVFQEAYSNAIVIDMSHWGLLKITGEDRLKFLHNLSTNNIKDLKPKQLCETIFIN  71

Query  515   PTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVG  694
                RT+D+A A+IM+N I L+ SP     +   + +YIF  DKV++ DIS +   F LVG
Sbjct  72    SIGRTLDLATAYIMENEILLLVSPNRRSLLLDWMERYIFPMDKVQLVDISHENAVFSLVG  131

Query  695   PRSNQIVEGLN--LGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSV  868
             P+  Q ++  N    ++       +   ++  N + +A+ N ++  G +++ S   AK++
Sbjct  132   PQVAQKLQKWNCDFKNISNSRLDVYSILNIENNRIIVALNNGLALPGCTIITSKNYAKTI  191

Query  869   WKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
              K L+    +P  +N WE+LRI QGRP P  ELT+ +N LEA LW+ +S +KGCY GQET
Sbjct  192   LKELIGCNFLPASNNVWEKLRIRQGRPFPNNELTETYNPLEAGLWSKISFDKGCYIGQET  251

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+KQ LWGI+LS  +   + I V+G KVG LTS          +GL YI+ K
Sbjct  252   IARLNTYHGVKQYLWGIKLSQLINVPNPIYVNGDKVGVLTSCIQINQDF--WGLAYIKAK  309



>ref|WP_002757310.1| glycine cleavage system protein T [Microcystis aeruginosa]
 emb|CCH99675.1| Aminomethyltransferase [Microcystis aeruginosa PCC 9717]
Length=337

 Score =   225 bits (573),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 192/321 (60%), Gaps = 18/321 (6%)
 Frame = +2

Query  278   IDTMKVAGAKVLEGDIIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQS  457
             +DT+K   A     + ++ Y ND ++L +      ++D S +G + + G+DR++FLHNQ+
Sbjct  5     LDTIKAEYA----ANFLKDYHNDPQSLASQ---TILIDRSDWGLLELKGQDRLRFLHNQT  57

Query  458   TANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIFFS  637
             +   + L  GQGC+T+F+  T RT+D    +   +++ ++ SP+  + +  ++ +YIF  
Sbjct  58    SNAIDRLKPGQGCETIFLNSTGRTLDFVTVYAGDDSLLILVSPQRRQFLLELIDRYIFPF  117

Query  638   DKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGD--LVGQPYGSHKHYSVNGNPVTIAVGN  811
             DKVEI D++       L+G  S Q ++ + + +  L G     H HY ++   + +AVG 
Sbjct  118   DKVEISDLTDNFGIVTLIGAESGQYLQKIAIPEQILTGV---QHSHYLLSQPALRLAVGT  174

Query  812   IISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLE  991
              +   G++L+V+ A A  +W+ L+  G  P     WE LRI QGRPA  +ELT+++N LE
Sbjct  175   GLDLPGYTLIVAAAEAGPLWENLIKNGVTPADEQVWEYLRIHQGRPAVDRELTEDYNPLE  234

Query  992   ANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTS  1171
             A LW A+  +KGCY GQETI+RL TY G+KQRLWGI+LS SV   + I ++ +KVG LTS
Sbjct  235   AGLWRAIVFDKGCYIGQETIARLNTYKGVKQRLWGIKLSQSVPSNTPIILEAQKVGLLTS  294

Query  1172  VTSSGDTSKPFGLGYIRKKAA  1234
             V         FGLGY++ KA 
Sbjct  295   VLED------FGLGYVKTKAG  309



>ref|WP_015222909.1| folate-binding protein YgfZ [Cyanobacterium stanieri]
 ref|YP_007165241.1| folate-binding protein YgfZ [Cyanobacterium stanieri PCC 7202]
 gb|AFZ47592.1| folate-binding protein YgfZ [Cyanobacterium stanieri PCC 7202]
Length=351

 Score =   224 bits (571),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/323 (39%), Positives = 190/323 (59%), Gaps = 5/323 (2%)
 Frame = +2

Query  275   LIDTMKVAGAKVLEGD-IIETYGNDDEALTATENGVAVVDLSHYGRIRVSGEDRVQFLHN  451
             L D  K  GA     +    T+ ND  AL      V + D +  G I+VSG DR+ F+HN
Sbjct  4     LQDLQKTQGAIFFASENTPSTFNNDSIALNHAFQEVVICDRTCSGLIKVSGSDRLSFIHN  63

Query  452   QSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKNAITLVTSPETSERITSMLRKYIF  631
             Q+T   + L  G+G ++VFV  T RTID+    + +  + L+TSP+ ++ +   + +YIF
Sbjct  64    QTTNQIQSLKTGKGANSVFVNSTGRTIDLVTVLVKEEKLLLLTSPQQNQPLIEWMDRYIF  123

Query  632   FSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGN  811
               DKVE++D++ Q   F L+G +S +I+        +  P  SH   +++G   T+ +G+
Sbjct  124   PFDKVELEDLTGQYAIFTLMGEKSPEILTDWVTESQLNAPEYSHFQINLDGVESTLVIGS  183

Query  812   IISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLE  991
                 +G+ L++    A  +WK L    A PMG+  +E LRI+QG+P P  ELT ++N LE
Sbjct  184   GFKIKGYILIIPQEKAPIIWKKLTAQKATPMGNQTYETLRILQGKPKPDHELTTDYNPLE  243

Query  992   ANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGIRL--sssvepgssisVDGKKVGKL  1165
             A LW+A+S +KGCY GQETI+RL TY G+KQRLWGI+   S ++     I+++G+KVG +
Sbjct  244   AGLWDAISFDKGCYIGQETIARLNTYKGVKQRLWGIKFPPSVNLTENKLITINGEKVGTI  303

Query  1166  TSVTSSGDTSKPFGLGYIRKKAA  1234
             TS  ++ +    F LGYIR KA 
Sbjct  304   TSYCTTSE--GIFALGYIRTKAG  324



>ref|XP_004242035.1| PREDICTED: dnaJ homolog subfamily B member 4 [Solanum lycopersicum]
Length=384

 Score =   198 bits (503),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             +I+EEE +TIKVKP W +GTKITFEGKG+ERPG   ADVIFVI EKKH +FKR+GD++EL
Sbjct  239   LIEEEEVLTIKVKPGWTKGTKITFEGKGNERPGTSAADVIFVIAEKKHPLFKRDGDNVEL  298

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
              V++PLV+ALTGCTI++P LGG +M L +DD II PG EK I GQGM  P  +G RG+L 
Sbjct  299   AVEVPLVKALTGCTISIPLLGGEKMSLTIDD-IICPGYEKIIEGQGMPKPKEEGNRGNLI  357

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             + FLV FPT+++EEQRS + SIL+DCC
Sbjct  358   VTFLVAFPTEIAEEQRSDIVSILQDCC  384


 Score = 70.1 bits (170),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -1

Query  2264  TSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYV  2097
             ++S++++TPI+ S S    KPPP EK LECTL+ELC+GC K++K+TR+ +++ G +
Sbjct  185   SASRKSSTPIMFSSSTGLVKPPPTEKTLECTLDELCFGCVKKMKVTRDAMTDNGLI  240



>ref|WP_038016330.1| hypothetical protein [Synechococcus sp. PCC 7335]
Length=335

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 186/302 (62%), Gaps = 21/302 (7%)
 Frame = +2

Query  383   VVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMKN  562
             + D SH+G+IR++G DRV+FLHNQ+T + E L   +GC TVFVT T RTID++  +  ++
Sbjct  4     LFDRSHWGQIRLTGADRVRFLHNQTTNSIEQLSANEGCHTVFVTSTGRTIDLSTVYAFED  63

Query  563   AITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDLV  742
             ++ ++ SP   +++   + KYIFFSDKV + D S QT  F +VG   +++   L    LV
Sbjct  64    SLLVIVSPGMEKKLYDWMDKYIFFSDKVTLVDESSQTFLFTVVGEGCDELARTLGAPSLV  123

Query  743   GQPYGSHK-----------------HYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVW  871
             G+   +H+                   S   + + +A    ++  G++L      A +  
Sbjct  124   GKRAFTHQAIADDNLQQASSGDSGTQESSTPDDIRMACDVELAIPGYTLWGPIEKADATQ  183

Query  872   KALVDYGAVPMGSNA-WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQET  1048
             +A++  G + +G+ A WE LRI QGRP P KELTD+ N LEA LW++VS  KGCY GQET
Sbjct  184   QAILSTG-ITVGTQAEWESLRIQQGRPTPHKELTDDDNPLEAGLWHSVSFEKGCYIGQET  242

Query  1049  ISRLVTYDGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKK  1228
             I+RL TY G+K+RLWG+ +  SV  GS I++DGK VGKLTS+T++   +  FGLGYIR K
Sbjct  243   IARLNTYKGVKKRLWGLAIDRSVLEGSDIALDGKIVGKLTSLTNT--EAGFFGLGYIRTK  300

Query  1229  AA  1234
             A 
Sbjct  301   AG  302



>ref|WP_006515237.1| folate-binding protein YgfZ [Leptolyngbya sp. PCC 7375]
 gb|EKV00831.1| folate-binding protein YgfZ [Leptolyngbya sp. PCC 7375]
Length=327

 Score =   220 bits (561),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 182/287 (63%), Gaps = 5/287 (2%)
 Frame = +2

Query  380   AVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK  559
             A +D S +GRI+++G+DR++FLHNQ+T  FE L  GQGC+TV VT TART+D+  A++  
Sbjct  8     AFIDRSDWGRIQITGDDRLRFLHNQTTNAFEQLAPGQGCETVLVTSTARTLDLVSAYVDD  67

Query  560   NAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDL  739
             +++ L+ SP  ++ +   + +YIFF+DKV + + ++ T  F ++GP ++Q++  L L   
Sbjct  68    SSVLLMVSPGMADELIGWMDRYIFFADKVNLSNQTEATFAFTILGPETDQLLTKLELPQP  127

Query  740   VGQPYGSH--KHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSN  913
                PY SH   ++      + +     +   G++L+ +     ++   L++     + + 
Sbjct  128   DTAPY-SHILANWPAGNVEIQVVRETGLGIPGYTLIGAKEHGLALHNWLIEQQISCLSAQ  186

Query  914   AWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLW  1093
              WE LRI QGRP PGKELTD+ N LEA LW+ VS  KGCY GQETI+RL TY G+K++LW
Sbjct  187   EWEVLRIRQGRPMPGKELTDKDNPLEAGLWHTVSFEKGCYIGQETIARLNTYQGVKKQLW  246

Query  1094  GIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAA  1234
             G +L   V   +++S++G  +GK+TSV +  D +  +GLGY+R KA 
Sbjct  247   GFKLGKQVPADAALSLEGAPMGKITSVVA--DDTGVWGLGYLRTKAG  291



>gb|EYU26527.1| hypothetical protein MIMGU_mgv1a0194981mg, partial [Erythranthe 
guttata]
Length=146

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 127/147 (86%), Gaps = 2/147 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI++EEE + IK+KP W++GTKITFEGKGDERPG LPAD+IF I+EK+H +FKREGDDLE
Sbjct  1     LIVEEEEILMIKIKPGWKKGTKITFEGKGDERPGTLPADIIFSIDEKRHPLFKREGDDLE  60

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP-NNQGQRGDLR  1678
             LGV++PLVQALTGCT+ VP LGGG++ L+++D IIYPG EK IPGQGMP + +G+RGDLR
Sbjct  61    LGVEVPLVQALTGCTVPVPLLGGGQITLSIED-IIYPGYEKIIPGQGMPVSKEGKRGDLR  119

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             L+FLV FP +LS+EQRS+V SIL  C 
Sbjct  120   LKFLVEFPAELSDEQRSEVVSILEGCS  146



>emb|CDP10930.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   197 bits (500),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             +IQE+E +TIKVKP WR+GTKITFEG G+E PG  PADVIF + EK+H M++REGDDLEL
Sbjct  147   LIQEDEVLTIKVKPGWRKGTKITFEGMGNEMPGADPADVIFTVLEKRHHMYRREGDDLEL  206

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
              V+IPLV+ALTGC   +P LGG +MIL +DD IIYPG +K IPG GM  P+ QG+RG+L 
Sbjct  207   AVEIPLVKALTGCIFAIPLLGGEKMILTIDD-IIYPGYQKIIPGHGMPKPHEQGERGNLI  265

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             +  LV FPT+L++EQRS++ SILRD C
Sbjct  266   ITMLVKFPTELTDEQRSEIVSILRDSC  292


 Score = 62.0 bits (149),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 12/110 (11%)
 Frame = -1

Query  2426  PRLLSRTTSRLAISPKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTS-SKR  2250
             P  LSR+TS+ +++P  S            AA+    + R  S   T     L  S S++
Sbjct  45    PSPLSRSTSKRSLTPIRSA-----------AANLLRSMSRRKSAEATTLPSTLSRSVSRK  93

Query  2249  TATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGY  2100
              +  I+ S S    KPP +E  LECTLEELC+GC K++KITR+ +++ GY
Sbjct  94    ASITIMYSNSNGLMKPPAMEMTLECTLEELCFGCIKKMKITRDSVTDDGY  143



>ref|XP_011087735.1| PREDICTED: dnaJ protein homolog 1-like [Sesamum indicum]
Length=372

 Score =   216 bits (551),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+QEEE V IKVKP W++GTKITFEGKGDERPG  PADVIF I+EK H +FKREGDDLE
Sbjct  227   LIVQEEETVKIKVKPGWKKGTKITFEGKGDERPGTFPADVIFSIDEKSHPLFKREGDDLE  286

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP-NNQGQRGDLR  1678
             LGV++PLVQALTGC++ VP LGGG++ L++DD IIYPG EK IPGQGMP + +G+RGDLR
Sbjct  287   LGVEVPLVQALTGCSLPVPLLGGGQINLSIDD-IIYPGYEKIIPGQGMPMSKEGKRGDLR  345

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             L+FLV FP +LS++QRS+V SIL +C
Sbjct  346   LKFLVEFPAELSDDQRSEVVSILAEC  371


 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 82/144 (57%), Gaps = 9/144 (6%)
 Frame = -1

Query  2459  QDEDEELFISGPRLLSRTTSRLAISPKFSKSSSRKGNKTPRAADFYAHLERSTSFSG---  2289
              D+ EEL IS P LLSRTTS+ +       S S   N TP   DFYA    + S +    
Sbjct  101   NDDGEELQISKPTLLSRTTSQNSPLSSPMFSRSSSYNTTPHM-DFYAFYPNTLSGANSPT  159

