BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23514_g2_i7 len=804 path=[5920:0-246 17321:247-252 6178:253-291
6237:292-354 9089:355-356 6302:357-426 17195:427-500 5060:501-544
17639:545-571 1397:572-597 1423:598-637 1463:638-656 17728:657-675
16264:676-712 16301:713-750 16339:751-803]

Length=804
                                                                      Score     E

ref|XP_009796821.1|  PREDICTED: uncharacterized protein LOC104243344  87.4    7e-18   
ref|XP_006348967.1|  PREDICTED: uncharacterized protein LOC102605417  86.3    2e-17   
ref|XP_009625092.1|  PREDICTED: uncharacterized protein LOC104116026  81.6    1e-15   
ref|XP_002524590.1|  metal ion binding protein, putative              80.9    1e-15   Ricinus communis
ref|XP_004243215.1|  PREDICTED: uncharacterized protein LOC101251005  80.9    1e-15   
ref|XP_009625093.1|  PREDICTED: uncharacterized protein LOC104116027  80.9    2e-15   
ref|XP_004243216.1|  PREDICTED: uncharacterized protein LOC101251303  80.1    3e-15   
ref|XP_009793872.1|  PREDICTED: uncharacterized protein LOC104240694  80.5    3e-15   
ref|XP_009796820.1|  PREDICTED: uncharacterized protein LOC104243343  79.7    4e-15   
ref|XP_006348965.1|  PREDICTED: uncharacterized protein LOC102604739  79.0    7e-15   
ref|XP_006348966.1|  PREDICTED: uncharacterized protein LOC102605080  76.3    5e-14   
gb|EYU41174.1|  hypothetical protein MIMGU_mgv1a016413mg              75.5    1e-13   
gb|EYU33985.1|  hypothetical protein MIMGU_mgv1a016390mg              75.5    1e-13   
ref|XP_002263660.1|  PREDICTED: uncharacterized protein LOC100258045  75.5    1e-13   Vitis vinifera
emb|CDP06147.1|  unnamed protein product                              75.1    2e-13   
gb|KDP22991.1|  hypothetical protein JCGZ_01713                       74.3    3e-13   
ref|XP_004294695.1|  PREDICTED: uncharacterized protein LOC101309518  74.3    3e-13   
ref|XP_010107367.1|  hypothetical protein L484_006882                 73.6    5e-13   
emb|CDP06148.1|  unnamed protein product                              73.2    7e-13   
gb|KDP22996.1|  hypothetical protein JCGZ_01718                       72.8    7e-13   
ref|XP_010942541.1|  PREDICTED: uncharacterized protein LOC105060501  72.8    8e-13   
ref|XP_004502101.1|  PREDICTED: uncharacterized protein LOC101495677  73.2    8e-13   
gb|KHF99125.1|  Fimbrial                                              72.4    1e-12   
gb|KDP22994.1|  hypothetical protein JCGZ_01716                       72.4    1e-12   
ref|XP_003601491.1|  ATFP4-like protein                               72.4    1e-12   
ref|XP_002263769.1|  PREDICTED: uncharacterized protein LOC100252914  72.4    1e-12   Vitis vinifera
ref|XP_007206533.1|  hypothetical protein PRUPE_ppa019605mg           71.6    2e-12   
ref|XP_006469401.1|  PREDICTED: uncharacterized protein LOC102626...  71.2    4e-12   
ref|XP_011032087.1|  PREDICTED: uncharacterized protein LOC105131...  70.9    4e-12   
ref|XP_008380030.1|  PREDICTED: uncharacterized protein LOC103443026  70.9    4e-12   
ref|XP_002266819.2|  PREDICTED: uncharacterized protein LOC100242530  71.6    4e-12   Vitis vinifera
ref|XP_006379054.1|  hypothetical protein POPTR_0009s05300g           70.9    5e-12   
ref|XP_006447867.1|  hypothetical protein CICLE_v10017001mg           71.6    5e-12   
ref|XP_006469400.1|  PREDICTED: uncharacterized protein LOC102626...  71.2    5e-12   
ref|XP_009768957.1|  PREDICTED: uncharacterized protein LOC104219891  70.5    6e-12   
ref|XP_002313367.2|  hypothetical protein POPTR_0009s05280g           70.1    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011032085.1|  PREDICTED: uncharacterized protein LOC105131026  70.1    8e-12   
ref|XP_003589925.1|  ATFP4-like protein                               70.1    9e-12   
ref|XP_008794762.1|  PREDICTED: uncharacterized protein LOC103710688  69.7    9e-12   
ref|XP_011032086.1|  PREDICTED: uncharacterized protein LOC105131...  70.1    1e-11   
ref|NP_001150530.1|  heavy metal-associated domain containing pro...  70.5    1e-11   Zea mays [maize]
ref|XP_008218909.1|  PREDICTED: uncharacterized protein LOC103319169  68.9    2e-11   
ref|XP_007207854.1|  hypothetical protein PRUPE_ppa022793mg           68.9    2e-11   
ref|XP_008342265.1|  PREDICTED: uncharacterized protein LOC103405072  68.9    2e-11   
emb|CBI28485.3|  unnamed protein product                              70.9    2e-11   
ref|XP_007217188.1|  hypothetical protein PRUPE_ppa013552mg           68.9    2e-11   
gb|KDP22993.1|  hypothetical protein JCGZ_01715                       68.9    2e-11   
