BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23522_g1_i2 len=916 path=[1413:0-83 1497:84-143 1556:144-170
304:171-194 1606:195-205 339:206-263 1673:264-288 526:289-330
1739:331-389 1798:390-431 1839:432-511 3100:512-565 1972:566-625
2032:626-659 2066:660-915]

Length=916
                                                                      Score     E

ref|XP_009763134.1|  PREDICTED: protein COBRA                           284   9e-89   
ref|XP_009600080.1|  PREDICTED: protein COBRA                           284   1e-88   
ref|XP_006440797.1|  hypothetical protein CICLE_v10021527mg             277   2e-88   
ref|XP_011085599.1|  PREDICTED: protein COBRA                           283   3e-88   
ref|XP_006477704.1|  PREDICTED: protein COBRA-like                      275   7e-88   
ref|XP_011099166.1|  PREDICTED: protein COBRA-like                      283   8e-88   
ref|XP_009776823.1|  PREDICTED: protein COBRA-like                      281   9e-88   
ref|XP_009782894.1|  PREDICTED: protein COBRA-like                      281   1e-87   
ref|NP_001265883.1|  protein COBRA-like precursor                       281   1e-87   
ref|XP_009616573.1|  PREDICTED: protein COBRA-like                      281   1e-87   
ref|XP_004232141.1|  PREDICTED: protein COBRA                           281   2e-87   
ref|XP_006338345.1|  PREDICTED: protein COBRA-like                      281   2e-87   
ref|XP_010257981.1|  PREDICTED: protein COBRA-like isoform X2           278   6e-87   
ref|XP_006365658.1|  PREDICTED: protein COBRA-like                      278   9e-87   
gb|KHG10282.1|  COBRA-like protein 1                                    278   1e-86   
ref|XP_007032845.1|  COBRA-like protein 1 precursor                     278   1e-86   
ref|XP_010260537.1|  PREDICTED: protein COBRA-like isoform X1           277   4e-86   
gb|EPS71578.1|  hypothetical protein M569_03176                         276   4e-86   
ref|XP_002514629.1|  Protein COBRA precursor, putative                  275   5e-86   Ricinus communis
ref|XP_010257980.1|  PREDICTED: protein COBRA-like isoform X1           277   6e-86   
ref|XP_002531000.1|  Protein COBRA precursor, putative                  276   7e-86   Ricinus communis
ref|XP_002321786.2|  phytochelatin synthetase family protein            276   2e-85   Populus trichocarpa [western balsam poplar]
ref|XP_011006295.1|  PREDICTED: protein COBRA-like                      275   3e-85   
gb|KHN19598.1|  Protein COBRA                                           275   3e-85   
ref|XP_004138217.1|  PREDICTED: protein COBRA-like                      275   4e-85   
ref|XP_004488435.1|  PREDICTED: protein COBRA-like                      274   5e-85   
ref|XP_003527117.1|  PREDICTED: protein COBRA                           274   6e-85   
ref|XP_007037617.1|  COBRA-like extracellular glycosyl-phosphatid...    274   8e-85   
gb|KDP24286.1|  hypothetical protein JCGZ_25582                         273   9e-85   
gb|KHG07280.1|  COBRA-like protein 1                                    273   1e-84   
ref|XP_007138374.1|  hypothetical protein PHAVU_009G203100g             273   1e-84   
gb|KHG21362.1|  Protein COBRA -like protein                             273   1e-84   
ref|XP_008453302.1|  PREDICTED: protein COBRA-like                      273   2e-84   
gb|EYU34590.1|  hypothetical protein MIMGU_mgv1a006245mg                273   2e-84   
gb|KEH38144.1|  COBRA-like protein 2 precursor                          272   3e-84   
ref|XP_010939207.1|  PREDICTED: COBRA-like protein 1                    273   3e-84   
ref|XP_010459308.1|  PREDICTED: COBRA-like protein 1                    272   3e-84   
emb|CBI16946.3|  unnamed protein product                                271   4e-84   
ref|XP_010660572.1|  PREDICTED: protein COBRA                           272   5e-84   
emb|CAN68249.1|  hypothetical protein VITISV_020126                     272   6e-84   Vitis vinifera
ref|XP_002884308.1|  phytochelatin synthetase family protein            271   7e-84   
gb|KDP31373.1|  hypothetical protein JCGZ_11749                         271   7e-84   
ref|XP_010463618.1|  PREDICTED: COBRA-like protein 1                    271   8e-84   
ref|XP_003522986.1|  PREDICTED: protein COBRA-like                      271   1e-83   
ref|XP_002264600.1|  PREDICTED: protein COBRA                           271   1e-83   Vitis vinifera
gb|KHN18376.1|  Protein COBRA                                           270   1e-83   
ref|XP_007151373.1|  hypothetical protein PHAVU_004G041300g             270   2e-83   
ref|XP_008464583.1|  PREDICTED: COBRA-like protein 1                    270   2e-83   
ref|XP_006477706.1|  PREDICTED: protein COBRA-like                      270   2e-83   
ref|XP_003550707.1|  PREDICTED: protein COBRA-like                      270   3e-83   
ref|XP_008240088.1|  PREDICTED: protein COBRA-like isoform X2           267   4e-83   
emb|CDP19973.1|  unnamed protein product                                262   4e-83   
ref|XP_006408435.1|  hypothetical protein EUTSA_v10020716mg             269   7e-83   
emb|CDY43250.1|  BnaC05g48430D                                          269   7e-83   
emb|CDY60470.1|  BnaAnng16830D                                          269   7e-83   
ref|XP_009147371.1|  PREDICTED: COBRA-like protein 1                    269   8e-83   
ref|XP_003552600.1|  PREDICTED: protein COBRA-like                      268   8e-83   
ref|XP_002305390.1|  phytochelatin synthetase family protein            269   8e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008785625.1|  PREDICTED: COBRA-like protein 1                    269   8e-83   
ref|XP_010087346.1|  hypothetical protein L484_012679                   268   1e-82   
ref|XP_007208787.1|  hypothetical protein PRUPE_ppa024172mg             268   1e-82   
ref|XP_010528423.1|  PREDICTED: COBRA-like protein 2                    268   1e-82   
ref|XP_006297664.1|  hypothetical protein CARUB_v10013688mg             268   1e-82   
ref|XP_004137135.1|  PREDICTED: protein COBRA-like                      268   1e-82   
ref|XP_006440798.1|  hypothetical protein CICLE_v10020097mg             268   1e-82   
ref|NP_186870.1|  COBRA-like protein 1 precursor                        268   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011014072.1|  PREDICTED: COBRA-like protein 1                    268   2e-82   
ref|XP_010037254.1|  PREDICTED: protein COBRA-like                      268   2e-82   
gb|AFZ78568.1|  COBRA-like protein                                      268   2e-82   
gb|KCW48927.1|  hypothetical protein EUGRSUZ_K02540                     268   2e-82   
ref|XP_006603925.1|  PREDICTED: protein COBRA-like                      268   2e-82   
ref|XP_008240087.1|  PREDICTED: protein COBRA-like isoform X1           268   2e-82   
gb|AAM62930.1|  phytochelatin synthetase-like protein                   267   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241986.1|  uncharacterized protein LOC100782876 precursor     266   4e-82   
gb|KHN08345.1|  Protein COBRA                                           266   5e-82   
ref|XP_009338021.1|  PREDICTED: protein COBRA-like                      266   5e-82   
ref|XP_009415817.1|  PREDICTED: COBRA-like protein 1                    267   5e-82   
gb|KHN30325.1|  Protein COBRA                                           266   5e-82   
ref|XP_008374650.1|  PREDICTED: protein COBRA-like                      266   5e-82   
ref|XP_004491893.1|  PREDICTED: protein COBRA-like                      266   5e-82   
ref|XP_008393240.1|  PREDICTED: protein COBRA-like                      266   6e-82   
ref|XP_006394554.1|  hypothetical protein EUTSA_v10004178mg             266   6e-82   
ref|XP_008775852.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    266   7e-82   
ref|NP_568930.1|  glycosylphosphatidylinositol-anchored protein C...    266   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155211.1|  hypothetical protein PHAVU_003G183000g             266   7e-82   
ref|XP_009346186.1|  PREDICTED: protein COBRA-like                      266   7e-82   
ref|XP_010695258.1|  PREDICTED: protein COBRA-like                      266   9e-82   
ref|XP_011087367.1|  PREDICTED: protein COBRA-like isoform X1           266   1e-81   
gb|AFK41534.1|  unknown                                                 265   1e-81   
ref|XP_003543887.1|  PREDICTED: protein COBRA-like isoform X1           266   1e-81   
ref|XP_009589623.1|  PREDICTED: protein COBRA-like isoform X2           265   1e-81   
ref|XP_004958241.1|  PREDICTED: COBRA-like protein 1-like               265   1e-81   
gb|KFK27869.1|  hypothetical protein AALP_AA8G439700                    265   1e-81   
ref|XP_010032552.1|  PREDICTED: protein COBRA-like                      266   1e-81   
ref|XP_010522480.1|  PREDICTED: protein COBRA                           265   1e-81   
ref|XP_009395002.1|  PREDICTED: COBRA-like protein 1                    265   2e-81   
ref|XP_010551800.1|  PREDICTED: COBRA-like protein 1 isoform X2         265   2e-81   
ref|XP_009589615.1|  PREDICTED: protein COBRA-like isoform X1           265   2e-81   
ref|XP_010443903.1|  PREDICTED: protein COBRA-like                      265   2e-81   
ref|XP_002866404.1|  hypothetical protein ARALYDRAFT_496244             265   2e-81   
ref|XP_007151374.1|  hypothetical protein PHAVU_004G041400g             264   2e-81   
ref|XP_010456834.1|  PREDICTED: protein COBRA                           265   2e-81   
ref|XP_010936446.1|  PREDICTED: COBRA-like protein 1                    267   2e-81   
ref|XP_010551799.1|  PREDICTED: COBRA-like protein 1 isoform X1         266   3e-81   
gb|KEH21748.1|  COBRA-like protein 2 precursor                          265   3e-81   
ref|XP_009606715.1|  PREDICTED: COBRA-like protein 4                    263   3e-81   
ref|XP_006280281.1|  hypothetical protein CARUB_v10026206mg             267   3e-81   
emb|CDP21681.1|  unnamed protein product                                265   3e-81   
ref|XP_004234909.1|  PREDICTED: COBRA-like protein 4                    264   3e-81   
ref|XP_004232142.1|  PREDICTED: COBRA-like protein 4                    264   4e-81   
gb|ABD96927.1|  hypothetical protein                                    264   4e-81   Tarenaya spinosa
ref|XP_006338344.1|  PREDICTED: COBRA-like protein 4-like               263   4e-81   
ref|XP_010525122.1|  PREDICTED: COBRA-like protein 1                    264   4e-81   
ref|XP_002460985.1|  hypothetical protein SORBIDRAFT_02g038720          264   5e-81   Sorghum bicolor [broomcorn]
ref|XP_006368071.1|  PREDICTED: COBRA-like protein 4-like               263   5e-81   
ref|XP_007139436.1|  hypothetical protein PHAVU_008G029200g             263   5e-81   
emb|CDY16831.1|  BnaA09g05510D                                          264   6e-81   
emb|CDX87193.1|  BnaC09g05080D                                          264   6e-81   
ref|XP_006363258.1|  PREDICTED: COBRA-like protein 4-like               263   7e-81   
gb|AHC30880.1|  COBRA-like protein                                      264   7e-81   
ref|XP_003518180.1|  PREDICTED: protein COBRA-like                      263   8e-81   
ref|XP_004299285.1|  PREDICTED: protein COBRA-like                      263   9e-81   
gb|ABS88990.1|  ch-cobra                                                263   9e-81   Cunninghamia lanceolata [China fir]
ref|XP_009763133.1|  PREDICTED: COBRA-like protein 4                    263   9e-81   
gb|AFK45756.1|  unknown                                                 263   1e-80   
ref|XP_007139435.1|  hypothetical protein PHAVU_008G029100g             263   1e-80   
ref|XP_009151763.1|  PREDICTED: COBRA-like protein 2                    262   1e-80   
ref|XP_010546210.1|  PREDICTED: protein COBRA-like                      263   1e-80   
emb|CDX85277.1|  BnaC07g25880D                                          262   1e-80   
ref|XP_010087960.1|  hypothetical protein L484_016828                   266   2e-80   
emb|CDY58691.1|  BnaC07g49800D                                          263   2e-80   
ref|XP_011099033.1|  PREDICTED: COBRA-like protein 4                    262   2e-80   
ref|XP_009600081.1|  PREDICTED: COBRA-like protein 4                    262   2e-80   
ref|XP_009136413.1|  PREDICTED: protein COBRA                           263   2e-80   
emb|CDY02184.1|  BnaA03g39830D                                          263   2e-80   
gb|KHN04371.1|  COBRA-like protein 4                                    261   2e-80   
ref|XP_009386184.1|  PREDICTED: COBRA-like protein 1                    262   3e-80   
gb|EYU44224.1|  hypothetical protein MIMGU_mgv1a019628mg                261   4e-80   
ref|XP_009761753.1|  PREDICTED: COBRA-like protein 4                    261   4e-80   
ref|XP_007215357.1|  hypothetical protein PRUPE_ppa005522mg             261   4e-80   
ref|XP_006363260.1|  PREDICTED: COBRA-like protein 3-like               262   5e-80   
gb|KEH21749.1|  COBRA-like protein 2 precursor                          261   5e-80   
ref|XP_011085598.1|  PREDICTED: COBRA-like protein 4                    261   5e-80   
ref|XP_010694050.1|  PREDICTED: COBRA-like protein 4                    261   6e-80   
ref|XP_003554956.1|  PREDICTED: COBRA-like protein 4-like               261   6e-80   
ref|XP_006373387.1|  hypothetical protein POPTR_0017s13310g             259   6e-80   
ref|XP_009373790.1|  PREDICTED: COBRA-like protein 1 isoform X1         261   7e-80   
ref|XP_009373791.1|  PREDICTED: COBRA-like protein 1 isoform X2         261   7e-80   
ref|XP_002875546.1|  hypothetical protein ARALYDRAFT_484733             260   8e-80   
ref|XP_009780772.1|  PREDICTED: COBRA-like protein 1                    261   1e-79   
ref|XP_009784022.1|  PREDICTED: protein COBRA-like isoform X2           260   1e-79   
ref|XP_007037616.1|  COBRA-like extracellular glycosyl-phosphatid...    261   1e-79   
gb|ABK25014.1|  unknown                                                 260   1e-79   Picea sitchensis
ref|XP_008230280.1|  PREDICTED: COBRA-like protein 1                    260   1e-79   
ref|XP_009784021.1|  PREDICTED: protein COBRA-like isoform X1           261   1e-79   
ref|XP_009606717.1|  PREDICTED: COBRA-like protein 1                    260   2e-79   
ref|XP_009589606.1|  PREDICTED: COBRA-like protein 4                    259   2e-79   
ref|XP_004491892.1|  PREDICTED: COBRA-like protein 4-like               259   2e-79   
gb|EYU44221.1|  hypothetical protein MIMGU_mgv1a006633mg                259   3e-79   
emb|CBI16945.3|  unnamed protein product                                258   4e-79   
ref|XP_008393239.1|  PREDICTED: COBRA-like protein 4                    258   4e-79   
ref|XP_008353506.1|  PREDICTED: COBRA-like protein 1 isoform X1         259   5e-79   
ref|XP_008341799.1|  PREDICTED: COBRA-like protein 1 isoform X1         259   5e-79   
ref|XP_008341800.1|  PREDICTED: COBRA-like protein 1 isoform X2         259   5e-79   
ref|XP_006395263.1|  hypothetical protein EUTSA_v10004232mg             258   5e-79   
ref|XP_008353507.1|  PREDICTED: COBRA-like protein 1 isoform X2         259   5e-79   
gb|AAR01674.1|  putative phytochelatin synthetase, 3'-partial           252   7e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006400085.1|  hypothetical protein EUTSA_v10013604mg             258   8e-79   
ref|XP_010551802.1|  PREDICTED: COBRA-like protein 4                    258   9e-79   
gb|KHN10040.1|  Protein COBRA                                           258   1e-78   
ref|XP_008351868.1|  PREDICTED: COBRA-like protein 4                    258   1e-78   
ref|XP_010095794.1|  hypothetical protein L484_017602                   252   1e-78   
ref|XP_006287794.1|  hypothetical protein CARUB_v10001005mg             257   1e-78   
ref|XP_006658783.1|  PREDICTED: COBRA-like protein 1-like               258   1e-78   
ref|NP_001060219.2|  Os07g0604300                                       258   1e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131486.1|  PREDICTED: COBRA-like protein 4                    257   1e-78   
gb|EAZ04637.1|  hypothetical protein OsI_26785                          258   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_007032846.1|  COBRA-like extracellular glycosyl-phosphatid...    257   1e-78   
gb|AAG12670.1|AC027033_5  unknown protein; 31818-33764                  256   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660571.1|  PREDICTED: COBRA-like protein 4                    258   1e-78   
emb|CDX78644.1|  BnaA03g05560D                                          257   1e-78   
ref|XP_010936445.1|  PREDICTED: COBRA-like protein 4                    258   1e-78   
gb|KHG07276.1|  COBRA-like protein 4                                    257   2e-78   
ref|NP_197067.2|  COBRA-like protein 4                                  256   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871675.1|  hypothetical protein ARALYDRAFT_488408             256   2e-78   
ref|XP_010257979.1|  PREDICTED: COBRA-like protein 4                    257   2e-78   
gb|KGN63777.1|  hypothetical protein Csa_1G015710                       256   2e-78   
ref|XP_006602955.1|  PREDICTED: protein COBRA-like                      256   2e-78   
ref|XP_010492405.1|  PREDICTED: COBRA-like protein 4                    256   2e-78   
gb|AAM67179.1|  phytochelatin synthetase-like protein                   256   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425766.1|  PREDICTED: COBRA-like protein 2                    256   3e-78   
ref|XP_010420232.1|  PREDICTED: COBRA-like protein 4                    256   3e-78   
dbj|BAB02996.1|  phytochelatin synthetase-like protein                  256   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453698.1|  PREDICTED: COBRA-like protein 4                    256   3e-78   
gb|KFK25792.1|  hypothetical protein AALP_AA8G161300                    256   4e-78   
gb|KDO65677.1|  hypothetical protein CISIN_1g013089mg                   256   4e-78   
ref|NP_566851.1|  COBRA-like protein 2                                  256   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138334.1|  PREDICTED: COBRA-like protein 4-like               255   4e-78   
ref|NP_001242075.1|  uncharacterized protein LOC100783410 precursor     256   4e-78   
ref|XP_010483748.1|  PREDICTED: protein COBRA-like                      255   4e-78   
ref|XP_010694055.1|  PREDICTED: protein COBRA-like                      256   5e-78   
gb|KHN30324.1|  COBRA-like protein 4                                    256   5e-78   
gb|KHN37931.1|  COBRA-like protein 4                                    256   5e-78   
gb|KEH25135.1|  COBRA-like protein 2 precursor                          256   5e-78   
ref|XP_004299286.1|  PREDICTED: COBRA-like protein 4-like               256   5e-78   
ref|XP_008453301.1|  PREDICTED: COBRA-like protein 4                    256   5e-78   
ref|XP_009111966.1|  PREDICTED: protein COBRA-like                      256   5e-78   
gb|EYU34591.1|  hypothetical protein MIMGU_mgv1a006208mg                256   6e-78   
gb|EYU44225.1|  hypothetical protein MIMGU_mgv1a006751mg                255   7e-78   
ref|XP_010037255.1|  PREDICTED: COBRA-like protein 4                    256   7e-78   
ref|XP_008775851.1|  PREDICTED: COBRA-like protein 4                    256   7e-78   
ref|XP_006345207.1|  PREDICTED: uncharacterized protein LOC102589523    267   7e-78   
gb|KHN37929.1|  Protein COBRA                                           254   8e-78   
ref|XP_010663466.1|  PREDICTED: COBRA-like protein 4 isoform X1         255   8e-78   
ref|XP_006477707.1|  PREDICTED: COBRA-like protein 4-like               255   8e-78   
gb|KGN53787.1|  hypothetical protein Csa_4G129040                       255   9e-78   
ref|XP_009126060.1|  PREDICTED: COBRA-like protein 4                    255   9e-78   
ref|XP_006440799.1|  hypothetical protein CICLE_v10020292mg             254   1e-77   
gb|KGN63776.1|  hypothetical protein Csa_1G015700                       255   1e-77   
ref|XP_004137260.1|  PREDICTED: COBRA-like protein 4-like               255   1e-77   
ref|XP_004154765.1|  PREDICTED: COBRA-like protein 4-like               254   1e-77   
ref|XP_006650604.1|  PREDICTED: COBRA-like protein 3-like               255   2e-77   
ref|XP_002531001.1|  Protein COBRA precursor, putative                  254   2e-77   Ricinus communis
emb|CDX90983.1|  BnaC02g06140D                                          254   2e-77   
ref|XP_003562730.1|  PREDICTED: COBRA-like protein 6                    254   2e-77   
ref|XP_007139432.1|  hypothetical protein PHAVU_008G029000g             254   2e-77   
ref|XP_010099317.1|  hypothetical protein L484_018179                   254   2e-77   
gb|AAR13305.1|  phytochelatin synthetase-like protein                   255   2e-77   Phaseolus vulgaris [French bean]
dbj|BAK05255.1|  predicted protein                                      254   2e-77   
ref|XP_010514669.1|  PREDICTED: COBRA-like protein 2                    254   3e-77   
ref|XP_009394778.1|  PREDICTED: COBRA-like protein 4 isoform X2         254   3e-77   
ref|XP_008240086.1|  PREDICTED: COBRA-like protein 4                    254   3e-77   
ref|NP_001242777.1|  uncharacterized protein LOC100784352 precursor     253   3e-77   
gb|KEH25134.1|  COBRA-like protein 2 precursor                          254   4e-77   
ref|XP_004958244.1|  PREDICTED: COBRA-like protein 6-like isoform X3    251   4e-77   
ref|XP_010694042.1|  PREDICTED: protein COBRA                           246   4e-77   
ref|XP_006655271.1|  PREDICTED: COBRA-like protein 3-like               254   4e-77   
ref|XP_011006292.1|  PREDICTED: COBRA-like protein 4                    253   4e-77   
ref|XP_007209118.1|  hypothetical protein PRUPE_ppa005430mg             254   4e-77   
gb|EMT09067.1|  COBRA-like protein 6                                    254   4e-77   
ref|XP_009338030.1|  PREDICTED: COBRA-like protein 4                    254   5e-77   
ref|XP_006345208.1|  PREDICTED: protein COBRA-like                      253   6e-77   
ref|XP_004304207.1|  PREDICTED: protein COBRA-like                      253   7e-77   
ref|XP_006291010.1|  hypothetical protein CARUB_v10017122mg             254   7e-77   
ref|XP_009394776.1|  PREDICTED: COBRA-like protein 4 isoform X1         253   9e-77   
ref|XP_004304208.1|  PREDICTED: COBRA-like protein 4-like               252   9e-77   
ref|XP_006477734.1|  PREDICTED: COBRA-like protein 4-like               252   9e-77   
ref|XP_010549989.1|  PREDICTED: COBRA-like protein 4                    252   1e-76   
gb|EAY97880.1|  hypothetical protein OsI_19799                          253   1e-76   Oryza sativa Indica Group [Indian rice]
gb|KDO65676.1|  hypothetical protein CISIN_1g038127mg                   252   1e-76   
ref|XP_008379442.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    253   1e-76   
ref|XP_010260547.1|  PREDICTED: COBRA-like protein 4                    253   1e-76   
ref|NP_001055419.1|  Os05g0386800                                       253   1e-76   Oryza sativa Japonica Group [Japonica rice]
gb|AFZ78569.1|  COBRA-like protein                                      253   1e-76   
ref|XP_006440800.1|  hypothetical protein CICLE_v10023912mg             252   1e-76   
gb|EEE63576.1|  hypothetical protein OsJ_18393                          252   1e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011006293.1|  PREDICTED: COBRA-like protein 4                    252   2e-76   
ref|NP_001105970.1|  brittle stalk-2-like protein 6 precursor           252   2e-76   Zea mays [maize]
ref|XP_010502992.1|  PREDICTED: COBRA-like protein 2 isoform X4         251   2e-76   
ref|XP_010502991.1|  PREDICTED: COBRA-like protein 2 isoform X3         251   2e-76   
ref|XP_006374429.1|  phytochelatin synthetase-like family protein       252   2e-76   
ref|XP_010502993.1|  PREDICTED: COBRA-like protein 2 isoform X5         251   3e-76   
ref|XP_002264378.1|  PREDICTED: COBRA-like protein 4                    252   3e-76   Vitis vinifera
gb|EAY91898.1|  hypothetical protein OsI_13550                          251   3e-76   Oryza sativa Indica Group [Indian rice]
emb|CDY70289.1|  BnaAnng33230D                                          249   4e-76   
ref|XP_008341798.1|  PREDICTED: COBRA-like protein 4                    251   4e-76   
ref|XP_004958242.1|  PREDICTED: COBRA-like protein 6-like isoform X1    251   4e-76   
ref|XP_003559251.1|  PREDICTED: COBRA-like protein 3                    251   4e-76   
ref|XP_008374649.1|  PREDICTED: COBRA-like protein 4                    251   4e-76   
ref|XP_010502989.1|  PREDICTED: COBRA-like protein 2 isoform X2         251   4e-76   
gb|KCW83758.1|  hypothetical protein EUGRSUZ_B00629                     249   5e-76   
ref|XP_006374430.1|  phytochelatin synthetase-like family protein       251   5e-76   
ref|XP_010502988.1|  PREDICTED: COBRA-like protein 2 isoform X1         251   5e-76   
ref|XP_009346173.1|  PREDICTED: COBRA-like protein 4                    251   5e-76   
gb|EPS71579.1|  hypothetical protein M569_03177                         249   7e-76   
ref|XP_010031033.1|  PREDICTED: COBRA-like protein 4 isoform X1         250   8e-76   
ref|XP_009124784.1|  PREDICTED: COBRA-like protein 2                    250   9e-76   
ref|XP_006373386.1|  hypothetical protein POPTR_0017s13300g             249   9e-76   
gb|EYU23624.1|  hypothetical protein MIMGU_mgv1a006366mg                250   9e-76   
ref|XP_003559986.1|  PREDICTED: COBRA-like protein 1                    250   9e-76   
ref|XP_009373789.1|  PREDICTED: COBRA-like protein 4                    249   9e-76   
ref|XP_010695259.1|  PREDICTED: COBRA-like protein 4                    251   1e-75   
ref|XP_004236068.1|  PREDICTED: COBRA-like protein 4                    250   1e-75   
gb|KHG24029.1|  COBRA-like protein 4                                    249   1e-75   
ref|XP_004507298.1|  PREDICTED: protein COBRA-like                      250   1e-75   
ref|XP_011021064.1|  PREDICTED: COBRA-like protein 1                    249   1e-75   
ref|XP_002463158.1|  hypothetical protein SORBIDRAFT_02g038740          250   1e-75   
ref|XP_002991329.1|  hypothetical protein SELMODRAFT_133233             249   1e-75   
ref|NP_001105971.1|  brittle stalk-2-like protein 7 precursor           249   1e-75   
ref|XP_010092075.1|  hypothetical protein L484_007355                   251   2e-75   
ref|XP_008464584.1|  PREDICTED: COBRA-like protein 4                    249   2e-75   
ref|XP_002987954.1|  hypothetical protein SELMODRAFT_271954             249   2e-75   
ref|XP_006343506.1|  PREDICTED: protein COBRA-like                      244   2e-75   
emb|CDX70627.1|  BnaC03g07110D                                          258   2e-75   
ref|XP_009606716.1|  PREDICTED: COBRA-like protein 4                    249   2e-75   
tpg|DAA63525.1|  TPA: hypothetical protein ZEAMMB73_009152              249   2e-75   
gb|KDP31374.1|  hypothetical protein JCGZ_11750                         249   2e-75   
ref|XP_011087368.1|  PREDICTED: protein COBRA-like isoform X2           248   2e-75   
ref|XP_003559376.1|  PREDICTED: COBRA-like protein 3                    249   3e-75   
ref|XP_002514628.1|  Protein COBRA precursor, putative                  249   3e-75   
ref|XP_010032553.1|  PREDICTED: COBRA-like protein 4                    248   3e-75   
ref|XP_007037621.1|  COBRA-like extracellular glycosyl-phosphatid...    248   4e-75   
gb|KHG27746.1|  COBRA-like protein 4                                    248   4e-75   
gb|ACI24390.1|  COBRA-like protein                                      248   5e-75   
gb|EAZ27328.1|  hypothetical protein OsJ_11270                          248   6e-75   
ref|XP_006345105.1|  PREDICTED: COBRA-like protein 4-like               248   6e-75   
ref|XP_004304213.1|  PREDICTED: protein COBRA-like                      248   6e-75   
ref|XP_006650197.1|  PREDICTED: COBRA-like protein 5-like               248   9e-75   
ref|NP_001105969.1|  brittle stalk-2-like protein 4 precursor           247   1e-74   
gb|ACG27916.1|  COBRA-like protein 4 precursor                          247   1e-74   
ref|XP_009780773.1|  PREDICTED: COBRA-like protein 4                    248   1e-74   
gb|AFY03623.1|  COBRA-like protein                                      246   1e-74   
ref|NP_001050366.1|  Os03g0416200                                       248   1e-74   
ref|XP_004984022.1|  PREDICTED: COBRA-like protein 5-like               247   2e-74   
dbj|BAM05578.1|  COBRA-like protein                                     246   2e-74   
ref|XP_008777346.1|  PREDICTED: COBRA-like protein 3                    247   2e-74   
ref|XP_008240111.1|  PREDICTED: COBRA-like protein 4                    246   3e-74   
ref|XP_007216522.1|  hypothetical protein PRUPE_ppa024465mg             246   3e-74   
dbj|BAM05576.1|  COBRA-like protein                                     246   3e-74   
ref|XP_006856414.1|  hypothetical protein AMTR_s00047p00216760          245   3e-74   
gb|EMT17778.1|  hypothetical protein F775_25414                         246   4e-74   
ref|XP_004981735.1|  PREDICTED: COBRA-like protein 3-like               246   4e-74   
ref|XP_007037618.1|  COBRA-like extracellular glycosyl-phosphatid...    246   4e-74   
ref|XP_003557715.1|  PREDICTED: COBRA-like protein 5                    246   6e-74   
ref|XP_007210750.1|  hypothetical protein PRUPE_ppa021191mg             244   6e-74   
emb|CBI15331.3|  unnamed protein product                                255   8e-74   
ref|XP_010260542.1|  PREDICTED: protein COBRA-like isoform X2           244   8e-74   
emb|CDP21871.1|  unnamed protein product                                243   9e-74   
ref|XP_004236067.1|  PREDICTED: COBRA-like protein 1                    245   1e-73   
gb|ABF98936.1|  COBRA-like protein 4 precursor, putative, expressed     237   1e-73   
ref|XP_002465127.1|  hypothetical protein SORBIDRAFT_01g032460          242   1e-73   
ref|NP_001051307.2|  Os03g0754500                                       237   1e-73   
ref|XP_009794712.1|  PREDICTED: protein COBRA-like                      235   3e-73   
ref|XP_002467689.1|  hypothetical protein SORBIDRAFT_01g032480          244   3e-73   
ref|NP_001105928.1|  brittle stalk2 precursor                           244   3e-73   
ref|XP_009122873.1|  PREDICTED: COBRA-like protein 4                    242   4e-73   
ref|XP_002463862.1|  hypothetical protein SORBIDRAFT_01g007760          243   4e-73   
ref|XP_011087370.1|  PREDICTED: COBRA-like protein 4                    243   4e-73   
gb|AFW88100.1|  hypothetical protein ZEAMMB73_767703                    244   6e-73   
gb|ACA04978.1|  GPI-anchored protein                                    243   6e-73   
tpg|DAA51440.1|  TPA: hypothetical protein ZEAMMB73_864332              240   6e-73   
ref|XP_002306058.1|  phytochelatin synthetase-like family protein       242   7e-73   
ref|XP_002463861.1|  hypothetical protein SORBIDRAFT_01g007750          242   8e-73   
ref|XP_008230409.1|  PREDICTED: COBRA-like protein 4                    242   8e-73   
dbj|BAJ86473.1|  predicted protein                                      243   9e-73   
ref|XP_006394552.1|  hypothetical protein EUTSA_v10004931mg             234   1e-72   
emb|CDP20883.1|  unnamed protein product                                243   1e-72   
sp|Q6Z4G7.1|COBL6_ORYSJ  RecName: Full=COBRA-like protein 6; AltN...    242   1e-72   
gb|ADE67032.1|  COBRA-like 4 protein                                    241   1e-72   
gb|ADE67017.1|  COBRA-like 4 protein                                    241   1e-72   
ref|XP_003557716.1|  PREDICTED: COBRA-like protein 2                    242   1e-72   
gb|ADE67019.1|  COBRA-like 4 protein                                    241   1e-72   
gb|ADE67014.1|  COBRA-like 4 protein                                    241   1e-72   
gb|ADE67015.1|  COBRA-like 4 protein                                    241   1e-72   
gb|ADE67037.1|  COBRA-like 4 protein                                    241   1e-72   
gb|AAO86520.1|  phytochelatin synthetase                                242   2e-72   
emb|CDP20884.1|  unnamed protein product                                242   2e-72   
gb|EMT05391.1|  hypothetical protein F775_18404                         241   2e-72   
emb|CDP15248.1|  unnamed protein product                                241   3e-72   
gb|ADE67042.1|  COBRA-like 4 protein                                    241   3e-72   
ref|XP_011014071.1|  PREDICTED: COBRA-like protein 4                    241   3e-72   
gb|ADE67018.1|  COBRA-like 4 protein                                    240   3e-72   
gb|ADE67025.1|  COBRA-like 4 protein                                    240   3e-72   
gb|ADE67031.1|  COBRA-like 4 protein                                    240   3e-72   
ref|XP_006651506.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    241   4e-72   
gb|ADE67026.1|  COBRA-like 4 protein                                    240   4e-72   
gb|ADE67011.1|  COBRA-like 4 protein                                    240   4e-72   
gb|ADE67020.1|  COBRA-like 4 protein                                    240   4e-72   
gb|ADE67012.1|  COBRA-like 4 protein                                    240   4e-72   
emb|CDX85543.1|  BnaA02g02700D                                          241   4e-72   
gb|ABK25470.1|  unknown                                                 241   4e-72   
gb|ADE67039.1|  COBRA-like 4 protein                                    240   4e-72   
ref|XP_010031023.1|  PREDICTED: COBRA-like protein 1                    240   5e-72   
dbj|BAJ91851.1|  predicted protein                                      241   5e-72   
emb|CAC01762.1|  putative phytochelatin synthetase                      239   5e-72   
dbj|BAK01816.1|  predicted protein                                      240   6e-72   
gb|KGN64072.1|  hypothetical protein Csa_1G039860                       240   6e-72   
ref|XP_004137604.1|  PREDICTED: COBRA-like protein 4-like               239   6e-72   
ref|XP_010937850.1|  PREDICTED: COBRA-like protein 1                    240   7e-72   
dbj|BAJ99591.1|  predicted protein                                      241   7e-72   
ref|XP_006657931.1|  PREDICTED: COBRA-like protein 6-like               240   8e-72   
emb|CDX69511.1|  BnaA10g18600D                                          240   8e-72   
ref|XP_010099318.1|  hypothetical protein L484_018180                   239   9e-72   
gb|KDP24287.1|  hypothetical protein JCGZ_25583                         239   1e-71   
gb|EPS70668.1|  hypothetical protein M569_04090                         238   1e-71   
ref|XP_010456862.1|  PREDICTED: COBRA-like protein 5                    231   2e-71   
ref|XP_003522282.1|  PREDICTED: COBRA-like protein 4-like isoform X1    239   2e-71   
gb|ACG33719.1|  COBRA-like protein 4 precursor                          239   2e-71   
gb|KHN03079.1|  COBRA-like protein 4                                    239   2e-71   
ref|XP_010087345.1|  hypothetical protein L484_012678                   243   2e-71   
ref|XP_002514627.1|  hypothetical protein RCOM_1468720                  248   2e-71   
ref|NP_001104946.1|  brittle stalk-2-like protein 3 precursor           239   2e-71   
ref|NP_001050367.1|  Os03g0416300                                       238   4e-71   
ref|XP_008379444.1|  PREDICTED: COBRA-like protein 4                    237   4e-71   
ref|XP_010663467.1|  PREDICTED: COBRA-like protein 4 isoform X2         236   4e-71   
ref|XP_010483751.1|  PREDICTED: COBRA-like protein 5                    229   1e-70   
ref|XP_007210248.1|  hypothetical protein PRUPE_ppa014838mg             236   2e-70   
ref|XP_010443908.1|  PREDICTED: COBRA-like protein 5                    229   2e-70   
gb|ADE67036.1|  COBRA-like 4 protein                                    236   2e-70   
ref|XP_004981736.1|  PREDICTED: COBRA-like protein 3-like               236   2e-70   
gb|KHN19596.1|  COBRA-like protein 4                                    236   3e-70   
ref|XP_003528239.1|  PREDICTED: COBRA-like protein 4-like               236   3e-70   
ref|XP_010522491.1|  PREDICTED: COBRA-like protein 5                    228   4e-70   
ref|XP_009136418.1|  PREDICTED: COBRA-like protein 5                    227   8e-70   
ref|XP_006593701.1|  PREDICTED: protein COBRA-like isoform X2           233   1e-69   
ref|XP_011010808.1|  PREDICTED: COBRA-like protein 4                    234   1e-69   
gb|EMT25608.1|  hypothetical protein F775_09574                         234   2e-69   
ref|XP_007138375.1|  hypothetical protein PHAVU_009G203200g             234   2e-69   
gb|EMS68786.1|  hypothetical protein TRIUR3_15417                       234   3e-69   
gb|EMT31496.1|  hypothetical protein F775_27513                         234   3e-69   
ref|XP_006281938.1|  hypothetical protein CARUB_v10028146mg             225   4e-69   
gb|EAY90462.1|  hypothetical protein OsI_12049                          225   1e-68   
gb|EMS58622.1|  hypothetical protein TRIUR3_14619                       233   1e-68   
gb|KEH38143.1|  COBRA-like protein 2 precursor                          231   1e-68   
gb|KFK27874.1|  hypothetical protein AALP_AA8G440100                    223   2e-68   
ref|XP_008240110.1|  PREDICTED: COBRA-like protein 4                    231   3e-68   
gb|AAR14311.1|  phytochelatin synthetase                                231   3e-68   
gb|EMS47000.1|  hypothetical protein TRIUR3_01702                       231   3e-68   
gb|AFZ78570.1|  COBRA-like protein                                      230   3e-68   
ref|XP_007139434.1|  hypothetical protein PHAVU_008G029100g             230   1e-67   
ref|XP_006856415.1|  hypothetical protein AMTR_s00047p00217040          226   2e-67   
ref|XP_001760765.1|  predicted protein                                  229   2e-67   
emb|CDY58695.1|  BnaC07g49830D                                          221   3e-67   
ref|XP_004488434.1|  PREDICTED: COBRA-like protein 4-like isoform X2    228   3e-67   
ref|XP_004488433.1|  PREDICTED: COBRA-like protein 4-like isoform X1    228   3e-67   
gb|AFK33956.1|  unknown                                                 228   4e-67   
ref|NP_200903.1|  COBRA-like protein 5                                  219   7e-67   
ref|XP_001778885.1|  predicted protein                                  227   8e-67   
gb|EAZ04638.1|  hypothetical protein OsI_26786                          228   1e-66   
gb|KEH21750.1|  COBRA-like protein 2 precursor                          226   1e-66   
ref|XP_009339585.1|  PREDICTED: COBRA-like protein 4                    220   3e-66   
ref|XP_007139433.1|  hypothetical protein PHAVU_008G029100g             224   3e-66   
dbj|BAJ97141.1|  predicted protein                                      225   4e-66   
ref|XP_010456855.1|  PREDICTED: COBRA-like protein 5                    214   2e-65   
gb|EMT09066.1|  hypothetical protein F775_27360                         223   2e-65   
dbj|BAK04997.1|  predicted protein                                      223   3e-65   
gb|AAR13303.1|  phytochelatin synthetase-like protein                   221   4e-65   
ref|XP_006856413.1|  hypothetical protein AMTR_s00047p00216570          222   5e-65   
gb|EAY79078.1|  hypothetical protein OsI_34187                          221   1e-64   
gb|EMT26577.1|  hypothetical protein F775_19541                         220   1e-64   
gb|EMS55416.1|  hypothetical protein TRIUR3_34464                       216   1e-63   
ref|NP_001064961.1|  Os10g0497700                                       218   2e-63   
ref|XP_001766389.1|  predicted protein                                  218   2e-63   
ref|XP_004301102.1|  PREDICTED: COBRA-like protein 4-like               218   3e-63   
gb|KFK27873.1|  hypothetical protein AALP_AA8G440000                    209   1e-62   
ref|XP_008663686.1|  PREDICTED: COBRA-like protein 3                    208   1e-62   
gb|KCW48930.1|  hypothetical protein EUGRSUZ_K02543                     214   2e-62   
gb|KEH25133.1|  COBRA-like protein 2 precursor                          213   3e-62   
ref|XP_010039079.1|  PREDICTED: COBRA-like protein 4                    216   4e-62   
ref|XP_004309891.1|  PREDICTED: protein COBRA-like                      214   4e-62   
gb|AAX83596.1|  BRITTLE CULM1                                           211   4e-62   
gb|AAX83588.1|  BRITTLE CULM1                                           211   4e-62   
gb|AAX83600.1|  BRITTLE CULM1                                           211   5e-62   
gb|EMS49526.1|  hypothetical protein TRIUR3_12656                       213   7e-62   
gb|EMT17564.1|  hypothetical protein F775_22023                         208   8e-62   
ref|XP_010031041.1|  PREDICTED: COBRA-like protein 4 isoform X2         212   9e-62   
gb|AAX83616.1|  BRITTLE CULM1                                           209   2e-61   
gb|KHG18541.1|  COBRA-like protein 4                                    210   7e-61   
ref|XP_006662477.1|  PREDICTED: LOW QUALITY PROTEIN: COBRA-like p...    210   2e-60   
gb|KEH39624.1|  COBRA-like protein 2 precursor                          210   3e-60   
gb|EYU44226.1|  hypothetical protein MIMGU_mgv1a022766mg                203   3e-60   
ref|XP_004958243.1|  PREDICTED: COBRA-like protein 6-like isoform X2    208   3e-60   
emb|CDY26444.1|  BnaC09g42240D                                          207   5e-60   
ref|XP_008445923.1|  PREDICTED: COBRA-like protein 4                    204   2e-58   
ref|XP_010092076.1|  hypothetical protein L484_007358                   206   2e-58   
ref|XP_002318574.2|  hypothetical protein POPTR_0012s05940g             201   9e-58   
gb|EMS57525.1|  hypothetical protein TRIUR3_13620                       195   2e-57   
ref|XP_002975319.1|  hypothetical protein SELMODRAFT_174860             201   4e-57   
gb|ACU18662.1|  unknown                                                 193   6e-57   
ref|XP_002964476.1|  hypothetical protein SELMODRAFT_405727             197   1e-55   
ref|XP_009595325.1|  PREDICTED: COBRA-like protein 2 isoform X1         186   3e-53   
ref|XP_006578523.1|  PREDICTED: COBRA-like protein 4-like isoform X2    186   1e-51   
ref|XP_010030139.1|  PREDICTED: COBRA-like protein 6 isoform X1         186   2e-51   
ref|XP_010030140.1|  PREDICTED: COBRA-like protein 6 isoform X2         186   2e-51   
gb|KDO65675.1|  hypothetical protein CISIN_1g040362mg                   183   3e-51   
emb|CAA07251.1|  putative phytochelatin synthetase                      182   1e-50   
ref|XP_009397863.1|  PREDICTED: COBRA-like protein 3 isoform X3         182   3e-50   
ref|XP_009397865.1|  PREDICTED: COBRA-like protein 7 isoform X4         182   3e-50   
ref|XP_009397862.1|  PREDICTED: COBRA-like protein 7 isoform X2         182   3e-50   
ref|XP_009397861.1|  PREDICTED: COBRA-like protein 7 isoform X1         182   4e-50   
emb|CDY29033.1|  BnaC07g32390D                                          175   4e-50   
ref|XP_010027267.1|  PREDICTED: COBRA-like protein 1                    179   3e-49   
ref|XP_010027265.1|  PREDICTED: COBRA-like protein 1                    179   3e-49   
gb|AFZ78571.1|  COBRA-like protein                                      179   1e-48   
ref|XP_011028305.1|  PREDICTED: COBRA-like protein 6                    177   4e-48   
gb|EYU26510.1|  hypothetical protein MIMGU_mgv1a004710mg                177   4e-48   
ref|XP_008351867.1|  PREDICTED: COBRA-like protein 4                    171   6e-48   
ref|XP_006349429.1|  PREDICTED: COBRA-like protein 6-like               176   8e-48   
gb|EYU26509.1|  hypothetical protein MIMGU_mgv1a004710mg                177   1e-47   
ref|XP_010314626.1|  PREDICTED: COBRA-like protein 6 isoform X1         176   2e-47   
emb|CDY14723.1|  BnaC05g19800D                                          172   2e-47   
ref|XP_006365694.1|  PREDICTED: protein COBRA-like                      166   6e-47   
ref|XP_011087711.1|  PREDICTED: COBRA-like protein 6 isoform X2         172   2e-46   
gb|KHG25808.1|  COBRA-like protein 6                                    172   2e-46   
ref|XP_011087710.1|  PREDICTED: COBRA-like protein 6 isoform X1         173   2e-46   
ref|XP_006471247.1|  PREDICTED: COBRA-like protein 6-like               172   3e-46   
ref|XP_009776069.1|  PREDICTED: COBRA-like protein 6 isoform X1         170   2e-45   
ref|XP_008791642.1|  PREDICTED: COBRA-like protein 7                    170   2e-45   
ref|XP_010919369.1|  PREDICTED: COBRA-like protein 7                    170   3e-45   
ref|XP_009602801.1|  PREDICTED: COBRA-like protein 6 isoform X3         168   3e-45   