Query  2288  -----TQSHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITR  2124
                  T S  L    S+R  TPI  S+S  R+KPPPVEK+LECTLEELC+GC K++KITR
Sbjct  160   TPRTPTGSATLSKIGSRRCVTPIFFSQSAVRKKPPPVEKKLECTLEELCHGCVKKIKITR  219

Query  2123  EILSNTGYVCVEHNIYKIYVTINY  2052
             + +S++G +  E    KI V   +
Sbjct  220   DAISSSGLIVQEEETVKIKVKPGW  243



>emb|CDO97560.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   216 bits (551),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I+QEEE + IKVKP W++GTKITFEGKGDERPG  PAD+IF+I+EK+H +FKREGDDLE
Sbjct  225   IIVQEEEILRIKVKPGWKKGTKITFEGKGDERPGMHPADIIFIIDEKRHPLFKREGDDLE  284

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDL  1681
             LGV+IPLVQALTGCTI+VP LGG +M L++ D II+PG EK IP QGMP     G+RGDL
Sbjct  285   LGVEIPLVQALTGCTISVPLLGGDQMDLSIGD-IIFPGYEKIIPDQGMPISKQHGRRGDL  343

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
             RLRFLV FPTDLS++QRS V  IL DCC
Sbjct  344   RLRFLVEFPTDLSKQQRSAVVRILEDCC  371


 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 103/187 (55%), Gaps = 23/187 (12%)
 Frame = -1

Query  2567  QAISSRKRDKQTATFDVDNQNTPKGSSRKTLPESLEQDEDEELFISGPRLLSRTTSRLAI  2388
             + +SS+KR++   T   D+  TP+ S           D+D +  IS P LLS T++R+  
Sbjct  63    RVLSSKKREEINGTSH-DDPKTPENSYH----HRSSSDDDGQFVISSPTLLSSTSTRITP  117

Query  2387  S--PKFSKSSSRKG--NKTPRAADFYAHLERSTSFSGTQSH-----------DLLGTSSK  2253
             +  P+ S  SS +G  +  P   +FY H   S S +GT +             L   +SK
Sbjct  118   TGTPRSSDGSSHRGYYSGAPSPRNFYGH---SRSPNGTDTPSTPTTPEPPLVSLSKITSK  174

Query  2252  RTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYK  2073
             R   PII S++ +RRK  P++K+LECTLEELC+GC K+VKITR+++SN G +  E  I +
Sbjct  175   RATNPIIYSQTTARRKAQPIQKKLECTLEELCHGCVKKVKITRDVISNAGIIVQEEEILR  234

Query  2072  IYVTINY  2052
             I V   +
Sbjct  235   IKVKPGW  241



>gb|EPS69253.1| hypothetical protein M569_05511 [Genlisea aurea]
Length=257

 Score =   209 bits (532),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             L++QE+E + IKVKP W+RGTKITFEGKGDERPG LPAD+IF IEEK+H +FKREGDDLE
Sbjct  112   LLVQEDEILMIKVKPGWKRGTKITFEGKGDERPGALPADIIFSIEEKQHPLFKREGDDLE  171

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN-NQGQRGDLR  1678
             LGV++PLVQALTGCT+ VP LGGGE+ L++DD IIYPG EKTIPG+GMP   +G+RGDLR
Sbjct  172   LGVEVPLVQALTGCTVPVPLLGGGEITLSIDD-IIYPGYEKTIPGEGMPKPKEGRRGDLR  230

Query  1677  LRFLVGFPTDLSEEQRSQVASIL  1609
             L+FLV F T+L +EQR +V  IL
Sbjct  231   LKFLVDFQTELRDEQRQEVVRIL  253


 Score = 73.6 bits (179),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  2252  RTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYK  2073
             R A PI  S+S  RRKP P+EK+LEC+LEELC GC K++KITR+ +S++G +  E  I  
Sbjct  62    RVAMPIFYSQSAVRRKPQPIEKKLECSLEELCNGCIKKIKITRDSISSSGLLVQEDEILM  121

Query  2072  IYVTINY  2052
             I V   +
Sbjct  122   IKVKPGW  128



>ref|WP_011057784.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_682739.1| hypothetical protein tlr1949 [Thermosynechococcus elongatus BP-1]
 dbj|BAC09501.1| tlr1949 [Thermosynechococcus elongatus BP-1]
Length=313

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 190/309 (61%), Gaps = 12/309 (4%)
 Frame = +2

Query  380   AVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK  559
             AV D SH+GR+R++G DR+QFLHNQS+ N  +L  GQG DTVF+T TART+D+    + +
Sbjct  13    AVYDCSHWGRLRLTGGDRLQFLHNQSSNNCLVLQAGQGADTVFLTSTARTLDLVTLLVHQ  72

Query  560   NAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDL  739
               + L+ SP+  E +   L KYIFF D V++ D + ++  + + G  + +I     L D 
Sbjct  73    EWVDLLVSPQRREFLLKWLEKYIFFGDDVQLSDRTPESYCYRVFGSVAAKITAQFGL-DP  131

Query  740   VGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNA-  916
             +  PY  H        P+T+A  + ++  G +L     + + +   L  Y   P  S+A 
Sbjct  132   LANPY-DHVTIPHADAPLTLAATSGLAIPGLTLW----SDRPLRDLLSPY---PQLSDAD  183

Query  917   WEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWG  1096
             WE LRI QGRPA   ELT+E+N LEA L + +S NKGCY GQETI+RL TY G+KQ LWG
Sbjct  184   WEHLRIRQGRPAADAELTEEYNPLEARLGHTISFNKGCYIGQETIARLNTYQGVKQHLWG  243

Query  1097  IRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvg  1276
             + L+++V P + + ++G+KVG +TS T  G  +  FGLGY+R K    G T+   +GV+ 
Sbjct  244   LELTATVTPPTPLILEGEKVGLVTSCTPLGKGA--FGLGYVRTKVGGPGLTLHTPEGVMA  301

Query  1277  tvvevPFLG  1303
              VVEVPFLG
Sbjct  302   QVVEVPFLG  310



>ref|XP_011092346.1| PREDICTED: flocculation protein FLO11-like [Sesamum indicum]
Length=545

 Score =   214 bits (546),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 3/144 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+QEEE ++IKV P W +GTKI  EGKGDERPG LPAD+IF IEEK H MF+REGDDLE
Sbjct  400   LIVQEEEMLSIKVNPGWTKGTKIMVEGKGDERPGTLPADIIFNIEEKIHPMFQREGDDLE  459

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDL  1681
             LGV++PLVQALTGCTI+VP LGGGE+ L++DD IIYPG EK IPGQGMP +  +G+RGDL
Sbjct  460   LGVEVPLVQALTGCTISVPLLGGGEIPLSIDD-IIYPGYEKIIPGQGMPKSKEEGRRGDL  518

Query  1680  RLRFLVGFPTDLSEEQRSQVASIL  1609
             RL+FLVGFP +LS+EQRS+V SIL
Sbjct  519   RLKFLVGFPDELSDEQRSEVVSIL  542


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 103/208 (50%), Gaps = 50/208 (24%)
 Frame = -1

Query  2531  ATFDVDNQNTP--KGSSRKTLPESLEQDEDEELFISGPRLLSRTTSRL--AISPKFSKSS  2364
             +T  +D+  +P   GSSR+T P +  QD+D+   IS P+LLSRTTSR+    SP  SKSS
Sbjct  211   STSQIDHMPSPYASGSSRQTPPPTDFQDDDKS-SISKPKLLSRTTSRINPMPSPNLSKSS  269

Query  2363  SRKGNKTPRAADFY-----------------------------------------AHLER  2307
             +R  + TP A D +                                           +  
Sbjct  270   NRT-STTPPAVDSHDDDDFQISKPVLLSRTVSQISPMARPNLSRCSTRAQNVSSPIDIHE  328

Query  2306  STSFSGTQSHD---LLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEV  2136
             S+S   T S +   L   +S  + TPI  S+S+ R+KP P+EK+LECTLEELC GC K++
Sbjct  329   SSSGGSTPSKEQTSLPKVASSISTTPIFFSQSMVRKKPKPIEKKLECTLEELCLGCVKKI  388

Query  2135  KITREILSNTGYVCVEHNIYKIYVTINY  2052
              ITR+ +S++G +  E  +  I V   +
Sbjct  389   NITRDAISSSGLIVQEEEMLSIKVNPGW  416



>ref|XP_006363886.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Solanum tuberosum]
Length=385

 Score =   188 bits (478),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = -3

Query  2067  CNDQLYVIMC-RLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKK  1891
             C  ++ V M    + +EEE +TIKVKP W +GTKITFEGKG+ERPG   ADVIFVI EKK
Sbjct  228   CVKKMKVTMTDNGLTEEEEVLTIKVKPGWTKGTKITFEGKGNERPGTSAADVIFVIAEKK  287

Query  1890  HSMFKREGDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM  1711
             H +F R+GD++EL V+IPLV+ALTGCTI++P LGG +M L +DD II PG EK I GQGM
Sbjct  288   HPLFMRDGDNVELAVEIPLVKALTGCTISIPLLGGEKMSLTIDD-IICPGYEKIIEGQGM  346

Query  1710  --PNNQGQRGDLRLRFLVGFPTDLSEEQRSQVASILRDC  1600
               P  +G RG+L + FLV FPT+++EEQRS +  IL+DC
Sbjct  347   PKPKEEGNRGNLIVTFLVAFPTEIAEEQRSDIVRILQDC  385


 Score = 61.6 bits (148),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  2261  SSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKIT  2127
             +S++++TPI+ S S    KPPP EK LECTL+ELC+GC K++K+T
Sbjct  191   ASRKSSTPIMFSSSTGLVKPPPTEKTLECTLDELCFGCVKKMKVT  235



>ref|XP_009792410.1| PREDICTED: dnaJ protein homolog 1-like [Nicotiana sylvestris]
Length=347

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -3

Query  2052  YVIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKR  1873
             ++    LI++EEE VTIKV+P W+RGTKITFE KGDERPG LPAD++F I+EK H +FKR
Sbjct  195   FIATTGLIVKEEEVVTIKVRPGWKRGTKITFEVKGDERPGTLPADIVFSIDEKTHPLFKR  254

Query  1872  EGDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--  1699
             EGDDL LGV++PLVQALTGC ITVP LGG EM ++  D++IYPG +K IPGQGMP  +  
Sbjct  255   EGDDLVLGVEVPLVQALTGCIITVPLLGGDEMTMSF-DQVIYPGFQKIIPGQGMPKPKED  313

Query  1698  GQRGDLRLRFLVGFPTDLSEEQRSQVASILRDC  1600
              +RGDL L+FLV FP DLS+EQR QV SIL DC
Sbjct  314   SRRGDLILQFLVEFPLDLSQEQRFQVVSILEDC  346


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 99/185 (54%), Gaps = 30/185 (16%)
 Frame = -1

Query  2609  YLSFNENVNVFG*IQAISSRKRDKQTATFDVDNQNTPKGSSRKTLPESLEQDEDEELFIS  2430
             + S NE   V      +S +KRD++      D   TP+ SS          DEDE L IS
Sbjct  56    FRSINEAYRV------LSKKKRDEENL-LKSDVAKTPRQSS----------DEDE-LQIS  97

Query  2429  GPRLLSRTTSRLAISPKFSKSS---SRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTS  2259
              P LLSRTTSR++ +  F  S    S  G  TP            T  S  Q+ +L   +
Sbjct  98    SPTLLSRTTSRISPTVDFYTSMPCFSMSGASTPTTP--------GTPISD-QTPNLFKVA  148

Query  2258  SKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNI  2079
             SKR  TPII S+S SRRKP P+EK+LECTLEELC+GC K+V ITR+ ++ TG +  E  +
Sbjct  149   SKRNTTPIIFSQSTSRRKPQPIEKKLECTLEELCHGCVKKVMITRDFIATTGLIVKEEEV  208

Query  2078  YKIYV  2064
               I V
Sbjct  209   VTIKV  213



>ref|XP_004140234.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Cucumis sativus]
 ref|XP_004164087.1| PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog subfamily B member 
4-like [Cucumis sativus]
Length=333

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
              I+  +I+QEEE + I+VKP W++GTKITFEGKGDE+PG LPAD+ F I+E++H +F R+
Sbjct  181   AIVNGIIVQEEELLRIEVKPGWKKGTKITFEGKGDEKPGFLPADITFSIDERRHPLFSRD  240

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQG  1696
             GDDL+LGV+IPLV ALTGC+ITVP LGG +M L+ D+ IIYPG +K I GQGMPN   QG
Sbjct  241   GDDLDLGVEIPLVNALTGCSITVPLLGGEKMSLSFDN-IIYPGFQKAIKGQGMPNPKQQG  299

Query  1695  QRGDLRLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              RGDLR++FLV FP+ L+++QRS+ A+IL+DCC
Sbjct  300   IRGDLRIQFLVNFPSQLTQQQRSEAATILQDCC  332


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 64/110 (58%), Gaps = 15/110 (14%)
 Frame = -1

Query  2378  FSKSSSRKGNKTPRAADFY-AHLERSTSFSGTQSHDLLGTSSKRTATPIILSESISRRKP  2202
              S+++SR+ + TP    FY   L R+TS    +S            TPII S+S + +KP
Sbjct  107   LSRNTSRR-STTPSPRSFYIGSLSRNTSRRSPKS------------TPIIYSQSTALKKP  153

Query  2201  PPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             PPVEK+LECTLEELC GC K++ ITR+ + N G +  E  + +I V   +
Sbjct  154   PPVEKKLECTLEELCEGCIKKIMITRDAIVN-GIIVQEEELLRIEVKPGW  202



>ref|XP_009597477.1| PREDICTED: dnaJ homolog subfamily B member 4-like isoform X1 
[Nicotiana tomentosiformis]
Length=348

 Score =   204 bits (519),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI++E+E VTIKV+P W+RGTKITFEGKGDERPG LPAD++F I+EK H +FKREGDDL 
Sbjct  202   LIVKEDEVVTIKVRPGWKRGTKITFEGKGDERPGTLPADIVFSIDEKTHPLFKREGDDLV  261

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDL  1681
             LGV++PLVQALTGC ITVP LGG +M ++  D++IY G EK IPGQGMP  +   +RGDL
Sbjct  262   LGVEVPLVQALTGCIITVPLLGGDDMTMSF-DQVIYSGFEKIIPGQGMPKPKEDTRRGDL  320

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDC  1600
              L+FLV FP DLS EQR QV SIL DC
Sbjct  321   VLQFLVEFPLDLSREQRFQVVSILEDC  347


 Score =   101 bits (251),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 95/174 (55%), Gaps = 29/174 (17%)
 Frame = -1