ref|XP_004956437.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...  69.7    2e-11   
gb|EYU21092.1|  hypothetical protein MIMGU_mgv1a023329mg              68.2    3e-11   
ref|XP_006387353.1|  hypothetical protein POPTR_1183s00200g           68.9    3e-11   
ref|XP_004243774.1|  PREDICTED: uncharacterized protein LOC101249661  68.6    3e-11   
ref|XP_010942540.1|  PREDICTED: uncharacterized protein LOC105060500  68.2    3e-11   
ref|XP_006469399.1|  PREDICTED: uncharacterized protein LOC102626447  68.6    4e-11   
ref|XP_002320539.2|  heavy-metal-associated domain-containing fam...  68.2    4e-11   Populus trichocarpa [western balsam poplar]
emb|CBI22645.3|  unnamed protein product                              68.9    4e-11   
ref|XP_011012621.1|  PREDICTED: uncharacterized protein LOC105116833  68.2    4e-11   
ref|XP_011012623.1|  PREDICTED: uncharacterized protein LOC105116834  68.2    4e-11   
ref|XP_007049439.1|  Heavy metal transport/detoxification superfa...  67.8    5e-11   
ref|XP_009395840.1|  PREDICTED: uncharacterized protein LOC103980998  67.8    6e-11   
gb|EEC84223.1|  hypothetical protein OsI_30639                        68.6    7e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_007026099.1|  Uncharacterized protein TCM_030240               71.6    9e-11   
gb|EYU34048.1|  hypothetical protein MIMGU_mgv1a020264mg              67.0    9e-11   
ref|XP_008218899.1|  PREDICTED: uncharacterized protein LOC103319162  67.4    1e-10   
gb|ABK96536.1|  unknown                                               67.0    1e-10   Populus trichocarpa x Populus deltoides
ref|XP_003577912.1|  PREDICTED: uncharacterized protein LOC100824...  67.4    1e-10   
ref|XP_002299059.1|  hypothetical protein POPTR_0001s47250g           67.0    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_003601487.1|  hypothetical protein MTR_3g082210                67.0    1e-10   
gb|EMT28218.1|  hypothetical protein F775_20960                       68.6    1e-10   
ref|XP_011009814.1|  PREDICTED: uncharacterized protein LOC105114819  67.0    1e-10   
dbj|BAK01008.1|  predicted protein                                    67.8    1e-10   
dbj|BAD26132.1|  unknown protein                                      67.0    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011039897.1|  PREDICTED: uncharacterized protein LOC105136306  65.1    3e-10   
ref|XP_009361504.1|  PREDICTED: uncharacterized protein LOC103951779  65.9    3e-10   
ref|XP_011095815.1|  PREDICTED: uncharacterized protein LOC105175165  65.9    3e-10   
gb|EMS63592.1|  hypothetical protein TRIUR3_12405                     66.6    3e-10   
gb|EMT28219.1|  hypothetical protein F775_25180                       65.5    4e-10   
ref|XP_009339282.1|  PREDICTED: uncharacterized protein LOC103931496  65.5    4e-10   
dbj|BAD17465.1|  hypothetical protein                                 65.5    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011095605.1|  PREDICTED: uncharacterized protein LOC105175...  65.1    5e-10   
ref|XP_008809611.1|  PREDICTED: uncharacterized protein LOC103721258  64.7    6e-10   
ref|XP_007208514.1|  hypothetical protein PRUPE_ppa026247mg           64.7    6e-10   
ref|XP_006375589.1|  hypothetical protein POPTR_0014s16960g           65.1    7e-10   
gb|KDO42092.1|  hypothetical protein CISIN_1g033335mg                 64.7    7e-10   
ref|XP_010237995.1|  PREDICTED: uncharacterized protein LOC100824...  66.6    7e-10   
ref|XP_010246562.1|  PREDICTED: uncharacterized protein LOC104589819  64.3    9e-10   
ref|XP_011095818.1|  PREDICTED: uncharacterized protein LOC105175168  64.3    1e-09   
gb|EMS63591.1|  hypothetical protein TRIUR3_12404                     65.5    1e-09   
ref|XP_007208673.1|  hypothetical protein PRUPE_ppa023968mg           63.5    1e-09   
ref|XP_008809608.1|  PREDICTED: uncharacterized protein LOC103721256  63.9    1e-09   
ref|NP_001151460.1|  ATFP4                                            63.9    2e-09   Zea mays [maize]
ref|XP_003601492.1|  ATFP4                                            65.1    2e-09   
ref|XP_007216846.1|  hypothetical protein PRUPE_ppa022086mg           63.2    3e-09   
ref|NP_001053041.1|  Os04g0469000                                     63.2    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572271.1|  PREDICTED: uncharacterized protein LOC100826249  63.9    3e-09   
dbj|BAJ88821.1|  predicted protein                                    63.9    3e-09   
gb|EYU27493.1|  hypothetical protein MIMGU_mgv1a016643mg              63.2    3e-09   
gb|AAO63778.1|  unknown                                               63.2    3e-09   Populus tremuloides