>ref|XP_009763134.1| PREDICTED: protein COBRA [Nicotiana sylvestris]
Length=451

 Score =   284 bits (726),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VTIYN+Q+ R I+ PGWTLGW WAK EVIWTMMG Q
Sbjct  35   LDPNGNITIKWDVITWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWTMMGGQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SWG++ + A VS 
Sbjct  95   TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPTTA-VSS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+FVS+ GRRVT AMMTW
Sbjct  154  FQISVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFVSADGRRVTQAMMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_009600080.1| PREDICTED: protein COBRA [Nicotiana tomentosiformis]
Length=451

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGY+A+VTIYN+Q+ R I+ PGWTLGW WAK EVIWTMMG Q
Sbjct  35   LDPNGNITIKWDVITWTPDGYMAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWTMMGGQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SWG++ + A VS 
Sbjct  95   TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPTTA-VSS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+FVSS GRRVT AMMTW
Sbjct  154  FQISVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFVSSDGRRVTQAMMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_006440797.1| hypothetical protein CICLE_v10021527mg [Citrus clementina]
 gb|ESR54037.1| hypothetical protein CICLE_v10021527mg [Citrus clementina]
Length=284

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 164/213 (77%), Gaps = 8/213 (4%)
 Frame = +3

Query  24   SILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQRLR  203
            +ILLL +L+  T   + ++       L+  GNITI WD++ WT DGYVA+VTI+N+Q+ R
Sbjct  20   TILLLFLLSCSTFTSTEAY-----DALDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYR  74

Query  204  KIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYN  383
             I+ PGWTLGW WAK EVIW+MMG QTT QGDCS++KGNIPH C++ P VVDLL GTPYN
Sbjct  75   HIQAPGWTLGWTWAKKEVIWSMMGGQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYN  134

Query  384  QQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYAC  563
            QQIENCCKGGV+SSW ++ + A +S FQLSVG AG TNKTV +PKNFT +APG   GY C
Sbjct  135  QQIENCCKGGVISSWAQDPTTA-LSSFQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTC  191

Query  564  GPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            GPAK+ KPT+F++S  RRVT AMMTW ++C YS
Sbjct  192  GPAKVGKPTKFITSDKRRVTQAMMTWNVTCTYS  224



>ref|XP_011085599.1| PREDICTED: protein COBRA [Sesamum indicum]
Length=453

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 164/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            M F+   +LLL L   +   S    DA    L+  GNITI WDVI WT DGYVA+VTI+N
Sbjct  9    MRFTTPTILLLFLLSCSTFTSTEAYDA----LDPNGNITIKWDVISWTPDGYVAVVTIFN  64

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q+ R I+ PGWTLGW WAK EVIW MMG QTT QGDCSRFKGNIPH C++ P VVDLL 
Sbjct  65   FQQYRHIQAPGWTLGWTWAKKEVIWNMMGGQTTEQGDCSRFKGNIPHCCKKDPTVVDLLP  124

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            GTPYNQQI NCCKGGV+SSWG++ + A+ S FQ+SVG AG TNKTV +PKNFT +APG  
Sbjct  125  GTPYNQQIANCCKGGVISSWGQDPANAA-SSFQVSVGAAGTTNKTVKVPKNFTLKAPGP-  182

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CGPAKIVKPT++V+  GRRVT AMMTW ++C YS
Sbjct  183  -GYTCGPAKIVKPTKYVTKDGRRVTQAMMTWNVTCTYS  219



>ref|XP_006477704.1| PREDICTED: protein COBRA-like [Citrus sinensis]
Length=257

 Score =   275 bits (703),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 163/214 (76%), Gaps = 8/214 (4%)
 Frame = +3

Query  24   SILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQRLR  203
            +ILLL +L+  T   + ++       L+  GNITI WD++ WT DGYVA+VTI+N+Q+ R
Sbjct  20   TILLLFLLSCSTFTSTEAY-----DALDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYR  74

Query  204  KIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYN  383
             I+ PGWTLGW WAK EVIW+MMG QTT QGDCS++KGNIPH C++ P VVDLL GTPYN
Sbjct  75   HIQAPGWTLGWTWAKKEVIWSMMGGQTTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYN  134

Query  384  QQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYAC  563
            QQI NCCKGGV+SSW ++ + A +S FQLSVG AG TNKTV +PKNFT +APG   GY C
Sbjct  135  QQIANCCKGGVISSWAQDPTTA-LSSFQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTC  191

Query  564  GPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYSN  665
            GPAK+ KPT+F++S  RRVT AMMTW ++C YS 
Sbjct  192  GPAKVGKPTKFITSDKRRVTQAMMTWNVTCTYSQ  225



>ref|XP_011099166.1| PREDICTED: protein COBRA-like [Sesamum indicum]
Length=520

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VTI+N+Q+ R I+ PGWTLGW WAK EVIW+MMG Q
Sbjct  86   LDPNGNITIKWDVISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGQ  145

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SWG++ + A+ S 
Sbjct  146  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDPTSAA-SS  204

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+FV+  GRRVT AMMTW
Sbjct  205  FQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFVTQDGRRVTQAMMTW  262

Query  642  KLSCLYS  662
             ++C YS
Sbjct  263  NVTCTYS  269



>ref|XP_009776823.1| PREDICTED: protein COBRA-like [Nicotiana sylvestris]
Length=452

 Score =   281 bits (720),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW MMGAQ
Sbjct  35   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWNMMGAQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SWG++ + A VS 
Sbjct  95   TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDTATA-VSS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+FV+  GRRVT AMMTW
Sbjct  154  FQVSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFVTQDGRRVTQAMMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_009782894.1| PREDICTED: protein COBRA-like [Nicotiana sylvestris]
Length=452

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW MMGAQ
Sbjct  35   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWNMMGAQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SWG++ + A VS 
Sbjct  95   TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWGQDTATA-VSS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+FV+  GRRVT AMMTW
Sbjct  154  FQVSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFVTQDGRRVTQAMMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|NP_001265883.1| protein COBRA-like precursor [Solanum lycopersicum]
 gb|AFD29886.1| COBRA protein [Solanum lycopersicum]
Length=444

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 163/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            M F RS +LL+ L       +    DA    L+  GNITI WDVI WT DGYVA+VT++N
Sbjct  1    MEFFRSTILLVFLLSCFSFSATDAFDA----LDPNGNITIKWDVISWTPDGYVAVVTMFN  56

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q+ R I+ PGWTLGW WAK EVIW MMGAQTT QGDCS+FKGNIPH C+R P VVDLL 
Sbjct  57   FQQYRHIQAPGWTLGWTWAKKEVIWGMMGAQTTEQGDCSKFKGNIPHCCKRDPTVVDLLP  116

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            GTPYNQQI NCCKGGV++SWG++   A VS FQ+SVG AG TNKTV +PKNFT +APG  
Sbjct  117  GTPYNQQIANCCKGGVINSWGQDPETA-VSSFQVSVGAAGTTNKTVRVPKNFTLKAPGP-  174

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CGPAK+VKPT+F S  GRR+T AMMTW ++C YS
Sbjct  175  -GYTCGPAKVVKPTKFSSGDGRRITQAMMTWNVTCTYS  211



>ref|XP_009616573.1| PREDICTED: protein COBRA-like [Nicotiana tomentosiformis]
Length=452

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW MMGAQ
Sbjct  35   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWNMMGAQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P +VDLL GTPYNQQI NCCKGGV++SWG++ + A VS 
Sbjct  95   TTEQGDCSKFKGNIPHCCKKDPTIVDLLPGTPYNQQIANCCKGGVINSWGQDTATA-VSS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+FV+  GRRVT AMMTW
Sbjct  154  FQVSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFVTQDGRRVTQAMMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_004232141.1| PREDICTED: protein COBRA [Solanum lycopersicum]
Length=447

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 169/216 (78%), Gaps = 8/216 (4%)
 Frame = +3

Query  15   FSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQ  194
            F+ +ILLL +++ F+   + +F       L+  GNITI WDVI WT DGYVA+VT+YN+Q
Sbjct  7    FASTILLLFLISCFSFSSTDAF-----DPLDPNGNITIKWDVISWTPDGYVAVVTMYNFQ  61

Query  195  RLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGT  374
            + R I+ PGW+LGW WAK EVIWTMMGAQTT QGDCS++KGNIPH C++ P VVD+L GT
Sbjct  62   QYRHIQAPGWSLGWTWAKKEVIWTMMGAQTTEQGDCSKYKGNIPHCCKKDPTVVDMLPGT  121

Query  375  PYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGG  554
            PYNQQI NCCKGGV++SWG++ + A VS FQ+SVG AG TNKTV +PKNFT +APG   G
Sbjct  122  PYNQQIANCCKGGVINSWGQDPATA-VSSFQVSVGAAGTTNKTVRVPKNFTLKAPGP--G  178

Query  555  YACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            Y CGPAKIVK T+FVS+ GRRVT AMMTW ++C YS
Sbjct  179  YTCGPAKIVKSTKFVSADGRRVTQAMMTWNVTCTYS  214



>ref|XP_006338345.1| PREDICTED: protein COBRA-like [Solanum tuberosum]
Length=459

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 168/216 (78%), Gaps = 8/216 (4%)
 Frame = +3

Query  15   FSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQ  194
            F+ +IL+L +L+ F+   + +F       L+  GNITI WDVI W  DGYVA+VT+YN+Q
Sbjct  19   FASTILVLFLLSSFSFHSTDAF-----DPLDPNGNITIKWDVISWAPDGYVAVVTMYNFQ  73

Query  195  RLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGT  374
            + R I+ PGW+LGW WAK EVIWTMMG QTT QGDCS++KGNIPH C++ P VVD+L GT
Sbjct  74   QYRHIQAPGWSLGWTWAKKEVIWTMMGGQTTEQGDCSKYKGNIPHCCKKDPTVVDMLPGT  133

Query  375  PYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGG  554
            PYNQQI NCCKGGV++SWG++ + A VS FQ+SVG AG TNKTV +PKNFT +APG   G
Sbjct  134  PYNQQIANCCKGGVINSWGQDPANA-VSSFQISVGAAGTTNKTVRVPKNFTLKAPGP--G  190

Query  555  YACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            Y CGPAKIVKPT+FVS+ GRRVT AMMTW ++C YS
Sbjct  191  YTCGPAKIVKPTKFVSADGRRVTQAMMTWNVTCTYS  226



>ref|XP_010257981.1| PREDICTED: protein COBRA-like isoform X2 [Nelumbo nucifera]
Length=399

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VTIYN+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  40   LDPNGNITIKWDVISWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPTNAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CGPAKIVKPT+F ++  RR T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKIVKPTKFTTADQRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_006365658.1| PREDICTED: protein COBRA-like [Solanum tuberosum]
Length=444

 Score =   278 bits (712),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 164/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            M F RS +LL+ L       +    DA    L+  GNITI WDVI W+ DGYVA+VT++N
Sbjct  1    MEFFRSTILLVFLLSCFSFSATDAFDA----LDPNGNITIKWDVISWSPDGYVAVVTMFN  56

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q+ R I+ PGWTLGW WAK EVIW M+GAQTT QGDCS+FKGNIPH C+R P V+DLL 
Sbjct  57   FQQYRHIQAPGWTLGWTWAKKEVIWGMVGAQTTEQGDCSKFKGNIPHCCKRDPTVIDLLP  116

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            GTPYNQQI NCCKGGV++SWG++   A VS FQ+SVG AG TNKTV +PKNFT +APG  
Sbjct  117  GTPYNQQIANCCKGGVINSWGQDPETA-VSSFQVSVGSAGTTNKTVRVPKNFTLKAPGP-  174

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CGPAK+VKPT+F ++ GRRVT AMMTW ++C YS
Sbjct  175  -GYTCGPAKVVKPTKFFTNDGRRVTQAMMTWNITCTYS  211