Query  2567  QAISSRKRDKQTATFDVDNQNTPKGSSRKTLPESLEQDEDEELFISGPRLLSRTTSRLAI  2388
             + +S +KRD++      D   TP+ SS          DEDE L IS P LLSRTTSR  I
Sbjct  64    KVLSKKKRDEENL-LKSDVAKTPRKSS----------DEDE-LQISSPTLLSRTTSR--I  109

Query  2387  SPK-----FSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTSSKRTATP-IILS  2226
             SP      F    S  G  TP            T  S  Q+ +L   +SKR  TP II S
Sbjct  110   SPTVDFYTFIPCFSMSGASTPTTP--------GTPISD-QTPNLFKVASKRNTTPPIIFS  160

Query  2225  ESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYV  2064
             +S SRRKP P+EK+LECTLEELC+GC K+V ITR++++ TG +  E  +  I V
Sbjct  161   QSTSRRKPQPIEKKLECTLEELCHGCVKKVIITRDVIATTGLIVKEDEVVTIKV  214



>gb|KGN47935.1| hypothetical protein Csa_6G417870 [Cucumis sativus]
Length=392

 Score =   206 bits (523),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
              I+  +I+QEEE + I+VKP W++GTKITFEGKGDE+PG LPAD+ F I+E++H +F R+
Sbjct  240   AIVNGIIVQEEELLRIEVKPGWKKGTKITFEGKGDEKPGFLPADITFSIDERRHPLFSRD  299

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQG  1696
             GDDL+LGV+IPLV ALTGC+ITVP LGG +M L+ D+ IIYPG +K I GQGMPN   QG
Sbjct  300   GDDLDLGVEIPLVNALTGCSITVPLLGGEKMSLSFDN-IIYPGFQKAIKGQGMPNPKQQG  358

Query  1695  QRGDLRLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              RGDLR++FLV FP+ L+++QRS+ A+IL+DCC
Sbjct  359   IRGDLRIQFLVNFPSQLTQQQRSEAATILQDCC  391


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 80/153 (52%), Gaps = 25/153 (16%)
 Frame = -1

Query  2492  SSRKTLPESLEQDE------DEELFISGPRLLSRTTSRLAISPKFSKSSSRKGNKTPRAA  2331
             S R T P SL +DE      D E F+  P  +SR   R    P+ ++ + R+ +     A
Sbjct  128   SRRSTTPTSLMRDEKRRSNSDSE-FLGEP--ISRNFGRRTDVPESNEEALRRISS---EA  181

Query  2330  DFYAHLERSTSFSGTQSHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYG  2151
              +   L R+TS    +S            TPII S+S + +KPPPVEK+LECTLEELC G
Sbjct  182   SYIGSLSRNTSRRSPKS------------TPIIYSQSTALKKPPPVEKKLECTLEELCEG  229

Query  2150  CTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             C K++ ITR+ + N G +  E  + +I V   +
Sbjct  230   CIKKIMITRDAIVN-GIIVQEEELLRIEVKPGW  261



>ref|XP_003547049.1| PREDICTED: uncharacterized protein LOC100799984 [Glycine max]
 gb|KHN33453.1| DnaJ like subfamily B member 13 [Glycine soja]
Length=381

 Score =   203 bits (517),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +IIQEEE + I+VKP WR+GTKITFEG GDE+PG LP+D++F+I+EKKH +F+REG+DLE
Sbjct  234   VIIQEEEILKIEVKPGWRKGTKITFEGVGDEKPGYLPSDIVFLIDEKKHPLFRREGNDLE  293

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             + V+IPLV ALTGC I++P LGG  M L+ ++ +IYPG EK I GQGMPN  N G RGDL
Sbjct  294   ICVEIPLVDALTGCFISIPLLGGENMGLSFENNVIYPGYEKVIKGQGMPNPKNNGIRGDL  353

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              ++F + FPT+LSEEQR + ASIL+DCC
Sbjct  354   HVKFFIEFPTELSEEQRKEAASILQDCC  381


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = -1

Query  2423  RLLSRTTSRLAISPKFSKSSSRKGNKTP---RAADFYAHLERSTSFSGTQSHDLLGTSSK  2253
             R++SR  S  ++S K + S  +  N      + AD      R   +    S  L    S 
Sbjct  126   RIMSRRGSPASLSSKLNISEPKLTNHVASPTKDADACLKTTRKPEYIPAVS--LSSNLSC  183

Query  2252  RTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYK  2073
             R  TPII S++ +RRKPP VE++L CTLE LC+GC K++K+TR+++   G +  E  I K
Sbjct  184   RLTTPIIFSQTTARRKPPEVERKLHCTLENLCFGCIKKIKVTRDVIKYPGVIIQEEEILK  243

Query  2072  IYVTINY  2052
             I V   +
Sbjct  244   IEVKPGW  250



>ref|XP_008449405.1| PREDICTED: dnaJ homolog subfamily B member 1 [Cucumis melo]
Length=393

 Score =   203 bits (517),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 125/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
              I+  +I+QEEE + I+VKP W++GTKITFEGKGDE+PG LPAD+ F I+E++H +F R+
Sbjct  241   AIVNGIIVQEEELLKIEVKPGWKKGTKITFEGKGDEKPGYLPADITFSIDERRHPLFSRD  300

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQG  1696
             GDDL+LGV+IPLV ALTGC+IT+P LGG +M L+ D+ IIYPG +K I GQGMPN   QG
Sbjct  301   GDDLDLGVEIPLVNALTGCSITIPLLGGEKMSLSFDN-IIYPGFQKAIKGQGMPNPKQQG  359

Query  1695  QRGDLRLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              RGDLR++FLV FP+ L+++QR + A+IL+DCC
Sbjct  360   IRGDLRIQFLVKFPSQLTQQQRDEAATILQDCC  392


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 85/161 (53%), Gaps = 21/161 (13%)
 Frame = -1

Query  2474  PESLEQDEDEELFISGPRLLSRTTSRLAISP-KFSKSSSRKGN------KTPRAADFYAH  2316
             P SL ++         PR LSR  SR + +P   S+   R+ N      + P + +F   
Sbjct  103   PRSLSRNTSRRSTTPSPRSLSRNASRRSTTPTSLSREEKRRSNSDLEFLREPISRNFSRR  162

Query  2315  LERSTSFSG-------TQSHDLLGTSSKRTA------TPIILSESISRRKPPPVEKRLEC  2175
              + S S  G       + +++ +G+ S+ T+      TPII S+S + +KPPP+EK+LEC
Sbjct  163   TDVSESNEGGIFSEANSTANNNIGSLSRNTSRRSPKSTPIIYSQSTALKKPPPIEKKLEC  222

Query  2174  TLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             TLEELC GC K++ ITR+ + N G +  E  + KI V   +
Sbjct  223   TLEELCEGCVKKIMITRDAIVN-GIIVQEEELLKIEVKPGW  262



>ref|XP_010068172.1| PREDICTED: dnaJ protein homolog 1 [Eucalyptus grandis]
Length=352

 Score =   202 bits (513),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
             VI    IIQEEE + I VKP W++GTKI+FEGKGD++PG LPAD++F IEEK+H +FKR 
Sbjct  199   VISDTGIIQEEETLKINVKPGWKKGTKISFEGKGDQKPGYLPADIVFSIEEKRHRLFKRR  258

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--G  1696
             GD+LE+ V+IPLVQAL GCT++VP LGG EM +   DE+I+PG EK IPGQGMPN +  G
Sbjct  259   GDNLEIAVEIPLVQALAGCTLSVPLLGGEEMKVPF-DEVIFPGYEKAIPGQGMPNPKEDG  317

Query  1695  QRGDLRLRFLVGFPTDLSEEQRSQVASILRDCC  1597
             +RGDLRL+F V FP +L +EQRS+++SIL  CC
Sbjct  318   KRGDLRLKFYVEFPDELDDEQRSEISSILEGCC  350


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 78/127 (61%), Gaps = 5/127 (4%)
 Frame = -1

Query  2420  LLSRTTSRLAISPKFSKSSSRKGNKTPRAADFYAHLERSTS---FSGTQSHDLLGTS-SK  2253
              LS++TSR + +P  S S +        ++  ++   RSTS    S T++   L  + S+
Sbjct  95    FLSKSTSRRSHTPNPSLSRTSSRINPSSSSSDFSTFLRSTSRKVGSETEAPATLSRNMSR  154

Query  2252  RTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYK  2073
             + +TPI+ S + +RRKP P+EK+LECTLEELC+G  K+VKI R+++S+TG +  E  + K
Sbjct  155   KGSTPILFSHTAARRKPAPIEKKLECTLEELCHGSVKKVKIKRDVISDTGIIQEEETL-K  213

Query  2072  IYVTINY  2052
             I V   +
Sbjct  214   INVKPGW  220



>ref|XP_009593286.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   201 bits (511),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             + +EEE +TIKVKP W +GTKITFEGKG+ERPG  PADVIFVI EK+H +F+REGD+LEL
Sbjct  270   LTEEEEVLTIKVKPGWTKGTKITFEGKGNERPGTSPADVIFVIAEKRHPLFRREGDNLEL  329

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
              V+IPLV+ALTGCTI++P LGG +M L +DD IIYPG EK I GQGM  P  QG RG+L 
Sbjct  330   AVEIPLVKALTGCTISIPLLGGEKMSLTIDD-IIYPGYEKIIAGQGMAKPKEQGNRGNLI  388

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             + FLV FPT+L+EEQRS V  IL D C
Sbjct  389   ITFLVAFPTELTEEQRSDVVRILEDSC  415


 Score = 40.8 bits (94),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -1

Query  2261  SSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSN  2109
             +S+R++TPI+ S S    KPPP+E+ LECTLEELC+GC K++K+TR+ +++
Sbjct  217   ASRRSSTPIMFSSSTGLVKPPPMEETLECTLEELCFGCVKKMKVTRDTVTD  267



>ref|XP_006473023.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Citrus sinensis]
 gb|KDO80583.1| hypothetical protein CISIN_1g036222mg [Citrus sinensis]
Length=298

 Score =   199 bits (507),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             +IQ+EE ++IKVKP W++GTKITFEGKG+E PG  PAD+IF+I EK+H +F+R+GDDLEL
Sbjct  152   LIQDEEVLSIKVKPGWKKGTKITFEGKGNEVPGTQPADIIFLIAEKRHHLFRRDGDDLEL  211

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLR  1678
              V+IPLV+ALTGCTI+VP LGG +M L++DDEII+PG  K I GQGMP    +G RG+L+
Sbjct  212   AVEIPLVKALTGCTISVPLLGGEKMDLSIDDEIIHPGYVKMIEGQGMPTKDPEGARGNLK  271

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             L FLV FPT+L++EQRS V  IL DCC
Sbjct  272   LLFLVDFPTELTDEQRSNVLGILEDCC  298


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -1

Query  2303  TSFSGTQSHDLLGTSSKRTATPIILSESIS-RRKPPPVEKRLECTLEELCYGCTKEVKIT  2127
             T   G     L   +S+R+ TPI+ S S     KPP VEK+LECTLEELC+GCTK++KIT
Sbjct  83    TGHPGASPASLSRNTSRRSTTPIMYSNSTGIPVKPPAVEKKLECTLEELCFGCTKKIKIT  142

Query  2126  REILSNTGYVCVEHNIYKIYVTINY  2052
             R+ ++++G +  +  +  I V   +
Sbjct  143   RDAITSSGQLIQDEEVLSIKVKPGW  167



>ref|XP_009790113.1| PREDICTED: uncharacterized protein LOC104237630 [Nicotiana sylvestris]
Length=409

 Score =   194 bits (493),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 115/145 (79%), Gaps = 3/145 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             + +EEE +TIKVKP W +GTKITFEGKGDERPG  PADVIFVI EK+H +F+REGD+LEL
Sbjct  264   LTEEEEVLTIKVKPGWTKGTKITFEGKGDERPGTSPADVIFVIAEKRHLLFRREGDNLEL  323

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
              V+IPLV+ALTGCTI++P L G +M L +DD IIYPG EK I GQGM  P  QG RG+L 
Sbjct  324   AVEIPLVKALTGCTISIPLLCGEKMSLTIDD-IIYPGYEKIIAGQGMAKPKEQGNRGNLI  382

Query  1677  LRFLVGFPTDLSEEQRSQVASILRD  1603
             + FLV FPT+L+EEQ+S V  IL D
Sbjct  383   ITFLVAFPTELTEEQKSDVVRILED  407


 Score = 46.6 bits (109),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 24/122 (20%)
 Frame = -1

Query  2432  SGPRL---LSRTTSRL--------AISPKFSKSSS-RKGNKTPRAADFYAHLERSTSFSG  2289
             SGP L   LSR  SR         A+   FS+S+S R  ++ P AA        ST+   
Sbjct  154   SGPALASTLSRNASRTHDRVDSTHAVPKSFSRSASLRNRSEAPPAA--------STALPA  205

Query  2288  TQSHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSN  2109
             + S +    +S+R++TPI+ S S    KPPP+E+ LECTLEELC+GC K++K+TR+ +++
Sbjct  206   SFSRN----ASRRSSTPIMFSSSTGLVKPPPMEETLECTLEELCFGCVKKMKVTRDAVTD  261

Query  2108  TG  2103
              G
Sbjct  262   IG  263



>ref|XP_002529542.1| heat shock protein binding protein, putative [Ricinus communis]
 gb|EEF32845.1| heat shock protein binding protein, putative [Ricinus communis]
Length=257

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
             +I   +I Q EE + IKVKP W++GTKITFEGKGDERPG LPAD+IF+I+EK+H +F RE
Sbjct  107   IISNGIIKQVEEILKIKVKPGWKKGTKITFEGKGDERPGYLPADIIFLIDEKRHPLFTRE  166

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN-QGQ  1693
             GDDLE G++IPLVQALTGC+I+VP LGG +M L+  DEII+P  EK IPGQGMP   +G 
Sbjct  167   GDDLEYGLEIPLVQALTGCSISVPLLGGEKMRLSF-DEIIFPRFEKVIPGQGMPTKREGH  225

Query  1692  RGDLRLRFLVGFPTDLSEEQRSQVASILRDCC  1597
             RGDLR++F V FP  LS+EQRS+ + IL+DC 
Sbjct  226   RGDLRIKFFVEFPLQLSDEQRSEASRILQDCS  257


 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -1

Query  2255  KRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIY  2076
             K   TPI+ S+S + R P P+E++L CTLEELC+GC K++KITR+I+SN G +     I 
Sbjct  62    KGNTTPIVYSQSTAWRIPSPIERKLACTLEELCHGCVKKIKITRDIISN-GIIKQVEEIL  120