ref|XP_008794753.1|  PREDICTED: uncharacterized protein LOC103710677  62.8    3e-09   
ref|XP_006447868.1|  hypothetical protein CICLE_v10018068mg           63.2    3e-09   
ref|XP_008218443.1|  PREDICTED: uncharacterized protein LOC103318786  62.8    4e-09   
tpg|DAA37388.1|  TPA: ATFP4                                           63.2    4e-09   
ref|XP_006447866.1|  hypothetical protein CICLE_v10017259mg           62.4    4e-09   
ref|XP_006422046.1|  hypothetical protein CICLE_v10006246mg           62.4    4e-09   
ref|XP_004956436.1|  PREDICTED: 5'-3' exoribonuclease 2-like isof...  63.5    5e-09   
gb|KDP22988.1|  hypothetical protein JCGZ_01710                       62.8    6e-09   
ref|XP_002305267.1|  hypothetical protein POPTR_0004s07140g           62.4    6e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010542497.1|  PREDICTED: uncharacterized protein LOC104815685  62.4    6e-09   
ref|XP_009339286.1|  PREDICTED: uncharacterized protein LOC103931499  62.0    8e-09   
ref|XP_011035351.1|  PREDICTED: FK506-binding protein 4-like isof...  62.0    8e-09   
emb|CDY07985.1|  BnaC03g35380D                                        62.8    1e-08   
ref|XP_009134984.1|  PREDICTED: uncharacterized protein LOC103859...  62.0    1e-08   
gb|EMT24129.1|  hypothetical protein F775_26351                       62.4    1e-08   
ref|XP_004296129.1|  PREDICTED: uncharacterized protein LOC101294055  61.6    1e-08   
ref|XP_008794752.1|  PREDICTED: uncharacterized protein LOC103710676  61.2    1e-08   
ref|XP_008803071.1|  PREDICTED: uncharacterized protein LOC103716...  61.2    1e-08   
ref|XP_004294919.1|  PREDICTED: uncharacterized protein LOC101303978  60.8    2e-08   
ref|XP_006439474.1|  hypothetical protein CICLE_v10022806mg           61.2    2e-08   
ref|XP_008809609.1|  PREDICTED: uncharacterized protein LOC103721...  60.8    2e-08   
ref|XP_003594348.1|  hypothetical protein MTR_2g027600                60.1    2e-08   
emb|CDX74037.1|  BnaA03g30100D                                        61.6    2e-08   
ref|XP_009803996.1|  PREDICTED: uncharacterized protein LOC104249299  60.8    2e-08   
ref|XP_009124284.1|  PREDICTED: early nodulin-75-like                 61.6    2e-08   
ref|XP_002268731.1|  PREDICTED: uncharacterized protein LOC100255094  60.8    2e-08   Vitis vinifera
ref|XP_011015695.1|  PREDICTED: uncharacterized protein LOC105119269  60.5    3e-08   
ref|NP_001062737.1|  Os09g0272000                                     61.2    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010279042.1|  PREDICTED: FK506-binding protein 4-like          60.5    4e-08   
gb|KDP25385.1|  hypothetical protein JCGZ_20541                       60.8    4e-08   
gb|AES76597.2|  hypothetical protein MTR_6g082180                     61.2    4e-08   
ref|XP_010036115.1|  PREDICTED: uncharacterized protein LOC104425195  60.1    4e-08   
ref|XP_009134983.1|  PREDICTED: uncharacterized protein LOC103859...  60.5    4e-08   
ref|XP_007206826.1|  hypothetical protein PRUPE_ppa026184mg           60.1    4e-08   
gb|KEH21133.1|  heavy metal transport/detoxification superfamily ...  60.1    4e-08   
ref|XP_006476499.1|  PREDICTED: putative late blight resistance p...  60.1    4e-08   
ref|XP_002865298.1|  hypothetical protein ARALYDRAFT_917047           59.3    4e-08   
ref|XP_004975911.1|  PREDICTED: uncharacterized protein LOC101766713  60.8    5e-08   
ref|XP_007160106.1|  hypothetical protein PHAVU_002G292900g           60.1    5e-08   
ref|XP_010671617.1|  PREDICTED: uncharacterized protein LOC104888366  60.1    5e-08   
gb|EMT17916.1|  hypothetical protein F775_42527                       59.7    5e-08   
ref|XP_007020579.1|  Heavy metal transport/detoxification superfa...  60.1    5e-08   
ref|XP_011095606.1|  PREDICTED: uncharacterized protein LOC105175...  59.3    5e-08   
ref|XP_010551977.1|  PREDICTED: uncharacterized protein LOC104822...  60.1    6e-08   
gb|EYU21091.1|  hypothetical protein MIMGU_mgv1a018053mg              59.7    6e-08   
ref|XP_010251773.1|  PREDICTED: uncharacterized protein LOC104593570  59.7    6e-08   
emb|CAD41036.1|  OSJNBa0060P14.7                                      59.7    6e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMT17914.1|  hypothetical protein F775_22425                       60.5    6e-08   
ref|XP_006407818.1|  hypothetical protein EUTSA_v10021695mg           60.1    6e-08   
gb|AFK44478.1|  unknown                                               59.7    7e-08   
gb|EMS57369.1|  hypothetical protein TRIUR3_01188                     59.3    7e-08   