>gb|KHG10282.1| COBRA-like protein 1 [Gossypium arboreum]
Length=455

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA+VTI+N+Q+ R I+ PGWTLGW+W+K EVIW+MMG Q
Sbjct  40   LDPNGNITIKWDIMSWTADGYVAVVTIFNFQQYRHIQAPGWTLGWKWSKKEVIWSMMGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDSATAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV +PKNFT +APG   GY CGPAKIVKP+RFV++  RRVT A+MTW
Sbjct  159  FQVSVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPSRFVTADKRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_007032845.1| COBRA-like protein 1 precursor [Theobroma cacao]
 gb|EOY03771.1| COBRA-like protein 1 precursor [Theobroma cacao]
Length=455

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VTIYN+Q+ R I+ PGWTLGW+WAK EVIW MMG Q
Sbjct  40   LDPNGNITIKWDIMSWTPDGYVAVVTIYNFQQYRHIQSPGWTLGWKWAKKEVIWGMMGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPA-AAASS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV +PKNFT +APG   GY CGPAKIVKP+RFVS   RRVT A+MTW
Sbjct  159  FQVSVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPSRFVSPDKRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_010260537.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=456

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VTI+N+Q+ R I+ PGWTLGW WAK EVIW+MMG Q
Sbjct  42   LDPNGNITIKWDIISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGQ  101

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  102  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPANAA-SS  160

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPT+F+S+  RRVT AMMTW
Sbjct  161  FQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTKFISADKRRVTQAMMTW  218

Query  642  KLSCLYS  662
             ++C YS
Sbjct  219  NVTCTYS  225



>gb|EPS71578.1| hypothetical protein M569_03176, partial [Genlisea aurea]
Length=433

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VTI+N+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  21   LDPNGNITIKWDVISWTPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQ  80

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  81   TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPANAA-SS  139

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CGPAK VKPT+FV+  GRRVT AMMTW
Sbjct  140  FQVSVGGAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKNVKPTKFVTQDGRRVTQAMMTW  197

Query  642  KLSCLYS  662
             ++C YS
Sbjct  198  NVTCTYS  204



>ref|XP_002514629.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF47735.1| Protein COBRA precursor, putative [Ricinus communis]
Length=383

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  37   LDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A VS 
Sbjct  97   TTEQGDCSKFKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPATA-VSS  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT +APG   GY CGPAKIV+PT+FV+   RRVT A+MTW
Sbjct  156  FQVSVGAAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKIVRPTKFVTPDKRRVTQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_010257980.1| PREDICTED: protein COBRA-like isoform X1 [Nelumbo nucifera]
Length=455

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VTIYN+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  40   LDPNGNITIKWDVISWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPTNAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CGPAKIVKPT+F ++  RR T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKIVKPTKFTTADQRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_002531000.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31388.1| Protein COBRA precursor, putative [Ricinus communis]
Length=456

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW M+G Q
Sbjct  37   LDPTGNITIKWDIINWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWNMVGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV+SSWG++ S+A VS 
Sbjct  97   TTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYNQQIANCCKGGVISSWGQDPSKA-VSA  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV +PKNFT +APG   GY CGPAKIV+P+RF ++  RRVT A+MTW
Sbjct  156  FQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVRPSRFFTTDKRRVTQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_002321786.2| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|ABK92936.1| unknown [Populus trichocarpa]
 gb|EEF05913.2| phytochelatin synthetase family protein [Populus trichocarpa]
Length=457

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW MMGAQ
Sbjct  40   LDPNGNITIKWDVIQWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWNMMGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A VS 
Sbjct  100  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPANA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKN T +APG   GY CGPAKIV+PT+F+S+  RR+T A+MTW
Sbjct  159  FQISVGAAGTTNKTVRVPKNITLKAPGP--GYTCGPAKIVRPTKFISADKRRITQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>ref|XP_011006295.1| PREDICTED: protein COBRA-like [Populus euphratica]
Length=458

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW MMGAQ
Sbjct  40   LDPNGNITIKWDVIQWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWNMMGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A VS 
Sbjct  100  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPANA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKN T  APG   GY CGPAKIV+PT+F+S+  RR+T A+MTW
Sbjct  159  FQISVGAAGTTNKTVRVPKNITLRAPGP--GYTCGPAKIVRPTKFISADKRRITQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>gb|KHN19598.1| Protein COBRA [Glycine soja]
Length=456

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGW+LGW WAK EVIW+MMGAQ
Sbjct  41   LDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWSMMGAQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SWG++ S A VS 
Sbjct  101  TTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPSNA-VSS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAK+VKPT F+++  RR T AMMTW
Sbjct  160  FQISVGSAGTTNKTVKMPKNFTLKAPGP--GYTCGPAKVVKPTVFITNDKRRTTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NITCTYS  224



>ref|XP_004138217.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 ref|XP_004171717.1| PREDICTED: protein COBRA-like [Cucumis sativus]
Length=455

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  40   LDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT +APG   GY CGPAKIV+PT+FVS   RRVT A+MTW
Sbjct  159  FQVSVGSAGTSNKTVKLPKNFTLKAPGP--GYTCGPAKIVRPTKFVSGDKRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_004488435.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=442

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDVI WT DGYVA+VT+YN+Q+ R I+EPGWTLGW WAK EVIW MMG+Q
Sbjct  28   LDPNGNITLKWDVISWTPDGYVAVVTMYNFQQYRHIQEPGWTLGWTWAKKEVIWNMMGSQ  87

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A VS 
Sbjct  88   TTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPNNA-VSS  146

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LP+NFT +APG   GY CGPAKIV+PT+F+++  RRVT A+MTW
Sbjct  147  FQISVGSAGTTNKTVKLPRNFTLKAPGP--GYTCGPAKIVRPTQFITNDKRRVTQALMTW  204

Query  642  KLSCLYS  662
             ++C YS
Sbjct  205  NITCTYS  211



>ref|XP_003527117.1| PREDICTED: protein COBRA [Glycine max]
Length=456

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGW+LGW WAK EVIW MMGAQ
Sbjct  41   LDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWNMMGAQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SWG++ S A VS 
Sbjct  101  TTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPSNA-VSS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAK+VKPT F+++  RR T AMMTW
Sbjct  160  FQISVGSAGTTNKTVKMPKNFTLKAPGP--GYTCGPAKVVKPTVFITNDKRRTTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NITCTYS  224



>ref|XP_007037617.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
 gb|EOY22118.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 2 [Theobroma cacao]
Length=456

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDVI WT DGYVA+VTIYN+Q+ R I+ PGWTLGW WAK EVIW+MMGAQ
Sbjct  40   LDPTGNVTIKWDVISWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT  APG   GY CGPAKIV+PT+FV+   RR+T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVRVPRNFTLRAPGP--GYTCGPAKIVRPTKFVTPDKRRITQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>gb|KDP24286.1| hypothetical protein JCGZ_25582 [Jatropha curcas]
Length=445

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+YN+Q+ R I  PGWTLGW WAK EVIW+M+G Q
Sbjct  29   LDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHIEAPGWTLGWTWAKKEVIWSMVGGQ  88

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+++P VVDLL GTPYNQQI NCCKGGV+SSW ++ S+A VS 
Sbjct  89   ATEQGDCSKFKGNIPHCCKKSPAVVDLLPGTPYNQQIANCCKGGVISSWAQDPSKA-VSA  147

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLS+G AG TNKTV LP+NFT +APG   GY CGPAKIV+P++F++   RRVT A+MTW
Sbjct  148  FQLSIGAAGTTNKTVRLPRNFTLKAPGP--GYTCGPAKIVRPSKFLTPDKRRVTQALMTW  205

Query  642  KLSCLYS  662
             ++C YS
Sbjct  206  NVTCTYS  212



>gb|KHG07280.1| COBRA-like protein 1 [Gossypium arboreum]
 gb|KHG08968.1| COBRA-like protein 1 [Gossypium arboreum]
Length=450

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT+DGYVA+VTIYN+Q+ R I+ PGW LGW WAK EVIW+MMG +
Sbjct  40   LDPNGNITIKWDIMSWTSDGYVAVVTIYNFQQYRHIQAPGWKLGWTWAKKEVIWSMMGGE  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C + P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNIPHCCNKHPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPATAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVGQ+G TNKTV +P NFT +APG   GY CGPAKIVKP+RFV+  GRR T AMMTW
Sbjct  159  FQLSVGQSGTTNKTVRVPVNFTLKAPGP--GYTCGPAKIVKPSRFVTPDGRRETQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_007138374.1| hypothetical protein PHAVU_009G203100g [Phaseolus vulgaris]
 gb|ESW10368.1| hypothetical protein PHAVU_009G203100g [Phaseolus vulgaris]
Length=452

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WTADGYVA+VT+YN+Q+ R I+ PGW+LGW WAK EVIW+MMG+Q
Sbjct  40   LDPTGNITIKWDVISWTADGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWSMMGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SWG++   A VS 
Sbjct  100  TTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDPGSA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG +G TNKTV +PKNFT +APG   GY CGPAKIVKPT F+++  RR T AMMTW
Sbjct  159  FQISVGSSGTTNKTVKMPKNFTLKAPGP--GYTCGPAKIVKPTTFITNDKRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>gb|KHG21362.1| Protein COBRA -like protein [Gossypium arboreum]
Length=455

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  40   LDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  100  TTEQGDCSKYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT +APG   GY CGPAKIVKPT+F+++  RR+T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVRVPRNFTLKAPGP--GYTCGPAKIVKPTKFITADKRRITQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_008453302.1| PREDICTED: protein COBRA-like [Cucumis melo]
Length=455

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+MMG Q
Sbjct  40   LDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT +APG   GY CGPAKIV+PT+FVS   RRVT A+MTW
Sbjct  159  FQVSVGAAGTSNKTVKLPKNFTLKAPGP--GYTCGPAKIVRPTKFVSGDKRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>gb|EYU34590.1| hypothetical protein MIMGU_mgv1a006245mg [Erythranthe guttata]
Length=451

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV  WTADGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+MMG Q
Sbjct  37   LDPNGNITIKWDVTSWTADGYVALVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ S  S S 
Sbjct  97   TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIGNCCKGGVINSWAQDPSN-SASA  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LP+NFT  APG   GY CGPAKIVKPT++++  GRRVT AMMTW
Sbjct  156  FQVSVGGAGTTNKTVKLPRNFTLRAPGP--GYTCGPAKIVKPTKYLTGDGRRVTQAMMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NITCTYS  220



>gb|KEH38144.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=452

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = +3

Query  18   SRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQR  197
            SRS+ ++L L     C +   +  A   L+  GNITI WDV+ W  DGY+AIVT+YN+Q+
Sbjct  11   SRSVFVVL-LFLLISCSTLFTSTEAYDPLDPNGNITIKWDVMGWNPDGYIAIVTMYNFQQ  69

Query  198  LRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTP  377
             R I+EPGWTLGW WAK EVIW MMG+QTT QGDCS+FK  IPH C++ P VVDLL GTP
Sbjct  70   YRHIQEPGWTLGWTWAKKEVIWNMMGSQTTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTP  129

Query  378  YNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGY  557
            YNQQI NCCKGG+L+SW ++ S A VS FQ+SVG AG TNKTV LP+NFT  APG   GY
Sbjct  130  YNQQIANCCKGGILNSWAQDPSNA-VSSFQISVGSAGTTNKTVKLPRNFTLRAPGP--GY  186

Query  558  ACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             CGPAKIV+PT+F+++  RRVT A+MTW ++C YS
Sbjct  187  TCGPAKIVRPTQFITTDKRRVTQALMTWNVTCTYS  221



>ref|XP_010939207.1| PREDICTED: COBRA-like protein 1 [Elaeis guineensis]
Length=460

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VTI+N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  44   LDPNGNITIKWDVMQWTPDGYVAVVTIFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQ  103

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYN QI NCCKGGV+SSW ++ + A+ S 
Sbjct  104  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWVQDPANAA-SS  162

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVGQAG TNKTV +PKNFT  APG   GY CG AKIVKPT+F+S  GRR T A+MTW
Sbjct  163  FQLSVGQAGTTNKTVRVPKNFTLRAPGP--GYTCGIAKIVKPTKFISQDGRRTTQALMTW  220

Query  642  KLSCLYS  662
             ++C YS
Sbjct  221  NVTCTYS  227



>ref|XP_010459308.1| PREDICTED: COBRA-like protein 1 [Camelina sativa]
Length=451

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +3

Query  9    MGF--SRSILLLLVLafftccfsfsfadaasHD-LNHGGNITINWDVIFWTADGYVAIVT  179
            MGF  S SI   L ++         +  + ++D L+  GNITI WD++ WTADGYVA+VT
Sbjct  1    MGFLCSSSIFFKLGISIIFLVSFSCYTPSEAYDPLDPSGNITIKWDIMTWTADGYVAVVT  60

Query  180  IYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVD  359
            IYN+Q+ R I+ PGWTLGW WAK EVIW M G QTT QGDCS+FKGNIPH C++TP VVD
Sbjct  61   IYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQTTEQGDCSKFKGNIPHCCKKTPSVVD  120

Query  360  LLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAP  539
            LL GTPYNQQI NCC+GGV++SW ++ + A VS FQL+VGQAG TNKTV +PKNFT +AP
Sbjct  121  LLPGTPYNQQIANCCRGGVINSWAQDPATA-VSAFQLTVGQAGTTNKTVRVPKNFTLKAP  179

Query  540  GSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            G   GY C P KIVKPTRF+ +  RRVT A+MTW ++C YS
Sbjct  180  GP--GYTCSPGKIVKPTRFIGTDKRRVTQALMTWNVTCTYS  218



>emb|CBI16946.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+YN+Q+ R I+ PGW+L W WAK EVIW+M+G Q
Sbjct  40   LDPNGNITIKWDIMSWTPDGYVAVVTMYNFQQYRHIQSPGWSLQWTWAKKEVIWSMLGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+SSW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVVSSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPTRFV+  GRRVT A+MTW
Sbjct  159  FQVSVGSAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTRFVTQDGRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_010660572.1| PREDICTED: protein COBRA [Vitis vinifera]
Length=456

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+YN+Q+ R I+ PGW+L W WAK EVIW+M+G Q
Sbjct  40   LDPNGNITIKWDIMSWTPDGYVAVVTMYNFQQYRHIQSPGWSLQWTWAKKEVIWSMLGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+SSW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVVSSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPTRFV+  GRRVT A+MTW
Sbjct  159  FQVSVGSAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTRFVTQDGRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>emb|CAN68249.1| hypothetical protein VITISV_020126 [Vitis vinifera]
Length=469

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+YN+Q+ R I+ PGW+L W WAK EVIW+M+G Q
Sbjct  40   LDPNGNITIKWDIMSWTPDGYVAVVTMYNFQQYRHIQSPGWSLQWTWAKKEVIWSMLGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+SSW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVVSSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY CGPAKIVKPTRFV+  GRRVT A+MTW
Sbjct  159  FQVSVGSAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKIVKPTRFVTQDGRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_002884308.1| phytochelatin synthetase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60567.1| phytochelatin synthetase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=451

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WD+I WT DGYVA VTIYN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  36   LDPTGNITVKWDIITWTGDGYVATVTIYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL GTPYNQQI NCC+GGVL+SW ++ + A VS 
Sbjct  96   TTEQGDCSKFKGNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVLNSWAQDSATA-VSA  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL++GQAG TNKTV +PKNFT +APG   GY C PAKIVKPTRF+ +  RRVT A+MTW
Sbjct  155  FQLTIGQAGTTNKTVRVPKNFTLKAPGP--GYTCSPAKIVKPTRFIGTDKRRVTQALMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>gb|KDP31373.1| hypothetical protein JCGZ_11749 [Jatropha curcas]
Length=457

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+M+G Q
Sbjct  40   LDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A VS 
Sbjct  100  TTEQGDCSKYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWAQDPATA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT +APG   GY CGPAKIV+PT+F+SS  RR T A+MTW
Sbjct  159  FQVSVGAAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKIVRPTKFISSDKRRSTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_010463618.1| PREDICTED: COBRA-like protein 1 [Camelina sativa]
Length=451

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +3

Query  9    MGF--SRSILLLLVLafftccfsfsfadaasHD-LNHGGNITINWDVIFWTADGYVAIVT  179
            MGF  S SI   L ++         +  + ++D L+  GNITI WD++ WTADGYVA+VT
Sbjct  1    MGFLCSSSIFFKLGISIIFLVSFSCYTPSEAYDPLDPSGNITIKWDIMTWTADGYVAVVT  60

Query  180  IYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVD  359
            IYN+Q+ R I+ PGWT+GW WAK EVIW M G QTT QGDCS+FKGNIPH C++TP VVD
Sbjct  61   IYNFQQYRHIQAPGWTVGWSWAKREVIWGMNGGQTTEQGDCSKFKGNIPHCCKKTPSVVD  120

Query  360  LLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAP  539
            LL GTPYNQQI NCC+GGV++SW ++ + A VS FQL+VGQAG TNKTV +PKNFT +AP
Sbjct  121  LLPGTPYNQQIANCCRGGVINSWAQDPATA-VSAFQLTVGQAGTTNKTVRVPKNFTLKAP  179

Query  540  GSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            G   GY C P KIVKPTRF+ +  RRVT A+MTW ++C YS
Sbjct  180  GP--GYTCSPGKIVKPTRFIGTDKRRVTQALMTWNVTCTYS  218



>ref|XP_003522986.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN03078.1| Protein COBRA [Glycine soja]
Length=456

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGW+LGW WAK EVIW+MMGAQ
Sbjct  41   LDPTGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWSMMGAQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SWG++ S A VS 
Sbjct  101  TTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWGQDASTA-VSS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TN+TV +PKNFT +APG   GY CGPAK+ KPT F+++  RR T AMMTW
Sbjct  160  FQVSVGSAGTTNRTVKMPKNFTLKAPGP--GYTCGPAKVGKPTVFITNDKRRTTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NITCTYS  224



>ref|XP_002264600.1| PREDICTED: protein COBRA [Vitis vinifera]
 emb|CBI15330.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT++N+Q+ R I+ PGW+LGW WAK EVIW+MMG Q
Sbjct  40   LDPEGNITIKWDVMSWTPDGYVAVVTMFNFQQYRHIQAPGWSLGWSWAKKEVIWSMMGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN+PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT  APG   GY CGPAKIVKPT+F ++  RRVT A+MTW
Sbjct  159  FQVSVGAAGTTNKTVKLPKNFTLRAPGP--GYTCGPAKIVKPTKFTTADQRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>gb|KHN18376.1| Protein COBRA, partial [Glycine soja]
Length=431

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGY+A+VT+YN+Q+ R I+ PGW LGW WAK EVIW +MG Q
Sbjct  18   LDPIGNITIKWDVISWTPDGYIAVVTMYNFQQYRHIQAPGWILGWTWAKKEVIWNVMGGQ  77

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCC GGVL+SW ++   A +S 
Sbjct  78   TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCSGGVLTSWAQDPENA-ISS  136

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV LPKNFT +APG   GY CGPAKIVKPT+F++   RR T A+MTW
Sbjct  137  FQLSVGSAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKIVKPTKFITKDKRRTTQALMTW  194

Query  642  KLSCLYS  662
             ++C YS
Sbjct  195  NVTCTYS  201



>ref|XP_007151373.1| hypothetical protein PHAVU_004G041300g [Phaseolus vulgaris]
 gb|ESW23367.1| hypothetical protein PHAVU_004G041300g [Phaseolus vulgaris]
Length=426

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+ N+Q+ R I  PGW+LGW WAK EVIW+M+G Q
Sbjct  41   LDPNGNITIKWDIMSWTPDGYVAVVTMNNFQKYRHISAPGWSLGWTWAKKEVIWSMVGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH CR+ P VVDLL GTPYNQQI NCCKGGVLSSW ++ S+A VS 
Sbjct  101  TTEQGDCSRFKGNIPHCCRKDPTVVDLLPGTPYNQQIANCCKGGVLSSWAQDQSKA-VSA  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LP++FT +APG   GY CGPAKIV+PT F+    RRVT A+MTW
Sbjct  160  FQISVGSAGTTNKTVKLPQSFTLKAPGP--GYTCGPAKIVEPTEFIQPDKRRVTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_008464583.1| PREDICTED: COBRA-like protein 1 [Cucumis melo]
Length=455

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA+VT+YN+Q+ R I+ PGW+L W+WAK EVIW MMG Q
Sbjct  36   LDPNGNITIKWDVMSWTADGYVAVVTLYNFQQYRHIQTPGWSLQWKWAKKEVIWNMMGGQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A VS 
Sbjct  96   ATEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPATA-VSS  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VG AG +NKTV LPKNFT +APG   GY CGPAKIVKP++F S   RRVT A+MTW
Sbjct  155  FQLTVGSAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKIVKPSKFKSPDKRRVTQALMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>ref|XP_006477706.1| PREDICTED: protein COBRA-like [Citrus sinensis]
Length=456

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ W  DGYVA+VTI+N+Q+ R I+ PGWTLGW WAK EVIW+MMG Q
Sbjct  41   LDPNGNITIKWDLMTWNPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV+SSW ++ + A +S 
Sbjct  101  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVISSWAQDPTTA-LSS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV +PKNFT +APG   GY CGPAK+ KPT+F++S  RRVT AMMTW
Sbjct  160  FQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKVGKPTKFITSDKRRVTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_003550707.1| PREDICTED: protein COBRA-like [Glycine max]
Length=454

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGY+A+VT+YN+Q+ R I+ PGW LGW WAK EVIW +MG Q
Sbjct  41   LDPIGNITIKWDVISWTPDGYIAVVTMYNFQQYRHIQAPGWILGWTWAKKEVIWNVMGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCC GGVL+SW ++   A +S 
Sbjct  101  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCSGGVLTSWAQDPENA-ISS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV LPKNFT +APG   GY CGPAKIVKPT+F++   RR T A+MTW
Sbjct  160  FQLSVGSAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKIVKPTKFITKDKRRTTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_008240088.1| PREDICTED: protein COBRA-like isoform X2 [Prunus mume]
Length=373

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSR+KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A +S 
Sbjct  100  TTEQGDCSRYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWIQDPANA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY+CG AKIVKPTRF+++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRMPKNFTLKAPGP--GYSCGIAKIVKPTRFLTADKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>emb|CDP19973.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R+I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  37   LDPNGNITIKWDVITWTPDGYVAVVTMFNFQQYRRIQAPGWTLGWTWAKKEVIWSMVGAQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFK N PH C++ P VVDLL GTPYNQQI NCCKGGVL+ W ++ + A VS 
Sbjct  97   TTEQGDCSRFKLNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNPWVQDPATA-VSA  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG +G TNKTV +PKNFT +APG   GY CGPAK+ KPT+F ++ GRR T AMMTW
Sbjct  156  FQVSVGSSGTTNKTVRMPKNFTLKAPGP--GYTCGPAKVGKPTKFFTADGRRTTQAMMTW  213

Query  642  KLSC  653
             ++C
Sbjct  214  NVTC  217



>ref|XP_006408435.1| hypothetical protein EUTSA_v10020716mg [Eutrema salsugineum]
 gb|ESQ49888.1| hypothetical protein EUTSA_v10020716mg [Eutrema salsugineum]
Length=451

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA VT+YN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  35   LDPTGNITIKWDIITWTGDGYVATVTLYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL GTPYNQQI NCC+GGV++SW ++ + A VS 
Sbjct  95   TTEQGDCSKFKGNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVINSWAQDPATA-VSA  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY CGP KIVKPTRF+++  RR T A MTW
Sbjct  154  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGPGKIVKPTRFIATDKRRATQAFMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>emb|CDY43250.1| BnaC05g48430D [Brassica napus]
Length=457

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA VT+YN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  37   LDPSGNITIKWDIITWTGDGYVATVTLYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++TP VVDLL GTPYNQQ+ NCC+GGV++SW ++ + A VS 
Sbjct  97   TTEQGDCSKFKGTIPHCCKKTPSVVDLLPGTPYNQQVANCCRGGVINSWAQDPATA-VSS  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY CGP KIVKP+RFV +  RRVT AMMTW
Sbjct  156  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGPGKIVKPSRFVGTDKRRVTQAMMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>emb|CDY60470.1| BnaAnng16830D [Brassica napus]
Length=458

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA VT+YN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  38   LDPSGNITIKWDIITWTGDGYVATVTMYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQ  97

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++TP VVDLL GTPYNQQ+ NCC+GGV++SW ++ + A VS 
Sbjct  98   TTEQGDCSKFKGTIPHCCKKTPSVVDLLPGTPYNQQVANCCRGGVINSWAQDPATA-VSS  156

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY CGP KIVKP+RFV +  RRVT AMMTW
Sbjct  157  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGPGKIVKPSRFVGTDKRRVTQAMMTW  214

Query  642  KLSCLYS  662
             ++C YS
Sbjct  215  NVTCTYS  221



>ref|XP_009147371.1| PREDICTED: COBRA-like protein 1 [Brassica rapa]
Length=455

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA VT+YN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  40   LDPSGNITIKWDIITWTGDGYVATVTMYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++TP VVDLL GTPYNQQ+ NCC+GGV++SW ++ + A VS 
Sbjct  100  TTEQGDCSKFKGTIPHCCKKTPSVVDLLPGTPYNQQVANCCRGGVINSWAQDPATA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY CGP KIVKP+RFV +  RRVT AMMTW
Sbjct  159  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGPGKIVKPSRFVGTDKRRVTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_003552600.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN37930.1| Protein COBRA [Glycine soja]
Length=448

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+ N+Q+ R I  PGW++GW WAK EVIW+MMG Q
Sbjct  33   LDPNGNITIKWDIISWTPDGYVAVVTMNNFQQYRHIASPGWSMGWTWAKKEVIWSMMGGQ  92

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ + A VS 
Sbjct  93   TTEQGDCSKFKGGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWAQDPTNA-VSS  151

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG+AG TNKTV +PKNFT +APG   GY CGPAKIV PT+F++S  RRVT A+MTW
Sbjct  152  FQVSVGRAGTTNKTVKVPKNFTLKAPGP--GYTCGPAKIVAPTKFITSDKRRVTQALMTW  209

Query  642  KLSCLYS  662
             ++C YS
Sbjct  210  NVTCTYS  216



>ref|XP_002305390.1| phytochelatin synthetase family protein [Populus trichocarpa]
 gb|EEE85901.1| phytochelatin synthetase family protein [Populus trichocarpa]
Length=453

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW+M+G Q
Sbjct  37   LDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKKEVIWSMLGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGN+PH C+++P VVDLL GTPYNQQ  NCCKGGV+SSW ++ + A+ S 
Sbjct  97   ATDQGDCSKFKGNVPHCCKKSPTVVDLLPGTPYNQQTANCCKGGVISSWAQDPANAA-SS  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG +NKTV LPKNFT +APG   GY C  AKIVKPTRF+S+  RR+T A+MTW
Sbjct  156  FQLSVGSAGTSNKTVRLPKNFTLKAPGP--GYTCARAKIVKPTRFMSTDKRRITQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_008785625.1| PREDICTED: COBRA-like protein 1 [Phoenix dactylifera]
Length=461

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VTIYN+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  45   LDPNGNITIKWDVMQWTPDGYVAVVTIYNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQ  104

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYN QI NCCKGGV+SSW ++ + A+ S 
Sbjct  105  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWVQDQANAA-SS  163

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVGQAG TNKTV +PKNFT  APG   GY CG AKIVK ++FVS  GRR T A+MTW
Sbjct  164  FQLSVGQAGTTNKTVRVPKNFTLRAPGP--GYTCGIAKIVKSSKFVSQDGRRTTQALMTW  221

Query  642  KLSCLYS  662
             ++C YS
Sbjct  222  NVTCTYS  228



>ref|XP_010087346.1| hypothetical protein L484_012679 [Morus notabilis]
 gb|EXB28920.1| hypothetical protein L484_012679 [Morus notabilis]
Length=449

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  32   LDPTGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  91

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN+PH C++ P VVDLL GT YNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  92   TTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTAYNQQIANCCKGGVLNSWVQDPANAA-SS  150

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CGPAKIV+ T+F+++  RRVT A+MTW
Sbjct  151  FQISVGAAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKIVRATKFITADKRRVTQALMTW  208

Query  642  KLSCLYS  662
             ++C YS
Sbjct  209  NVTCTYS  215



>ref|XP_007208787.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica]
 gb|EMJ09986.1| hypothetical protein PRUPE_ppa024172mg [Prunus persica]
Length=447

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSR+KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A +S 
Sbjct  100  TTEQGDCSRYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWIQDPANA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY+CG AKIVKPTRF+++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRLPKNFTLKAPGP--GYSCGIAKIVKPTRFLTADKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_010528423.1| PREDICTED: COBRA-like protein 2 [Tarenaya hassleriana]
Length=445

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGW LGW WAK EVIW+M+G Q
Sbjct  30   LDPNGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWQLGWTWAKKEVIWSMLGGQ  89

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            +T QGDCS+FKGNIPH C+++P +VDLL GTPYNQQI NCCKGGV++SW ++ + AS S 
Sbjct  90   STEQGDCSKFKGNIPHCCKKSPTIVDLLPGTPYNQQIANCCKGGVINSWAQDPATASAS-  148