Query  2075  KIYVTINY  2052
             KI V   +
Sbjct  121   KIKVKPGW  128



>ref|XP_007042244.1| HSP40/DnaJ peptide-binding protein, putative [Theobroma cacao]
 gb|EOX98075.1| HSP40/DnaJ peptide-binding protein, putative [Theobroma cacao]
Length=393

 Score =   201 bits (512),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I+QEEE +TI +KP WR+GTK+TFEGKG+E+PG LPAD+IF+I+EK H +F R+GDDLE
Sbjct  248   IIVQEEETLTINLKPGWRKGTKVTFEGKGNEKPGYLPADIIFLIQEKSHPLFTRQGDDLE  307

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN-NQGQRGDLR  1678
             + V+IPLV+ALTGC+++VP LGG  M ++ +D IIYPG EK I GQGMPN  +G+RGDLR
Sbjct  308   IAVEIPLVKALTGCSLSVPLLGGETMSIHFND-IIYPGYEKVIQGQGMPNAKEGKRGDLR  366

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             + FLV FP++LS +QRS+  SIL DC
Sbjct  367   ITFLVNFPSELSHQQRSEACSILEDC  392


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 101/202 (50%), Gaps = 39/202 (19%)
 Frame = -1

Query  2543  DKQTATFDVDNQNTPKGSS-RKTLPESLEQ-DEDEELFISGPRLLSRTTSRLAISPK---  2379
             D+   T + + Q    GSS R +  E L     D+  F      LS++TSR + +P    
Sbjct  64    DEAYKTINSNKQEQGFGSSDRPSTREKLNNLSVDDSFFSRRSSFLSKSTSRRSTTPSPRP  123

Query  2378  --FSKSSSRKGNKTPRAADFY----------AHLERSTSFSG------------------  2289
                SKSSSR+G+ + +  +F           A  E S + SG                  
Sbjct  124   TYLSKSSSRRGSPS-KTLNFALSRTFSRRSRADAETSPNVSGSVGGHSPSPLSRSMSRKC  182

Query  2288  ---TQSHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREI  2118
                T+  ++  ++S+R+ TPII S+S++RRKPPPVEK LECTLEELC+G  K++K+ R++
Sbjct  183   TSETEMRNISRSTSRRSTTPIIFSQSVARRKPPPVEKMLECTLEELCHGGLKKIKVIRDV  242

Query  2117  LSNTGYVCVEHNIYKIYVTINY  2052
             +S+ G +  E     I +   +
Sbjct  243   ISDEGIIVQEEETLTINLKPGW  264



>ref|XP_006585485.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Glycine max]
 gb|KHN11234.1| DnaJ like subfamily B member 13 [Glycine soja]
Length=384

 Score =   201 bits (511),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +IIQEEE + I+VKP WR+GTKITFEG GDE+PG LPAD++F+I+EKKH +F+REG DLE
Sbjct  237   VIIQEEEILKIEVKPGWRKGTKITFEGVGDEKPGYLPADIVFLIDEKKHPLFRREGIDLE  296

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             +GV+IPLV ALTGC I++P LGG  M L+ ++++IYPG EK I GQGMP+  N G RGDL
Sbjct  297   IGVEIPLVDALTGCFISIPLLGGENMGLSFENDVIYPGYEKVIKGQGMPDPKNNGIRGDL  356

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              +RFL+ FP +LSEE+R + ASIL+DCC
Sbjct  357   LVRFLIEFPRELSEERRKEAASILQDCC  384


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 71/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  2489  SRKTLPESLEQDEDEELFISGPRLLSRTTSRLAISPKFSKSSSRKGNKTPRAADFYAHLE  2310
             S++  P SL  ++   L IS P L +   S    +   +K+++RK    P  +       
Sbjct  130   SKRVSPPSLSSNK---LDISEPELTNHVASPTKDADAGAKTTTRKTQHIPAVS-------  179

Query  2309  RSTSFSGTQSHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKI  2130
                         L    S R+ TPII S++ +RRKPP VE+ L CTLE LC+GC K VK+
Sbjct  180   ------------LSSNMSCRSTTPIIFSQTTTRRKPPQVERTLYCTLENLCFGCKKNVKV  227

Query  2129  TREILSNTGYVCVEHNIYKIYVTINY  2052
             TR+ +   G +  E  I KI V   +
Sbjct  228   TRDAIKFPGVIIQEEEILKIEVKPGW  253



>ref|XP_011009738.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Populus euphratica]
Length=334

 Score =   169 bits (428),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
             V++  +I Q+ E V I VKP W++GT+ITFEGKGDERPG  PAD+IF+I+EK H +F+RE
Sbjct  178   VMINGIIEQQGEMVNITVKPGWKKGTRITFEGKGDERPGYQPADLIFLIDEKPHLLFERE  237

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQG  1696
              D+L    +IPL QAL GC I+VP L G  M L+ D  ++YPG  K I GQGMP  N  G
Sbjct  238   DDNLVYKAEIPLAQALVGCAISVPLLEGERMSLSFDI-VLYPGYVKIIKGQGMPTSNEIG  296

Query  1695  QRGDLRLRFLVGFPTDLSEEQRSQVASILRDC  1600
             +RGDLR++FL+ FP  LS EQR   +SIL+DC
Sbjct  297   KRGDLRIKFLINFPMSLSPEQRFDASSILKDC  328


 Score = 70.9 bits (172),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 63/119 (53%), Gaps = 14/119 (12%)
 Frame = -1

Query  2447  EELFISGPRLLSRTTSR----LAISPKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQS  2280
             EE F   P +L R+ SR    L+ SP F    +   + +PR       L+    F     
Sbjct  71    EESFFYRPSILLRSLSRKSSTLSTSPSFLPKGASSRDNSPRNESHRGCLDIENPF-----  125

Query  2279  HDLLGTSSKRTA--TPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSN  2109
                L  S  R +  +PII S+S   +KPPP EK+LECTLEELC+GC K++  +R+++ N
Sbjct  126   ---LQRSMSRISPRSPIIFSQSTLLKKPPPTEKKLECTLEELCFGCVKQIMTSRDVMIN  181



>gb|KDP38849.1| hypothetical protein JCGZ_05006 [Jatropha curcas]
Length=463

 Score =   203 bits (517),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I QEEE + I+V+P W++GTKITFEGKGDE+PG  PAD+I V+EEK+H +F+REGDDLE
Sbjct  316   IIDQEEEVLKIRVQPGWKKGTKITFEGKGDEKPGYHPADIILVVEEKRHPLFEREGDDLE  375

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN-QGQRGDLR  1678
             L ++IPLV+ALTGC+I+VP LGG +M L+ DD IIYPG EK I GQGMP   +G+RGDLR
Sbjct  376   LALKIPLVKALTGCSISVPLLGGEKMCLSFDD-IIYPGFEKVIRGQGMPTTEEGKRGDLR  434

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC*C  1591
             ++F V FP +LS+EQR+Q +SIL+DC  C
Sbjct  435   IKFFVEFPIELSDEQRTQASSILQDCFSC  463


 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = -1

Query  2252  RTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYK  2073
             + + PI+ S+S +RR PPP+EK+LEC+LEELC GC K+VKITR  L N G +  E  + K
Sbjct  267   KGSAPIVYSQSTARRTPPPIEKKLECSLEELCRGCIKKVKITRSFLRN-GIIDQEEEVLK  325

Query  2072  IYVTINY  2052
             I V   +
Sbjct  326   IRVQPGW  332



>ref|WP_024124984.1| folate-binding protein YgfZ [Thermosynechococcus sp. NK55a]
 ref|YP_008900105.1| folate-binding protein YgfZ [Thermosynechococcus sp. NK55a]
 gb|AHB88592.1| folate-binding protein YgfZ [Thermosynechococcus sp. NK55a]
Length=313

 Score =   197 bits (502),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 183/307 (60%), Gaps = 10/307 (3%)
 Frame = +2

Query  380   AVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTIDIAHAWIMK  559
             AV D SH+GR+R++G DR++FLHNQS+ +   L  GQG DTVF+T TART+D+    + +
Sbjct  13    AVYDCSHWGRLRLTGGDRLKFLHNQSSNHCLALQPGQGADTVFLTSTARTLDLVTLLVHQ  72

Query  560   NAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIVEGLNLGDL  739
               + L+ SP+  E +   L KYIFF D V++ D + ++  + + G  + ++     LG L
Sbjct  73    EWVDLLVSPQRREFLLKWLDKYIFFGDDVQLSDRTPESYCYRVFGSVAEKMTAQFGLGPL  132

Query  740   VGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGAVPMGSNAW  919
                PY  H   +    P+T+A  + ++  G +L     + + +   L  Y    +    W
Sbjct  133   -ANPY-DHVTITHEDAPLTLAATSGLAIPGLTLW----SDRPLRDLLSPYPQ--LSDTDW  184

Query  920   EELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDGIKQRLWGI  1099
             E LRI QGRPA   ELT+ +N LE  L + +S NKGCY GQETI+RL TY G+KQ LWG+
Sbjct  185   EHLRIRQGRPAADAELTEAYNPLEGRLGHTISFNKGCYIGQETIARLNTYQGVKQHLWGL  244

Query  1100  RLsssvepgssisVDGKKVGKLTSVTSSGDTSKPFGLGYIRKKAASegdtviigdgvvgt  1279
               +++V P + + ++G+KVG +TS T  G  +  FGLGY+R K    G T+   +GV+  
Sbjct  245   EFTAAVTPPTPLILEGEKVGLVTSCTPLGRGA--FGLGYVRTKVGGAGLTLHTPEGVMAQ  302

Query  1280  vvevPFL  1300
             VVEVPFL
Sbjct  303   VVEVPFL  309



>ref|XP_006434230.1| hypothetical protein CICLE_v10003769mg, partial [Citrus clementina]
 gb|ESR47470.1| hypothetical protein CICLE_v10003769mg, partial [Citrus clementina]
Length=378

 Score =   199 bits (507),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 121/147 (82%), Gaps = 2/147 (1%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             +IQ+EE ++IKVKP W++GTKITFEGKG+E PG  PAD+IF++ EK+H +F+R+GDDLEL
Sbjct  232   LIQDEEVLSIKVKPGWKKGTKITFEGKGNEVPGTQPADIIFLVAEKRHHLFRRDGDDLEL  291

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLR  1678
              V+IPLV+ALTGCTI+VP LGG +M L++DDEII+PG  K I GQGMP    +G RG+L+
Sbjct  292   AVEIPLVKALTGCTISVPLLGGEKMDLSIDDEIIHPGYVKMIEGQGMPTKDPEGARGNLK  351

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             L FLV FPT+L++EQRS V  IL DCC
Sbjct  352   LLFLVDFPTELTDEQRSNVLGILEDCC  378


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -1

Query  2303  TSFSGTQSHDLLGTSSKRTATPIILSESIS-RRKPPPVEKRLECTLEELCYGCTKEVKIT  2127
             T   G     L   +S+R+ TPI+ S S     KPP VEK+LECTLEELC+GCTK++KIT
Sbjct  163   TGHPGASPASLSRNTSRRSTTPIMYSNSTGIPVKPPAVEKKLECTLEELCFGCTKKIKIT  222

Query  2126  REILSNTGYVCVEHNIYKIYVTINY  2052
             R+ ++++G +  +  +  I V   +
Sbjct  223   RDAITSSGQLIQDEEVLSIKVKPGW  247



>ref|XP_004485492.1| PREDICTED: uncharacterized protein LOC101514711 [Cicer arietinum]
Length=385

 Score =   199 bits (507),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +IIQEEE + I+VKP WR+GTKITFEG GDE+PG LP D++F+I+EKKH +F R+G+DLE
Sbjct  238   VIIQEEEILKIEVKPGWRKGTKITFEGVGDEKPGYLPTDIVFLIDEKKHPLFMRDGNDLE  297

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             +GV+IPLV AL GC+I +P LGG +M L+ ++ +IYPG EK I GQGMPN  N   RGDL
Sbjct  298   IGVEIPLVDALAGCSIPIPLLGGDKMTLSFENTVIYPGFEKVIQGQGMPNPKNNSTRGDL  357

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              ++FL+ FPT+L++EQR +  SIL+DCC
Sbjct  358   HVKFLIDFPTELNDEQRKEAVSILQDCC  385


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  2243  TPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYV  2064
             TPII S++  RRKPP V+K+L CTLEELC+G  K++K+TR+++ + G +  E  I KI V
Sbjct  191   TPIIFSQTTVRRKPPEVQKKLHCTLEELCFGTVKKIKVTRDVIKHPGVIIQEEEILKIEV  250

Query  2063  TINY  2052
                +
Sbjct  251   KPGW  254



>ref|WP_011430013.1| aminomethyltransferase [Synechococcus sp. JA-3-3Ab]
 ref|YP_474595.1| aminomethyltransferase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99332.1| putative aminomethyltransferase [Synechococcus sp. JA-3-3Ab]
Length=322

 Score =   196 bits (499),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 173/294 (59%), Gaps = 8/294 (3%)
 Frame = +2

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             L A   G  ++D S +GR+R+ G   + +LHN+ST N + L  GQG DTVFVTPTA  +D
Sbjct  4     LAAVSTGSLLLDRSGWGRLRMKGSPGLDYLHNRSTQNLKALKPGQGADTVFVTPTAGILD  63

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             +A  ++ +    + TSP+    +   L + +      ++QD + QT  F L+G +S  ++
Sbjct  64    LATVYVGEEDCWIWTSPQRRSLLMQSLGRMLPLVRGAQLQDETDQTFGFGLLGSQSQALL  123

Query  716   EGLNLGDLVGQPYGSHKHYSV--NGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDY  889
             E +   + +  P G H+H +V   G PV +A G  +++ GF+L  +     ++ + L+  
Sbjct  124   EKVVGSERI--PTGPHEHCAVEIQGIPVHLACGTGLAQPGFTLWGTIDQKVALEECLLQA  181

Query  890   GAVPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTY  1069
             GA       WE LR+  GRPA  +ELT ++N LEA LW AVSL+KGCY GQE +++ VTY
Sbjct  182   GAKLAPPELWEVLRLEAGRPAADRELTSDYNPLEAGLWRAVSLDKGCYVGQEVLAKQVTY  241

Query  1070  DGIKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPF-GLGYIRKK  1228
               I+Q LWGIRL     PG+ I   G+K+G L   TS+G TS+ + GLGY+R K
Sbjct  242   RRIRQTLWGIRLQGEARPGTEILRQGEKIGLL---TSAGQTSQEYLGLGYVRTK  292



>ref|XP_010103912.1| DnaJ homolog subfamily B member 13 [Morus notabilis]
 gb|EXB97353.1| DnaJ homolog subfamily B member 13 [Morus notabilis]
Length=363