gb|KEH15709.1|  heavy metal transport/detoxification superfamily ...  58.5    7e-08   
ref|XP_010251978.1|  PREDICTED: uncharacterized protein LOC104593713  60.1    7e-08   
gb|EMT17917.1|  hypothetical protein F775_02489                       59.3    7e-08   
gb|EMS57367.1|  hypothetical protein TRIUR3_01185                     59.3    8e-08   
ref|NP_187417.1|  heavy-metal-associated domain-containing protein    59.7    9e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234832.1|  PREDICTED: FK506-binding protein 4-like          59.3    9e-08   
ref|XP_009101379.1|  PREDICTED: uncharacterized protein LOC103827613  58.9    9e-08   
ref|XP_009609542.1|  PREDICTED: uncharacterized protein LOC104103...  59.3    9e-08   
ref|XP_008355039.1|  PREDICTED: uncharacterized protein LOC103418705  58.5    9e-08   
ref|XP_002448006.1|  hypothetical protein SORBIDRAFT_06g019560        58.9    9e-08   Sorghum bicolor [broomcorn]
ref|XP_010464391.1|  PREDICTED: uncharacterized protein LOC104744...  59.7    9e-08   
gb|KDO41138.1|  hypothetical protein CISIN_1g041984mg                 58.5    1e-07   
ref|XP_010644659.1|  PREDICTED: uncharacterized protein LOC100257...  58.9    1e-07   
gb|AES60176.2|  metal ion-binding protein, putative                   58.5    1e-07   
ref|XP_010097269.1|  U-box domain-containing protein 4                62.0    1e-07   
gb|KHN21789.1|  hypothetical protein glysoja_027673                   58.9    1e-07   
ref|XP_009415399.1|  PREDICTED: uncharacterized protein LOC103996246  58.9    1e-07   
ref|XP_003547302.1|  PREDICTED: uncharacterized protein LOC100776617  57.8    1e-07   
ref|XP_002447998.1|  hypothetical protein SORBIDRAFT_06g019490        58.5    1e-07   Sorghum bicolor [broomcorn]
gb|AAD09508.1|  ATFP4                                                 59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABK20952.1|  unknown                                               58.5    2e-07   Picea sitchensis
ref|XP_011046029.1|  PREDICTED: uncharacterized protein LOC105140...  58.5    2e-07   
ref|XP_006372383.1|  hypothetical protein POPTR_0017s01100g           58.5    2e-07   
gb|KHN44736.1|  hypothetical protein glysoja_032075                   58.5    2e-07   
ref|XP_008219472.1|  PREDICTED: uncharacterized protein LOC103319678  61.2    2e-07   
ref|XP_003610793.1|  ATFP4                                            57.8    2e-07   
ref|XP_006301602.1|  hypothetical protein CARUB_v10022041mg           58.2    2e-07   
gb|ABK21992.1|  unknown                                               58.5    2e-07   Picea sitchensis
ref|XP_011088106.1|  PREDICTED: heavy metal-associated isoprenyla...  58.2    2e-07   
ref|XP_010551978.1|  PREDICTED: uncharacterized protein LOC104822...  58.5    2e-07   
ref|XP_007020383.1|  Heavy metal transport/detoxification superfa...  58.2    2e-07   
ref|XP_010537144.1|  PREDICTED: uncharacterized protein LOC104811951  58.2    2e-07   
ref|XP_008344748.1|  PREDICTED: uncharacterized protein LOC103407626  57.8    2e-07   
gb|KDO64067.1|  hypothetical protein CISIN_1g0009451mg                61.6    2e-07   
gb|KDO64073.1|  hypothetical protein CISIN_1g0009451mg                61.2    2e-07   
gb|EMS57368.1|  hypothetical protein TRIUR3_01187                     57.8    2e-07   
ref|XP_002447999.1|  hypothetical protein SORBIDRAFT_06g019500        58.2    3e-07   Sorghum bicolor [broomcorn]
ref|XP_010644663.1|  PREDICTED: uncharacterized protein LOC100853541  57.8    3e-07   
ref|XP_002303608.1|  hypothetical protein POPTR_0003s13210g           58.2    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008809610.1|  PREDICTED: uncharacterized protein LOC103721...  57.8    3e-07   
ref|XP_007206993.1|  hypothetical protein PRUPE_ppb021408mg           57.8    3e-07   
ref|XP_010064973.1|  PREDICTED: uncharacterized protein LOC104452160  57.4    3e-07   
ref|XP_009339284.1|  PREDICTED: uncharacterized protein LOC103931498  57.8    3e-07   
ref|XP_007020387.1|  Heavy metal transport/detoxification superfa...  57.8    3e-07   
emb|CBI22646.3|  unnamed protein product                              57.0    3e-07   
ref|XP_011046030.1|  PREDICTED: uncharacterized protein LOC105140...  57.8    3e-07   
gb|AES71738.2|  metal ion-binding protein, putative                   57.4    3e-07   
gb|EMT17918.1|  hypothetical protein F775_02490                       58.5    3e-07   
ref|XP_004503674.1|  PREDICTED: uncharacterized protein LOC101514701  57.8    3e-07   
ref|XP_008353240.1|  PREDICTED: uncharacterized protein LOC103416792  57.4    3e-07   
ref|XP_010464393.1|  PREDICTED: uncharacterized protein LOC104744...  58.2    3e-07   