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV +P+NFT +APG   GY CGPAKIVKP+RF+++  RR T A+MTW
Sbjct  149  FQISVGQAGTSNKTVRVPRNFTLKAPGP--GYTCGPAKIVKPSRFITADNRRFTQALMTW  206

Query  642  KLSCLYS  662
             ++C YS
Sbjct  207  NVTCTYS  213



>ref|XP_006297664.1| hypothetical protein CARUB_v10013688mg [Capsella rubella]
 gb|EOA30562.1| hypothetical protein CARUB_v10013688mg [Capsella rubella]
Length=450

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGY+A+VTIYN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  35   LDPSGNITIKWDIISWTADGYMAVVTIYNFQQYRHIQAPGWTLGWSWAKREVIWGMSGGQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVDLL GTPYNQQI NCC+GGV++SW ++ + A VS 
Sbjct  95   ATEQGDCSKFKGNIPHCCKKTPSVVDLLPGTPYNQQIANCCRGGVINSWAQDPATA-VSA  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL VGQAG TNKTV +PKNFT  APG   GY C P KIVKPTRF+ +  RRVT A+MTW
Sbjct  154  FQLIVGQAGTTNKTVRVPKNFTLNAPGP--GYTCSPGKIVKPTRFIGTDKRRVTQALMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_004137135.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 ref|XP_004154723.1| PREDICTED: protein COBRA-like [Cucumis sativus]
 gb|KGN53788.1| hypothetical protein Csa_4G129050 [Cucumis sativus]
Length=455

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA+VT+YN+Q+ R I+ PGW+L W+WAK EVIW M+G Q
Sbjct  36   LDPNGNITIKWDIMSWTADGYVAVVTLYNFQQYRHIQTPGWSLQWKWAKKEVIWNMLGGQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A VS 
Sbjct  96   ATEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPATA-VSS  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VG AG +NKTV LPKNFT +APG   GY CGPAKIVKP++F S   RRVT A+MTW
Sbjct  155  FQLTVGSAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKIVKPSKFKSPDKRRVTQALMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>ref|XP_006440798.1| hypothetical protein CICLE_v10020097mg [Citrus clementina]
 gb|ESR54038.1| hypothetical protein CICLE_v10020097mg [Citrus clementina]
Length=456

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ W  DGYVA+VTI+N+Q+ R I+ PGWTLGW WAK EVIW+MMG  
Sbjct  41   LDPNGNITIKWDIMTWNPDGYVAVVTIFNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGGL  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV+SSW ++ + A +S 
Sbjct  101  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVISSWAQDPTTA-LSS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV +PKNFT +APG   GY CGPAK+ KPT+F++S  RRVT AMMTW
Sbjct  160  FQLSVGAAGTTNKTVRVPKNFTLKAPGP--GYTCGPAKVGKPTKFITSDKRRVTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|NP_186870.1| COBRA-like protein 1 precursor [Arabidopsis thaliana]
 sp|Q9SRT7.1|COBL1_ARATH RecName: Full=COBRA-like protein 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02128.1|AC009755_21 unknown protein [Arabidopsis thaliana]
 dbj|BAC43156.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|AAO63437.1| At3g02210 [Arabidopsis thaliana]
 gb|AEE73779.1| COBRA-like protein 1 precursor [Arabidopsis thaliana]
Length=452

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WD+I WT DGYVA VT+YN+Q+ R I+ PGWTLGW WAK EVIW M G Q
Sbjct  37   LDPSGNITVKWDIITWTGDGYVATVTVYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++TP VVDLL G+PYNQQI NCC+GGVL+SW ++ + A VS 
Sbjct  97   TTEQGDCSKFKGTIPHCCKKTPSVVDLLPGSPYNQQIANCCRGGVLNSWAQDPATA-VSA  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY C PAKIVKPTRF+ +  RRVT A+MTW
Sbjct  156  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCSPAKIVKPTRFIGTDKRRVTQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_011014072.1| PREDICTED: COBRA-like protein 1 [Populus euphratica]
Length=453

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW+M+G Q
Sbjct  37   LDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKKEVIWSMLGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+++P VVDLL G PYNQQ  NCCKGGV+SSW ++ + A+ S 
Sbjct  97   ATEQGDCSKFKGNIPHCCKKSPTVVDLLPGIPYNQQTANCCKGGVISSWAQDPANAA-SS  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG +NKTV LPKNFT +APG   GY C  AKIVKPTRF+S+  RR+T A+MTW
Sbjct  156  FQLSVGSAGTSNKTVRLPKNFTLKAPGP--GYTCARAKIVKPTRFMSTDKRRITQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_010037254.1| PREDICTED: protein COBRA-like [Eucalyptus grandis]
 gb|KCW48926.1| hypothetical protein EUGRSUZ_K02540 [Eucalyptus grandis]
Length=458

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  41   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQSPGWTLGWTWAKKEVIWSMMGSQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSR+KGN PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  101  TTEQGDCSRYKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPANAA-SS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT +APG   GY CGPAKIV+ T+FVS+  RR T A+MTW
Sbjct  160  FQVSVGAAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKIVRSTKFVSADKRRTTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>gb|AFZ78568.1| COBRA-like protein [Populus tomentosa]
Length=453

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW+M+G Q
Sbjct  37   LDPTGNITIKWDIISWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKKEVIWSMLGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+++P VVDLL G PYNQQ  NCCKGGV+SSW ++ + A+ S 
Sbjct  97   ATDQGDCSKFKGNIPHCCKKSPTVVDLLPGIPYNQQTANCCKGGVISSWAQDSANAA-SS  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG +NKTV LPKNFT +APG   GY C  AKIVKPTRF+S+  RR+T A+MTW
Sbjct  156  FQLSVGSAGTSNKTVRLPKNFTLKAPGP--GYTCARAKIVKPTRFMSTDKRRITQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>gb|KCW48927.1| hypothetical protein EUGRSUZ_K02540 [Eucalyptus grandis]
Length=457

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+MMG+Q
Sbjct  40   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQSPGWTLGWTWAKKEVIWSMMGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSR+KGN PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  100  TTEQGDCSRYKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT +APG   GY CGPAKIV+ T+FVS+  RR T A+MTW
Sbjct  159  FQVSVGAAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKIVRSTKFVSADKRRTTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_006603925.1| PREDICTED: protein COBRA-like [Glycine max]
 gb|KHN04372.1| Protein COBRA [Glycine soja]
Length=454

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+ N+Q+ R I EPGW+LGW WAK EVIW+M+G Q
Sbjct  36   LDPYGNITIKWDIISWTPDGYVAVVTMNNFQQYRHISEPGWSLGWTWAKKEVIWSMVGGQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ S+A VS 
Sbjct  96   TTEQGDCSKYKGNIPHCCKKNPVVVDLLPGTPYNQQIANCCKGGVLSSWAQDQSKA-VSA  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPK+FT +APG   GY CGPA IVKPT F+    RRVT A+MTW
Sbjct  155  FQVSVGSAGTTNKTVKLPKDFTLKAPGP--GYTCGPATIVKPTLFIQPDKRRVTQALMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>ref|XP_008240087.1| PREDICTED: protein COBRA-like isoform X1 [Prunus mume]
Length=456

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQTPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSR+KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A +S 
Sbjct  100  TTEQGDCSRYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWIQDPANA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT +APG   GY+CG AKIVKPTRF+++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRMPKNFTLKAPGP--GYSCGIAKIVKPTRFLTADKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>gb|AAM62930.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=456

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 166/226 (73%), Gaps = 9/226 (4%)
 Frame = +3

Query  3    LEMGFSRSI-----LLLLVLafftccfsfsfadaasHD-LNHGGNITINWDVIFWTADGY  164
            +E  FSRS      L  L L       S SF    ++D L+  GNITI WDV+ WT DGY
Sbjct  1    MESFFSRSTSIVSKLSFLALWIVFLISSSSFTSTEAYDALDPEGNITIKWDVMSWTPDGY  60

Query  165  VAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRT  344
            VA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQTT QGDCS++KGNIPH C++ 
Sbjct  61   VAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKD  120

Query  345  PEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNF  524
            P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S FQ+SVG AG TNKTV +P+NF
Sbjct  121  PTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SSFQISVGAAGTTNKTVRVPRNF  179

Query  525  TFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            T   PG   GY CGPAKIV+PT+FV++  RR T AMMTW ++C YS
Sbjct  180  TLMGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCTYS  223



>ref|NP_001241986.1| uncharacterized protein LOC100782876 precursor [Glycine max]
 gb|ACU21272.1| unknown [Glycine max]
Length=448

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+ N+Q+ R I  PGW++GW WAK EVIW+MMG Q
Sbjct  33   LDPNGNITIKWDIISWTPDGYVAVVTMNNFQQYRHIASPGWSMGWTWAKKEVIWSMMGGQ  92

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ + A VS 
Sbjct  93   TTEQGDCSKFKGGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWVQDPTNA-VSS  151

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG+AG TN+TV +PKNFT +APG   GY CGPAKIV PT+F++S  RRVT A+MTW
Sbjct  152  FQVSVGRAGTTNRTVKVPKNFTLKAPGP--GYTCGPAKIVAPTKFITSDKRRVTQALMTW  209

Query  642  KLSCLYS  662
             ++C YS
Sbjct  210  NVTCTYS  216



>gb|KHN08345.1| Protein COBRA, partial [Glycine soja]
Length=438

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+YN+Q+ R I  PGW+LGW WAK EVIW+MMG Q
Sbjct  21   LDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHISAPGWSLGWTWAKKEVIWSMMGGQ  80

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++K NIPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ S+A V+ 
Sbjct  81   TTEQGDCSKYKANIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQSKA-VAA  139

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG A  TNKTV +PK+FT +APG   GY CGPA IVKPT+F+    RRVT A+MTW
Sbjct  140  FQVSVGSASTTNKTVKVPKDFTLKAPGP--GYTCGPATIVKPTQFLQPDKRRVTQALMTW  197

Query  642  KLSCLYS  662
             ++C YS
Sbjct  198  NVTCTYS  204



>ref|XP_009338021.1| PREDICTED: protein COBRA-like [Pyrus x bretschneideri]
Length=456

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+ SW ++   A +S 
Sbjct  100  TTEQGDCSKYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPPNA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT  APG   GY+CG AKIVKPTRF++S  RR T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVRLPKNFTLRAPGP--GYSCGIAKIVKPTRFLTSDKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_009415817.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=458

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 157/216 (73%), Gaps = 9/216 (4%)
 Frame = +3

Query  15   FSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQ  194
            F+ S L +LVL+                 L+  GNITI WD++ WT DGYVA+VTI+N+Q
Sbjct  22   FALSFLFVLVLSSLIPSTEAY------DSLDPNGNITIKWDIMQWTPDGYVAVVTIFNFQ  75

Query  195  RLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGT  374
            + R I+ PGW LGW WAK EVIW+M+GAQTT QGDCSRFKGN PH C++ P VVDLL GT
Sbjct  76   QYRHIQAPGWILGWTWAKKEVIWSMVGAQTTEQGDCSRFKGNTPHCCKKDPTVVDLLPGT  135

Query  375  PYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGG  554
            PYNQQI NCCKGGV++SW ++ + A+ S FQ+SVG AG TNKTV +PKNFT  APG   G
Sbjct  136  PYNQQIANCCKGGVINSWVQDPANAA-SSFQVSVGAAGTTNKTVRVPKNFTLRAPGP--G  192

Query  555  YACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            Y CG AKIVKPT+FV+  GRR T A+MTW ++C YS
Sbjct  193  YTCGIAKIVKPTKFVTQDGRRTTQALMTWNVTCTYS  228



>gb|KHN30325.1| Protein COBRA [Glycine soja]
Length=448

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+ N+Q+ R I  PGW++GW WAK EVIW+MMG Q
Sbjct  33   LDPNGNITIKWDIISWTPDGYVAVVTMNNFQQYRHIASPGWSMGWTWAKKEVIWSMMGGQ  92

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG IPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ + A VS 
Sbjct  93   TTEQGDCSKFKGGIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLSSWVQDPTNA-VSS  151

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG+AG TN+TV +PKNFT +APG   GY CGPAKIV PT+F++S  RRVT A+MTW
Sbjct  152  FQVSVGRAGTTNRTVKVPKNFTLKAPGP--GYTCGPAKIVAPTKFITSDKRRVTQALMTW  209

Query  642  KLSCLYS  662
             ++C YS
Sbjct  210  NVTCTYS  216



>ref|XP_008374650.1| PREDICTED: protein COBRA-like [Malus domestica]
Length=456

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+ SW ++   A +S 
Sbjct  100  ATEQGDCSKYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPDNA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY+CG AKIVKPTRF++S  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRLPKNFTLKAPGP--GYSCGIAKIVKPTRFLTSDKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_004491893.1| PREDICTED: protein COBRA-like [Cicer arietinum]
Length=446

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 161/221 (73%), Gaps = 10/221 (5%)
 Frame = +3

Query  9    MGFS---RSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVT  179
            MGFS   ++ +L L L   +C  S          L+  GNITI WD+I WT DGYVA+VT
Sbjct  1    MGFSLLSKAFILFLFLLSSSCFTSTDAY----DPLDPNGNITIKWDIITWTPDGYVAVVT  56

Query  180  IYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVD  359
            + N+Q+ R I  PGW+LGW WAK EVIW M+G+QTT QGDCS+FKGN+PH C++ P VVD
Sbjct  57   VNNFQQYRHIAAPGWSLGWTWAKKEVIWGMVGSQTTEQGDCSKFKGNVPHCCKKDPTVVD  116

Query  360  LLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAP  539
            LL GTPYNQQI NCCKGGVLSSW ++ + A V  FQ+SVG+AG TNKTV +PKNFT +AP
Sbjct  117  LLPGTPYNQQIANCCKGGVLSSWAQDPTNA-VGSFQISVGRAGTTNKTVKVPKNFTLKAP  175

Query  540  GSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            G   GY CGPAK+V+PT+F+    RRVT A+MTW ++C YS
Sbjct  176  GP--GYTCGPAKVVRPTQFIQPDKRRVTQALMTWNVTCTYS  214



>ref|XP_008393240.1| PREDICTED: protein COBRA-like [Malus domestica]
Length=456

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPTGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+ SW ++   A +S 
Sbjct  100  TTEQGDCSKYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPPNA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT  APG   GY+CG AKIVKPTRF++S  RR T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVRLPKNFTLRAPGP--GYSCGIAKIVKPTRFLTSDKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_006394554.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
 gb|ESQ31840.1| hypothetical protein EUTSA_v10004178mg [Eutrema salsugineum]
Length=458

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 165/226 (73%), Gaps = 9/226 (4%)
 Frame = +3

Query  3    LEMGFSRSI-----LLLLVLafftccfsfsfadaasHD-LNHGGNITINWDVIFWTADGY  164
            +E  FSRS      L  L +  F    S SF    ++D L+  GNIT+ WDV+ WT DGY
Sbjct  1    MESFFSRSTSIVFKLSFLAVYIFFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGY  60

Query  165  VAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRT  344
            VA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQTT QGDCS++KGNIPH C++ 
Sbjct  61   VAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKD  120

Query  345  PEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNF  524
            P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S FQ+SVG AG TNKTV +P+NF
Sbjct  121  PTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGNAA-SSFQISVGAAGTTNKTVRVPRNF  179

Query  525  TFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            T   PG   GY CGPAKIVKPT+FV+   RR T AMMTW ++C YS
Sbjct  180  TLMGPGP--GYTCGPAKIVKPTKFVTPDTRRTTQAMMTWNITCTYS  223



>ref|XP_008775852.1| PREDICTED: LOW QUALITY PROTEIN: COBRA-like protein 1 [Phoenix 
dactylifera]
Length=460

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  45   LDPNGNITIKWDIMQWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  104

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYN QI NCCKGGVLSSW ++ + A+ S 
Sbjct  105  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVLSSWVQDPANAA-SS  163

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G+AG TNKTV +PKNFT  APG   GY CG AKIVKPT+FVS  GRR T A+MTW
Sbjct  164  FQISAGRAGTTNKTVRVPKNFTLNAPGP--GYTCGVAKIVKPTKFVSQDGRRTTQALMTW  221

Query  642  KLSCLYS  662
             ++C YS
Sbjct  222  NVTCTYS  228



>ref|NP_568930.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
 sp|Q94KT8.1|COBRA_ARATH RecName: Full=Protein COBRA; AltName: Full=Cell expansion protein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56072.1|AF319663_1 putative glycosylphosphatidylinositol-anchored protein [Arabidopsis 
thaliana]
 gb|AAM19781.1| AT5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AAN64510.1| At5g60920/MSL3_40 [Arabidopsis thaliana]
 gb|AED97397.1| glycosylphosphatidylinositol-anchored protein COBRA [Arabidopsis 
thaliana]
Length=456

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 166/226 (73%), Gaps = 9/226 (4%)
 Frame = +3

Query  3    LEMGFSRSI-----LLLLVLafftccfsfsfadaasHD-LNHGGNITINWDVIFWTADGY  164
            +E  FSRS      L  L L       S SF    ++D L+  GNIT+ WDV+ WT DGY
Sbjct  1    MESFFSRSTSIVSKLSFLALWIVFLISSSSFTSTEAYDALDPEGNITMKWDVMSWTPDGY  60

Query  165  VAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRT  344
            VA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQTT QGDCS++KGNIPH C++ 
Sbjct  61   VAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKD  120

Query  345  PEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNF  524
            P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S FQ+SVG AG TNKTV +P+NF
Sbjct  121  PTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SSFQISVGAAGTTNKTVRVPRNF  179

Query  525  TFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            T   PG   GY CGPAKIV+PT+FV++  RR T AMMTW ++C YS
Sbjct  180  TLMGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCTYS  223



>ref|XP_007155211.1| hypothetical protein PHAVU_003G183000g [Phaseolus vulgaris]
 gb|ESW27205.1| hypothetical protein PHAVU_003G183000g [Phaseolus vulgaris]
Length=454

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGY+A+VT+YN+Q+ R I  PGW LGW WAK EVIW +MG Q
Sbjct  41   LDPTGNITIKWDVISWTPDGYMAVVTMYNFQQYRHIEAPGWILGWTWAKKEVIWNVMGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P +VDLL G+PYNQQI NCC GGVL+SW ++   A +S 
Sbjct  101  TTEQGDCSRFKGNIPHCCKKDPTIVDLLPGSPYNQQIANCCTGGVLTSWAQDPEHA-ISS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TNKTV LP+NFT +APG   GY CGPAKIVKPT+F++   RR T A+MTW
Sbjct  160  FQLSVGSAGTTNKTVKLPRNFTLKAPGP--GYTCGPAKIVKPTKFITKDKRRSTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_009346186.1| PREDICTED: protein COBRA-like [Pyrus x bretschneideri]
Length=456

 Score =   266 bits (680),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPNGNITIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS++KGN+PH C++ P +VDLL GTPYNQQI NCCKGGV+ SW ++   A +S 
Sbjct  100  ATEQGDCSKYKGNVPHCCKKDPTIVDLLPGTPYNQQIANCCKGGVMQSWIQDPDNA-ISS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY+CG AKIVKPTRF++S  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRLPKNFTLKAPGP--GYSCGIAKIVKPTRFLTSDKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_010695258.1| PREDICTED: protein COBRA-like [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGY+A+VT++N+Q+ R I+ PGWTLGW WAK +VIW+M+GAQ
Sbjct  40   LDPNGNITIKWDVINWTPDGYLAVVTMFNFQQYRHIQPPGWTLGWTWAKKDVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCC+GGVL+SWG++ + A V  
Sbjct  100  TTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYNQQIANCCRGGVLTSWGQDPANA-VGA  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LP+NFT +APG   GY CGPA+IVK T F ++  RR T A+MTW
Sbjct  159  FQISVGQAGTSNKTVKLPRNFTLQAPGP--GYTCGPARIVKSTEFKTADKRRTTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_011087367.1| PREDICTED: protein COBRA-like isoform X1 [Sesamum indicum]
Length=454

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VTI+N+Q+ R I  PGW LGW WAK EVIW+M+G Q
Sbjct  38   LDPNGNITVKWDVMSWTPDGYVAVVTIFNFQKYRHIESPGWKLGWTWAKKEVIWSMLGGQ  97

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFKGNIPH C++ P +VDLL GTPYNQQI NCCKGGV+SSW ++ + A+ S 
Sbjct  98   ATEQGDCSRFKGNIPHCCKKNPTIVDLLPGTPYNQQIANCCKGGVISSWVQDPANAA-SS  156

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVGQAG +NKTV LPKNFT   PG   GY CGPAKIVKP++F +   RRVT A+MTW
Sbjct  157  FQLSVGQAGTSNKTVRLPKNFTLLGPGP--GYTCGPAKIVKPSKFTTPDKRRVTQALMTW  214

Query  642  KLSCLYS  662
             ++C YS
Sbjct  215  NVTCSYS  221



>gb|AFK41534.1| unknown [Lotus japonicus]
Length=432

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA VT+YN+Q+ R I+ PGW+LGW WAK EVIW MMG Q
Sbjct  37   LDPTGNITIKWDVISWTPDGYVATVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWDMMGGQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++ P VVDLL GTPYNQQ+ NCCKGGVL+SW ++   A VS 
Sbjct  97   TTEQGDCSKFKAGIPHCCKKDPTVVDLLPGTPYNQQVANCCKGGVLNSWAQDPGNA-VSS  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CGPAK V+PT++++S  RR+T A+MTW
Sbjct  156  FQISVGSAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKNVRPTKYITSDKRRITQALMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_003543887.1| PREDICTED: protein COBRA-like isoform X1 [Glycine max]
Length=458

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+YN+Q+ R I  PGW+LGW WAK EVIW+MMG Q
Sbjct  41   LDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHISAPGWSLGWTWAKKEVIWSMMGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++K NIPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ S+A V+ 
Sbjct  101  TTEQGDCSKYKANIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQSKA-VAA  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG A  TNKTV +PK+FT +APG   GY CGPA IVKPT+F+    RRVT A+MTW
Sbjct  160  FQVSVGSASTTNKTVKVPKDFTLKAPGP--GYTCGPATIVKPTQFLQPDKRRVTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_009589623.1| PREDICTED: protein COBRA-like isoform X2 [Nicotiana tomentosiformis]
Length=445

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITINWDVI WT DGYVA+VT+YN+Q+ R I+ PGWTL W WAK EVIW M+G++
Sbjct  13   LDPNGNITINWDVISWTPDGYVAVVTMYNFQQYRHIQPPGWTLRWTWAKDEVIWNMIGSR  72

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QG+CS+FKG+IPH C++ P VVDLL  TP+NQQI NCCKGGV++SWG++ S A V+ 
Sbjct  73   TTEQGNCSKFKGDIPHCCKKNPTVVDLLPETPHNQQIANCCKGGVVNSWGQDPSTA-VTS  131

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG  NKTV +PKNFT +APG   GY CGPAKIVKPT+F++   RRVT AMMTW
Sbjct  132  FQLSVGSAGTNNKTVRVPKNFTLQAPGL--GYTCGPAKIVKPTKFITPDRRRVTQAMMTW  189

Query  642  KLSCLYS  662
             ++C YS
Sbjct  190  NVTCTYS  196



>ref|XP_004958241.1| PREDICTED: COBRA-like protein 1-like [Setaria italica]
Length=452

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+V++YNYQ+ R I+ PGW LGW WAK E+IW M G Q
Sbjct  35   LDPNGNITIKWDVMQWTPDGYVAVVSLYNYQQYRHIQAPGWKLGWVWAKKEIIWAMTGGQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPH CR+ PE+VDLL GTPYN QI NCCKGGVL++W ++   A V+ 
Sbjct  95   ATEQGDCSKFKSNIPHCCRKDPEIVDLLPGTPYNMQIANCCKGGVLTAWAQDPENA-VAS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TN+TV +PKNFT +APG   GY CGPAK+VKPT+F+S  GRR T A MTW
Sbjct  154  FQISVGQAGTTNRTVKVPKNFTLKAPGP--GYTCGPAKLVKPTKFISQDGRRSTQAHMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>gb|KFK27869.1| hypothetical protein AALP_AA8G439700 [Arabis alpina]
Length=455

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 165/226 (73%), Gaps = 9/226 (4%)
 Frame = +3

Query  3    LEMGFSRSILL------LLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGY  164
            +E  FSRS  L      L V   F    SF  +  A   L+  GNIT+ WDV+ WT DGY
Sbjct  1    MESFFSRSTSLVAKSSFLAVCIVFLISSSFFTSAEAYDALDPEGNITMKWDVMSWTPDGY  60

Query  165  VAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRT  344
            VA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQTT QGDCS++KGNIPH C++ 
Sbjct  61   VAVVTMFNFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQTTEQGDCSKYKGNIPHCCKKD  120

Query  345  PEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNF  524
            P VVDLL GTPYNQQI NCC+GGV++SW ++ + A+ S FQ+SVG AG TNKTV +P+NF
Sbjct  121  PTVVDLLPGTPYNQQIANCCRGGVMNSWVQDPATAA-SSFQISVGAAGTTNKTVRVPRNF  179

Query  525  TFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            T   PG   GY CGPAKIVKPT+FV++  RR T AMMTW ++C YS
Sbjct  180  TLMGPGP--GYTCGPAKIVKPTKFVTTDTRRTTQAMMTWNITCTYS  223



>ref|XP_010032552.1| PREDICTED: protein COBRA-like [Eucalyptus grandis]
 gb|KCW51945.1| hypothetical protein EUGRSUZ_J01392 [Eucalyptus grandis]
Length=480

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VTI+N+Q+ R I+ PGW+LGW WAK EVIWTM+G Q
Sbjct  67   LDPNGNITIRWDVMSWTPDGYVAVVTIFNFQQYRHIQAPGWSLGWTWAKKEVIWTMLGGQ  126

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSR+KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+SSW ++ + A+ S 
Sbjct  127  ATEQGDCSRYKGNVPHCCKKNPTVVDLLPGTPYNQQIANCCKGGVISSWLQDPANAA-SA  185

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG +G TNKTV LPKNFT +APG   GY CGPAKIVKPT+F ++  RR T A MTW
Sbjct  186  FQLSVGASGTTNKTVRLPKNFTLKAPGP--GYTCGPAKIVKPTKFPTADKRRFTQAQMTW  243

Query  642  KLSCLYS  662
             ++C YS
Sbjct  244  NVTCAYS  250



>ref|XP_010522480.1| PREDICTED: protein COBRA [Tarenaya hassleriana]
Length=458

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW+WAK EVIW+M+G Q
Sbjct  40   LDPEGNITIKWDVMSWTPDGYVAVVTMYNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCC+GGVL+SW ++ S A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCRGGVLNSWVQDPSTAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT  APG   GY CGPAK+ KPT+FV+   RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLLAPGP--GYTCGPAKVGKPTKFVTPDSRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_009395002.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  43   LDPNGNITIKWDIMQWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  102

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  103  TTEQGDCSRFKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPANAA-SS  161

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT  APG   GY CG AKIVKPT+FV+  GRR T A+MTW
Sbjct  162  FQVSVGAAGTTNKTVRVPKNFTLRAPGP--GYTCGIAKIVKPTKFVTQDGRRTTQALMTW  219

Query  642  KLSCLYS  662
             ++C YS
Sbjct  220  NVTCTYS  226



>ref|XP_010551800.1| PREDICTED: COBRA-like protein 1 isoform X2 [Tarenaya hassleriana]
Length=450

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW M G Q
Sbjct  34   LDPFGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWGMNGGQ  93

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A V+ 
Sbjct  94   TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPATA-VAA  152

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY CG   I+KP+RF+S   RRVT A+MTW
Sbjct  153  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGAGNIIKPSRFISPDKRRVTQALMTW  210

Query  642  KLSCLYS  662
             ++C YS
Sbjct  211  NVTCTYS  217



>ref|XP_009589615.1| PREDICTED: protein COBRA-like isoform X1 [Nicotiana tomentosiformis]
Length=466

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITINWDVI WT DGYVA+VT+YN+Q+ R I+ PGWTL W WAK EVIW M+G++
Sbjct  34   LDPNGNITINWDVISWTPDGYVAVVTMYNFQQYRHIQPPGWTLRWTWAKDEVIWNMIGSR  93

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QG+CS+FKG+IPH C++ P VVDLL  TP+NQQI NCCKGGV++SWG++ S A V+ 
Sbjct  94   TTEQGNCSKFKGDIPHCCKKNPTVVDLLPETPHNQQIANCCKGGVVNSWGQDPSTA-VTS  152

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG  NKTV +PKNFT +APG   GY CGPAKIVKPT+F++   RRVT AMMTW
Sbjct  153  FQLSVGSAGTNNKTVRVPKNFTLQAPGL--GYTCGPAKIVKPTKFITPDRRRVTQAMMTW  210

Query  642  KLSCLYS  662
             ++C YS
Sbjct  211  NVTCTYS  217



>ref|XP_010443903.1| PREDICTED: protein COBRA-like [Camelina sativa]
Length=456

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLLGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>ref|XP_002866404.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42663.1| hypothetical protein ARALYDRAFT_496244 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLLGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>ref|XP_007151374.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
 gb|ESW23368.1| hypothetical protein PHAVU_004G041400g [Phaseolus vulgaris]
Length=431