 Score =   197 bits (502),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 3/148 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I+QEEE + I VKP WRRGTKI FEGKGDE+PG LPAD+I +I+EK+H +++REGDDLE
Sbjct  217   VIVQEEEVLWITVKPGWRRGTKIMFEGKGDEKPGYLPADIILLIDEKRHPLYEREGDDLE  276

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             + V+IPLV+ALTGC+I +P LGG  M L+ DD IIYPG EK I GQGMPN   Q +RGDL
Sbjct  277   IVVEIPLVKALTGCSIPIPLLGGDNMTLSFDD-IIYPGYEKVIRGQGMPNPKEQSRRGDL  335

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
             R++FLV FP +LS+EQR++   IL+DC 
Sbjct  336   RIKFLVEFPAELSDEQRAEAVDILQDCS  363


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -1

Query  2258  SKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNI  2079
             S ++ TPI+ S+S +++KP PVE++LEC LEEL  GC K++KITR++++ TG +  E  +
Sbjct  165   STQSTTPIVFSQSTAKKKPAPVERKLECALEELLDGCVKKIKITRDVIAETGVIVQEEEV  224

Query  2078  YKIYVTINY  2052
               I V   +
Sbjct  225   LWITVKPGW  233



>gb|KCW62966.1| hypothetical protein EUGRSUZ_G00563 [Eucalyptus grandis]
Length=307

 Score =   195 bits (495),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             IIQEEE + I VKP W++GTKI+FEGKGD++PG LPAD++F IEEK+H +FKR GD+LE+
Sbjct  162   IIQEEETLKINVKPGWKKGTKISFEGKGDQKPGYLPADIVFSIEEKRHRLFKRRGDNLEI  221

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDLR  1678
              V+IPLVQAL GCT++VP LGG EM +   DE+I+PG EK IPGQGMPN +  G+RGDLR
Sbjct  222   AVEIPLVQALAGCTLSVPLLGGEEMKVPF-DEVIFPGYEKAIPGQGMPNPKEDGKRGDLR  280

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             L+F V FP +L +EQRS+++  + DC
Sbjct  281   LKFYVEFPDELDDEQRSEISREIHDC  306


 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -1

Query  2258  SKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNI  2079
             S++ +TPI+ S + +RRKP P+EK+LECTLEELC+G  K+VKI R+++S+TG +  E  +
Sbjct  110   SRKGSTPILFSHTAARRKPAPIEKKLECTLEELCHGSVKKVKIKRDVISDTGIIQEEETL  169

Query  2078  YKIYVTINY  2052
              KI V   +
Sbjct  170   -KINVKPGW  177



>ref|XP_011027502.1| PREDICTED: mitochondrial protein import protein MAS5-like [Populus 
euphratica]
Length=360

 Score =   196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             IIQEEE +TIKVKP W++GTKITFEG G+ERPG  PAD+IFVI EK+HS+F+REG+DLE+
Sbjct  215   IIQEEEILTIKVKPGWKKGTKITFEGMGNERPGSCPADIIFVIAEKRHSLFRREGEDLEI  274

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLR  1678
             GV+IPLV+ALTGC I++P LGG +  L +DD IIYPG E+ I GQGMPN   QG+RG L+
Sbjct  275   GVEIPLVKALTGCKISIPLLGGKKTSLLIDD-IIYPGYERIIEGQGMPNTKEQGKRGSLK  333

Query  1677  LRFLVGFPTDLSEEQRSQVASILRD  1603
             + FLV FPT+L++EQRS + SIL+D
Sbjct  334   VVFLVEFPTELTDEQRSDILSILQD  358


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = -1

Query  2432  SGPRLLSRTTSRLAISPKFSKSSSRKGN-KTPRAADFYAHLERSTSFSGTQSH-----DL  2271
             S PR   +  S     P  S   SR G+ K+P     +  L+R+ S   T SH      L
Sbjct  100   SSPRGFFKHKSMDGCFPNISSPLSRTGSRKSPSLKPPF--LKRNMSRRSTDSHHGSSASL  157

Query  2270  LGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCV  2091
                +S+ + + I+ S S+ + KPP +E+ LECTL+ELCYGC K++KITR++++NTG +  
Sbjct  158   SRNASRNSTSNIMFSNSMGKMKPPAIERPLECTLDELCYGCMKKIKITRDVITNTGQIIQ  217

Query  2090  EHNIYKIYVTINY  2052
             E  I  I V   +
Sbjct  218   EEEILTIKVKPGW  230



>ref|XP_002300977.2| hypothetical protein POPTR_0002s08220g [Populus trichocarpa]
 gb|EEE80250.2| hypothetical protein POPTR_0002s08220g [Populus trichocarpa]
Length=377

 Score =   196 bits (498),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             IIQEEE +TIKVKP W++GTKITFEG G+ERPG  PAD+IFVI EK+HS+F+REG+DLE+
Sbjct  232   IIQEEEILTIKVKPGWKKGTKITFEGMGNERPGSCPADIIFVIAEKRHSLFRREGEDLEI  291

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLR  1678
             GV+IPLV+ALTGC I++P LGG +  L +DD IIYPG E+ I GQGMPN   QG+RG L+
Sbjct  292   GVEIPLVKALTGCQISIPLLGGKKTSLLIDD-IIYPGYERIIEGQGMPNTKEQGKRGSLK  350

Query  1677  LRFLVGFPTDLSEEQRSQVASILRD  1603
             + FLV FPT+L++EQRS + SIL+D
Sbjct  351   VVFLVEFPTELTDEQRSDILSILQD  375


 Score = 80.9 bits (198),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 89/174 (51%), Gaps = 14/174 (8%)
 Frame = -1

Query  2552  RKRDKQTATFDVDNQNTPKG-SSRKTLPESLEQDEDEELFISGPRLLSRTTSRLAISPKF  2376
             R+ D Q   +D +++ T  G  S +   +++  D       S PR   +  S     P  
Sbjct  81    RRWDFQELGYDTEDEKTMNGIHSLRYNADNMRGDNP-----SSPRGFFKHKSMDGCFPNI  135

Query  2375  SKSSSRKGN-KTPRAADFYAHLERSTSFSGTQSH-----DLLGTSSKRTATPIILSESIS  2214
             S   SR G+ K+P     +  L+R+ S   T SH      L   +S+ + + I+ S S  
Sbjct  136   SSPLSRTGSRKSPSLKPPF--LKRNMSRRSTDSHHGSSASLSRNASRNSTSNIMFSNSTG  193

Query  2213  RRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             + KPP +E+ LECTL+ELCYGC K++KITR++++NTG +  E  I  I V   +
Sbjct  194   KMKPPAIERPLECTLDELCYGCMKKIKITRDVITNTGQIIQEEEILTIKVKPGW  247



>gb|KHG30797.1| DnaJ subfamily B member 13 [Gossypium arboreum]
Length=348

 Score =   160 bits (404),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 108/144 (75%), Gaps = 3/144 (2%)
 Frame = -3

Query  2028  IQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLELG  1849
             ++ +E ++I V+P W++GTKITFEG G+E P    ADV FVI EK+H +F R+GDDLEL 
Sbjct  203   VEHKEMLSINVEPGWKKGTKITFEGMGNEVPRLYAADVTFVIAEKQHPIFGRDGDDLELT  262

Query  1848  VQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDLRL  1675
             ++IPLV+ALTGC++ +P LGG +M L + DEII+PG EK I GQGMP  +    RG+L++
Sbjct  263   IEIPLVKALTGCSLPIPLLGGEKMELKI-DEIIHPGYEKIITGQGMPTTKEAASRGNLKV  321

Query  1674  RFLVGFPTDLSEEQRSQVASILRD  1603
             RFL+ FPT+L+++QR+    IL D
Sbjct  322   RFLINFPTELTDDQRAAAVRILGD  345


 Score = 73.2 bits (178),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 1/63 (2%)
 Frame = -1

Query  2273  LLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVC  2094
             L G++S+    PI+ S S    KPPP+EK+LECTLE+LCYGCT+++KI R++++ +G   
Sbjct  144   LSGSTSRPNGNPIMFSNSTGVVKPPPIEKQLECTLEDLCYGCTEKIKIKRDVITESGQR-  202

Query  2093  VEH  2085
             VEH
Sbjct  203   VEH  205



>ref|XP_004142703.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus]
 ref|XP_004161184.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus]
 gb|KGN54553.1| hypothetical protein Csa_4G361870 [Cucumis sativus]
Length=364

 Score =   169 bits (427),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 4/143 (3%)
 Frame = -3

Query  2028  IQEEEYVTIKVKPEWRRGTKITFEG-KGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             ++EEE +T+KVKP WR+GTKITFEG  G+ER G  PAD  FVI EK+HS FKREGDDLEL
Sbjct  217   MEEEETLTMKVKPGWRKGTKITFEGGMGNERAGSYPADTSFVIAEKRHSYFKREGDDLEL  276

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDLR  1678
              V+IPL++ALTGCTI+VP LGG  M L++  E++ PG EK I GQGMP   +   RGDL 
Sbjct  277   MVEIPLLKALTGCTISVPLLGGETMSLDI-HEVVSPGYEKLIQGQGMPKLKDPDTRGDLI  335

Query  1677  LRFLVGFPTDLSEEQRSQVASIL  1609
             L+F V FPT L+ +QRS V  IL
Sbjct  336   LKFFVDFPTQLTPQQRSDVCRIL  358


 Score = 64.3 bits (155),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -1

Query  2264  TSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVE  2088
             + SKR+ TPI+ S S    K   +EK+LECTLEELC+GC K++K+TR++L   G    E
Sbjct  161   SGSKRSTTPIMFSNSSGVLKAAAIEKQLECTLEELCFGCIKKIKVTRDLLLINGQAMEE  219



>ref|WP_011434198.1| aminomethyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478837.1| glycine cleavage system protein T [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03574.1| aminomethyltransferase, putative [Synechococcus sp. JA-2-3B'a(2-13)]
Length=322

 Score =   192 bits (489),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 168/292 (58%), Gaps = 4/292 (1%)
 Frame = +2

Query  356   LTATENGVAVVDLSHYGRIRVSGEDRVQFLHNQSTANFEILHEGQGCDTVFVTPTARTID  535
             L A   G  ++D S +GR+R+ G   + +LHN+ST N + L  GQG DTVFVTPTA  +D
Sbjct  4     LAAVSTGSLLLDRSGWGRLRMKGSPGLDYLHNRSTQNLKALQPGQGADTVFVTPTAGILD  63

Query  536   IAHAWIMKNAITLVTSPETSERITSMLRKYIFFSDKVEIQDISKQTCFFVLVGPRSNQIV  715
             +A  +  +    + TSP+    +   L + +      +++D + QT  F L+GP+S  ++
Sbjct  64    LATVYAGEEDCWIWTSPQRRSLLMQSLGRMLPLVRGAQLKDETDQTFGFGLLGPQSQALL  123

Query  716   EGLNLGDLVGQPYGSHKHYSVNGNPVTIAVGNIISEEGFSLLVSPATAKSVWKALVDYGA  895
             E +   + +      H    + G PV +A G  +++ GF+L  +     ++ + L+  GA
Sbjct  124   EQVVSSEEIPTRLNEHCAVEIQGIPVHLACGTGLAQPGFTLWGTIDQKVALEECLLQAGA  183

Query  896   VPMGSNAWEELRIIQGRPAPGKELTDEFNVLEANLWNAVSLNKGCYKGQETISRLVTYDG  1075
                    WE LR+  GRPA  +ELT ++N LEA LW AVSL+KGCY GQE +++ VTY  
Sbjct  184   KLAPPELWEVLRLEAGRPAADRELTSDYNPLEAGLWRAVSLDKGCYVGQEVLAKQVTYQR  243

Query  1076  IKQRLWGIRLsssvepgssisVDGKKVGKLTSVTSSGDTSKPF-GLGYIRKK  1228
             I+Q LWGIRL     PG+ I   G+K+G L   TS+G TS+ + GLGY+R K
Sbjct  244   IRQTLWGIRLQGEAHPGTEILRQGEKIGLL---TSAGLTSQGYLGLGYVRTK  292



>ref|XP_006431845.1| hypothetical protein CICLE_v10003603mg [Citrus clementina]
 gb|ESR45085.1| hypothetical protein CICLE_v10003603mg [Citrus clementina]
Length=308

 Score =   192 bits (488),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I QEEE + +K+KP W++GTKITFEGKGD +PG LPAD++F I+EK+H +F+R GDDLE+
Sbjct  163   IYQEEETLRVKLKPGWKKGTKITFEGKGDRKPGYLPADIVFSIDEKRHPLFRRTGDDLEI  222

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
             GV+IPLVQALTGC++ VP LG  +M L+  DEIIYP  EK I GQGM  P  +G+RGDLR
Sbjct  223   GVEIPLVQALTGCSLAVPLLGKEKMNLSF-DEIIYPDFEKVIQGQGMPKPKEEGKRGDLR  281

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             +RFLV FPT+LS  QR +  +IL+DC
Sbjct  282   IRFLVEFPTNLSNAQRHEAYTILQDC  307


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 5/107 (5%)
 Frame = -1

Query  2381  KFSKSSSRKGNKTPRAADFYAHLERS--TSFSGTQSHDLLGTSSKRTATPIILSES-ISR  2211
             + S+ SSR+G  +  + +      R+  T+   T    L    S+R   PII S++  +R
Sbjct  68    QVSEGSSRRGRTSTDSTEGSTRRGRTSETTMESTADPSLSRNMSRRG--PIIFSQTTAAR  125

Query  2210  RKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKI  2070
             RKPPPVE++L CTLEELC G  K++ I REI+S+ G +  E    ++
Sbjct  126   RKPPPVERKLTCTLEELCEGSVKKITINREIVSDDGKIYQEEETLRV  172



>emb|CBI23775.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   192 bits (488),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+QEEE + I++KP WR+GTK+ F+G+GDERPG LPAD+IF+I+EK+H +FKR GD+LE
Sbjct  170   LIVQEEEILRIQIKPGWRQGTKVKFDGRGDERPGTLPADIIFLIDEKRHPIFKRVGDNLE  229

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDL  1681
             +GV+IPLV+A+TGC ++VP LGG +M L +DD IIY G EK IPGQGMP    +G+RGDL
Sbjct  230   IGVEIPLVKAITGCPLSVPLLGGEKMSLFIDD-IIYHGYEKIIPGQGMPMAKQEGRRGDL  288

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRD  1603
             +++FLV FPT+LS++QRS V  IL+D
Sbjct  289   KIKFLVSFPTELSDQQRSDVYRILQD  314


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (61%), Gaps = 15/128 (12%)
 Frame = -1