gb|KHN14404.1|  hypothetical protein glysoja_012442                   56.6    4e-07   
ref|XP_009609541.1|  PREDICTED: uncharacterized protein LOC104103...  57.4    4e-07   
gb|AES71743.2|  hypothetical protein MTR_3g082260                     57.0    4e-07   
ref|XP_008229766.1|  PREDICTED: uncharacterized protein LOC103329115  57.4    4e-07   
ref|NP_001238668.1|  uncharacterized protein LOC100306170             57.4    4e-07   
ref|XP_009391790.1|  PREDICTED: uncharacterized protein LOC103977867  57.4    4e-07   
gb|KCW47638.1|  hypothetical protein EUGRSUZ_K01380                   57.4    5e-07   
ref|XP_004952918.1|  PREDICTED: uncharacterized protein LOC101784893  57.4    5e-07   
ref|XP_010089046.1|  Putative late blight resistance-like protein     57.4    5e-07   
emb|CAN77999.1|  hypothetical protein VITISV_002984                   57.0    5e-07   Vitis vinifera
emb|CBI22643.3|  unnamed protein product                              57.0    5e-07   
ref|XP_008232983.1|  PREDICTED: FK506-binding protein 4               57.8    6e-07   
gb|EMT11065.1|  hypothetical protein F775_02341                       56.6    6e-07   
ref|XP_004952921.1|  PREDICTED: uncharacterized protein LOC101786...  57.0    6e-07   
ref|XP_002268343.1|  PREDICTED: heavy metal-associated isoprenyla...  56.6    6e-07   Vitis vinifera
ref|XP_006652383.1|  PREDICTED: uncharacterized protein LOC102714171  56.6    6e-07   
ref|XP_004492796.1|  PREDICTED: FK506-binding protein 4-like          57.4    7e-07   
gb|ABK22997.1|  unknown                                               57.0    7e-07   Picea sitchensis
emb|CAH67426.1|  OSIGBa0150F01.6                                      57.0    7e-07   Oryza sativa [red rice]
ref|XP_010928047.1|  PREDICTED: uncharacterized protein LOC105049937  56.6    7e-07   
ref|XP_011046033.1|  PREDICTED: uncharacterized protein LOC105140...  56.6    7e-07   
ref|XP_002307842.2|  hypothetical protein POPTR_0006s00390g           55.8    7e-07   Populus trichocarpa [western balsam poplar]
gb|KHN21790.1|  hypothetical protein glysoja_027674                   56.6    7e-07   
gb|ADE80955.1|  NBS-LRR class disease resistance protein              60.1    7e-07   
gb|KHM99946.1|  Putative late blight resistance protein like R1B-19   56.6    7e-07   
ref|XP_002276701.1|  PREDICTED: FK506-binding protein 4               57.4    8e-07   Vitis vinifera
ref|XP_003616824.1|  hypothetical protein MTR_5g084660                56.6    8e-07   
gb|ADE80954.1|  NBS-LRR class disease resistance protein              60.1    8e-07   
gb|ADE80953.1|  NBS-LRR class disease resistance protein              60.1    8e-07   
gb|ADV58352.1|  resistance protein Pikp-1                             60.1    8e-07   
ref|XP_009147052.1|  PREDICTED: uncharacterized protein LOC103870652  57.0    8e-07   
ref|XP_010036114.1|  PREDICTED: uncharacterized protein LOC104425194  56.6    8e-07   
gb|ADE80951.1|  NBS-LRR class disease resistance protein              59.7    8e-07   
ref|XP_006372382.1|  hypothetical protein POPTR_0017s01090g           56.6    8e-07   
gb|ADZ48537.1|  Pik-1 blast resistance protein                        59.7    8e-07   
ref|NP_001053015.1|  Os04g0464100                                     56.2    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006474799.1|  PREDICTED: uncharacterized protein LOC102607832  56.2    9e-07   
emb|CDY22124.1|  BnaC01g39770D                                        59.3    1e-06   
ref|XP_010928046.1|  PREDICTED: uncharacterized protein LOC105049936  56.2    1e-06   
ref|XP_010671619.1|  PREDICTED: uncharacterized protein LOC104888368  55.8    1e-06   
ref|XP_010455734.1|  PREDICTED: uncharacterized protein LOC104737...  56.6    1e-06   
gb|ABK25811.1|  unknown                                               56.2    1e-06   Picea sitchensis
gb|AFK37005.1|  unknown                                               57.0    1e-06   
ref|XP_008232364.1|  PREDICTED: uncharacterized protein LOC103331...  55.8    1e-06   
gb|KCW70441.1|  hypothetical protein EUGRSUZ_F03666                   55.8    1e-06   
dbj|BAO45868.1|  hypothetical protein                                 55.8    1e-06   
gb|ABK22901.1|  unknown                                               56.2    1e-06   Picea sitchensis
emb|CDY49337.1|  BnaA05g32990D                                        55.1    1e-06   
ref|XP_009398759.1|  PREDICTED: uncharacterized protein LOC103983262  56.2    1e-06   
ref|XP_002273341.2|  PREDICTED: uncharacterized protein LOC100247478  55.8    1e-06   Vitis vinifera