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT++N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDVMSWTPDGYVAVVTVHNFQMFRHIMNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG+IPH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S+A +S 
Sbjct  83   TTEQGDCSKFKGSIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSQA-ISS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT  APG   GY+CGPAKIV  T F++   RR T A+MTW
Sbjct  142  FQVSVGQAGTTNKTVKLPKNFTLLAPGP--GYSCGPAKIVPSTTFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_010456834.1| PREDICTED: protein COBRA [Camelina sativa]
Length=456

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLLGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>ref|XP_010936446.1| PREDICTED: COBRA-like protein 1 [Elaeis guineensis]
Length=547

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  131  LDPNGNITIKWDIMQWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  190

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYN QI NCCKGGV+SSW ++ + A+ S 
Sbjct  191  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWIQDPANAA-SS  249

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G+AG TNKTV +PKNFT  APG   GY CG AKIVKPT+FV++ GRR T A+MTW
Sbjct  250  FQISAGRAGTTNKTVRVPKNFTLNAPGP--GYTCGAAKIVKPTKFVTADGRRTTQALMTW  307

Query  642  KLSCLYS  662
             ++C YS
Sbjct  308  NVTCTYS  314



>ref|XP_010551799.1| PREDICTED: COBRA-like protein 1 isoform X1 [Tarenaya hassleriana]
Length=502

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW M G Q
Sbjct  86   LDPFGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWGMNGGQ  145

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A V+ 
Sbjct  146  TTEQGDCSRFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPATA-VAA  204

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY CG   I+KP+RF+S   RRVT A+MTW
Sbjct  205  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCGAGNIIKPSRFISPDKRRVTQALMTW  262

Query  642  KLSCLYS  662
             ++C YS
Sbjct  263  NVTCTYS  269



>gb|KEH21748.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=446

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA VT+ N+Q+ R I  PGW+LGW WAK EVIW+M+G+Q
Sbjct  31   LDPNGNITIKWDIIQWTPDGYVATVTMNNFQQYRHIASPGWSLGWTWAKKEVIWSMVGSQ  90

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ + A V  
Sbjct  91   TTEQGDCSKFKGNVPHCCKKNPTVVDLLPGTPYNQQIANCCKGGVLSSWAQDPTMA-VGA  149

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG+AG TNKTV +PKNFT  APG   GY CGPAKIV+PT+F+    RRVT A+MTW
Sbjct  150  FQISVGRAGTTNKTVKVPKNFTLNAPGP--GYTCGPAKIVRPTQFIQPDKRRVTQALMTW  207

Query  642  KLSCLYS  662
             ++C YS
Sbjct  208  NVTCTYS  214



>ref|XP_009606715.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=408

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ NYQ  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  29   LDPNGNITIKWDVLSWTPDGYVAVVTMNNYQMYRPIMSPGWTLGWTWAKNEVIWSMLGAQ  88

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+F+ NIPHSC + P +VDLL  TP+NQQI NCCKGGVL SWG++ S A++S 
Sbjct  89   ATEQGDCSKFRTNIPHSCDKNPSIVDLLPNTPFNQQIANCCKGGVLDSWGKDPS-AALSA  147

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TN+TV LPKNFT  APG   GY CGPAKI+  TRF++  GRRVT AMMTW
Sbjct  148  FQISVGSAGTTNRTVKLPKNFTLLAPGP--GYTCGPAKIITSTRFITPDGRRVTKAMMTW  205

Query  642  KLSCLYS  662
            ++ C YS
Sbjct  206  RVICTYS  212



>ref|XP_006280281.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
 gb|EOA13179.1| hypothetical protein CARUB_v10026206mg, partial [Capsella rubella]
Length=537

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 151/188 (80%), Gaps = 3/188 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQ
Sbjct  121  LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQ  180

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  181  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SS  239

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV++  RR T AMMTW
Sbjct  240  FQISVGAAGTTNKTVRVPRNFTLMGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTW  297

Query  642  KLSCLYSN  665
             ++C YS 
Sbjct  298  NITCTYSQ  305



>emb|CDP21681.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  37   LDPNGNITIKWDVITWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  96

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFK N PH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A VS 
Sbjct  97   TTEQGDCSRFKLNTPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPATA-VSA  155

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG +G TN+TV +PKNFT +APG   GY CGPAK+ KPT+F ++ GRR T AMMTW
Sbjct  156  FQVSVGSSGTTNRTVRMPKNFTLKAPGP--GYTCGPAKVGKPTKFSTADGRRTTQAMMTW  213

Query  642  KLSCLYS  662
             ++C YS
Sbjct  214  NVTCTYS  220



>ref|XP_004234909.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=431

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  22   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWTMIGAQ  81

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVD+L G PYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  82   ATEQGDCSKFKGNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQD-PQSSVSA  140

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C PAKIV PT+F +   RR T A+MTW
Sbjct  141  FQVSVGQAGTTNKTVKLPKNFTLLGPGP--GYTCSPAKIVPPTKFFTPDLRRKTQALMTW  198

Query  642  KLSCLYS  662
             L+C YS
Sbjct  199  NLTCTYS  205



>ref|XP_004232142.1| PREDICTED: COBRA-like protein 4 [Solanum lycopersicum]
Length=434

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  25   LDPNGNITIKWDVMSWTPDGYVATVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSMVGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  85   TTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYNQQFTNCCKGGVLASWGQD-PQSSVSA  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY CGPAKIV PT+F +   RR T A+MTW
Sbjct  144  FQVSVGQAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPPTKFFTPDLRRKTQALMTW  201

Query  642  KLSCLYS  662
             ++C YS
Sbjct  202  NVTCTYS  208



>gb|ABD96927.1| hypothetical protein [Cleome spinosa]
Length=436

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW M G Q
Sbjct  20   LDPDGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWGMNGGQ  79

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDL+ GTPYNQQI NCCKGGV++S+ ++ +  +VS 
Sbjct  80   TTEQGDCSRFKGNIPHCCKQDPTVVDLMPGTPYNQQIANCCKGGVINSFAQDPA-TTVSA  138

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY C P  IVKP+RF+S+  RR+T A+MTW
Sbjct  139  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCSPGNIVKPSRFISADKRRITQALMTW  196

Query  642  KLSCLYS  662
             ++C YS
Sbjct  197  NVTCTYS  203



>ref|XP_006338344.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  25   LDPNGNITIKWDVMSWTPDGYVATVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSMVGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  85   TTEQGDCSKFKGNIPHCCKKNPTVVDLLPGTPYNQQFTNCCKGGVLASWGQD-PQSSVSA  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY CGPAKIV PT+F +   RR T A+MTW
Sbjct  144  FQVSVGQAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPPTKFFTPDLRRKTQALMTW  201

Query  642  KLSCLYS  662
             ++C YS
Sbjct  202  NVTCTYS  208



>ref|XP_010525122.1| PREDICTED: COBRA-like protein 1 [Tarenaya hassleriana]
Length=450

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW M G Q
Sbjct  34   LDPDGNITIKWDIMTWTADGYVAVVTIYNFQQYRHIQAPGWSLGWTWAKREVIWGMNGGQ  93

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGNIPH C++ P VVDL+ GTPYNQQI NCCKGGV++S+ ++ +  +VS 
Sbjct  94   TTEQGDCSRFKGNIPHCCKQDPTVVDLMPGTPYNQQIANCCKGGVINSFAQDPA-TTVSA  152

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VGQAG TNKTV +PKNFT +APG   GY C P  IVKP+RF+S+  RR+T A+MTW
Sbjct  153  FQLTVGQAGTTNKTVRVPKNFTLKAPGP--GYTCSPGNIVKPSRFISADKRRITQALMTW  210

Query  642  KLSCLYS  662
             ++C YS
Sbjct  211  NVTCTYS  217



>ref|XP_002460985.1| hypothetical protein SORBIDRAFT_02g038720 [Sorghum bicolor]
 gb|EER97506.1| hypothetical protein SORBIDRAFT_02g038720 [Sorghum bicolor]
Length=458

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT+DGYVA+V++YNYQ+ R I+ PGW LGW WAK EVIW M G Q
Sbjct  41   LDPNGNITIKWDVIQWTSDGYVAVVSLYNYQQYRHIQAPGWKLGWVWAKKEVIWAMTGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPH CR+ PEVVDLL GTPYN QI NCCKGGVL+SW ++ S A V+ 
Sbjct  101  ATEQGDCSKFKTNIPHCCRKDPEVVDLLPGTPYNMQIANCCKGGVLTSWAQDPSNA-VAS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TN+TV +PKNFT +APG   GY CG AK+V PT+F+S  GRR T A MTW
Sbjct  160  FQVSVGQAGTTNRTVKVPKNFTLKAPGP--GYTCGTAKLVTPTKFISPDGRRSTQAHMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_006368071.1| PREDICTED: COBRA-like protein 4-like, partial [Solanum tuberosum]
Length=408

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  12   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWTMIGAQ  71

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVD+L G PYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  72   ATEQGDCSKFKGNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQD-PQSSVSA  130

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C PAKIV PT+F ++  RR T A+MTW
Sbjct  131  FQVSVGQAGTTNKTVKLPKNFTLLGPGP--GYTCSPAKIVPPTKFFTADLRRKTQALMTW  188

Query  642  KLSCLYS  662
             ++C YS
Sbjct  189  NVTCTYS  195



>ref|XP_007139436.1| hypothetical protein PHAVU_008G029200g [Phaseolus vulgaris]
 gb|ESW11430.1| hypothetical protein PHAVU_008G029200g [Phaseolus vulgaris]
Length=420

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+QR R I  PGW+LGW WAK EVIW+MMG Q
Sbjct  33   LDPNGNITIKWDVLSWTPDGYVAVVTMNNFQRYRHITSPGWSLGWTWAKREVIWSMMGGQ  92

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPHSC++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ SRA+ S 
Sbjct  93   TTEQGDCSKFKGNIPHSCKKNPTVVDLLPGTPYNQQIANCCKGGVLSSWVQDPSRAAAS-  151

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AGN+ +TV LP NFT + PG   GY CG A+IV+PT+F++   RR T A+MTW
Sbjct  152  FQVSVGDAGNSKRTVKLPTNFTLKTPGP--GYTCGKARIVRPTKFITPDKRRTTQALMTW  209

Query  642  KLSCLYS  662
            ++ C YS
Sbjct  210  QVVCTYS  216



>emb|CDY16831.1| BnaA09g05510D [Brassica napus]
Length=458

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I  PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGNAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAK+V+PT+FV++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMGPGP--GYTCGPAKVVRPTKFVTTDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>emb|CDX87193.1| BnaC09g05080D [Brassica napus]
Length=456

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I  PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGNAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAK+V+PT+FV++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMGPGP--GYTCGPAKVVRPTKFVTTDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>ref|XP_006363258.1| PREDICTED: COBRA-like protein 4-like [Solanum tuberosum]
Length=434

 Score =   263 bits (672),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  25   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTLGWTWAKKEVIWTMIGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVD+L G PYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  85   ATEQGDCSKFKGNIPHCCKKTPTVVDMLPGVPYNQQFTNCCKGGVLASWGQD-PQSSVSA  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C PAKIV PT+F ++  RR T A+MTW
Sbjct  144  FQVSVGQAGTTNKTVKLPKNFTLLGPGP--GYTCSPAKIVPPTKFFTADLRRKTQALMTW  201

Query  642  KLSCLYS  662
             ++C YS
Sbjct  202  NVTCTYS  208



>gb|AHC30880.1| COBRA-like protein [Oncidium hybrid cultivar]
 gb|AHJ14778.1| COBRA-like protein [Oncidium hybrid cultivar]
Length=461

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VTI N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  44   LDPNGNITIKWDIMQWTPDGYVAVVTINNFQQYRHIQSPGWTLGWTWAKKEVIWSMVGAQ  103

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYN QI NCCKGGV+SSW ++   A VS 
Sbjct  104  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNMQIANCCKGGVISSWAQDPPNA-VSA  162

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT  APG   GY CG AKIVK T+FVS  GRR T A+MTW
Sbjct  163  FQVSVGAAGTTNKTVRVPKNFTLRAPGP--GYTCGAAKIVKQTQFVSQDGRRTTQALMTW  220

Query  642  KLSCLYS  662
             ++C YS
Sbjct  221  NVTCTYS  227



>ref|XP_003518180.1| PREDICTED: protein COBRA-like [Glycine max]
Length=458

 Score =   263 bits (673),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+YN+Q+ R I  PGW+LGW WAK EVIW+M+G Q
Sbjct  41   LDPNGNITIKWDIISWTPDGYVAVVTMYNFQQYRHISVPGWSLGWTWAKKEVIWSMIGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++K NIPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ S+A V+ 
Sbjct  101  TTEQGDCSKYKANIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQSKA-VAA  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG A  TNKTV +PK+FT +APG   GY CGPA IVKPT+F+    RRVT A+MTW
Sbjct  160  FQVSVGSASTTNKTVKVPKDFTLKAPGP--GYTCGPATIVKPTQFLQPDKRRVTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_004299285.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDVI WT DGYVA+VT++N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  40   LDPLGNVTIKWDVISWTPDGYVAVVTMFNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSR+KGN+PH C++ P VVDLL GTPYNQQI NCCKGGV+ SW ++   A VS 
Sbjct  100  TTEQGDCSRYKGNVPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMQSWIQDPGNA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY+CG A IVKPTR++++  RR T AMMTW
Sbjct  159  FQVSVGAAGTTNKTVRLPKNFTLKAPGP--GYSCGRAAIVKPTRYLTADKRRWTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>gb|ABS88990.1| ch-cobra [Cunninghamia lanceolata]
Length=452

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGW+LGW WAK EVIW+M+GAQ
Sbjct  36   LDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQAPGWSLGWTWAKKEVIWSMVGAQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFKGNIPH C +TP VVDLL GTPYNQQI NCCKGGV++SW ++   A VS 
Sbjct  96   ATQQGDCSRFKGNIPHCCLKTPNVVDLLPGTPYNQQIANCCKGGVIASWAQDPINA-VSA  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +N TV LPKNFT +APG   GY CGPAK VK + F+S+ GRR T A+MTW
Sbjct  155  FQVSVGSAGTSNTTVRLPKNFTLKAPGP--GYTCGPAKKVKSSLFLSADGRRFTQALMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>ref|XP_009763133.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=435

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  26   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSMVGAQ  85

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL G PYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  86   TTEQGDCSKFKGNIPHCCKKNPTVVDLLPGVPYNQQFTNCCKGGVLASWGQD-PQSSVSA  144

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAKIV PT+F +   RR T A+MTW
Sbjct  145  FQISVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPPTKFFTPDLRRKTQALMTW  202

Query  642  KLSCLYS  662
             ++C YS
Sbjct  203  NVTCTYS  209



>gb|AFK45756.1| unknown [Lotus japonicus]
Length=448

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 161/225 (72%), Gaps = 15/225 (7%)
 Frame = +3

Query  9    MGFSRS-------ILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYV  167
            MGFS S       IL L +L+      + ++       L+  GNITI WD+I WT+DGYV
Sbjct  1    MGFSLSSTAASTCILFLFLLSCTCFTSTDAY-----DPLDPNGNITIKWDIITWTSDGYV  55

Query  168  AIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTP  347
            A+VT+ N+Q+ R I  PGW+LGW WAK EVIW+M+G Q T QGDCS+FKG+IPH C++ P
Sbjct  56   AVVTMNNFQQYRHIAAPGWSLGWAWAKKEVIWSMVGGQATEQGDCSKFKGSIPHCCKKDP  115

Query  348  EVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFT  527
             VVDLL GTPYN Q  NCCKGGVLSSW ++ + A V+ FQ+SVG+AG TNKTV +PKNFT
Sbjct  116  TVVDLLPGTPYNMQFSNCCKGGVLSSWAQDPTNA-VASFQVSVGRAGTTNKTVKVPKNFT  174

Query  528  FEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             +APG   GY CGPAKIVKPT+F+    RRVT A+MTW ++C YS
Sbjct  175  LKAPGP--GYTCGPAKIVKPTKFIQPDKRRVTQALMTWNVTCTYS  217



>ref|XP_007139435.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
 gb|AAR13304.1| phytochelatin synthetase-like protein [Phaseolus vulgaris]
 gb|ESW11429.1| hypothetical protein PHAVU_008G029100g [Phaseolus vulgaris]
Length=448

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 159/223 (71%), Gaps = 12/223 (5%)
 Frame = +3

Query  9    MGFS-----RSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAI  173
            MGFS        +LLLVL + TC  S          L+  GNITI WD+I WT DGYVA+
Sbjct  1    MGFSLLPKATPCILLLVLLYCTCFTSTDAY----DPLDPNGNITIKWDIITWTPDGYVAV  56

Query  174  VTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEV  353
            VT+ N+Q+ R I  PGW LGW WAK EVIW+MMG QTT QGDCS+FK  IPH C++ P V
Sbjct  57   VTMNNFQQYRHIASPGWRLGWTWAKKEVIWSMMGGQTTEQGDCSKFKAGIPHCCKKDPTV  116

Query  354  VDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFE  533
            VDLL GTPYNQQI NCCKGGVL SW ++ + A VS FQ+SVG+AG TNKTV +PKNFT  
Sbjct  117  VDLLPGTPYNQQIANCCKGGVLGSWVQDPTNA-VSSFQVSVGRAGTTNKTVKVPKNFTLS  175

Query  534  APGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            APG   GY CGPAKIVKPT+F+ +  RRVT A+MTW ++C YS
Sbjct  176  APGP--GYTCGPAKIVKPTQFIQADKRRVTQALMTWNVTCQYS  216



>ref|XP_009151763.1| PREDICTED: COBRA-like protein 2 [Brassica rapa]
 emb|CDX86358.1| BnaA06g30750D [Brassica napus]
Length=436

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA+V+I+N+Q+ R I+ PGW LGW W K EVIW+M+GAQ
Sbjct  30   LDPTGNITIKWDIISWTADGYVAVVSIFNFQQYRHIQAPGWQLGWSWYKKEVIWSMVGAQ  89

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVDLL GTPYNQQI NCC+GGV+SSW ++ + A VS 
Sbjct  90   ATEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQQISNCCRGGVISSWAQDPATA-VSS  148

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQ+G TN TV  P+N T +APG   GY CGPAK+V PT+F+S+  RR T AM+TW
Sbjct  149  FQISVGQSGTTNTTVRAPRNVTLKAPGP--GYTCGPAKVVPPTKFISNDKRRKTQAMLTW  206

Query  642  KLSCLYS  662
             ++C YS
Sbjct  207  NMTCTYS  213



>ref|XP_010546210.1| PREDICTED: protein COBRA-like [Tarenaya hassleriana]
Length=455

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWT+GW+WAK EVIW+M+G Q
Sbjct  40   LDPEGNITIKWDVMSWTPDGYVAVVTMYNFQKYRHIQSPGWTMGWKWAKKEVIWSMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN PH C++ P VVDLL GTPYNQQI NCC+GGVL+SW ++ S A+ S 
Sbjct  100  TTEQGDCSKYKGNTPHCCKKDPTVVDLLPGTPYNQQIANCCRGGVLNSWVQDPSTAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT  APG   GY CGPAK+ +PT+FV+S  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMAPGP--GYTCGPAKVGRPTQFVTSDSRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>emb|CDX85277.1| BnaC07g25880D [Brassica napus]
Length=436

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA+V+I+N+Q+ R I+ PGW LGW W K EVIW+M+GAQ
Sbjct  30   LDPTGNITIKWDIISWTADGYVAVVSIFNFQQYRHIQAPGWQLGWSWYKKEVIWSMVGAQ  89

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVDLL GTPYNQQI NCC+GGV+SSW ++ + A VS 
Sbjct  90   ATEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQQISNCCRGGVISSWAQDPATA-VSS  148

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQ+G TN TV  P+N T +APG   GY CGPAK+V PT+F+S+  RR T AM+TW
Sbjct  149  FQISVGQSGTTNTTVRAPRNVTLKAPGP--GYTCGPAKVVPPTKFISNDKRRKTQAMLTW  206

Query  642  KLSCLYS  662
             ++C YS
Sbjct  207  NMTCTYS  213



>ref|XP_010087960.1| hypothetical protein L484_016828 [Morus notabilis]
 gb|EXB30970.1| hypothetical protein L484_016828 [Morus notabilis]
Length=587

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 151/182 (83%), Gaps = 3/182 (2%)
 Frame = +3

Query  114  GNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQ  293
            GNITI WDV+ WT DGYVA+VTIYN+Q  R+I+ PGWTLGW WA+ EVIW+M+GAQTT Q
Sbjct  16   GNITIKWDVMSWTPDGYVAVVTIYNFQHNREIKAPGWTLGWTWAEKEVIWSMLGAQTTEQ  75

Query  294  GDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLS  473
            GDCSRF  NIPHSC++ P VVDLL GTP+NQQIENCCKGGVL+SW R+ + A+ S FQ+S
Sbjct  76   GDCSRFIENIPHSCKKKPIVVDLLPGTPFNQQIENCCKGGVLNSWFRDPANAA-SSFQVS  134

Query  474  VGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSC  653
            VG AGN+N+TV LPKNFT +APG   GY CGPA+IV+PT+F++   +RVT+A MTW ++C
Sbjct  135  VGVAGNSNRTVKLPKNFTLKAPGP--GYPCGPARIVRPTKFLTPDKKRVTYAFMTWNVTC  192

Query  654  LY  659
            ++
Sbjct  193  IH  194



>emb|CDY58691.1| BnaC07g49800D [Brassica napus]
Length=458

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I  PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S 
Sbjct  100  TTEQGDCSKYKGNLPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGTAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV+   RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMGPGP--GYTCGPAKIVRPTQFVTPDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>ref|XP_011099033.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=433

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMSPGWTVGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVDLL G PYNQQ  NCCKGGVL++WG++  +ASVS 
Sbjct  83   ATEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVLAAWGQD-PQASVSA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAKIV PT F++   RR T A+MTW
Sbjct  142  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPPTNFLTPDRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_009600081.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=435

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  26   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWSMVGAQ  85

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P +VDLL G PYNQQ  NCCKGGVL+SWG++  ++SVS 
Sbjct  86   TTEQGDCSKFKGNIPHCCKKNPTIVDLLPGVPYNQQFTNCCKGGVLASWGQD-PQSSVSA  144

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAKIV PT+F +   RR T A+MTW
Sbjct  145  FQISVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPPTKFFTPDLRRKTQALMTW  202

Query  642  KLSCLYS  662
             ++C YS
Sbjct  203  NVTCTYS  209



>ref|XP_009136413.1| PREDICTED: protein COBRA [Brassica rapa]
Length=457

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I  PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S 
Sbjct  100  TTEQGDCSKYKGNLPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGTAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV+   RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMGPGP--GYTCGPAKIVRPTQFVTPDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>emb|CDY02184.1| BnaA03g39830D [Brassica napus]
Length=457

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I  PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGN+PH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S 
Sbjct  100  TTEQGDCSKYKGNLPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGTAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV+   RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMGPGP--GYTCGPAKIVRPTQFVTPDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>gb|KHN04371.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA+VT++N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNVTIKWDVMSWTPDGYVAVVTMHNFQMFRHIMNPGWTLGWTWAKKEVIWSMIGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL G PYNQQ  NCCKGGV+++WG++ S+A +S 
Sbjct  83   TTEQGDCSKFKGNIPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSQA-ISS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT  APG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  142  FQVSVGQAGTSNKTVKLPKNFTLFAPGP--GYTCGPAKIVPSTNFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_009386184.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ W  DGYVA+VTI+N+Q+ R I+ PGW LGW WAK EVIW+M+G Q
Sbjct  43   LDPNGNITIKWDVMQWAPDGYVAVVTIFNFQQYRHIQAPGWMLGWTWAKKEVIWSMVGGQ  102

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFKGNIPH C++ P VVDLL GTPYN QI NCCKGG++SSW ++ + A+ S 
Sbjct  103  ATEQGDCSRFKGNIPHCCKKDPSVVDLLPGTPYNMQIANCCKGGIISSWVQDPANAA-SS  161

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +PKNFT ++PG   GY CG AKIVKP+RFVS  GRR T A+MTW
Sbjct  162  FQISVGAAGTTNKTVRVPKNFTLKSPGP--GYTCGAAKIVKPSRFVSQDGRRTTQALMTW  219

Query  642  KLSCLYS  662
             ++C YS
Sbjct  220  NVTCTYS  226



>gb|EYU44224.1| hypothetical protein MIMGU_mgv1a019628mg [Erythranthe guttata]
Length=440

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 153/215 (71%), Gaps = 7/215 (3%)
 Frame = +3

Query  21   RSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQRL  200
            RS+LLL  L       S    DA    L+  GNITINWD+I WT +GY A+VTI N+Q+ 
Sbjct  6    RSMLLLFFLFSCATFTSIEAYDA----LDPNGNITINWDIITWTGNGYTAVVTISNFQKY  61

Query  201  RKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKG-NIPHSCRRTPEVVDLLSGTP  377
            R I+ PGWTLGW WAK EVI TM G QTT QGDCSRF+G NIPH C++ P VVDLL GTP
Sbjct  62   RHIQAPGWTLGWTWAKSEVILTMAGGQTTEQGDCSRFQGSNIPHCCKKDPTVVDLLPGTP  121

Query  378  YNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGY  557
            YNQQI NCC+GGV+ S+ ++    S S FQL+VG+AG TN TV LPKNFT +APG   GY
Sbjct  122  YNQQIANCCRGGVIDSFAQDPPAHSASSFQLTVGEAGTTNTTVDLPKNFTLKAPGP--GY  179

Query  558  ACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             CGPA+I  PT+F+S  GRR T AMMTWK+ C YS
Sbjct  180  TCGPAEIAMPTKFISQDGRRATQAMMTWKVKCTYS  214



>ref|XP_009761753.1| PREDICTED: COBRA-like protein 4 [Nicotiana sylvestris]
Length=434

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VTI N+Q  R I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  25   LDPNGNITIKWDVMSWTPDGYVAVVTINNFQMYRHIMTPGWTLGWTWAKKEVIWTMVGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP  VD+L G PYNQQ  NCCKGGVL+SWG++  +ASVS 
Sbjct  85   TTEQGDCSKFKGNVPHCCKKTPTTVDMLPGVPYNQQFTNCCKGGVLASWGQD-PQASVSA  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAKIV  T+F +   RR T A+MTW
Sbjct  144  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTKFFTPDLRRKTQALMTW  201

Query  642  KLSCLYS  662
             ++C YS
Sbjct  202  NVTCTYS  208



>ref|XP_007215357.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica]
 gb|EMJ16556.1| hypothetical protein PRUPE_ppa005522mg [Prunus persica]
Length=456

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VTIYN+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  40   LDPSGNITIKWDIISWTPDGYVAVVTIYNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A V  
Sbjct  100  ATEQGDCSKFKTTIPHCCKKNPTVVDLLPGTPYNQQITNCCKGGVLASWVQDPANA-VGS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVGQAG TNKTV  PKN T  APG   GY CG A IVKPT+FV++  RRVT AMMTW
Sbjct  159  FQLSVGQAGTTNKTVRAPKNLTLNAPGP--GYTCGRANIVKPTKFVTADKRRVTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_006363260.1| PREDICTED: COBRA-like protein 3-like [Solanum tuberosum]
Length=466

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
             +  GNITI WDVI WT DGYVA+VTI N+Q+ R I+ PGW+L W W K EVIW+M+G+Q
Sbjct  26   FDPNGNITIKWDVISWTPDGYVAVVTINNFQQYRHIQPPGWSLKWTWEKDEVIWSMLGSQ  85

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QG+CS+FKG+IPH C++ P V+DLL  TP+NQQI NCCKGGV++SWG++ S  S+S 
Sbjct  86   TTEQGNCSKFKGDIPHCCKKDPTVIDLLPETPHNQQIANCCKGGVVNSWGQDPSN-SISS  144

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG AG TN TV +PKNFT  APG   GY CGPAKIVKPT+F +  GRRVT AMMTW
Sbjct  145  FQLSVGSAGTTNNTVRIPKNFTLNAPGP--GYTCGPAKIVKPTKFFTPDGRRVTQAMMTW  202

Query  642  KLSCLYS  662
             ++C YS
Sbjct  203  NVTCTYS  209



>gb|KEH21749.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=431

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA VT+ N+Q  R I  PGWTLGW WAK EVIW+M+G+Q
Sbjct  23   LDPNGNITIKWDVVSWTADGYVAAVTMSNFQMYRHIMNPGWTLGWSWAKKEVIWSMVGSQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT  APG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQVSVGQAGTSNKTVKLPKNFTLLAPGP--GYTCGPAKIVPSTTFLTTDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_011085598.1| PREDICTED: COBRA-like protein 4 [Sesamum indicum]
Length=431

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 153/218 (70%), Gaps = 12/218 (6%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            MGF  ++  + VL      +           L+  GNITI WD++ WT DGYVA+VT+ N
Sbjct  1    MGFLVAVFFVCVLFSSVDAY---------DPLDPNGNITIKWDIMSWTPDGYVAVVTMNN  51