Query  2432  SGPRLLSRTTSRLAISPK-FSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTSS  2256
             S P  LS++  R + +P   SKS+SR+ N    + DF A L +STS              
Sbjct  73    STPTSLSKSAGRQSTNPNSLSKSASRRSNSAGTSTDFAASLSKSTS--------------  118

Query  2255  KRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIY  2076
             +R+ TPII S+S  RRKP P+EK+LECTLEELC+GC K++KITR+++S+ G +  E  I 
Sbjct  119   RRSTTPIIYSQSTVRRKPQPIEKKLECTLEELCHGCNKKIKITRDVISDIGLIVQEEEIL  178

Query  2075  KIYVTINY  2052
             +I +   +
Sbjct  179   RIQIKPGW  186



>ref|XP_002298168.1| DNAJ chaperone C-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEE82973.1| DNAJ chaperone C-terminal domain-containing family protein [Populus 
trichocarpa]
Length=205

 Score =   164 bits (416),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 107/152 (70%), Gaps = 3/152 (2%)
 Frame = -3

Query  2049  VIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKRE  1870
             VI+  +  Q+ E V I VKP W++GT+ITFEGKGDERPG  PAD+IF+I+EK H  F+RE
Sbjct  49    VIINGITEQQGEMVNITVKPGWKKGTRITFEGKGDERPGYQPADLIFLIDEKPHLFFERE  108

Query  1869  GDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--G  1696
              D+L    +IPL QAL GC I+VP L G  M L+ D  ++YPG  K I GQGMP  +  G
Sbjct  109   DDNLVYKAEIPLAQALGGCAISVPLLEGERMSLSFDI-VLYPGYVKIIKGQGMPTAKEIG  167

Query  1695  QRGDLRLRFLVGFPTDLSEEQRSQVASILRDC  1600
             +RGDLR++FL+ FP  LS EQR   +SIL+DC
Sbjct  168   KRGDLRIKFLINFPMSLSPEQRFDASSILKDC  199


 Score = 66.2 bits (160),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  2243  TPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSN  2109
             +PII S+S   RKPPP EK+LECTLEELCYGC K++  +R+++ N
Sbjct  8     SPIIFSQSTLLRKPPPTEKKLECTLEELCYGCVKQIMTSRDVIIN  52



>ref|XP_004250740.1| PREDICTED: dnaJ protein homolog 1-like [Solanum lycopersicum]
Length=344

 Score =   192 bits (488),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = -3

Query  2079  IQNICNDQLY-VIMCR-------LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLP  1924
             ++ +CN  +  VI+ R       LI++EEE VTI VKP W+RGTKITFEGKGDER G   
Sbjct  175   LEELCNGCVKKVIITRDVVATTGLIVKEEEVVTIMVKPGWKRGTKITFEGKGDERTG---  231

Query  1923  ADVIFVIEEKKHSMFKREGDDLELGVQIPLVQALTGCTITVPTLGGGE-MILNLDDEIIY  1747
              D+IF I+EK H ++KREGDDL LGV++PLVQALTGCTIT+P LG  E M ++ DDEIIY
Sbjct  232   -DIIFSIDEKTHPLYKREGDDLLLGVEVPLVQALTGCTITIPLLGRDEAMTMSFDDEIIY  290

Query  1746  PGLEKTIPGQGMPNNQGQ---RGDLRLRFLVGFPTDLSEEQRSQVASILRD  1603
             PG EK IPGQGMP ++ +   RG+L L+FL+ FP +LSEEQRS+V SIL +
Sbjct  291   PGFEKVIPGQGMPKSKQESTNRGNLVLQFLIQFPLELSEEQRSEVVSILEN  341


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 91/176 (52%), Gaps = 32/176 (18%)
 Frame = -1

Query  2561  ISSRKRDKQTATFDVDNQNTPKGSSRKTLPESLEQDEDEELFISGPRLLSRTTSRLAISP  2382
             + S+K+ ++   F  D   TPK SS+         DE++EL IS P LLSRTTSR  ISP
Sbjct  65    VLSKKKREEADLFKSDTAKTPKKSSK---------DEEDELQISSPTLLSRTTSR--ISP  113

Query  2381  KFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQ------SHDLLGTSSKRTATPIILSES  2220
                              DFY  +    + SGT       S       SK  + PII S+S
Sbjct  114   ---------------TVDFYTSMPACFTMSGTNTPTTPVSDQPPNNLSKVASKPIIFSQS  158

Query  2219  ISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
              SRRK  P+EK+LECTLEELC GC K+V ITR++++ TG +  E  +  I V   +
Sbjct  159   TSRRKTQPIEKKLECTLEELCNGCVKKVIITRDVVATTGLIVKEEEVVTIMVKPGW  214



>ref|XP_006471113.1| PREDICTED: A-agglutinin anchorage subunit-like [Citrus sinensis]
Length=417

 Score =   194 bits (492),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I QEEE + +K+KP W++GTKITFEGKGD +PG LPAD++F I+EK+H +F+R GDDLE+
Sbjct  272   IYQEEETLRVKLKPGWKKGTKITFEGKGDRKPGYLPADIVFSIDEKRHPLFRRTGDDLEI  331

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
             GV+IPLVQALTGC++ VP LG  +M L+  DEIIYP  EK I GQGM  P  +G+RGDLR
Sbjct  332   GVEIPLVQALTGCSLAVPLLGKEKMNLSF-DEIIYPDFEKVIQGQGMPKPKEEGKRGDLR  390

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             +RFLV FPT+LS  QR +  +IL+DC
Sbjct  391   IRFLVEFPTNLSNAQRHEAYTILQDC  416


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = -1

Query  2381  KFSKSSSRKGNKTPRAADFYAHLERS--TSFSGTQSHDLLGTSSKRTATPIILSESIS-R  2211
             + S+ SSR+G  +  + +      R+  T+   T    L    S+R+  PII S++ + R
Sbjct  177   QVSEGSSRRGKTSTDSTEGSTRRGRTSETTMESTADPSLSRNMSRRS--PIIFSQTTAAR  234

Query  2210  RKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKI  2070
             RKPPPVE++L CTLEELC G  K++ I REI+S+ G +  E    ++
Sbjct  235   RKPPPVERKLTCTLEELCEGSVKKITINREIVSDDGKIYQEEETLRV  281



>gb|KDO53503.1| hypothetical protein CISIN_1g014837mg [Citrus sinensis]
Length=417

 Score =   194 bits (492),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I QEEE + +K+KP W++GTKITFEGKGD +PG LPAD++F I+EK+H +F+R GDDLE+
Sbjct  272   IYQEEETLRVKLKPGWKKGTKITFEGKGDRKPGYLPADIVFSIDEKRHPLFRRTGDDLEI  331

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGM--PNNQGQRGDLR  1678
             GV+IPLVQALTGC++ VP LG  +M L+  DEIIYP  EK I GQGM  P  +G+RGDLR
Sbjct  332   GVEIPLVQALTGCSLAVPLLGKEKMNLSF-DEIIYPDFEKVIQGQGMPKPKEEGKRGDLR  390

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             +RFLV FPT+LS  QR +  +IL+DC
Sbjct  391   IRFLVEFPTNLSNAQRHEAYTILQDC  416


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = -1

Query  2381  KFSKSSSRKGNKTPRAADFYAHLERS--TSFSGTQSHDLLGTSSKRTATPIILSESIS-R  2211
             + S+ SSR+G  +  + +      R+  T+   T    L    S+R+  PII S++ + R
Sbjct  177   QVSEGSSRRGRTSTDSTEGSTRRGRTSETTMESTADPSLSRNMSRRS--PIIFSQTTAAR  234

Query  2210  RKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKI  2070
             RKPPPVE++L CTLEELC G  K++ I REI+S+ G +  E    ++
Sbjct  235   RKPPPVERKLTCTLEELCEGSVKKITINREIVSDDGKIYQEEETLRV  281



>ref|XP_010269106.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Nelumbo nucifera]
Length=324

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I+QEEE + IKVKP WR+GTK+TFEG G+E+PG LPAD+IF+I EK+H +FKRE +DL 
Sbjct  178   IIVQEEELLRIKVKPGWRKGTKVTFEGMGNEKPGSLPADIIFLIAEKRHPLFKREENDLV  237

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             L V+IPL++ALTGCTI+VP LGG +M L+LDD IIYPG EK IPGQGMP+   +G+RG L
Sbjct  238   LAVEIPLIKALTGCTISVPLLGGEKMSLSLDD-IIYPGYEKIIPGQGMPDPKEKGRRGGL  296

Query  1680  RLRFLVGFPTDLSEEQRSQVASILR  1606
             R++F + FPT LS EQRS + S+L+
Sbjct  297   RVKFRINFPTQLSSEQRSDIRSLLQ  321


 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = -1

Query  2264  TSSKRTATPIILS-ESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVE  2088
             T   R+ T I+ S  + +RRKPPP+EK+LECTLEELC+GC K++KITR +++++G +  E
Sbjct  123   TGRPRSTTQIMFSYTTTARRKPPPIEKQLECTLEELCHGCVKKIKITRNVVTDSGIIVQE  182

Query  2087  HNIYKIYVTINY  2052
               + +I V   +
Sbjct  183   EELLRIKVKPGW  194



>gb|EYU35448.1| hypothetical protein MIMGU_mgv1a0212672mg, partial [Erythranthe 
guttata]
Length=276

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 121/154 (79%), Gaps = 6/154 (4%)
 Frame = -3

Query  2049  VIMCR-LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKR  1873
              I C  LI+QEE+ + IKVKP W+ GTKI FEGKGDERPG LPAD+IF ++EK H +F+R
Sbjct  114   AISCSGLIVQEEDTLMIKVKPGWKNGTKIVFEGKGDERPGSLPADIIFAVDEKIHPLFER  173

Query  1872  EGDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQGQ  1693
             + DDLE+GV++PLVQALTGCTI+VP LGG E+ + + DEIIYPG EK I GQGMP N+ +
Sbjct  174   KEDDLEVGVEVPLVQALTGCTISVPLLGGEELEICI-DEIIYPGYEKIILGQGMPKNKEE  232

Query  1692  ----RGDLRLRFLVGFPTDLSEEQRSQVASILRD  1603
                 RGDLRL+F+V FP +L++ QR +V SILRD
Sbjct  233   GLMVRGDLRLKFMVEFPEELTDCQRDEVVSILRD  266


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 78/136 (57%), Gaps = 6/136 (4%)
 Frame = -1

Query  2441  LFISGPRLLSRTTSRLAISPKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGT  2262
             L IS P+LLSRTTS ++  P  + S+          +DF  +L   ++ S  Q+     T
Sbjct  1     LHISSPKLLSRTTSWISPIPSPNLSTINPLPPPVIISDFQENLSGGSAPSSPQTPRKQQT  60

Query  2261  SSKRTA------TPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGY  2100
                +TA      TPI  S+S +RRKPPPVE++LECTLE+LC+GC K++ ITR+ +S +G 
Sbjct  61    FLSKTASGRNMTTPIFFSQSAARRKPPPVERKLECTLEDLCFGCVKKIDITRDAISCSGL  120

Query  2099  VCVEHNIYKIYVTINY  2052
             +  E +   I V   +
Sbjct  121   IVQEEDTLMIKVKPGW  136



>ref|XP_002520351.1| Protein psi1, putative [Ricinus communis]
 gb|EEF42137.1| Protein psi1, putative [Ricinus communis]
Length=276

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I+QEEE +TI +KP W++GTKITFEG G+ERPG  PAD+ FVI EK+H +F+REGDDLE+
Sbjct  131   IVQEEELLTIDIKPGWKKGTKITFEGMGNERPGTCPADITFVIAEKRHPLFRREGDDLEI  190

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLR  1678
              V+IPLV+ALTGC I++P LGG    L +DD IIYPG +K + GQGMPN    G++G+L+
Sbjct  191   AVEIPLVKALTGCDISIPLLGGERTTLMIDD-IIYPGFQKIVKGQGMPNTKEHGKKGNLK  249

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             + FLV FPT+L+ EQRS V SIL D C
Sbjct  250   VIFLVEFPTELTNEQRSDVLSILEDSC  276


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -1

Query  2243  TPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYV  2064
             TPI+ S S    KPP V+K LECTLE+LC+GCTK++K+TR++L+NTG +  E  +  I +
Sbjct  83    TPIMFSNSTGMLKPPAVQKYLECTLEDLCHGCTKKIKVTRDVLTNTGQIVQEEELLTIDI  142



>ref|XP_010657685.1| PREDICTED: dnaJ homolog subfamily B member 4 [Vitis vinifera]
Length=415

 Score =   192 bits (489),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+QEEE + I++KP WR+GTK+ F+G+GDERPG LPAD+IF+I+EK+H +FKR GD+LE
Sbjct  269   LIVQEEEILRIQIKPGWRQGTKVKFDGRGDERPGTLPADIIFLIDEKRHPIFKRVGDNLE  328

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDL  1681
             +GV+IPLV+A+TGC ++VP LGG +M L +DD IIY G EK IPGQGMP    +G+RGDL
Sbjct  329   IGVEIPLVKAITGCPLSVPLLGGEKMSLFIDD-IIYHGYEKIIPGQGMPMAKQEGRRGDL  387

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
             +++FLV FPT+LS++QRS V  IL+D  
Sbjct  388   KIKFLVSFPTELSDQQRSDVYRILQDSS  415


 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (61%), Gaps = 15/128 (12%)
 Frame = -1

Query  2432  SGPRLLSRTTSRLAISPK-FSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTSS  2256
             S P  LS++  R + +P   SKS+SR+ N    + DF A L +STS              
Sbjct  172   STPTSLSKSAGRQSTNPNSLSKSASRRSNSAGTSTDFAASLSKSTS--------------  217

Query  2255  KRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIY  2076
             +R+ TPII S+S  RRKP P+EK+LECTLEELC+GC K++KITR+++S+ G +  E  I 
Sbjct  218   RRSTTPIIYSQSTVRRKPQPIEKKLECTLEELCHGCNKKIKITRDVISDIGLIVQEEEIL  277

Query  2075  KIYVTINY  2052
             +I +   +
Sbjct  278   RIQIKPGW  285



>ref|XP_003593020.1| DnaJ homolog subfamily B member [Medicago truncatula]
 gb|AES63271.1| DnaJ chaperone carboxy-terminal domain protein [Medicago truncatula]
Length=382

 Score =   191 bits (486),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +IIQEEE + I+VKP WR+GTKITFEG GDE+PG LPAD++F+I+EK+H +F R G+DLE
Sbjct  232   VIIQEEEILKIEVKPGWRKGTKITFEGVGDEKPGYLPADIVFLIDEKEHHLFSRNGNDLE  291