gb|AFK47311.1|  unknown                                               55.8    1e-06   
ref|XP_002454080.1|  hypothetical protein SORBIDRAFT_04g024270        55.8    1e-06   Sorghum bicolor [broomcorn]
ref|XP_006467227.1|  PREDICTED: uncharacterized protein LOC102624...  55.1    1e-06   
emb|CAN78416.1|  hypothetical protein VITISV_001731                   55.5    1e-06   Vitis vinifera
ref|XP_010096497.1|  hypothetical protein L484_017949                 55.1    1e-06   
ref|XP_009363395.1|  PREDICTED: putative late blight resistance p...  55.8    2e-06   
ref|XP_002278542.1|  PREDICTED: uncharacterized protein LOC100258716  55.8    2e-06   Vitis vinifera
ref|XP_009625094.1|  PREDICTED: uncharacterized protein LOC104116028  55.8    2e-06   
ref|XP_006422043.1|  hypothetical protein CICLE_v10006198mg           55.8    2e-06   
ref|XP_010486325.1|  PREDICTED: uncharacterized protein LOC104764...  55.8    2e-06   
ref|XP_011029352.1|  PREDICTED: putative late blight resistance p...  55.8    2e-06   
ref|XP_011022620.1|  PREDICTED: uncharacterized protein LOC105124334  55.8    2e-06   
ref|XP_003633635.2|  PREDICTED: uncharacterized protein LOC100853...  55.8    2e-06   
emb|CDX77803.1|  BnaC07g20570D                                        54.7    2e-06   
ref|XP_004252097.2|  PREDICTED: uncharacterized protein LOC101254173  55.5    2e-06   
ref|XP_004143886.1|  PREDICTED: uncharacterized protein LOC101213529  55.5    2e-06   
gb|KHN44735.1|  hypothetical protein glysoja_032074                   55.5    2e-06   
ref|XP_003635014.1|  PREDICTED: uncharacterized protein LOC100853035  55.5    2e-06   
gb|AFK37277.1|  unknown                                               55.5    2e-06   
gb|KDP22989.1|  hypothetical protein JCGZ_01711                       55.8    2e-06   
ref|XP_002299508.1|  hypothetical protein POPTR_0001s09840g           55.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003624087.1|  hypothetical protein MTR_7g079110                56.2    2e-06   
ref|XP_006849251.1|  hypothetical protein AMTR_s00027p00240310        55.5    2e-06   
ref|XP_009781683.1|  PREDICTED: actin-binding protein F-like          55.5    2e-06   
emb|CBI22648.3|  unnamed protein product                              54.7    2e-06   
ref|XP_006599547.1|  PREDICTED: uncharacterized protein LOC100801...  55.5    2e-06   
ref|XP_002509857.1|  metal ion binding protein, putative              55.5    2e-06   Ricinus communis
ref|XP_002274512.1|  PREDICTED: heavy metal-associated isoprenyla...  55.1    2e-06   Vitis vinifera
ref|XP_010038750.1|  PREDICTED: uncharacterized protein LOC104427343  55.1    3e-06   
ref|XP_003575245.1|  PREDICTED: uncharacterized protein LOC100845716  55.5    3e-06   
ref|XP_010493641.1|  PREDICTED: uncharacterized protein LOC104770877  55.8    3e-06   
emb|CDY35949.1|  BnaA05g30010D                                        56.2    3e-06   
ref|XP_010482075.1|  PREDICTED: uncharacterized protein LOC104760...  55.8    3e-06   
ref|XP_003535594.1|  PREDICTED: putative late blight resistance p...  55.1    3e-06   
ref|XP_011073260.1|  PREDICTED: copper transport protein CCH-like     55.1    3e-06   
ref|XP_010659770.1|  PREDICTED: uncharacterized protein LOC100853...  54.7    3e-06   
gb|EYU35375.1|  hypothetical protein MIMGU_mgv1a016629mg              54.7    3e-06   
ref|XP_011091871.1|  PREDICTED: uncharacterized protein LOC105172...  54.7    3e-06   
ref|XP_004140067.1|  PREDICTED: uncharacterized protein LOC101216311  54.7    3e-06   
ref|XP_006665112.1|  PREDICTED: uncharacterized protein LOC102708959  55.1    3e-06   
ref|XP_010442248.1|  PREDICTED: uncharacterized protein LOC104725...  55.8    3e-06   
ref|XP_008360723.1|  PREDICTED: uncharacterized protein LOC103424419  54.7    3e-06   
ref|XP_010668394.1|  PREDICTED: serrate RNA effector molecule hom...  55.5    3e-06   
ref|XP_006386610.1|  hypothetical protein POPTR_0002s16500g           55.5    3e-06   
ref|XP_002300434.2|  hypothetical protein POPTR_0001s38790g           54.7    3e-06   
ref|XP_009419465.1|  PREDICTED: uncharacterized protein LOC103999434  55.5    3e-06   
gb|KHG06942.1|  hypothetical protein F383_06777                       53.9    3e-06   
ref|XP_011045596.1|  PREDICTED: uncharacterized protein LOC105140450  54.7    4e-06   
emb|CDY17700.1|  BnaA06g35190D                                        53.9    4e-06   
ref|XP_009789253.1|  PREDICTED: uncharacterized protein LOC104236903  55.1    4e-06   
ref|XP_010455810.1|  PREDICTED: uncharacterized protein LOC104737...  55.1    4e-06   
ref|XP_010092580.1|  hypothetical protein L484_012921                 56.6    4e-06   