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q  R I  PGWT+GW WAK EVIW+M+GAQTT QGDCS+FKGNIPH C++ P VVDLL 
Sbjct  52   FQMYRHIMSPGWTVGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKDPTVVDLLP  111

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            G PYNQQ  NCCKGGVL++W ++  +ASVS FQ+SVGQAG TNKTV LPKNFT   PG  
Sbjct  112  GAPYNQQFSNCCKGGVLAAWAQD-PQASVSAFQVSVGQAGTTNKTVKLPKNFTLLGPGP-  169

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CGPAK+V PT F++   RR T A+MTW ++C YS
Sbjct  170  -GYTCGPAKVVPPTNFLTPDRRRKTQALMTWNVTCTYS  206



>ref|XP_010694050.1| PREDICTED: COBRA-like protein 4 [Beta vulgaris subsp. vulgaris]
Length=435

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WD++ WT DGYVA VTI N+Q  R + +PGW LGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITVKWDIMSWTPDGYVATVTINNFQMYRHVGDPGWQLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL GTPYNQQ  NCCKGGVL+SWG++ S  SVS+
Sbjct  83   TTEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQQFSNCCKGGVLNSWGQDKS-GSVSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  142  FQVSVGQAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTNFLTQDRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_003554956.1| PREDICTED: COBRA-like protein 4-like [Glycine max]
Length=431

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WD++ WT DGYVA+VT++N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNVTIKWDLMSWTPDGYVAVVTMHNFQMFRHIMNPGWTLGWTWAKKEVIWSMIGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL G PYNQQ  NCCKGGV+++WG++ S+A +S 
Sbjct  83   TTEQGDCSKFKGNIPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSQA-ISS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT  APG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  142  FQVSVGQAGTSNKTVKLPKNFTLFAPGP--GYTCGPAKIVPSTNFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_006373387.1| hypothetical protein POPTR_0017s13310g [Populus trichocarpa]
 gb|ERP51184.1| hypothetical protein POPTR_0017s13310g [Populus trichocarpa]
Length=404

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VTIYNYQ+ R I  PGW+LGW WA++EVIW M+G  
Sbjct  21   LDPNGNITIKWDVMAWTPDGYVAVVTIYNYQQYRHIEAPGWSLGWTWAEHEVIWNMVGGL  80

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRF+G IP+SC+++P VVDLL GTPYNQQI NCCKGGV+SS  ++ S A+ S 
Sbjct  81   TTEQGDCSRFQGEIPYSCQKSPTVVDLLPGTPYNQQIANCCKGGVISSRVQDPSNAA-SS  139

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VG AG TNKTV +PKN T   PG   GY CGPAKIV+PTRF+S+  RRVT A+MTW
Sbjct  140  FQLAVGAAGTTNKTVRIPKNITLNTPGP--GYTCGPAKIVRPTRFLSADKRRVTQALMTW  197

Query  642  KLSCLYS  662
             ++C YS
Sbjct  198  NITCTYS  204



>ref|XP_009373790.1| PREDICTED: COBRA-like protein 1 isoform X1 [Pyrus x bretschneideri]
Length=457

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA VT++N+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  41   LDPNGNITIKWDIISWTADGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFK  +PH C++TP +VDLL GTPYNQQ  NCCKGGVLSSW ++  +A V  
Sbjct  101  ATEQGDCSRFKTTLPHCCKKTPTIVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEKA-VGS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C  AK+VKPT+F+S   RRVT AMMTW
Sbjct  160  FQISVGQAGTTNKTVRLPKNFTLNTPGP--GYTCARAKVVKPTKFISPDKRRVTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_009373791.1| PREDICTED: COBRA-like protein 1 isoform X2 [Pyrus x bretschneideri]
Length=456

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA VT++N+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  40   LDPNGNITIKWDIISWTADGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFK  +PH C++TP +VDLL GTPYNQQ  NCCKGGVLSSW ++  +A V  
Sbjct  100  ATEQGDCSRFKTTLPHCCKKTPTIVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEKA-VGS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C  AK+VKPT+F+S   RRVT AMMTW
Sbjct  159  FQISVGQAGTTNKTVRLPKNFTLNTPGP--GYTCARAKVVKPTKFISPDKRRVTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_002875546.1| hypothetical protein ARALYDRAFT_484733 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51805.1| hypothetical protein ARALYDRAFT_484733 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 162/220 (74%), Gaps = 7/220 (3%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            + + FSR  +LLL L  +T   +    DA    L+  GNITI WD+I WTADGY+A+VTI
Sbjct  1    MNILFSRFSILLLFLCSWTSFTTTEAYDA----LDPTGNITIKWDIISWTADGYLAVVTI  56

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
            +N+Q+ R I  PGW LGW W K EVIW+M+G Q T QGDCS+FKGNIPH C++TP +VDL
Sbjct  57   FNFQQYRHIEAPGWQLGWSWLKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKTPAIVDL  116

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L GTPYNQQI NCC+GGV+S+W ++ + A +S FQ+SVGQ+G TN TV  P+N T +APG
Sbjct  117  LPGTPYNQQISNCCRGGVISAWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNITLKAPG  175

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPAK+VKPT+F+S+  RR T A++TW ++C YS
Sbjct  176  P--GYTCGPAKLVKPTKFISADERRKTQALLTWNITCTYS  213



>ref|XP_009780772.1| PREDICTED: COBRA-like protein 1 [Nicotiana sylvestris]
Length=457

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGY A+VTIYN+Q+ R I+ PGW LGW WAK EVIW+  G+Q
Sbjct  40   LDPNGNITIKWDIISWTPDGYNAVVTIYNFQKYRHIQAPGWQLGWTWAKKEVIWSATGSQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+R P +VDLL GTPYNQQ  NCCKGGV+SSW ++  +A VS 
Sbjct  100  ATEQGDCSKFKGNIPHCCKRDPTIVDLLPGTPYNQQTANCCKGGVISSWVQDPQKA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL VGQAG +NKTV LPKNFT +APG   GY CGPAK  KP++F +  GRRVT A+MTW
Sbjct  159  FQLGVGQAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKKGKPSKFPTPDGRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_009784022.1| PREDICTED: protein COBRA-like isoform X2 [Nicotiana sylvestris]
Length=445

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGWTL W WAK EVIW M+G++
Sbjct  13   LDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQPPGWTLRWTWAKDEVIWNMIGSR  72

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QG+CS+FKG+IPH C++ P VVDLL  TP+ QQI NCCKGG+L+SWG++ + A  S 
Sbjct  73   TTEQGNCSKFKGDIPHCCKKNPTVVDLLPETPHKQQIANCCKGGMLNSWGQDPATAFTS-  131

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VG AG  NKTV +PKNFT +APG   GY CGPAKIVKPT+F++  GRRVT AMMTW
Sbjct  132  FQLTVGSAGTNNKTVRVPKNFTLQAPGP--GYTCGPAKIVKPTKFITPDGRRVTQAMMTW  189

Query  642  KLSCLYS  662
             ++C YS
Sbjct  190  NVTCTYS  196



>ref|XP_007037616.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 1 [Theobroma cacao]
 gb|EOY22117.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family isoform 1 [Theobroma cacao]
Length=475

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 151/206 (73%), Gaps = 22/206 (11%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDVI WT DGYVA+VTIYN+Q+ R I+ PGWTLGW WAK EVIW+MMGAQ
Sbjct  40   LDPTGNVTIKWDVISWTPDGYVAVVTIYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S 
Sbjct  100  TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWVQDPANAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAM---  632
            FQ+SVG AG TNKTV +P+NFT  APG   GY CGPAKIV+PT+FV+   RR+T AM   
Sbjct  159  FQVSVGAAGTTNKTVRVPRNFTLRAPGP--GYTCGPAKIVRPTKFVTPDKRRITQAMSKM  216

Query  633  ----------------MTWKLSCLYS  662
                            +TW ++C YS
Sbjct  217  VEQSSNFSLSYLHLIAVTWNVTCTYS  242



>gb|ABK25014.1| unknown [Picea sitchensis]
Length=458

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGY+A+VTI N+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  43   LDPNGNITIKWDIMSWTPDGYLAVVTINNFQQYRHIQSPGWTLGWTWAKKEVIWSMVGAQ  102

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C + P VVDLL GTPYNQQI NCCKGGV++SW ++   A VS 
Sbjct  103  TTEQGDCSKYKGNIPHCCNKNPTVVDLLPGTPYNQQIANCCKGGVIASWAQDPVNA-VSA  161

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TN TV LPKNFT +APG   GY CGPAK V+ ++F+++ GRRVT A+MTW
Sbjct  162  FQVSVGNAGTTNTTVRLPKNFTLKAPGP--GYTCGPAKKVRASKFLTTDGRRVTQALMTW  219

Query  642  KLSCLYS  662
             ++C YS
Sbjct  220  NITCTYS  226



>ref|XP_008230280.1| PREDICTED: COBRA-like protein 1 [Prunus mume]
Length=456

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VTIYN+Q+ R I+ PGW+L W WAK EVIW M+G Q
Sbjct  40   LDPNGNITIKWDIISWTPDGYVAVVTIYNFQKYRHIQAPGWSLQWTWAKKEVIWNMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK  IPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++ + A V  
Sbjct  100  ATEQGDCSKFKTTIPHCCKKNPTVVDLLPGTPYNQQITNCCKGGVLTSWVQDPANA-VGS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVGQAG TNKTV  PKNFT  APG   GY CG A IVKPT+FV+   RRVT AMMTW
Sbjct  159  FQLSVGQAGTTNKTVRAPKNFTLNAPGP--GYTCGRANIVKPTKFVTPDKRRVTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_009784021.1| PREDICTED: protein COBRA-like isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+YN+Q+ R I+ PGWTL W WAK EVIW M+G++
Sbjct  35   LDPNGNITIKWDVISWTPDGYVAVVTMYNFQQYRHIQPPGWTLRWTWAKDEVIWNMIGSR  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QG+CS+FKG+IPH C++ P VVDLL  TP+ QQI NCCKGG+L+SWG++ + A  S 
Sbjct  95   TTEQGNCSKFKGDIPHCCKKNPTVVDLLPETPHKQQIANCCKGGMLNSWGQDPATAFTS-  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL+VG AG  NKTV +PKNFT +APG   GY CGPAKIVKPT+F++  GRRVT AMMTW
Sbjct  154  FQLTVGSAGTNNKTVRVPKNFTLQAPGP--GYTCGPAKIVKPTKFITPDGRRVTQAMMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_009606717.1| PREDICTED: COBRA-like protein 1 [Nicotiana tomentosiformis]
Length=457

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGY  +VTIYN+Q+ R I+ PGW LGW WAK EVIW+  G Q
Sbjct  40   LDPNGNITIKWDVISWTPDGYNVVVTIYNFQKYRHIQAPGWQLGWTWAKKEVIWSATGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFKGNIPH C+R P +VDLL GTPYNQQ  NCCKGGV+SSW ++  +A VS 
Sbjct  100  ATEQGDCSRFKGNIPHCCKRDPTIVDLLPGTPYNQQTANCCKGGVISSWVQDPQKA-VSS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQL VGQAG +NKTV LPKNFT +APG   GY CGPAK  KP++F +  GRRVT A+MTW
Sbjct  159  FQLGVGQAGTSNKTVRLPKNFTLKAPGP--GYTCGPAKKGKPSKFPTPDGRRVTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_009589606.1| PREDICTED: COBRA-like protein 4 [Nicotiana tomentosiformis]
Length=434

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  25   LDPNGNITIKWDVMSWTPDGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKEVIWTMVGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGN+PH C++TP +VD+L G PYNQQ  NCCKGGVL+SWG++  +ASVS 
Sbjct  85   ATEQGDCSKFKGNVPHCCKKTPTIVDMLPGVPYNQQFTNCCKGGVLASWGQD-PQASVSA  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAKIV  T+F +   RR T A+MTW
Sbjct  144  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTKFFTPDLRRKTQALMTW  201

Query  642  KLSCLYS  662
             ++C YS
Sbjct  202  NVTCTYS  208



>ref|XP_004491892.1| PREDICTED: COBRA-like protein 4-like [Cicer arietinum]
Length=432

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+G+Q
Sbjct  23   LDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMYRHIMNPGWTLGWSWAKKEVIWSMVGSQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQ G +NKTV LPKNFT  APG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQISVGQGGTSNKTVKLPKNFTLLAPGP--GYTCGPAKIVPSTTFLTADKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|EYU44221.1| hypothetical protein MIMGU_mgv1a006633mg [Erythranthe guttata]
Length=437

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVAIVT+ N+Q  R I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  27   LDPNGNITIKWDIMTWTPDGYVAIVTVNNFQMYRHIMSPGWTVGWTWAKKEVIWSMVGAQ  86

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C + P VVDLL G PYNQQ  NCCKGGVL++WG++  +ASVS 
Sbjct  87   TTEQGDCSKFKGNIPHCCNKKPTVVDLLPGVPYNQQFANCCKGGVLAAWGQD-PQASVSA  145

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LP NFT   PG   GY CGPAK V PT F+S   RR T A+MTW
Sbjct  146  FQVSVGQAGTTNKTVRLPSNFTLLGPGP--GYTCGPAKTVPPTNFLSPDLRRKTQALMTW  203

Query  642  KLSCLYS  662
             ++C YS
Sbjct  204  NVTCTYS  210



>emb|CBI16945.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT++N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDIMSWTPDGYVAVVTMHNFQMYRHIISPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL G PYNQQ  NCCKGGV+SSWG++ + ASVS 
Sbjct  83   TTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVSSWGQDPA-ASVSA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CG AKIV PT F++   RR T A+MTW
Sbjct  142  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGIAKIVPPTNFLTPDRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_008393239.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=436

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA VT+ N+Q  R+I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  23   LDPTGNITIRWDVMSWTADGYVAAVTMNNFQMYRQIPSPGWTLGWSWAKKEVIWTMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ S A+VS 
Sbjct  83   TTEQGDCSKFKATIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVLASWGQDPS-AAVSG  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  142  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_008353506.1| PREDICTED: COBRA-like protein 1 isoform X1 [Malus domestica]
Length=457

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA VT++N+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  41   LDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFK  +PH C++TP VVDLL GTPYNQQ  NCCKGGVLSSW ++  +A V  
Sbjct  101  ATEQGDCSRFKTTLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEKA-VGS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C  AK+VKPT+F+S   RRVT AMMTW
Sbjct  160  FQISVGQAGTTNKTVRLPKNFTLNTPGP--GYTCARAKVVKPTKFISPDKRRVTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_008341799.1| PREDICTED: COBRA-like protein 1 isoform X1 [Malus domestica]
Length=457

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA VT++N+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  41   LDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFK  +PH C++TP VVDLL GTPYNQQ  NCCKGGVLSSW ++  +A V  
Sbjct  101  ATEQGDCSRFKTTLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEKA-VGS  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C  AK+VKPT+F+S   RRVT AMMTW
Sbjct  160  FQISVGQAGTTNKTVRLPKNFTLNTPGP--GYTCARAKVVKPTKFISPDKRRVTQAMMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_008341800.1| PREDICTED: COBRA-like protein 1 isoform X2 [Malus domestica]
Length=456

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA VT++N+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  40   LDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFK  +PH C++TP VVDLL GTPYNQQ  NCCKGGVLSSW ++  +A V  
Sbjct  100  ATEQGDCSRFKTTLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEKA-VGS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C  AK+VKPT+F+S   RRVT AMMTW
Sbjct  159  FQISVGQAGTTNKTVRLPKNFTLNTPGP--GYTCARAKVVKPTKFISPDKRRVTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_006395263.1| hypothetical protein EUTSA_v10004232mg [Eutrema salsugineum]
 gb|ESQ32549.1| hypothetical protein EUTSA_v10004232mg [Eutrema salsugineum]
Length=441

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VTI+N+Q+ R I+ PGW LGW W K EVIW+M+GAQ
Sbjct  30   LDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIQAPGWQLGWTWLKKEVIWSMVGAQ  89

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP VVDLL GTPYNQQI NCCKGGV+SSW ++ S A VS 
Sbjct  90   ATEQGDCSKFKGNIPHCCKKTPTVVDLLPGTPYNQQISNCCKGGVISSWAQDPSTA-VSS  148

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQ+G TNKTV  P+N T ++PG   GY CGPAK V P++F+S   RR T A++TW
Sbjct  149  FQISVGQSGTTNKTVRAPRNITLKSPGP--GYTCGPAKNVMPSKFISGDKRRKTQALLTW  206

Query  642  KLSCLYS  662
             ++C YS
Sbjct  207  NMTCTYS  213



>ref|XP_008353507.1| PREDICTED: COBRA-like protein 1 isoform X2 [Malus domestica]
Length=456

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA VT++N+Q+ R I+ PGW+LGW WAK EVIW M+G Q
Sbjct  40   LDPNGNITIKWDILSWTXDGYVAAVTLFNFQKYRHIQAPGWSLGWTWAKKEVIWNMVGGQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCSRFK  +PH C++TP VVDLL GTPYNQQ  NCCKGGVLSSW ++  +A V  
Sbjct  100  ATEQGDCSRFKTTLPHCCKKTPTVVDLLPGTPYNQQYTNCCKGGVLSSWVQDPEKA-VGS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV LPKNFT   PG   GY C  AK+VKPT+F+S   RRVT AMMTW
Sbjct  159  FQISVGQAGTTNKTVRLPKNFTLNTPGP--GYTCARAKVVKPTKFISPDKRRVTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>gb|AAR01674.1| putative phytochelatin synthetase, 3'-partial [Oryza sativa Japonica 
Group]
Length=266

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT++NYQ+ R I+ PGW LGW WAK EVIW+M+GAQ
Sbjct  40   LDPNGNITIKWDVMQWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN PH C++ P +VDLL GTPYN QI NCCK GV++++ ++   A+ S 
Sbjct  100  TTEQGDCSKFKGNPPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPLNAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CG A IV+PT+F ++ GRR T A+MTW
Sbjct  159  FQISVGLAGTTNKTVKLPKNFTLKAPGP--GYTCGRAMIVRPTKFFTNDGRRATQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|XP_006400085.1| hypothetical protein EUTSA_v10013604mg [Eutrema salsugineum]
 gb|ESQ41538.1| hypothetical protein EUTSA_v10013604mg [Eutrema salsugineum]
Length=432

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPSGNITIKWDIMSWTADGYVATVTMNNFQMYRHIQNPGWTLGWAWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A VS+
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVGAWGQDPSSA-VSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_010551802.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
Length=433

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT+DGYVA+VT+ N+Q  R +  PGWTLGW WAK EVIW+M+GAQ
Sbjct  25   LDPNGNITIKWDVMSWTSDGYVAVVTMNNFQMYRHVPNPGWTLGWTWAKKEVIWSMVGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP +VDLL G PYNQQ  NCCKGGV+++WG++ S ASVS+
Sbjct  85   TTEQGDCSKFKGNVPHCCKKTPTIVDLLPGVPYNQQFSNCCKGGVMAAWGQDPS-ASVSQ  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  144  FQVSVGLAGTTNKTVKLPKNFTLLGPGL--GYTCGPAKIVPSTTFLTPDKRRKTQALMTW  201

Query  642  KLSCLYS  662
             ++C YS
Sbjct  202  NVTCTYS  208



>gb|KHN10040.1| Protein COBRA, partial [Glycine soja]
Length=437

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 4/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGY A+VT+YN+Q+ R I  PGW+LGW WAK EVIW+M+G Q
Sbjct  21   LDPNGNITIKWDIISWTPDGY-AVVTMYNFQQYRHISVPGWSLGWTWAKKEVIWSMIGGQ  79

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++K NIPH C++ P VVDLL GTPYNQQI NCCKGGVLSSW ++ S+A V+ 
Sbjct  80   TTEQGDCSKYKANIPHCCKKNPIVVDLLPGTPYNQQISNCCKGGVLSSWAQDQSKA-VAA  138

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG A  TNKTV +PK+FT +APG   GY CGPA IVKPT+F+    RRVT A+MTW
Sbjct  139  FQVSVGSASTTNKTVKVPKDFTLKAPGP--GYTCGPATIVKPTQFLQPDKRRVTQALMTW  196

Query  642  KLSCLYS  662
             ++C YS
Sbjct  197  NVTCTYS  203



>ref|XP_008351868.1| PREDICTED: COBRA-like protein 4 [Malus domestica]
Length=458

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA VT+ N+Q  R+I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  45   LDPTGNITIRWDVMSWTADGYVAAVTMNNFQMYRQIPSPGWTLGWSWAKKEVIWTMVGAQ  104

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ S A+VS 
Sbjct  105  TTEQGDCSKFKATIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVLASWGQDPS-AAVSG  163

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  164  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADRRRKTQALMTW  221

Query  642  KLSCLYS  662
             ++C YS
Sbjct  222  NVTCTYS  228



>ref|XP_010095794.1| hypothetical protein L484_017602 [Morus notabilis]
 gb|EXB62214.1| hypothetical protein L484_017602 [Morus notabilis]
Length=280

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  32   LDPTGNITIKWDVMSWTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMVGAQ  91

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCSRFKGN+PH C++ P VVDLL GT YNQQI NCCKGGVL+SW ++ + A+ S 
Sbjct  92   TTEQGDCSRFKGNVPHCCKKDPTVVDLLPGTAYNQQIANCCKGGVLNSWVQDPANAA-SS  150

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAM  632
            FQ+SVG AG TNKTV LPKNFT +APG   GY CGPAKIV+ T+F+++  RRVT A+
Sbjct  151  FQISVGAAGTTNKTVKLPKNFTLKAPGP--GYTCGPAKIVRATKFITADKRRVTQAL  205



>ref|XP_006287794.1| hypothetical protein CARUB_v10001005mg [Capsella rubella]
 gb|EOA20692.1| hypothetical protein CARUB_v10001005mg [Capsella rubella]
Length=432

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPSGNVTIKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A+VS+
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS-AAVSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTAFLTTDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_006658783.1| PREDICTED: COBRA-like protein 1-like [Oryza brachyantha]
Length=448

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+V++YNYQ+ R I+ PGW LGW WAK E+IW M G Q
Sbjct  34   LDPNGNITIKWDVLQWTPDGYVAVVSLYNYQQYRHIQSPGWKLGWVWAKKEIIWAMNGGQ  93

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPH C++ PE+VDLL GTPYN QI NCCKGGVL+SW ++ + A V+ 
Sbjct  94   ATEQGDCSKFKSNIPHCCKKNPEIVDLLPGTPYNMQIANCCKGGVLNSWAQDPANA-VAS  152

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV +P+NFT ++PG   GY CG AK+V+PT+F S  GRR T A MTW
Sbjct  153  FQVSVGQAGTTNKTVRVPRNFTLKSPGP--GYTCGSAKLVRPTKFFSQDGRRTTQAHMTW  210

Query  642  KLSCLYS  662
             ++C YS
Sbjct  211  NVTCTYS  217



>ref|NP_001060219.2| Os07g0604300 [Oryza sativa Japonica Group]
 sp|Q6Z4G8.1|COBL1_ORYSJ RecName: Full=COBRA-like protein 1; AltName: Full=Protein BRITTLE 
CULM1-like 6; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAC83872.1| putative phytochelatin synthetase [Oryza sativa Japonica Group]
 gb|EAZ40580.1| hypothetical protein OsJ_25037 [Oryza sativa Japonica Group]
 dbj|BAG95261.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00705.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF22133.2| Os07g0604300 [Oryza sativa Japonica Group]
Length=446

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+V++YNYQ+ R I+ PGW LGW WAK E+IW M G Q
Sbjct  32   LDPNGNITIKWDVLQWTPDGYVAVVSLYNYQQYRHIQSPGWKLGWVWAKKEIIWAMNGGQ  91

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPH C++ PE+VDLL GTPYN QI NCCKGGVL+SW ++ + A ++ 
Sbjct  92   ATEQGDCSKFKSNIPHCCKKDPEIVDLLPGTPYNMQIANCCKGGVLNSWAQDPANA-IAS  150

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV +P+NFT ++PG   GY CG AK+V+PT+F S  GRR T A MTW
Sbjct  151  FQVSVGQAGTTNKTVRVPRNFTLKSPGP--GYTCGSAKVVRPTKFFSQDGRRTTQAHMTW  208

Query  642  KLSCLYS  662
             ++C YS
Sbjct  209  NVTCTYS  215



>ref|XP_009131486.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=433

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQSPGWTLGWAWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGN+PH C++TP VVDLL G PYNQQI NCCKGGV+ +WG++ S A VS+
Sbjct  83   ATEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQISNCCKGGVVGAWGQDPSSA-VSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|EAZ04637.1| hypothetical protein OsI_26785 [Oryza sativa Indica Group]
Length=446

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+V++YNYQ+ R I+ PGW LGW WAK E+IW M G Q
Sbjct  32   LDPNGNITIKWDVLQWTPDGYVAVVSLYNYQQYRHIQSPGWKLGWVWAKKEIIWAMNGGQ  91

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPH C++ PE+VDLL GTPYN QI NCCKGGVL+SW ++ + A ++ 
Sbjct  92   ATEQGDCSKFKSNIPHCCKKDPEIVDLLPGTPYNMQIANCCKGGVLNSWAQDPANA-IAS  150

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV +P+NFT ++PG   GY CG AK+V+PT+F S  GRR T A MTW
Sbjct  151  FQVSVGQAGTTNKTVRVPRNFTLKSPGP--GYTCGSAKVVRPTKFFSQDGRRTTQAHMTW  208

Query  642  KLSCLYS  662
             ++C YS
Sbjct  209  NVTCTYS  215



>ref|XP_007032846.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
 gb|EOY03772.1| COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored 
protein family [Theobroma cacao]
Length=432

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 152/218 (70%), Gaps = 12/218 (6%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            M F  S L L VL      +           L+  GN+TI WD++ WT DGYVA+VT+ N
Sbjct  1    MRFVNSALFLFVLFSHAAAY---------DPLDPNGNVTIKWDIVSWTPDGYVAVVTMNN  51

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q  R I  PGWTLGW WAK EVIW+M+GAQTT QGDCS+FKGNIPH C++TP VVDLL 
Sbjct  52   FQMYRHIMSPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLP  111

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            G PYNQQ  NCCKGGVLS+WG++  +A+VS FQ+S+G AG +NKTV LPKNFT   PG  
Sbjct  112  GVPYNQQFTNCCKGGVLSAWGQD-PQAAVSAFQVSIGLAGTSNKTVKLPKNFTLLGPGP-  169

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CGPAK+V  T F++   RR T A+MTW ++C YS
Sbjct  170  -GYTCGPAKVVPSTTFLTPDRRRRTQALMTWNVTCTYS  206



>gb|AAG12670.1|AC027033_5 unknown protein; 31818-33764 [Arabidopsis thaliana]
Length=404

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            + + FSR   LLL L  +T     +        L+  GNITI WD++ WT DGYVA+VTI
Sbjct  1    MNILFSRFSFLLLFLCSWTSFTFTTTEAY--DALDPYGNITIKWDIMSWTGDGYVAVVTI  58

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
            +N+Q+ R I  PGW LGW W K EVIW+M+G Q T QGDCS+FKGNIPH C++TP +VDL
Sbjct  59   FNFQQYRHIEAPGWQLGWSWMKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKTPAIVDL  118

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L GTPYNQQI NCC+GGV+S+W ++ + A +S FQ+SVGQ+G TN TV  P+N T +APG
Sbjct  119  LPGTPYNQQISNCCRGGVISAWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNITLKAPG  177

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPAK+VKP+RF+S+  RR T +++TW ++C YS
Sbjct  178  P--GYTCGPAKLVKPSRFISADKRRKTQSLLTWNITCTYS  215



>ref|XP_010660571.1| PREDICTED: COBRA-like protein 4 [Vitis vinifera]
Length=464

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT++N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  56   LDPNGNITIKWDIMSWTPDGYVAVVTMHNFQMYRHIISPGWTLGWTWAKKEVIWSMVGAQ  115

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL G PYNQQ  NCCKGGV+SSWG++ + ASVS 
Sbjct  116  TTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVSSWGQDPA-ASVSA  174

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CG AKIV PT F++   RR T A+MTW
Sbjct  175  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGIAKIVPPTNFLTPDRRRKTQALMTW  232

Query  642  KLSCLYS  662
             ++C YS
Sbjct  233  NVTCTYS  239



>emb|CDX78644.1| BnaA03g05560D [Brassica napus]
Length=433

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQSPGWTLGWAWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGN+PH C++TP VVDLL G PYNQQI NCCKGGV+ +WG++ S A VS+
Sbjct  83   ATEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQISNCCKGGVVGAWGQDPSSA-VSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_010936445.1| PREDICTED: COBRA-like protein 4 [Elaeis guineensis]
Length=466

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT  WDVI WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  56   LDPTGNITFKWDVISWTPDGYVAVVTMNNFQMYRHIMNPGWTLGWTWAKKEVIWSMVGAQ  115

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL G PYNQQI NCCKGGV+SSWG++ +  SVS 
Sbjct  116  TTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQIANCCKGGVVSSWGQDPA-GSVSS  174