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             + V+IPL+ AL GC++ +P LGG +M L  ++ +IYPG EK I GQGMPN  N   RGDL
Sbjct  292   ICVRIPLLDALAGCSMPIPLLGGEKMNLAFENTVIYPGFEKVIEGQGMPNPKNNSTRGDL  351

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              ++FL+  PT+LS+EQR +V +IL+DCC
Sbjct  352   HVKFLIDLPTELSDEQREEVVTILQDCC  379


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 56/95 (59%), Gaps = 3/95 (3%)
 Frame = -1

Query  2336  AADFYAHLERSTSFSGTQSHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELC  2157
             A DF     R   F    S  L    ++R+ TPII S++  RRKPP VEK+L+ TLEELC
Sbjct  157   ANDFVIKNPREEHF---HSVSLSSNLNRRSTTPIIFSQTTVRRKPPVVEKKLQFTLEELC  213

Query  2156  YGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             +GC K++K+TR+ + + G +  E  I KI V   +
Sbjct  214   FGCVKKIKVTRDAIKDPGVIIQEEEILKIEVKPGW  248



>ref|XP_010243531.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Nelumbo nucifera]
Length=344

 Score =   190 bits (483),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+QEEE + IKVKP W+RGTK+TFEG GDE+PG LPAD++F+I EK H +FKR  DDL 
Sbjct  199   LIVQEEETLKIKVKPGWKRGTKVTFEGMGDEKPGSLPADIVFLIAEKHHPLFKRVEDDLL  258

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPN--NQGQRGDL  1681
             L ++IPL+ ALTGCT+++P LGG +M L L D IIYPG EK IPGQGMP+  +QG+RGDL
Sbjct  259   LTIEIPLLSALTGCTLSIPLLGGAKMSLQLKD-IIYPGYEKIIPGQGMPDPRDQGRRGDL  317

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRD  1603
             R++F + FPT LS +QRS++  +L D
Sbjct  318   RVKFHINFPTQLSNQQRSEIRDLLGD  343


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  2282  SHDLLGTSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTG  2103
             S  L  + S+R+ TPI+ S S +RRKP P+EK+LECTLEELC+GC K++KITR+++S+ G
Sbjct  139   SSSLTKSMSQRSTTPIMYSFSRARRKPAPIEKQLECTLEELCHGCVKKIKITRDVVSDVG  198

Query  2102  YVCVEHNIYKIYVTINY  2052
              +  E    KI V   +
Sbjct  199   LIVQEEETLKIKVKPGW  215



>gb|ADW83718.1| DnaJ-like protein [Musa acuminata AAA Group]
Length=318

 Score =   171 bits (432),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 109/146 (75%), Gaps = 2/146 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+++EE  T++VKP W++GTKITFEG GDER GCLPAD IFVI EK+H +FKR+G+DL 
Sbjct  171   LIVRKEETQTVRVKPGWKKGTKITFEGMGDERRGCLPADAIFVISEKEHPVFKRKGNDLV  230

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDL  1681
             + V++PLV ALTG   +   L G +M  +  DEIIYPG EK I GQGMP  +++G RGDL
Sbjct  231   MKVEVPLVNALTGWFFSFRLLTGEKMSCSFQDEIIYPGYEKVIKGQGMPSAHDKGVRGDL  290

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRD  1603
             R++F + FPT LS EQ S +  +L+D
Sbjct  291   RIKFHIVFPTQLSNEQLSGIKELLKD  316


 Score = 58.2 bits (139),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  2207  KPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVC  2094
             KPPPVE++LECTLEELC G  KE+K TR +++N G + 
Sbjct  136   KPPPVERKLECTLEELCRGSKKEIKFTRNVITNKGLIV  173



>ref|XP_007148517.1| hypothetical protein PHAVU_006G215400g [Phaseolus vulgaris]
 gb|ESW20511.1| hypothetical protein PHAVU_006G215400g [Phaseolus vulgaris]
Length=381

 Score =   191 bits (485),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I+QEEE + I+VKP WR+GT+ITFEG GDE+PG LPADV+F+I+EKKH ++ R+GDDLE
Sbjct  234   IIVQEEEVLRIEVKPGWRKGTRITFEGVGDEKPGYLPADVVFLIDEKKHHLYSRDGDDLE  293

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQGQ--RGDL  1681
             + VQIPL+ ALTGC+I +P LGG  M L+ +  II+P  EK I GQGMPN +    RGDL
Sbjct  294   ICVQIPLIDALTGCSIPIPLLGGENMTLSFESTIIHPEYEKVIKGQGMPNAKKNEMRGDL  353

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
              ++FL+ FP  L+EEQR +  SIL+DCC
Sbjct  354   HVKFLIDFPKKLTEEQRIEAVSILQDCC  381


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 7/123 (6%)
 Frame = -1

Query  2417  LSRTTSRLAIS-PKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTSSKRTAT  2241
             L R  S L IS P+ + S+    N      +     E +++FS      L G  S+R+ T
Sbjct  134   LERNKSVLEISEPELTNSTISPTNDAGTKKESSGETEDTSAFS------LPGNRSRRSTT  187

Query  2240  PIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVT  2061
             PII S++ SRRKPP VE +L+CTLE LC+GCTK ++++R+++   G +  E  + +I V 
Sbjct  188   PIIFSQTTSRRKPPEVETKLDCTLENLCFGCTKNIRVSRDVIKYPGIIVQEEEVLRIEVK  247

Query  2060  INY  2052
               +
Sbjct  248   PGW  250



>ref|XP_004292708.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Fragaria vesca 
subsp. vesca]
Length=375

 Score =   191 bits (485),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 122/164 (74%), Gaps = 12/164 (7%)
 Frame = -3

Query  2067  CNDQLYVIMCRLII-------QEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIF  1909
             CN ++ V   R+++       QEEE VTI VKP W++GTKITFEG G+ERPG  PAD+IF
Sbjct  214   CNKKMKVT--RVVVKDTGQMAQEEELVTINVKPGWKKGTKITFEGLGNERPGAYPADIIF  271

Query  1908  VIEEKKHSMFKREGDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKT  1729
             VI EK+H +F +EGDDLEL V+I L+QALTGCTI++P LGG    L ++D IIYPG EKT
Sbjct  272   VIAEKRHPLFVKEGDDLELTVEISLIQALTGCTISIPLLGGENTTLTIED-IIYPGYEKT  330

Query  1728  IPGQGMP--NNQGQRGDLRLRFLVGFPTDLSEEQRSQVASILRD  1603
             IP QGMP    +G+RG+L++ FLV FPT L++EQRS V +IL D
Sbjct  331   IPHQGMPIAKGEGKRGNLKVMFLVEFPTSLTQEQRSDVVTILED  374


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 5/112 (4%)
 Frame = -1

Query  2387  SPKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTSSKRTATPIILSESISRR  2208
             SP+ S SS RK +    +   ++      S SG     LL   S+R+ T I+ S S    
Sbjct  140   SPETSTSSGRKSSNDSVSTTPFSRSTTPISKSGP----LLNCESRRSTT-IMFSNSSGML  194

Query  2207  KPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             KPP +EK+LECTLEELC+GC K++K+TR ++ +TG +  E  +  I V   +
Sbjct  195   KPPAIEKQLECTLEELCFGCNKKMKVTRVVVKDTGQMAQEEELVTINVKPGW  246



>ref|XP_006352130.1| PREDICTED: dnaJ protein homolog 1-like [Solanum tuberosum]
Length=347

 Score =   189 bits (480),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 126/171 (74%), Gaps = 16/171 (9%)
 Frame = -3

Query  2079  IQNICNDQLY-VIMCR-------LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLP  1924
             ++ +CN  +  VI+ R       LI++EEE VTI VKP W+RGTKITFEGKGDER G   
Sbjct  179   LEELCNGCVKKVIITRDVVATTGLIVKEEEVVTIMVKPGWKRGTKITFEGKGDERAG---  235

Query  1923  ADVIFVIEEKKHSMFKREGDDLELGVQIPLVQALTGCTITVPTLGGGE-MILNLDDEIIY  1747
              D+IF I+EK H ++KREGDDL LGV++PLVQALTGCTITVP L G E M ++ DDEII+
Sbjct  236   -DIIFSIDEKTHPLYKREGDDLLLGVEVPLVQALTGCTITVPLLAGDEVMTMSFDDEIIH  294

Query  1746  PGLEKTIPGQGMPNNQGQ---RGDLRLRFLVGFPTDLSEEQRSQVASILRD  1603
             PG EK IPGQGMP  + +   RGDL L+FL+ FP +LSEEQ+S+  SIL +
Sbjct  295   PGFEKIIPGQGMPKPKQESTNRGDLVLQFLIQFPLELSEEQKSEAVSILEN  345


 Score = 99.4 bits (246),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 98/195 (50%), Gaps = 41/195 (21%)
 Frame = -1

Query  2609  YLSFNENVNVFG*IQAISSRKRDKQTATFDVDNQNTPKGSSRKTLPESLEQDEDEELFIS  2430
             + S NE   V        S+K+ ++   F  D   TPK +SR         +E++EL IS
Sbjct  56    FRSINEAYRVL-------SKKKREEADLFKSDAAKTPKKNSR--------DEEEDELQIS  100

Query  2429  GPRLLSRTTSRLAISPKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDLLGTS---  2259
              P LLSRTTSR  ISP                 DFY  +    + SGT +    GT    
Sbjct  101   SPTLLSRTTSR--ISP---------------TVDFYTSMPACFTMSGTNTPTTPGTPVSD  143

Query  2258  ------SKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYV  2097
                   SK  + PII S+S SRRKP P+EK+LECTLEELC GC K+V ITR++++ TG +
Sbjct  144   QPPNYLSKVASKPIIFSQSTSRRKPQPIEKKLECTLEELCNGCVKKVIITRDVVATTGLI  203

Query  2096  CVEHNIYKIYVTINY  2052
               E  +  I V   +
Sbjct  204   VKEEEVVTIMVKPGW  218



>ref|XP_009408315.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   168 bits (425),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+++EE   ++VKP W++GTKITFEG GDER GCLPAD IFVI EK+H +FKR+G+DL 
Sbjct  171   LIVRKEETQMVRVKPGWKKGTKITFEGMGDERRGCLPADAIFVISEKEHPVFKRKGNDLV  230

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDL  1681
             + V++PLV ALTG   +   L G +M     DEIIYPG EK I GQGMP  +++G RGDL
Sbjct  231   MKVEVPLVNALTGWFFSFRLLTGEKMSCTFQDEIIYPGYEKVIKGQGMPSAHDKGVRGDL  290

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRD  1603
             R++F + FPT LS+EQ S +  +L+D
Sbjct  291   RIKFHIVFPTQLSDEQLSGIKELLKD  316


 Score = 58.2 bits (139),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  2207  KPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVC  2094
             KPPPVE++LECTLEELC G  KE+K TR +++N G + 
Sbjct  136   KPPPVERKLECTLEELCRGSKKEIKFTRNVITNKGLIV  173



>ref|XP_009597480.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial protein import 
protein MAS5-like [Nicotiana tomentosiformis]
Length=348

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 3/148 (2%)
 Frame = -3

Query  2037  RLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDL  1858
             RLI++EEE V IKV+P W+RGTKITFEGKG ERPG LPAD++F I EK H +FKREGDDL
Sbjct  201   RLIVKEEEVVIIKVRPRWKRGTKITFEGKGXERPGTLPADIVFSIVEKTHPLFKREGDDL  260

Query  1857  ELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGD  1684
              LGV++PL+QALT C ITVP LGG EM ++  D++IYP  E+ IP QGMP  +   +RGD
Sbjct  261   VLGVEVPLLQALTCCIITVPLLGGDEMTMSF-DQVIYPVFERIIPCQGMPKPKEDSRRGD  319

Query  1683  LRLRFLVGFPTDLSEEQRSQVASILRDC  1600
             L L+FL+ F  DLS EQR Q+ SIL DC
Sbjct  320   LLLQFLIEFLLDLSREQRFQIVSILEDC  347



>ref|XP_010681831.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Beta vulgaris 
subsp. vulgaris]
Length=340

 Score =   187 bits (476),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 122/147 (83%), Gaps = 3/147 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             +I++EEE + I VKP W++GT ITFEGKGDE+PG LPAD++F+I+EK+H +FKR GD+LE
Sbjct  194   IIVEEEETLQIDVKPGWKKGTSITFEGKGDEKPGYLPADIVFLIDEKQHPLFKRVGDELE  253

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDL  1681
             LGV++PL++AL GC+IT+P LGGG+ +L +DD +IYPG EK I  QGMP ++  GQRGDL
Sbjct  254   LGVEVPLLKALVGCSITLPLLGGGKRVLRIDD-VIYPGYEKIIKDQGMPKSKENGQRGDL  312

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDC  1600
             RL+F+V FP +LS+++ S++ +IL+ C
Sbjct  313   RLKFIVDFPKELSDDKCSKICNILQSC  339


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 79/150 (53%), Gaps = 21/150 (14%)
 Frame = -1

Query  2450  DEELFISGPRLLSRTTSRLAISP--KFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSH  2277
             D+  FI  P LLSRT++R + +P  +  +++SR G               ++  S   S+
Sbjct  57    DDNFFIRSPSLLSRTSTRRSHTPTPRLHRNNSRSGRIIDSLKRSTTRTTVTSPVSTKTSN  116

Query  2276  D----LLGTSSKRT---------------ATPIILSESISRRKPPPVEKRLECTLEELCY  2154
             D    L+  +SK T                TPII S+S  RRKP  VEK+LEC+LEELC+
Sbjct  117   DSLRKLMSPNSKDTPIAGNNLSRSTSRRSTTPIIFSQSTRRRKPQHVEKKLECSLEELCF  176

Query  2153  GCTKEVKITREILSNTGYVCVEHNIYKIYV  2064
             G  +++KITR+++S+ G +  E    +I V
Sbjct  177   GAIRKIKITRDVISDVGIIVEEEETLQIDV  206



>gb|KHN47010.1| DnaJ like subfamily B member 13 [Glycine soja]
Length=193

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 3/145 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I+QEEE +TI V+P W +GTKITFEGKG+ERPG    D+IF+I EK+H +F+REGDDLEL
Sbjct  46    IVQEEELLTINVQPGWTKGTKITFEGKGNERPGAYREDIIFIISEKRHQLFRREGDDLEL  105

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDLR  1678
             GV+IPLV+ALTGCTI VP LG   M L LD+ II+PG EK IPGQGMP ++  G+RGDL+
Sbjct  106   GVEIPLVKALTGCTILVPLLGREHMNLTLDN-IIHPGFEKIIPGQGMPISREPGKRGDLK  164