ref|XP_008362786.1|  PREDICTED: putative late blight resistance p...  54.7    4e-06   
ref|XP_008345258.1|  PREDICTED: FK506-binding protein 4-like          55.1    4e-06   
gb|KHN29315.1|  hypothetical protein glysoja_005039                   55.5    4e-06   
ref|XP_007020384.1|  Copper transport protein family, putative is...  54.3    4e-06   
emb|CDP08855.1|  unnamed protein product                              54.3    4e-06   
ref|XP_008232363.1|  PREDICTED: uncharacterized protein LOC103331...  54.7    4e-06   
ref|XP_002305266.2|  hypothetical protein POPTR_0004s07150g           54.7    4e-06   
ref|XP_004978065.1|  PREDICTED: uncharacterized protein LOC101770792  54.3    4e-06   
ref|XP_008353688.1|  PREDICTED: uncharacterized protein LOC103417272  54.3    4e-06   
ref|NP_001236738.1|  uncharacterized protein LOC100527231             55.1    4e-06   
ref|XP_002307843.2|  hypothetical protein POPTR_0006s00400g           53.5    4e-06   
ref|NP_001235718.1|  uncharacterized protein LOC100527669             54.7    4e-06   
ref|XP_006299450.1|  hypothetical protein CARUB_v10015615mg           55.1    4e-06   
ref|XP_007204171.1|  hypothetical protein PRUPE_ppa017127mg           54.3    4e-06   
ref|XP_002889363.1|  hypothetical protein ARALYDRAFT_887301           55.1    5e-06   
ref|XP_003592191.1|  hypothetical protein MTR_1g099800                54.7    5e-06   
gb|KEH26283.1|  heavy metal-associated domain protein                 53.9    5e-06   
gb|KHG19695.1|  Putative late blight resistance R1A-3                 54.3    5e-06   
ref|XP_010486324.1|  PREDICTED: uncharacterized protein LOC104764...  54.7    5e-06   
ref|XP_002524589.1|  conserved hypothetical protein                   53.1    5e-06   
gb|ACJ84180.1|  unknown                                               55.8    5e-06   
gb|EMT10183.1|  hypothetical protein F775_42402                       54.3    6e-06   
gb|KDP22995.1|  hypothetical protein JCGZ_01717                       53.9    6e-06   
ref|XP_009118812.1|  PREDICTED: FK506-binding protein 4-like          55.1    6e-06   
emb|CDY38009.1|  BnaCnng08700D                                        55.1    6e-06   
ref|XP_004978062.1|  PREDICTED: uncharacterized protein LOC101769152  54.3    6e-06   
ref|XP_004515154.1|  PREDICTED: uncharacterized protein LOC101499358  53.9    6e-06   
ref|XP_011069516.1|  PREDICTED: uncharacterized protein LOC105155344  52.8    6e-06   
ref|XP_008375969.1|  PREDICTED: FK506-binding protein 4-like          54.7    6e-06   
ref|XP_004978064.1|  PREDICTED: uncharacterized protein LOC101770379  53.9    7e-06   
ref|XP_010036116.1|  PREDICTED: uncharacterized protein LOC104425196  53.9    7e-06   
ref|XP_004952920.1|  PREDICTED: uncharacterized protein LOC101786...  54.7    7e-06   
ref|XP_006289318.1|  hypothetical protein CARUB_v10002803mg           53.1    7e-06   
ref|XP_009771983.1|  PREDICTED: putative uncharacterized protein ...  54.3    7e-06   
ref|XP_008376650.1|  PREDICTED: FK506-binding protein 4-like          53.9    8e-06   
ref|XP_004978063.1|  PREDICTED: uncharacterized protein LOC101769967  53.9    8e-06   
ref|XP_006649255.1|  PREDICTED: nucleolar protein 58-like isoform X1  53.5    8e-06   
ref|XP_008448137.1|  PREDICTED: uncharacterized protein LOC103490424  53.5    8e-06   
ref|XP_008437534.1|  PREDICTED: uncharacterized protein LOC103482919  53.9    8e-06   
dbj|BAG15861.1|  hypothetical protein                                 53.9    8e-06   
ref|XP_007040347.1|  Heavy metal transport/detoxification superfa...  53.9    8e-06   
ref|XP_002863883.1|  hypothetical protein ARALYDRAFT_494881           54.3    8e-06   
ref|XP_007015335.1|  Heavy metal transport/detoxification superfa...  52.8    9e-06   
ref|XP_004975907.1|  PREDICTED: uncharacterized protein LOC101765088  53.5    9e-06   
ref|XP_007141682.1|  hypothetical protein PHAVU_008G216200g           53.5    9e-06   
ref|XP_007218588.1|  hypothetical protein PRUPE_ppa013273mg           53.5    9e-06   
ref|XP_009593962.1|  PREDICTED: beta-mannosyltransferase 3-like       53.5    9e-06   
ref|XP_003620388.1|  Mitochondrial protein, putative                  55.8    9e-06   
ref|XP_010669862.1|  PREDICTED: FK506-binding protein 4               54.3    1e-05   
ref|XP_011080908.1|  PREDICTED: putative late blight resistance p...  53.5    1e-05   
ref|XP_011091863.1|  PREDICTED: uncharacterized protein LOC105172...  53.1    1e-05   
ref|XP_003620393.1|  hypothetical protein MTR_6g082330                55.1    1e-05   
gb|EEC77445.1|  hypothetical protein OsI_16250                        55.5    1e-05   