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  175  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTTFLTPDKRRKTQALMTW  232

Query  642  KLSCLYS  662
             ++C YS
Sbjct  233  NVTCTYS  239



>gb|KHG07276.1| COBRA-like protein 4 [Gossypium arboreum]
 gb|KHG08964.1| COBRA-like protein 4 [Gossypium arboreum]
Length=433

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 154/218 (71%), Gaps = 12/218 (6%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            M F  S+L L VL  +   +           L+  GN+TI WD++ WT DGYVA+VT+ N
Sbjct  1    MKFFISVLFLFVLFSYAAAY---------DPLDPNGNVTIKWDIVSWTPDGYVAVVTMNN  51

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q  R I  PGWTLGW WAK EVIW+M+GAQTT QGDCS+FKGNIPH C++TP VVDLL 
Sbjct  52   FQMYRHIMSPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLP  111

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            G PYNQQ  NCCKGGVL++WG++  +++VS FQ+SVG AG +NKTV LPKNFT   PG  
Sbjct  112  GVPYNQQFTNCCKGGVLAAWGQD-PQSAVSAFQISVGLAGTSNKTVKLPKNFTLLGPGP-  169

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CGPAK+V  T F++   RR T A+MTW ++C YS
Sbjct  170  -GYTCGPAKVVPSTTFLTPDRRRKTQALMTWNVTCTYS  206



>ref|NP_197067.2| COBRA-like protein 4 [Arabidopsis thaliana]
 sp|Q9LFW3.2|COBL4_ARATH RecName: Full=COBRA-like protein 4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAT44976.1| At5g15630 [Arabidopsis thaliana]
 gb|AAW30024.1| At5g15630 [Arabidopsis thaliana]
 gb|AED92186.1| COBRA-like protein 4 [Arabidopsis thaliana]
Length=431

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  24   LDPSGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  83

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A+VS+
Sbjct  84   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS-AAVSQ  142

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  143  FQVSAGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  200

Query  642  KLSCLYS  662
             ++C YS
Sbjct  201  NVTCTYS  207



>ref|XP_002871675.1| hypothetical protein ARALYDRAFT_488408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47934.1| hypothetical protein ARALYDRAFT_488408 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  24   LDPSGNITIKWDIMSWTADGYVATVTMNNFQMYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  83

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A+VS+
Sbjct  84   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS-AAVSQ  142

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  143  FQVSAGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  200

Query  642  KLSCLYS  662
             ++C YS
Sbjct  201  NVTCTYS  207



>ref|XP_010257979.1| PREDICTED: COBRA-like protein 4 [Nelumbo nucifera]
Length=465

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VTI N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  56   LDPNGNITIKWDVMSWTPDGYVAVVTINNFQLYRHIMSPGWTLGWTWAKKEVIWSMVGAQ  115

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ + ASVS 
Sbjct  116  TTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVVTAWGQDPA-ASVSA  174

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F++   RR T ++MTW
Sbjct  175  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTTFLTPDRRRKTQSLMTW  232

Query  642  KLSCLYS  662
             ++C YS
Sbjct  233  NVTCTYS  239



>gb|KGN63777.1| hypothetical protein Csa_1G015710 [Cucumis sativus]
Length=403

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = +3

Query  147  WTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIP  326
            WT DGYVA+VT+YN+Q+ R I+ PGWTLGW WAK EVIW+MMG+QTT QGDCSRFKGN P
Sbjct  3    WTPDGYVAVVTMYNFQQYRHIQAPGWTLGWTWAKKEVIWSMMGSQTTEQGDCSRFKGNTP  62

Query  327  HSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTV  506
            H C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S FQ+SVG AG +NKTV
Sbjct  63   HCCKKDPTVVDLLPGTPYNQQIANCCKGGVINSWAQDPANAA-SSFQVSVGSAGTSNKTV  121

Query  507  SLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             LPKNFT +APG   GY CGPAKIV+PT+FVS   RRVT A+MTW ++C YS
Sbjct  122  KLPKNFTLKAPGP--GYTCGPAKIVRPTKFVSGDKRRVTQALMTWNVTCTYS  171



>ref|XP_006602955.1| PREDICTED: protein COBRA-like [Glycine max]
Length=420

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 162/224 (72%), Gaps = 14/224 (6%)
 Frame = +3

Query  9    MGFSR------SILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVA  170
            MGFS+      SIL L++L+      + ++       L+  GNITI WDVI WT DGYVA
Sbjct  1    MGFSQLPKATPSILFLVLLSCTCFTSTDAY-----DPLDPNGNITIKWDVISWTPDGYVA  55

Query  171  IVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPE  350
            +VT+ N+   R I  PGW++ W WAK EVIW M+G Q T QGDCS+FKGNIPHSC++ P 
Sbjct  56   VVTMNNFLAFRHIPSPGWSMRWTWAKKEVIWNMVGGQATEQGDCSKFKGNIPHSCKKNPT  115

Query  351  VVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTF  530
            VVDLL GTPYNQQ+ NCCKGGVL++  ++ ++A+ S FQ+SVG+AG TN+TV LPKNFT 
Sbjct  116  VVDLLPGTPYNQQVANCCKGGVLTTLVQDPTKAAAS-FQVSVGRAGTTNRTVKLPKNFTL  174

Query  531  EAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            +APG   GY CGPAKIV+PT+F++   RRVT A+MTWK+ C YS
Sbjct  175  KAPGP--GYTCGPAKIVRPTKFITPDKRRVTVALMTWKVVCTYS  216



>ref|XP_010492405.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  21   LDPSGNVTIKWDIMSWTADGYVATVTMNNFQVYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  80

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A+VS+
Sbjct  81   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS-AAVSQ  139

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  140  FQISAGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  197

Query  642  KLSCLYS  662
             ++C YS
Sbjct  198  NVTCTYS  204



>gb|AAM67179.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=441

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            + + FSR   LLL L  +T     +        L+  GNITI WD++ WT DGYVA+VTI
Sbjct  1    MNILFSRFSFLLLFLCSWTIFTFTTTEAY--DALDPYGNITIKWDIMSWTGDGYVAVVTI  58

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
            +N+Q+ R I  PGW LGW W K EVIW+M+G Q T QGDCS+FKGNIPH C++TP +VDL
Sbjct  59   FNFQQYRHIEAPGWQLGWSWMKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKTPAIVDL  118

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L GTPYNQQI NCC+GGV+S+W ++ + A +S FQ+SVGQ+G TN TV  P+N T +APG
Sbjct  119  LPGTPYNQQISNCCRGGVISAWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNITLKAPG  177

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPAK+VKP+RF+S+  RR T +++TW ++C YS
Sbjct  178  P--GYTCGPAKLVKPSRFISADKRRKTQSLLTWNITCTYS  215



>ref|XP_010425766.1| PREDICTED: COBRA-like protein 2 [Camelina sativa]
Length=439

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 160/220 (73%), Gaps = 7/220 (3%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            +++ FSR  +LLL L  +    +    DA    L+  GNITI WD++ WT DGYVA+VTI
Sbjct  1    MDIHFSRFSVLLLFLCSWNSFITTEAYDA----LDPTGNITIKWDIMSWTPDGYVAVVTI  56

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
            +N+Q+ R I+ PGW LGW W K EVIW+M+GAQ T QGDCS+FKGNIPH C++TP +VDL
Sbjct  57   FNFQQYRHIQAPGWQLGWSWMKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPTIVDL  116

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L GTPY QQI NCC+GGV+SSW ++ + A +S FQ+SVGQ+G TN TV  P+N T + PG
Sbjct  117  LPGTPYTQQISNCCRGGVISSWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNVTLKGPG  175

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPA+IVKP++F+S+  RR T A+ TW ++C YS
Sbjct  176  P--GYTCGPAQIVKPSKFISADKRRKTQALFTWNITCTYS  213



>ref|XP_010420232.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  21   LDPSGNVTIKWDIMSWTADGYVATVTMNNFQVYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  80

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A+VS+
Sbjct  81   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS-AAVSQ  139

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  140  FQVSAGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  197

Query  642  KLSCLYS  662
             ++C YS
Sbjct  198  NVTCTYS  204



>dbj|BAB02996.1| phytochelatin synthetase-like protein [Arabidopsis thaliana]
Length=442

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 160/220 (73%), Gaps = 7/220 (3%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            + + FSR   LLL L  +T   +    DA    L+  GNITI WD++ WT DGYVA+VTI
Sbjct  1    MNILFSRFSFLLLFLCSWTNLSNTEAYDA----LDPYGNITIKWDIMSWTGDGYVAVVTI  56

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
            +N+Q+ R I  PGW LGW W K EVIW+M+G Q T QGDCS+FKGNIPH C++TP +VDL
Sbjct  57   FNFQQYRHIEAPGWQLGWSWMKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKTPAIVDL  116

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L GTPYNQQI NCC+GGV+S+W ++ + A +S FQ+SVGQ+G TN TV  P+N T +APG
Sbjct  117  LPGTPYNQQISNCCRGGVISAWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNITLKAPG  175

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPAK+VKP+RF+S+  RR T +++TW ++C YS
Sbjct  176  P--GYTCGPAKLVKPSRFISADKRRKTQSLLTWNITCTYS  213



>ref|XP_010453698.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
 ref|XP_010453699.1| PREDICTED: COBRA-like protein 4 [Camelina sativa]
Length=428

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  21   LDPSGNVTIKWDIMSWTADGYVATVTMNNFQVYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  80

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+ +WG++ S A+VS+
Sbjct  81   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVIGAWGQDPS-AAVSQ  139

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S G AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  140  FQVSAGLAGTTNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTVFLTTDKRRKTQALMTW  197

Query  642  KLSCLYS  662
             ++C YS
Sbjct  198  NVTCTYS  204



>gb|KFK25792.1| hypothetical protein AALP_AA8G161300 [Arabis alpina]
Length=433

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WTADGYVA V I N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDIMSWTADGYVATVAINNFQIYRHIQNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS+
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVVAAWGQDPSSA-VSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY CGPAKIV  T F+++  RR T A+MTW
Sbjct  142  FQVSVGLAGTTNKTVKLPKNFTLLGPGL--GYTCGPAKIVPSTAFLTADKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|KDO65677.1| hypothetical protein CISIN_1g013089mg [Citrus sinensis]
Length=449

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA VTI N+Q  R I  PGWTLGW+WAK EVIWTM+GAQ
Sbjct  40   LDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAPGWTLGWQWAKKEVIWTMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK NIPH C+RTP VVDLL G PYNQQ  NCCKGGVLS+WG++ + A VS 
Sbjct  100  TTEQGDCSKFKANIPHCCKRTPIVVDLLPGVPYNQQFANCCKGGVLSAWGQDPASA-VSA  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT + PG   GY CGPAK+V  T +++S  RR T A+MTW
Sbjct  159  FQVSVGLAGTSNKTVKLPKNFTLQGPGP--GYTCGPAKVVPSTVYLTSDRRRKTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>ref|NP_566851.1| COBRA-like protein 2 [Arabidopsis thaliana]
 sp|Q8L8Q7.2|COBL2_ARATH RecName: Full=COBRA-like protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE77616.1| COBRA-like protein 2 [Arabidopsis thaliana]
Length=441

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 159/220 (72%), Gaps = 5/220 (2%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            + + FSR   LLL L  +T     +     +  L+  GNITI WD++ WT DGYVA+VTI
Sbjct  1    MNILFSRFSFLLLFLCSWTSFTFTTTEAYDA--LDPYGNITIKWDIMSWTGDGYVAVVTI  58

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
            +N+Q+ R I  PGW LGW W K EVIW+M+G Q T QGDCS+FKGNIPH C++TP +VDL
Sbjct  59   FNFQQYRHIEAPGWQLGWSWMKKEVIWSMVGGQATEQGDCSKFKGNIPHCCKKTPAIVDL  118

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L GTPYNQQI NCC+GGV+S+W ++ + A +S FQ+SVGQ+G TN TV  P+N T +APG
Sbjct  119  LPGTPYNQQISNCCRGGVISAWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNITLKAPG  177

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPAK+VKP+RF+S+  RR T +++TW ++C YS
Sbjct  178  P--GYTCGPAKLVKPSRFISADKRRKTQSLLTWNITCTYS  215



>ref|XP_004138334.1| PREDICTED: COBRA-like protein 4-like, partial [Cucumis sativus]
 ref|XP_004171718.1| PREDICTED: COBRA-like protein 4-like, partial [Cucumis sativus]
Length=416

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  7    LDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSPGWTLGWSWAKKEVIWSMVGAQ  66

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ + +SVS 
Sbjct  67   TTEQGDCSKFKGNVPHCCKKTPIVVDLLPGVPYNQQFSNCCKGGVLASWGQDPT-SSVSA  125

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  126  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDRRRKTQALMTW  183

Query  642  KLSCLYS  662
             ++C YS
Sbjct  184  NVTCTYS  190



>ref|NP_001242075.1| uncharacterized protein LOC100783410 precursor [Glycine max]
 gb|ACU18234.1| unknown [Glycine max]
Length=431

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S+G AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  142  FQVSIGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_010483748.1| PREDICTED: protein COBRA-like [Camelina sativa]
Length=409

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 145/179 (81%), Gaps = 3/179 (2%)
 Frame = +3

Query  126  INWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCS  305
            + WDV+ WT DGYVA+VT++N+Q+ R I+ PGWTLGW+WAK EVIW+M+GAQTT QGDCS
Sbjct  1    MKWDVMSWTPDGYVAVVTMFNFQKYRHIQTPGWTLGWKWAKKEVIWSMVGAQTTEQGDCS  60

Query  306  RFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQA  485
            ++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGV++SW ++ + A+ S FQ+SVG A
Sbjct  61   KYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQDPATAA-SSFQISVGAA  119

Query  486  GNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            G TNKTV +P+NFT   PG   GY CGPAKIV+PT+FV++  RR T AMMTW ++C YS
Sbjct  120  GTTNKTVRVPRNFTLLGPGP--GYTCGPAKIVRPTKFVTTDTRRTTQAMMTWNITCTYS  176



>ref|XP_010694055.1| PREDICTED: protein COBRA-like [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+V+I+N+Q+ R I+ PGW LGW WAK EVIW+M+G Q
Sbjct  34   LDPNGNITIKWDIINWTPDGYVAVVSIFNFQKYRHIQAPGWQLGWTWAKKEVIWSMVGGQ  93

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKG IPH C++ P VVDL+ GTPYNQQI NCC+GGVLSSW ++   A +S 
Sbjct  94   ATEQGDCSKFKGTIPHCCKKDPTVVDLMPGTPYNQQIANCCRGGVLSSWVQDPPTA-ISA  152

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG++G TNKTV +PKNFT  APG   GY CGP KIV+P+++ +  GRR T A+MTW
Sbjct  153  FQISVGRSGTTNKTVKVPKNFTLSAPGP--GYTCGPGKIVRPSQYRTQDGRRTTQALMTW  210

Query  642  KLSCLYS  662
             ++C+YS
Sbjct  211  NVTCMYS  217



>gb|KHN30324.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S+G AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  142  FQVSIGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|KHN37931.1| COBRA-like protein 4 [Glycine soja]
Length=431

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S+G AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  142  FQVSIGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|KEH25135.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=431

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VTI+N+Q  R I  PGWTLGW WAK EVIW++ GAQ
Sbjct  23   LDPNGNITIKWDVMSWTPDGYVATVTIHNFQMFRHIMNPGWTLGWTWAKKEVIWSVTGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL G PYNQQ  NCCKGGV+++WG++ + A +S 
Sbjct  83   TTEQGDCSKFKGNIPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPAEA-ISA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +N+TV LPKNFT  APG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  142  FQVSVGQAGTSNRTVKLPKNFTLLAPGP--GYTCGPAKVVPSTNFLTPDRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_004299286.1| PREDICTED: COBRA-like protein 4-like [Fragaria vesca subsp. vesca]
Length=455

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VT+ N+Q  R+I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  46   LDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQIANPGWTLGWTWAKKEVIWTMVGAQ  105

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN PH C++TP VVDLL G P+NQQ  NCCKGGV++SWG++ S ASVS 
Sbjct  106  TTEQGDCSKFKGNTPHCCKKTPTVVDLLPGVPFNQQFSNCCKGGVMASWGQDPS-ASVSA  164

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQ G +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  165  FQVSVGQGGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADRRRKTQALMTW  222

Query  642  KLSCLYS  662
             ++C YS
Sbjct  223  NVTCTYS  229



>ref|XP_008453301.1| PREDICTED: COBRA-like protein 4 [Cucumis melo]
Length=456

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  47   LDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSPGWTLGWSWAKKEVIWSMVGAQ  106

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ + +SVS 
Sbjct  107  TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVLASWGQDPT-SSVSA  165

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  166  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDRRRKTQALMTW  223

Query  642  KLSCLYS  662
             ++C YS
Sbjct  224  NVTCTYS  230



>ref|XP_009111966.1| PREDICTED: protein COBRA-like [Brassica rapa]
Length=458

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDV+ WT DGYVA+VT++N+Q+ R I  PGWTLGW+WAK EVIW+M+GAQ
Sbjct  40   LDPEGNITMKWDVMSWTPDGYVAVVTMFNFQKYRHIPSPGWTLGWKWAKKEVIWSMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS++KGNIPH C++ P VVDLL GTPYNQQI NCCKGGVL+SW ++   A+ S 
Sbjct  100  TTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVLNSWVQDPGNAA-SS  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV +P+NFT   P  G  +  GPAK+V+PT+FV++  RR T AMMTW
Sbjct  159  FQISVGAAGTTNKTVRVPRNFTLMGPCPGSTF--GPAKVVRPTKFVTTDTRRTTQAMMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NITCTYS  223



>gb|EYU34591.1| hypothetical protein MIMGU_mgv1a006208mg [Erythranthe guttata]
Length=453

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 141/187 (75%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I W ADGYVA+VT+ NYQ+ R I EPGWTLGW WA  EVIW+M+G Q
Sbjct  36   LDPNGNITIRWDIIDWMADGYVAVVTMLNYQQYRHIEEPGWTLGWSWANKEVIWSMLGGQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDC RFK NIPH C + P VVDL  GTP+N+ I NCCKGGV+SSW ++ + A VS 
Sbjct  96   ATEQGDCLRFKANIPHCCNKDPTVVDLFPGTPHNRTIPNCCKGGVVSSWAQDSTNA-VSS  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG +GNTN TV +PKNF+  APG   GY CG A+IV PTRFV+  GRR+T AMMTW
Sbjct  155  FQVSVGNSGNTNGTVKVPKNFSLNAPGP--GYTCGSARIVNPTRFVTPDGRRITQAMMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>gb|EYU44225.1| hypothetical protein MIMGU_mgv1a006751mg [Erythranthe guttata]
Length=433

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 140/187 (75%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVAIVT+ N+Q  R I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDIMAWTPDGYVAIVTVNNFQMYRHIMSPGWTVGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C + P VVDLL G PYNQQ  NCCKGGVL++WG++  +ASVS 
Sbjct  83   TTEQGDCSKFKGNIPHCCNKKPTVVDLLPGVPYNQQFANCCKGGVLAAWGQD-PQASVSA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG  NKTV LP NFT   PG   GY CGPAK V PT F+S   RR T A+MTW
Sbjct  142  FQVSVGLAGTNNKTVKLPSNFTLLGPGP--GYTCGPAKTVPPTNFLSPDRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_010037255.1| PREDICTED: COBRA-like protein 4 [Eucalyptus grandis]
 gb|KCW48928.1| hypothetical protein EUGRSUZ_K02541 [Eucalyptus grandis]
Length=459

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 154/220 (70%), Gaps = 14/220 (6%)
 Frame = +3

Query  3    LEMGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTI  182
            LE+ F  +IL+L++               A   L+  GNITI WDV+ WTADGYVA VT+
Sbjct  25   LELMFLAAILMLMI-----------PHTVAYDPLDPNGNITIKWDVVSWTADGYVASVTM  73

Query  183  YNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDL  362
             N+Q  R I  PGWTLGW WAK EVIW+M+GAQTT QGDCS+FKGN+PH C++ P VVD 
Sbjct  74   SNFQMYRPILLPGWTLGWSWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKDPIVVDF  133

Query  363  LSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPG  542
            L G PYNQQ  NCCKGGVLSSWG++ + +SVS FQ+SVG AG +NKTV LPKNFT   PG
Sbjct  134  LPGVPYNQQFSNCCKGGVLSSWGQDPT-SSVSAFQVSVGLAGTSNKTVKLPKNFTLLGPG  192

Query  543  SGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
               GY CGPAKIV  T +++   RR T AMMTW ++C YS
Sbjct  193  P--GYTCGPAKIVPSTVYLTPDRRRKTQAMMTWNVTCTYS  230



>ref|XP_008775851.1| PREDICTED: COBRA-like protein 4 [Phoenix dactylifera]
Length=466

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+V + N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  56   LDPTGNITIKWDVISWTPDGYVAVVIMNNFQMYRHIMNPGWTLGWSWAKKEVIWSMVGAQ  115

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++TP VVDLL G PYNQQI NCCKGGV+ SWG++ + A+VS 
Sbjct  116  TTEQGDCSKFKGNIPHCCKKTPTVVDLLPGVPYNQQIANCCKGGVVGSWGQDPA-AAVSS  174

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  175  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKIVPSTTFLTPDHRRKTQALMTW  232

Query  642  KLSCLYS  662
             ++C YS
Sbjct  233  NVTCTYS  239



>ref|XP_006345207.1| PREDICTED: uncharacterized protein LOC102589523 [Solanum tuberosum]
Length=1084

 Score =   267 bits (682),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW MMGAQ
Sbjct  706  LDPKGNITIKWDLISWTPDGYVAVVTMNNFQMYRPITSPGWTLGWTWAKNEVIWAMMGAQ  765

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+F+GNIPHSC + P +VDL+  TPYNQQI NCC GGV++S G++ S A++S 
Sbjct  766  ATDQGDCSKFRGNIPHSCEKKPAIVDLMPNTPYNQQIANCCTGGVMASMGKDPS-AALSA  824

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AGNTN TV LPKNFT  AP  GGGY CGPAKI++PTRFV + G +VT AMMTW
Sbjct  825  FQISVGSAGNTNTTVKLPKNFTLVAP--GGGYTCGPAKIIRPTRFVKNDGLQVTQAMMTW  882

Query  642  KLSCLYS  662
            ++ C YS
Sbjct  883  RVICTYS  889



>gb|KHN37929.1| Protein COBRA, partial [Glycine soja]
Length=397

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDVI WT DGYVA+VT+ N+   R I  PGW++ W WAK EVIW M+G Q
Sbjct  10   LDPNGNITIKWDVISWTPDGYVAVVTMNNFLAFRHIPSPGWSMRWTWAKKEVIWNMVGGQ  69

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPHSC++ P VVDLL GTPYNQQ+ NCCKGGVL++  ++ ++A+ S 
Sbjct  70   ATEQGDCSKFKGNIPHSCKKNPTVVDLLPGTPYNQQVANCCKGGVLTTLVQDPTKAAAS-  128

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG+AG TN+TV LPKNFT +APG   GY CGPAKIV+PT+F++   RRVT A+MTW
Sbjct  129  FQVSVGRAGTTNRTVKLPKNFTLKAPGP--GYTCGPAKIVRPTKFITPDKRRVTVALMTW  186

Query  642  KLSCLYS  662
            K+ C YS
Sbjct  187  KVVCTYS  193



>ref|XP_010663466.1| PREDICTED: COBRA-like protein 4 isoform X1 [Vitis vinifera]
Length=442

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 148/195 (76%), Gaps = 7/195 (4%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT+DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  33   LDPNGNITIKWDVMSWTSDGYVAVVTMSNFQMYRHIMSPGWTLGWIWAKKEVIWSMVGAQ  92

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+R P V+DLL G PYNQQI NCCKGGV++SWG++ S A+VS 
Sbjct  93   ATEQGDCSKFKGNIPHCCKRNPTVIDLLPGVPYNQQIANCCKGGVVASWGQDSS-AAVSS  151

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG +G +NKTV LPKNFT   PG   GY CG AK V  + F+SS GRR T A+MTW
Sbjct  152  FQLSVGLSGTSNKTVRLPKNFTLLGPGP--GYTCGQAKTVPSSIFLSSDGRRKTQALMTW  209

Query  642  KLSCLYS----NKFP  674
             ++C YS    +K+P
Sbjct  210  NVTCTYSQMVVSKYP  224



>ref|XP_006477707.1| PREDICTED: COBRA-like protein 4-like [Citrus sinensis]
Length=449

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA VTI N+Q  R I  PGWTLGW+WAK EV+WTM+GAQ
Sbjct  40   LDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAPGWTLGWQWAKKEVLWTMVGAQ  99

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK NIPH C+RTP VVDLL G PYNQQ  NCCKGGVLS+WG++ + A VS 
Sbjct  100  TTEQGDCSKFKANIPHCCKRTPIVVDLLPGVPYNQQFANCCKGGVLSAWGQDPASA-VSA  158

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT + PG   GY CGPAK+V  T +++S  RR T A+MTW
Sbjct  159  FQVSVGLAGTSNKTVKLPKNFTLQGPGP--GYTCGPAKVVPSTVYLTSDRRRKTQALMTW  216

Query  642  KLSCLYS  662
             ++C YS
Sbjct  217  NVTCTYS  223



>gb|KGN53787.1| hypothetical protein Csa_4G129040 [Cucumis sativus]
Length=433

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+ N+Q  R I  PGWT+GW WAK EVIW+M+G+Q
Sbjct  23   LDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTMGWTWAKKEVIWSMVGSQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPHSC++ P VVDL+ G PYNQQ  NCCKGGV+++WG++  +A+VS 
Sbjct  83   TTEQGDCSKFKGNIPHSCKKNPTVVDLMPGVPYNQQFTNCCKGGVVAAWGQD-PQAAVSA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLS+GQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  142  FQLSIGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTTFLTPDRRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>ref|XP_009126060.1| PREDICTED: COBRA-like protein 4 [Brassica rapa]
Length=434

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  24   LDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWAWAKKEVIWSMVGAQ  83

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++ P VVDLL G PYNQQ  NCCKGGV+ +WG++ S A VS+
Sbjct  84   TTEQGDCSKFKGNVPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVGAWGQDPSSA-VSQ  142

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY+CGPAKIV  T F+++  RR T A+MTW
Sbjct  143  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYSCGPAKIVPSTVFLTTDKRRKTQALMTW  200

Query  642  KLSCLYS  662
             ++C YS
Sbjct  201  NVTCTYS  207



>ref|XP_006440799.1| hypothetical protein CICLE_v10020292mg [Citrus clementina]
 gb|ESR54039.1| hypothetical protein CICLE_v10020292mg [Citrus clementina]
Length=423

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA VTI N+Q  R I  PGWTLGW+WAK EVIWTM+GAQ
Sbjct  14   LDPTGNVTIKWDVMSWTPDGYVAAVTINNFQMYRHIGAPGWTLGWQWAKKEVIWTMVGAQ  73

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK NIPH C+R P VVDLL G PYNQQ  NCCKGGVLS+WG++ + A VS 
Sbjct  74   TTEQGDCSKFKANIPHCCKRIPIVVDLLPGVPYNQQFANCCKGGVLSAWGQDPASA-VSA  132

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT + PG   GY CGPAK+V  T +++S  RR T A+MTW
Sbjct  133  FQVSVGLAGTSNKTVKLPKNFTLQGPGP--GYTCGPAKVVPSTVYLTSDRRRKTQALMTW  190

Query  642  KLSCLYS  662
             ++C YS
Sbjct  191  NVTCTYS  197



>gb|KGN63776.1| hypothetical protein Csa_1G015700 [Cucumis sativus]
Length=457

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  47   LDPNGNITIKWDVVSWTPDGYVAVVTMNNFQMYRHINSPGWTLGWSWAKKEVIWSMVGAQ  106

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ + +SVS 
Sbjct  107  TTEQGDCSKFKGNVPHCCKKTPIVVDLLPGVPYNQQFSNCCKGGVLASWGQDPT-SSVSA  165

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  166  FQVSVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDRRRKTQALMTW  223

Query  642  KLSCLYS  662
             ++C YS
Sbjct  224  NVTCTYS  230



>ref|XP_004137260.1| PREDICTED: COBRA-like protein 4-like [Cucumis sativus]
Length=451

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+ N+Q  R I  PGWT+GW WAK EVIW+M+G+Q
Sbjct  41   LDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTMGWTWAKKEVIWSMVGSQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPHSC++ P VVDL+ G PYNQQ  NCCKGGV+++WG++  +A+VS 
Sbjct  101  TTEQGDCSKFKGNIPHSCKKNPTVVDLMPGVPYNQQFTNCCKGGVVAAWGQD-PQAAVSA  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLS+GQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  160  FQLSIGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTTFLTPDRRRKTQALMTW  217

Query  642  KLSCLYS  662
             ++C YS
Sbjct  218  NVTCTYS  224



>ref|XP_004154765.1| PREDICTED: COBRA-like protein 4-like [Cucumis sativus]
Length=438