Query  1677  LRFLVGFPTDLSEEQRSQVASILRD  1603
             + FLV FPT L+  QRS+V  IL++
Sbjct  165   ITFLVEFPTKLTGNQRSEVVRILQN  189


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -1

Query  2228  SESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             S S    KPPP+EKRLECTLE+LCYGC K++ ITR++L++TG +  E  +  I V   +
Sbjct  3     SNSSGMLKPPPIEKRLECTLEDLCYGCKKKIMITRDVLTDTGGIVQEEELLTINVQPGW  61



>ref|XP_010533907.1| PREDICTED: uncharacterized protein LOC104809575 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010533908.1| PREDICTED: uncharacterized protein LOC104809575 isoform X2 [Tarenaya 
hassleriana]
Length=438

 Score =   189 bits (481),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 116/148 (78%), Gaps = 3/148 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI+QEEE + I +KP W++GTKITFEGKG+E+PG LP D+ F IEEK+H +FKR GDDLE
Sbjct  292   LIVQEEETLRINIKPGWKKGTKITFEGKGNEKPGYLPEDITFSIEEKRHPLFKRRGDDLE  351

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDL  1681
             + V+IPL++ALTGCT++VP L G +M L++  E+I+ G EK I GQGMPN +  G+RGDL
Sbjct  352   IAVEIPLLKALTGCTLSVPLLNGEKMALSI-GEVIFHGFEKAIKGQGMPNAKEGGKRGDL  410

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRDCC  1597
             R+ FLV FP  LSEEQR  V+ IL+DC 
Sbjct  411   RITFLVKFPEKLSEEQRFMVSDILKDCS  438


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = -1

Query  2387  SPKFSKSSSRKGNKTPRAADFYAHLERSTSFSGTQSHDL-LGTS-SKRTATPIILSESIS  2214
             SP FSK+ SR      R  +    L +STS     S    +G + S+R+ TPI+ S S++
Sbjct  201   SPMFSKNVSR------REREGSVPLSKSTSMRKDASAGATMGRAVSRRSPTPIVFSHSVA  254

Query  2213  RRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYVTINY  2052
             RRKPPP+E++LECTLEELC+G  K +KI R+++++ G +  E    +I +   +
Sbjct  255   RRKPPPIERKLECTLEELCHGGVKNIKIARDVITDEGLIVQEEETLRINIKPGW  308



>ref|XP_006655344.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Oryza brachyantha]
Length=319

 Score =   169 bits (428),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = -3

Query  2034  LIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLE  1855
             LI ++EE  TI+V+P W++G K+TFEG GDERPGCLP D +F I E+KH +FKR+G+DL 
Sbjct  171   LISKKEETKTIRVRPGWKKGMKVTFEGMGDERPGCLPGDAVFTISERKHKVFKRKGNDLV  230

Query  1854  LGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP---NNQGQRGD  1684
             L  ++PL  ALTG + +   +GG +M  +  DE+I+PG EK + G+GMP     +G RGD
Sbjct  231   LKAEVPLASALTGWSFSFRLIGGEKMSYSFRDEVIFPGYEKVVAGEGMPVAGGERGARGD  290

Query  1683  LRLRFLVGFPTDLSEEQRSQVASILRDC  1600
             LR++F V FP +L++EQR+ +ASILR C
Sbjct  291   LRVKFDVVFPKNLTDEQRAGLASILRAC  318


 Score = 55.1 bits (131),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -1

Query  2210  RKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYV  2097
             RK P +E+++ECTLEELC GC KEVK TR++++ TG +
Sbjct  135   RKAPALERKVECTLEELCTGCKKEVKYTRDVVTKTGLI  172



>gb|KDP32846.1| hypothetical protein JCGZ_12138 [Jatropha curcas]
Length=297

 Score =   185 bits (469),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -3

Query  2028  IQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLELG  1849
             +Q+EE +TI VKP W+ GT ITFEG G+ERPGC PAD+ FVI EK+H +F+REGDDLE+ 
Sbjct  153   VQQEEILTIDVKPGWKEGTTITFEGMGNERPGCCPADITFVIAEKQHPLFRREGDDLEIA  212

Query  1848  VQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLRL  1675
             V+IPLVQALTGC I +P LGG  M L ++D IIYPG EK I  QGMPN   QG+RG+L++
Sbjct  213   VEIPLVQALTGCEILIPLLGGENMTLMIND-IIYPGYEKIIREQGMPNTREQGKRGNLKV  271

Query  1674  RFLVGFPTDLSEEQRSQVASILRDCC  1597
              FLV FP  L+++QRS + SIL D C
Sbjct  272   IFLVDFPEQLTDKQRSDILSILEDSC  297


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = -1

Query  2384  PKFSKSSSRKGNK-TPRAADFYAHLERSTSFSGTQSH-----DLLGTSSKRTATPIILSE  2223
             P+FS S SR G++ +P     +    RS S +  +S+      L   +S R+  PI+ S 
Sbjct  51    PRFSASLSRNGSRRSPSPTPSFMSRTRSASKANNESNYGFTSSLSRNASGRSTAPIMFSN  110

Query  2222  SISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYV  2064
             S    KP  V+K LECTLEELCYGC K++K+TRE+L+ TG    +  I  I V
Sbjct  111   STGMIKPQAVQKNLECTLEELCYGCMKKIKVTREVLTCTGKAVQQEEILTIDV  163



>dbj|BAB86234.1| putative heat shock protein [Oryza sativa Japonica Group]
Length=342

 Score =   166 bits (419),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = -3

Query  2052  YVIMCRLIIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKR  1873
             + I+ R I+++E    + VKP W++G KITFEG GDERPGCLPAD +FVI EKKH +FKR
Sbjct  187   FTILDRSIVKKEVSQMVLVKPGWKKGNKITFEGMGDERPGCLPADAVFVISEKKHPVFKR  246

Query  1872  EGDDLELGVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQ  1699
              G+DL L  ++PLV ALTG + +   L G ++  +  DEII PG EK I G+GMP  + +
Sbjct  247   VGNDLVLKAEVPLVSALTGWSFSFRLLSGKKVSCSFQDEIICPGYEKIIKGEGMPIADQK  306

Query  1698  GQRGDLRLRFLVGFPTDLSEEQRSQVASILRDC  1600
             G RGDLR++F + FP  L++EQR  +A ILR C
Sbjct  307   GARGDLRVKFEIAFPKQLTDEQRDGLAQILRGC  339


 Score = 57.8 bits (138),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  2210  RKPPPVEKRLECTLEELCYGCTKEVKITREILSNTG  2103
             RK PP+E++L+CTLEELC+GC KEVK TR++++  G
Sbjct  142   RKAPPLERKLDCTLEELCHGCKKEVKFTRDVVTKNG  177



>gb|KCW71250.1| hypothetical protein EUGRSUZ_F04343 [Eucalyptus grandis]
Length=245

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             IIQEEE +TIKVK  W++GTKITF+G G+ERPG  PAD+ FVI EKKHS+F+R+GDDLEL
Sbjct  100   IIQEEELLTIKVKSGWKKGTKITFQGMGNERPGVQPADITFVIAEKKHSLFRRDGDDLEL  159

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDLR  1678
              V+IPLV+ALTGC I+VP LGG  + L + DEII+PG +K I G GMP    QG+RGDL+
Sbjct  160   AVEIPLVKALTGCDISVPLLGGESLDLTV-DEIIHPGYQKVIAGHGMPVSKEQGRRGDLK  218

Query  1677  LRFLVGFPTDLSEEQRSQVASIL  1609
             + FLV FPTDL+ +QR+++  +L
Sbjct  219   VIFLVHFPTDLTADQRAEIVGVL  241


 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  2243  TPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNIYKIYV  2064
             TPI+ S S    +PP +E+ L+CTLEELCYGC K++K+TR++L+NTG +  E  +  I V
Sbjct  52    TPIMFSNSTGMLQPPAIERTLQCTLEELCYGCMKKIKVTRDVLTNTGQIIQEEELLTIKV  111

Query  2063  TINY  2052
                +
Sbjct  112   KSGW  115



>ref|XP_007019118.1| HSP40/DnaJ peptide-binding protein, putative [Theobroma cacao]
 gb|EOY16343.1| HSP40/DnaJ peptide-binding protein, putative [Theobroma cacao]
Length=352

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I+QE+E +++KVKP W++GTKITFEG G+ERPG   AD+ FVI EK+H++F REGDDLEL
Sbjct  207   IVQEDEILSVKVKPGWKKGTKITFEGMGNERPGAYAADITFVIAEKRHNLFTREGDDLEL  266

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNN--QGQRGDLR  1678
              ++IPL +ALTGCTI +P LGG +M L + DEII+PG ++ I GQGMP+   QG RG+L+
Sbjct  267   AIEIPLAKALTGCTIPIPLLGGEKMNLRV-DEIIHPGYQRIITGQGMPSTKEQGSRGNLK  325

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDCC  1597
             + FL+ FPT+L++EQR+ V SIL D C
Sbjct  326   VVFLINFPTELTDEQRATVVSILGDSC  352


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -1

Query  2258  SKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYVCVEHNI  2079
             ++    PI+ S S    KPPP+E++LECTLEELCYGC K++KITR++L+  G +  E  I
Sbjct  154   ARWNGNPIMFSNSTGMMKPPPIERQLECTLEELCYGCMKKIKITRDVLTEPGQIVQEDEI  213

Query  2078  YKIYVTINY  2052
               + V   +
Sbjct  214   LSVKVKPGW  222



>ref|XP_010095409.1| DnaJ homolog subfamily B member 13 [Morus notabilis]
 gb|EXB60101.1| DnaJ homolog subfamily B member 13 [Morus notabilis]
Length=354

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I+QEEE +TI+VKP W+ GTKITFEG G+E+ G  PAD+ FVI EK+H +F+REGDDLEL
Sbjct  208   IVQEEELLTIQVKPGWKSGTKITFEGMGNEKLGTSPADITFVIAEKRHQLFRREGDDLEL  267

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP---NNQGQRGDL  1681
              ++IPLV+ALTGC++++P LGG +M L++DD IIYPG EK I G+GMP   +  G+RG+L
Sbjct  268   AIKIPLVKALTGCSLSIPLLGGDKMSLSIDD-IIYPGFEKIIHGRGMPIPKDQDGRRGNL  326

Query  1680  RLRFLVGFPTDLSEEQRSQVASILRD  1603
             ++ FLV FPT L++EQRS V SIL++
Sbjct  327   KVAFLVDFPTQLTDEQRSDVLSILQE  352


 Score = 69.7 bits (169),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -1

Query  2309  RSTSFSGTQSHDLLGTS-SKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVK  2133
             +S++ S   S   LG + S+R +  I+ S S    KPP +EK+L+CTLEELCYGC K++K
Sbjct  137   KSSTGSSPLSLPFLGKNLSRRNSNNILFSNSSGLLKPPAIEKKLKCTLEELCYGCQKKIK  196

Query  2132  ITREILSNTGYVCVEHNIYKIYVTINY  2052
             ITR+++ + G +  E  +  I V   +
Sbjct  197   ITRDVVKHNGKIVQEEELLTIQVKPGW  223



>ref|NP_001044965.1| Os01g0875700 [Oryza sativa Japonica Group]
 dbj|BAD82089.1| putative DnaJ-like protein [Oryza sativa Japonica Group]
 dbj|BAF06879.1| Os01g0875700 [Oryza sativa Japonica Group]
 dbj|BAG88875.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71892.1| hypothetical protein OsI_04636 [Oryza sativa Indica Group]
Length=327

 Score =   162 bits (410),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I+++E    + VKP W++G KITFEG GDERPGCLPAD +FVI EKKH +FKR G+DL L
Sbjct  179   IVKKEVSQMVLVKPGWKKGNKITFEGMGDERPGCLPADAVFVISEKKHPVFKRVGNDLVL  238

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMP--NNQGQRGDLR  1678
               ++PLV ALTG + +   L G ++  +  DEII PG EK I G+GMP  + +G RGDLR
Sbjct  239   KAEVPLVSALTGWSFSFRLLSGKKVSCSFQDEIICPGYEKIIKGEGMPIADQKGARGDLR  298

Query  1677  LRFLVGFPTDLSEEQRSQVASILRDC  1600
             ++F + FP  L++EQR  +A ILR C
Sbjct  299   VKFEIAFPKQLTDEQRDGLAQILRGC  324


 Score = 58.2 bits (139),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -1

Query  2210  RKPPPVEKRLECTLEELCYGCTKEVKITREILSNTGYV  2097
             RK PP+E++L+CTLEELC+GC KEVK TR++++  G +
Sbjct  142   RKAPPLERKLDCTLEELCHGCKKEVKFTRDVVTKNGSI  179



>ref|XP_003522576.2| PREDICTED: uncharacterized protein LOC100782604 [Glycine max]
Length=354

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 3/145 (2%)
 Frame = -3

Query  2031  IIQEEEYVTIKVKPEWRRGTKITFEGKGDERPGCLPADVIFVIEEKKHSMFKREGDDLEL  1852
             I+QEEE +TI V+P W +GTKITFEGKG+ERPG    D+IF+I EK+H +F+REGDDLEL
Sbjct  207   IVQEEELLTINVQPGWTKGTKITFEGKGNERPGAYREDIIFIISEKRHQLFRREGDDLEL  266

Query  1851  GVQIPLVQALTGCTITVPTLGGGEMILNLDDEIIYPGLEKTIPGQGMPNNQ--GQRGDLR  1678
             GV+IPLV+ALTGCTI VP LG   M L LD+ II+PG EK IPGQGMP ++  G+RGDL+
Sbjct  267   GVEIPLVKALTGCTILVPLLGREHMNLTLDN-IIHPGFEKIIPGQGMPISREPGKRGDLK  325

Query  1677  LRFLVGFPTDLSEEQRSQVASILRD  1603
             + FLV FPT L+  QRS+V  IL++
Sbjct  326   ITFLVEFPTKLTGNQRSEVVRILQN  350


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = -1

Query  2279  HDLLG-TSSKRTATPIILSESISRRKPPPVEKRLECTLEELCYGCTKEVKITREILSNTG  2103
             HDL    +S++  TPI+ S S    KPPP+EKRLECTLE+LCYGC K++ ITR++L++TG
Sbjct  146   HDLKSRNASRKRDTPIMYSNSSGMLKPPPIEKRLECTLEDLCYGCKKKIMITRDVLTDTG  205

Query  2102  YVCVEHNIYKIYVTINY  2052
              +  E  +  I V   +
Sbjct  206   GIVQEEELLTINVQPGW  222



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8258873607808