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VT+ N+Q  R I  PGWT+GW WAK EVIW+M+G+Q
Sbjct  28   LDPNGNITIKWDIMSWTPDGYVAVVTLNNFQMYRHIMSPGWTMGWTWAKKEVIWSMVGSQ  87

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPHSC++ P VVDL+ G PYNQQ  NCCKGGV+++WG++  +A+VS 
Sbjct  88   TTEQGDCSKFKGNIPHSCKKNPTVVDLMPGVPYNQQFTNCCKGGVVAAWGQD-PQAAVSA  146

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLS+GQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  147  FQLSIGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTTFLTPDRRRKTQALMTW  204

Query  642  KLSCLYS  662
             ++C YS
Sbjct  205  NVTCTYS  211



>ref|XP_006650604.1| PREDICTED: COBRA-like protein 3-like [Oryza brachyantha]
Length=453

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT++NYQ+ R I+ PGW LGW WAK EVIW+M+GAQ
Sbjct  36   LDPNGNITIKWDVMQWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWSWAKKEVIWSMVGAQ  95

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN PH C++ P +VDLL GTPYN QI NCCK GV++++ ++ S A+ S 
Sbjct  96   TTEQGDCSKFKGNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPSNAA-SS  154

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CG A IV+PT+F +  GRR T A+MTW
Sbjct  155  FQISVGLAGTTNKTVKLPKNFTLKAPGP--GYTCGRAMIVRPTKFFTQDGRRATQALMTW  212

Query  642  KLSCLYS  662
             ++C YS
Sbjct  213  NVTCTYS  219



>ref|XP_002531001.1| Protein COBRA precursor, putative [Ricinus communis]
 gb|EEF31389.1| Protein COBRA precursor, putative [Ricinus communis]
Length=426

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WD++ WT+DGY AIVT+ N+Q  R I +PGWT+GW W K E+IW+M+GAQ
Sbjct  23   LDPTGNVTIKWDIMAWTSDGYTAIVTLNNFQTFRHIIKPGWTVGWAWKKKEIIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
               QGDCS+FKGNIPHSC+R P VVDL+ G PYNQQ  NCCKGGVLS+WG++ S ASVS+
Sbjct  83   AVEQGDCSKFKGNIPHSCKRNPAVVDLMPGAPYNQQFANCCKGGVLSAWGQDLS-ASVSQ  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ++VG AG +NKTV LPKNFT   PG   GY CGPAK+V  T+F++  GRR T A+MTW
Sbjct  142  FQITVGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKLVPATKFLTPDGRRRTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>emb|CDX90983.1| BnaC02g06140D [Brassica napus]
Length=435

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WD++ WTADGYVA VT+ N+Q  R I+ PGWTLGW WAK EVIW+M+GAQ
Sbjct  24   LDPNGNITLKWDIMSWTADGYVATVTMNNFQIYRHIQNPGWTLGWAWAKKEVIWSMVGAQ  83

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++ P VVDLL G PYNQQ  NCCKGGV+ +WG++ S A VS+
Sbjct  84   TTEQGDCSKFKGNVPHCCKKIPTVVDLLPGVPYNQQFSNCCKGGVVGAWGQDPSSA-VSQ  142

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT   PG   GY+CGPAKIV  T F ++  RR T A+MTW
Sbjct  143  FQVSVGLAGTTNKTVKLPKNFTLLGPGP--GYSCGPAKIVPSTVFFTTDKRRKTQALMTW  200

Query  642  KLSCLYS  662
             ++C YS
Sbjct  201  NVTCTYS  207



>ref|XP_003562730.1| PREDICTED: COBRA-like protein 6 [Brachypodium distachyon]
Length=449

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA VTI N+Q  R+I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  27   LDPHGNITIKWDIISWTPDGYVAAVTINNFQAYRQIPSPGWTVGWTWAKREVIWSMVGAQ  86

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK N+PHSC+R P VVDLL G PYNQQI NCC+GGV+S++G++ + A VS 
Sbjct  87   ATEQGDCSKFKSNLPHSCKRDPAVVDLLPGVPYNQQIANCCRGGVVSAFGQDPATA-VSA  145

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TNKTV +PKNFTF  PG+  GY CGPAK+V  T F+S   RR T A+MTW
Sbjct  146  FQVSVGQAGTTNKTVKVPKNFTFLGPGN--GYTCGPAKVVPSTVFLSPDRRRKTQALMTW  203

Query  642  KLSCLYSNKF  671
             ++C YS   
Sbjct  204  NVTCTYSQHL  213



>ref|XP_007139432.1| hypothetical protein PHAVU_008G029000g [Phaseolus vulgaris]
 gb|ESW11426.1| hypothetical protein PHAVU_008G029000g [Phaseolus vulgaris]
Length=432

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTL W WAK EVIW+M+GAQ
Sbjct  24   LDPNGNVTIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLSWSWAKKEVIWSMVGAQ  83

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  84   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  142

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S+G AG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  143  FQVSIGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADKRRKTQALMTW  200

Query  642  KLSCLYS  662
             ++C YS
Sbjct  201  NVTCTYS  207



>ref|XP_010099317.1| hypothetical protein L484_018179 [Morus notabilis]
 gb|EXB77663.1| hypothetical protein L484_018179 [Morus notabilis]
Length=433

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA+VT+ N+Q  R I  PGWTLGW WAK +VIW+++GAQ
Sbjct  23   LDPNGNITIKWDVMSWTADGYVAVVTMNNFQMYRHIMTPGWTLGWTWAKKDVIWSIVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++ P VVDLL G PYNQQ  NCCKGGVLSSWG++ + ASVS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKDPTVVDLLPGVPYNQQFSNCCKGGVLSSWGQDPA-ASVSA  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LP+NFT   PG   GY CG AKIV PT F++   RR T A+MTW
Sbjct  142  FQVSVGLAGTSNKTVKLPRNFTLLGPGP--GYTCGGAKIVPPTTFLTPDHRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|AAR13305.1| phytochelatin synthetase-like protein [Phaseolus vulgaris]
Length=463

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTL W WAK EVIW+M+GAQ
Sbjct  55   LDPNGNVTIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLSWSWAKKEVIWSMVGAQ  114

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  115  TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  173

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+S+G AG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  174  FQVSIGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADKRRKTQALMTW  231

Query  642  KLSCLYS  662
             ++C YS
Sbjct  232  NVTCTYS  238



>dbj|BAK05255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 149/195 (76%), Gaps = 7/195 (4%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VTI N+Q  R+I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  27   LDPNGNITIKWDVLSWTPDGYVATVTINNFQTYRQIMAPGWTVGWTWAKREVIWSMVGAQ  86

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK N+PHSC+RTP VVDLL G PYNQQI NCC+GGV+S++G++ S A VS 
Sbjct  87   ATEQGDCSKFKANLPHSCKRTPAVVDLLPGVPYNQQIANCCRGGVVSAYGQDPSGA-VSS  145

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TN+TV +PKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  146  FQVSVGQAGTTNRTVKVPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADHRRKTQALMTW  203

Query  642  KLSCLYS----NKFP  674
             ++C YS    +K+P
Sbjct  204  NVTCTYSQHLASKYP  218



>ref|XP_010514669.1| PREDICTED: COBRA-like protein 2 [Camelina sativa]
Length=439

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 157/216 (73%), Gaps = 7/216 (3%)
 Frame = +3

Query  15   FSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYNYQ  194
            FSR  +LLL L  +    +    DA    L+  GNITI WD++ WT DGYVA+VTI+N+Q
Sbjct  5    FSRISVLLLFLCSWNSFITTEAYDA----LDPTGNITIKWDIMSWTPDGYVAVVTIFNFQ  60

Query  195  RLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLSGT  374
            + R I+ PGW LGW W K EVIW+M+GAQ T QGDCS+FKGNIPH C++TP +VDLL GT
Sbjct  61   QYRHIQAPGWQLGWSWRKKEVIWSMVGAQATEQGDCSKFKGNIPHCCKKTPTIVDLLPGT  120

Query  375  PYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSGGG  554
            PY QQI NCC+GGV+SSW ++ + A +S FQ+SVGQ+G TN TV  P+N T + PG   G
Sbjct  121  PYTQQISNCCRGGVISSWAQDPATA-ISSFQISVGQSGTTNTTVRAPRNVTLKGPGP--G  177

Query  555  YACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
            Y CGPA+IVKP++F+S+  RR T A+ TW ++C YS
Sbjct  178  YTCGPAQIVKPSKFISADKRRKTQALFTWNITCTYS  213



>ref|XP_009394778.1| PREDICTED: COBRA-like protein 4 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA+VT+ N+Q  R+I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  30   LDPTGNITIKWDVMSWTADGYVAVVTMNNFQMYRQIMSPGWTMGWTWAKKEVIWSMVGAQ  89

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+RTP VVDLL G PYNQQI NCCKGGV++S+G++ + A+VS 
Sbjct  90   ATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCKGGVVASYGQDPA-AAVSA  148

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG +G +NKTV LP NFT   PG   GY CGPAK+V  T F+S+  RR T A+MTW
Sbjct  149  FQVSVGLSGTSNKTVKLPNNFTLLGPGL--GYTCGPAKVVPSTTFLSADKRRKTQALMTW  206

Query  642  KLSCLYS  662
             ++C YS
Sbjct  207  NVTCTYS  213



>ref|XP_008240086.1| PREDICTED: COBRA-like protein 4 [Prunus mume]
Length=461

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VT+ N+Q  R+I  PGWTLGW W K EVIWTM+GAQ
Sbjct  48   LDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQIISPGWTLGWSWQKKEVIWTMVGAQ  107

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ + ASVS 
Sbjct  108  TTEQGDCSKFKAAIPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVLASWGQDPT-ASVSA  166

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  167  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTTDRRRKTQALMTW  224

Query  642  KLSCLYS  662
             ++C YS
Sbjct  225  NVTCTYS  231



>ref|NP_001242777.1| uncharacterized protein LOC100784352 precursor [Glycine max]
 gb|ACU17729.1| unknown [Glycine max]
Length=431

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT+ N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  23   LDPNGNITIKWDVVSWTPDGYVAVVTMSNFQMFRHIMNPGWTLGWTWAKKEVIWSMVGAQ  82

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP VVDLL G PYNQQ  NCCKGGV+++WG++ S A VS 
Sbjct  83   TTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQFSNCCKGGVVAAWGQDPSSA-VSS  141

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
             Q+S+G AG +NKTV LPKNFT   PG   GY CGPAK+V  T F++   RR T A+MTW
Sbjct  142  LQVSIGLAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTPDKRRKTQALMTW  199

Query  642  KLSCLYS  662
             ++C YS
Sbjct  200  NVTCTYS  206



>gb|KEH25134.1| COBRA-like protein 2 precursor [Medicago truncatula]
Length=446

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WTADGYVA VT+ N+Q+ R I  PGW+LGW WAK EVIW M+G+Q
Sbjct  32   LDPNGNITIKWDIISWTADGYVATVTMNNFQQYRHISSPGWSLGWTWAKKEVIWNMVGSQ  91

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGNIPH C++ P VVDLL GTPYNQQ  NCCKGGVLSSW ++ + A V+ 
Sbjct  92   TTEQGDCSKFKGNIPHCCKKDPTVVDLLPGTPYNQQTANCCKGGVLSSWAQDPTNA-VAS  150

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+ VG+AG TNKTV LP+NFT +APG   GY CG AK   PT+F +   RRVT A+MTW
Sbjct  151  FQVIVGRAGTTNKTVKLPQNFTLKAPGP--GYTCGRAKTGTPTKFTTPDKRRVTQALMTW  208

Query  642  KLSCLYS  662
             ++C YS
Sbjct  209  NVTCTYS  215



>ref|XP_004958244.1| PREDICTED: COBRA-like protein 6-like isoform X3 [Setaria italica]
Length=351

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VTI N+Q  R+I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  25   LDPNGNITIKWDIMSWTPDGYVAVVTINNFQMYRQIMAPGWTVGWTWAKKEVIWSMVGAQ  84

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+RTP VVDLL G PYNQQI NCC+GGV+S++G++   A+V+ 
Sbjct  85   ATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCRGGVISAYGQDPG-AAVAA  143

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TN+TV +PKNFT   PG   GY CGP KIV  T F++   RR T A+MTW
Sbjct  144  FQVSVGQAGTTNRTVKVPKNFTLLGPGP--GYTCGPGKIVPSTVFLTPDRRRKTQALMTW  201

Query  642  KLSCLYSNKF  671
             ++C YS   
Sbjct  202  NVTCTYSQHL  211



>ref|XP_010694042.1| PREDICTED: protein COBRA [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +3

Query  105  NHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQT  284
            N   NIT+ WD++ WT DGYVA+VTIYN+Q  R I+ PGW LGW WAK+EV+W+ +G Q 
Sbjct  28   NFNANITVKWDLMNWTPDGYVAVVTIYNFQEHRNIQAPGWRLGWTWAKHEVLWSTVGGQA  87

Query  285  TMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSEF  464
              QG+CS FKGNIP SC +TP +VDL   TPYNQQIENCC+GG+LS+W      + +S F
Sbjct  88   INQGNCSHFKGNIPVSCMKTPTIVDLKPNTPYNQQIENCCRGGLLSAWSNKHRTSYISAF  147

Query  465  QLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTWK  644
            Q+SVGQ+G +N+TV LPKNFTF+AP     Y CGPAK+V+PT+F++   RR T A+MTWK
Sbjct  148  QVSVGQSGTSNRTVKLPKNFTFKAPRD--RYTCGPAKVVRPTKFLTMDKRRTTQALMTWK  205

Query  645  LSCLYS  662
            ++C YS
Sbjct  206  ITCTYS  211



>ref|XP_006655271.1| PREDICTED: COBRA-like protein 3-like [Oryza brachyantha]
Length=452

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT++N+Q+ R I+ PGW LGW WAK EVIW+M+GAQ
Sbjct  35   LDPNGNITIKWDVMQWTPDGYVAVVTMFNFQQFRHIQAPGWQLGWTWAKKEVIWSMVGAQ  94

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN PH C++ P +VDLL GTPYN QI NCCK GV++++ ++ S A+ S 
Sbjct  95   TTEQGDCSKFKGNTPHCCKKDPTIVDLLPGTPYNMQIANCCKAGVINTFNQDPSNAA-SS  153

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CG A IV+PT+F +  GRR T A+MTW
Sbjct  154  FQISVGLAGTTNKTVKLPKNFTLKAPGP--GYTCGRAMIVRPTKFFTQDGRRATQALMTW  211

Query  642  KLSCLYS  662
             ++C YS
Sbjct  212  NVTCTYS  218



>ref|XP_011006292.1| PREDICTED: COBRA-like protein 4 [Populus euphratica]
Length=439

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WDVI WT DGYVA+VT+ N+Q  R I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  29   LDPTGNITLKWDVISWTPDGYVAVVTMTNFQMYRHIMSPGWTVGWTWAKKEVIWSMVGAQ  88

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+F+ NIPH C ++P VVD+LSG PYNQQI NCCKGGV+SSWG++ S A+VS 
Sbjct  89   ATGQGDCSKFRMNIPHCCMKSPAVVDMLSGVPYNQQIANCCKGGVVSSWGQDPS-AAVSS  147

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG++G TNKTV LPKNFT   PG   GY+C  AKIV PT F +  GRR T AMMTW
Sbjct  148  FQLSVGRSGTTNKTVRLPKNFTLLGPGR--GYSCSQAKIVPPTVFPTPDGRRKTQAMMTW  205

Query  642  KLSCLYS  662
             ++C YS
Sbjct  206  NVTCTYS  212



>ref|XP_007209118.1| hypothetical protein PRUPE_ppa005430mg [Prunus persica]
 gb|EMJ10317.1| hypothetical protein PRUPE_ppa005430mg [Prunus persica]
Length=461

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VT+ N+Q  R+I  PGWTLGW W K EVIWTM+GAQ
Sbjct  48   LDPTGNITIKWDVMSWTPDGYVAAVTMNNFQMYRQIISPGWTLGWSWQKKEVIWTMVGAQ  107

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++TP VVDLL G PYNQQ  NCCKGGVL+SWG++ + ASVS 
Sbjct  108  TTEQGDCSKFKAAIPHCCKKTPTVVDLLPGVPYNQQFTNCCKGGVLASWGQDPT-ASVSA  166

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  167  FQVSVGQAGTSNKTVKLPKNFTLFGPGP--GYTCGPAKVVPSTVFLTADRRRKTQALMTW  224

Query  642  KLSCLYS  662
             ++C YS
Sbjct  225  NVTCTYS  231



>gb|EMT09067.1| COBRA-like protein 6 [Aegilops tauschii]
Length=447

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VTI N+Q  R+I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  27   LDPNGNITIKWDVLSWTPDGYVATVTINNFQTYRQIMAPGWTVGWTWAKREVIWSMVGAQ  86

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK N+PHSC+RTP VVDLL G PYNQQI NCC+GGV+S++G++ S A VS 
Sbjct  87   ATEQGDCSKFKANLPHSCKRTPAVVDLLPGVPYNQQIANCCRGGVVSAYGQDPSGA-VSS  145

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG TN+TV +PKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  146  FQVSVGQAGTTNRTVKVPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADHRRKTQALMTW  203

Query  642  KLSCLYSNKF  671
             ++C YS   
Sbjct  204  NVTCTYSQHL  213



>ref|XP_009338030.1| PREDICTED: COBRA-like protein 4 [Pyrus x bretschneideri]
Length=458

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA VT+ N+Q  R+I  PGWTLGW WAK EVIWTM+GAQ
Sbjct  45   LDPTGNITIRWDVMSWTTDGYVAAVTMNNFQMYRQIPSPGWTLGWSWAKKEVIWTMVGAQ  104

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FK  IPH C++TP VVDLL G PYNQQ  NCCKGGV++SWG++ S A+V+ 
Sbjct  105  TTEQGDCSKFKATIPHCCKKTPTVVDLLPGVPYNQQFANCCKGGVVASWGQDPS-AAVAG  163

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQAG +NKTV LPKNFT   PG   GY CGPAK+V  T F+++  RR T A+MTW
Sbjct  164  FQVSVGQAGTSNKTVKLPKNFTLLGPGP--GYTCGPAKVVPSTVFLTADRRRKTQALMTW  221

Query  642  KLSCLYS  662
             ++C YS
Sbjct  222  NVTCTYS  228



>ref|XP_006345208.1| PREDICTED: protein COBRA-like, partial [Solanum tuberosum]
Length=451

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNIT+ WD+  WT DGY+AIVTIYN+Q+ R I+ PGW LGW WAK E+IW+  G Q
Sbjct  41   LDPNGNITVKWDIKSWTPDGYIAIVTIYNFQKYRHIQAPGWQLGWTWAKKEIIWSAAGGQ  100

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKG+IPH C+R P +VDLL GTPYNQQ+ NCC+GGV+SSW ++  +A VS 
Sbjct  101  ATEQGDCSKFKGSIPHCCKRDPFIVDLLPGTPYNQQVSNCCRGGVISSWVQDPEKA-VSA  159

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ++VGQAG +NKTV LPKNFT +APG   GY CGPA   KPT+F++  GRR T A+MTW
Sbjct  160  FQITVGQAGTSNKTVRLPKNFTLKAPGH--GYTCGPAMKGKPTKFLTPDGRRFTQALMTW  217

Query  642  KLSCLYS  662
             + C YS
Sbjct  218  NVICTYS  224



>ref|XP_004304207.1| PREDICTED: protein COBRA-like [Fragaria vesca subsp. vesca]
Length=448

 Score =   253 bits (646),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD+I WT DGYVA+VT++N+Q+ R I+ PGWT+GW WAK EVIW M+G Q
Sbjct  34   LDPNGNITIKWDIISWTPDGYVAVVTLFNFQQYRHIQAPGWTVGWTWAKKEVIWNMVGGQ  93

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK   PH C++TP +VDLL GTPYNQQ  NCCKGGVLSSW ++ S A+ S 
Sbjct  94   ATEQGDCSKFKPTPPHCCKKTPTIVDLLPGTPYNQQYSNCCKGGVLSSWMQDPSNAAAS-  152

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG++G TNKTV LPKN+T   PG   GY CG AK+VKPT+F ++  RRV+ AMMTW
Sbjct  153  FQLSVGRSGTTNKTVRLPKNYTLMGPGP--GYTCGVAKVVKPTKFFTADKRRVSQAMMTW  210

Query  642  KLSCLYSNKFPKVA*SAPP  698
             ++C YS     +A  APP
Sbjct  211  NVTCTYSQ---FLAQRAPP  226



>ref|XP_006291010.1| hypothetical protein CARUB_v10017122mg [Capsella rubella]
 gb|EOA23908.1| hypothetical protein CARUB_v10017122mg [Capsella rubella]
Length=482

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WD++ WT DGYVA+VTI+N+Q+ R I  PGW LGW W K EVIW+M+GAQ
Sbjct  73   LDPNGNITIKWDIMSWTPDGYVAVVTIFNFQQYRHIEAPGWQLGWSWRKKEVIWSMVGAQ  132

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C++TP +VDLL GTPY QQI NCC+GGV+SSW ++ + A VS 
Sbjct  133  ATEQGDCSKFKGNIPHCCKKTPAIVDLLPGTPYTQQISNCCRGGVISSWAQDPATA-VSS  191

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVGQ+G TN TV  P+N T + PG   GY CGPA++V+P++F+S+  RR T A++TW
Sbjct  192  FQISVGQSGTTNTTVRAPRNITLKGPGP--GYTCGPAQLVRPSKFISADKRRKTQALLTW  249

Query  642  KLSCLYS  662
             ++C YS
Sbjct  250  NITCTYS  256



>ref|XP_009394776.1| PREDICTED: COBRA-like protein 4 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WTADGYVA+VT+ N+Q  R+I  PGWT+GW WAK EVIW+M+GAQ
Sbjct  30   LDPTGNITIKWDVMSWTADGYVAVVTMNNFQMYRQIMSPGWTMGWTWAKKEVIWSMVGAQ  89

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FKGNIPH C+RTP VVDLL G PYNQQI NCCKGGV++S+G++ + A+VS 
Sbjct  90   ATEQGDCSKFKGNIPHCCKRTPAVVDLLPGVPYNQQIANCCKGGVVASYGQDPA-AAVSA  148

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG +G +NKTV LP NFT   PG   GY CGPAK+V  T F+S+  RR T A+MTW
Sbjct  149  FQVSVGLSGTSNKTVKLPNNFTLLGPGL--GYTCGPAKVVPSTTFLSADKRRKTQALMTW  206

Query  642  KLSCLYS  662
             ++C YS
Sbjct  207  NVTCTYS  213



>ref|XP_004304208.1| PREDICTED: COBRA-like protein 4-like [Fragaria vesca subsp. vesca]
Length=433

 Score =   252 bits (644),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 150/218 (69%), Gaps = 12/218 (6%)
 Frame = +3

Query  9    MGFSRSILLLLVLafftccfsfsfadaasHDLNHGGNITINWDVIFWTADGYVAIVTIYN  188
            M F  S L LLV+  +   +           L+  GNITI WD++ WT DGYVA VTI N
Sbjct  1    MRFFVSALFLLVIFSYAAAY---------DPLDPNGNITIRWDIMSWTPDGYVATVTINN  51

Query  189  YQRLRKIREPGWTLGWRWAKYEVIWTMMGAQTTMQGDCSRFKGNIPHSCRRTPEVVDLLS  368
            +Q  R I  PGWTLGW WAK EVIW+ +GAQTT QGDCS+FKGNIPH C++TP VVDLL 
Sbjct  52   FQMYRHIMSPGWTLGWTWAKKEVIWSAVGAQTTEQGDCSKFKGNIPHCCKKTPTVVDLLP  111

Query  369  GTPYNQQIENCCKGGVLSSWGRNGSRASVSEFQLSVGQAGNTNKTVSLPKNFTFEAPGSG  548
            G PYNQQ +NCCKGGV+ +WG++ S ASVS FQLSVG AG +NKTV LPKNFT   PG  
Sbjct  112  GVPYNQQYQNCCKGGVVGAWGQDPS-ASVSAFQLSVGMAGTSNKTVKLPKNFTLLGPGP-  169

Query  549  GGYACGPAKIVKPTRFVSSYGRRVTHAMMTWKLSCLYS  662
             GY CG AKIV  T F S   RR T A+MTW ++C YS
Sbjct  170  -GYTCGKAKIVPSTIFFSPDHRRKTQALMTWNVTCTYS  206



>ref|XP_006477734.1| PREDICTED: COBRA-like protein 4-like, partial [Citrus sinensis]
Length=423

 Score =   252 bits (643),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ W  DGYVA+VT+ N+Q  R I EPGWTLGW WAK EVIW+M+GAQ
Sbjct  14   LDPTGNITIKWDVMSWIPDGYVALVTMTNFQMYRHIMEPGWTLGWTWAKKEVIWSMVGAQ  73

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPHSC + P VVDLL G PYNQQI NCCKGGV+ SWG++ S A+VS 
Sbjct  74   ATEQGDCSKFKINIPHSCMKNPTVVDLLPGVPYNQQIANCCKGGVVGSWGQDPS-AAVSS  132

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG++G++NKTV LPKNFT   PG   GY C  AK V PT F+S+ GRR T AMMTW
Sbjct  133  FQLSVGRSGSSNKTVRLPKNFTLLGPGR--GYTCSQAKNVLPTAFISADGRRRTQAMMTW  190

Query  642  KLSCLYS  662
             ++C YS
Sbjct  191  NVTCTYS  197



>ref|XP_010549989.1| PREDICTED: COBRA-like protein 4 [Tarenaya hassleriana]
 gb|ABD96834.1| hypothetical protein [Cleome spinosa]
Length=440

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GN+TI WDV+ WT DGYVA+V + N+Q  R I  PGWTLGW WAK EVIW+M+GAQ
Sbjct  29   LDPNGNVTIKWDVMSWTPDGYVAVVAMNNFQMYRHIPNPGWTLGWTWAKKEVIWSMVGAQ  88

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKGN+PH C++TP +VDLL G PYNQQ  NCCKGGV+++WG++ S ASVS+
Sbjct  89   TTEQGDCSKFKGNVPHCCKKTPTLVDLLPGVPYNQQFSNCCKGGVVAAWGQDPS-ASVSQ  147

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG +NKTV LPKNFT   PG   GY CGPAKIV  T F++   RR T A+MTW
Sbjct  148  FQVSVGLAGTSNKTVKLPKNFTLLGPGL--GYTCGPAKIVPSTIFLTPDKRRKTQALMTW  205

Query  642  KLSCLYS  662
             ++C YS
Sbjct  206  NVTCTYS  212



>gb|EAY97880.1| hypothetical protein OsI_19799 [Oryza sativa Indica Group]
Length=456

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ WT DGYVA+VT++NYQ+ R I+ PGW LGW WAK EVIW+M+GAQ
Sbjct  39   LDPNGNITIKWDVMSWTPDGYVAVVTMFNYQQFRHIQAPGWQLGWTWAKKEVIWSMVGAQ  98

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
            TT QGDCS+FKG  PH C++ P VVDLL GTPYN QI NCCK GV++++ ++ S A+ S 
Sbjct  99   TTEQGDCSKFKGGTPHCCKKDPTVVDLLPGTPYNMQIANCCKAGVINTFNQDPSNAA-SS  157

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQ+SVG AG TNKTV LPKNFT +APG   GY CG A IV+PT+F +  GRR T A+MTW
Sbjct  158  FQISVGLAGTTNKTVKLPKNFTLKAPGP--GYTCGRAMIVRPTKFFTGDGRRATQALMTW  215

Query  642  KLSCLYS  662
             ++C YS
Sbjct  216  NVTCTYS  222



>gb|KDO65676.1| hypothetical protein CISIN_1g038127mg [Citrus sinensis]
Length=438

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  102  LNHGGNITINWDVIFWTADGYVAIVTIYNYQRLRKIREPGWTLGWRWAKYEVIWTMMGAQ  281
            L+  GNITI WDV+ W  DGYVA+VT+ N+Q  R I EPGWTLGW WAK EVIW+M+GAQ
Sbjct  29   LDPTGNITIKWDVMSWIPDGYVALVTMTNFQMYRHIMEPGWTLGWTWAKKEVIWSMVGAQ  88

Query  282  TTMQGDCSRFKGNIPHSCRRTPEVVDLLSGTPYNQQIENCCKGGVLSSWGRNGSRASVSE  461
             T QGDCS+FK NIPHSC + P VVDLL G PYNQQI NCCKGGV+ SWG++ S A+VS 
Sbjct  89   ATEQGDCSKFKINIPHSCMKNPTVVDLLPGVPYNQQIANCCKGGVVGSWGQDPS-AAVSS  147

Query  462  FQLSVGQAGNTNKTVSLPKNFTFEAPGSGGGYACGPAKIVKPTRFVSSYGRRVTHAMMTW  641
            FQLSVG++G++NKTV LPKNFT   PG   GY C  AK V PT F+S+ GRR T AMMTW
Sbjct  148  FQLSVGRSGSSNKTVRLPKNFTLLGPGR--GYTCSQAKNVLPTAFISADGRRRTQAMMTW  205

Query  642  KLSCLYS  662
             ++C YS
Sbjct  206  NVTCTYS  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1911954177188