ref|XP_010905100.1|  PREDICTED: uncharacterized protein LOC105032359  52.8    1e-05   
ref|NP_001152411.1|  ATFP4                                            53.1    1e-05   
gb|AFW72061.1|  ATFP4                                                 53.1    1e-05   
ref|XP_007152161.1|  hypothetical protein PHAVU_004G106900g           53.1    1e-05   
ref|XP_009151629.1|  PREDICTED: basic proline-rich protein            54.3    1e-05   
ref|XP_009419204.1|  PREDICTED: uncharacterized protein LOC103999...  53.1    1e-05   
gb|ADE80948.1|  NBS-LRR class disease resistance protein              56.2    1e-05   
ref|XP_002447286.1|  hypothetical protein SORBIDRAFT_06g032110        53.5    1e-05   
ref|XP_008805584.1|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
ref|XP_009366561.1|  PREDICTED: FK506-binding protein 4               53.9    1e-05   
ref|XP_010317603.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  52.8    1e-05   
gb|KDP28565.1|  hypothetical protein JCGZ_14336                       53.9    1e-05   
dbj|BAG71909.1|  NBS-LRR class disease resistance protein             56.2    1e-05   
ref|XP_004298831.1|  PREDICTED: uncharacterized protein LOC101291624  53.1    1e-05   
gb|EMS57371.1|  hypothetical protein TRIUR3_01191                     52.8    1e-05   
ref|XP_007051711.1|  Heavy metal transport/detoxification superfa...  53.9    1e-05   
ref|XP_006353303.1|  PREDICTED: microtubule-associated protein 1B...  52.8    1e-05   
ref|XP_010055082.1|  PREDICTED: FK506-binding protein 4 isoform X1    53.9    1e-05   
ref|XP_010057992.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-05   
ref|XP_004292546.1|  PREDICTED: uncharacterized protein LOC101296351  53.1    1e-05   
ref|XP_006452704.1|  hypothetical protein CICLE_v10010525mg           53.9    1e-05   
ref|XP_007040346.1|  Heavy metal transport/detoxification superfa...  53.1    1e-05   
ref|XP_008380205.1|  PREDICTED: putative late blight resistance p...  53.1    1e-05   
gb|KHG10757.1|  Putative late blight resistance R1A-3                 53.9    1e-05   
gb|KDO38735.1|  hypothetical protein CISIN_1g047835mg                 52.8    1e-05   
tpg|DAA37385.1|  TPA: hypothetical protein ZEAMMB73_318699            53.9    1e-05   
ref|XP_004952919.1|  PREDICTED: uncharacterized protein LOC101785283  53.1    1e-05   
ref|XP_010057990.1|  PREDICTED: TMV resistance protein N-like iso...  56.2    1e-05   
ref|NP_171656.1|  heavy-metal-associated domain-containing protein    53.9    1e-05   
ref|XP_010057991.1|  PREDICTED: TMV resistance protein N-like iso...  55.8    2e-05   
ref|XP_010659774.1|  PREDICTED: uncharacterized protein LOC100853...  52.8    2e-05   
gb|AFK38658.1|  unknown                                               52.4    2e-05   
ref|XP_011023277.1|  PREDICTED: actin-binding protein-like isofor...  53.5    2e-05   
dbj|BAK02304.1|  predicted protein                                    52.4    2e-05   
ref|XP_004306736.1|  PREDICTED: uncharacterized protein LOC101309084  53.5    2e-05   
ref|XP_006583442.1|  PREDICTED: uncharacterized protein LOC100812612  52.8    2e-05   
emb|CDY42926.1|  BnaC05g47250D                                        52.0    2e-05   
gb|AFK46184.1|  unknown                                               52.8    2e-05   
ref|XP_003548155.1|  PREDICTED: uncharacterized protein LOC100783411  52.4    2e-05   
ref|XP_008803335.1|  PREDICTED: FK506-binding protein 4               53.1    2e-05   
ref|NP_001236802.1|  uncharacterized protein LOC100305540             53.5    2e-05   
ref|XP_010038749.1|  PREDICTED: uncharacterized protein LOC104427342  53.5    2e-05   
ref|XP_009621673.1|  PREDICTED: uncharacterized protein LOC104113263  53.1    2e-05   
gb|KHN40433.1|  hypothetical protein glysoja_000931                   53.5    2e-05   
ref|XP_008355038.1|  PREDICTED: keratin-associated protein 4-7-like   53.1    2e-05   
ref|XP_010480225.1|  PREDICTED: transcription initiation factor T...  53.5    2e-05   
gb|KEH26284.1|  heavy metal-associated domain protein                 53.1    2e-05   
ref|XP_009382266.1|  PREDICTED: titin-like                            54.7    2e-05   
ref|XP_009615168.1|  PREDICTED: patellin-2-like                       52.0    2e-05   
ref|XP_006467228.1|  PREDICTED: uncharacterized protein LOC102624...  51.6    2e-05   
ref|XP_007152164.1|  hypothetical protein PHAVU_004G107100g           52.4    2e-05   
emb|CAE06009.3|  OSJNBa0016O02.19                                     52.8    2e-05   
gb|KCW75443.1|  hypothetical protein EUGRSUZ_E04208                   55.1    2e-05   
ref|XP_004512882.1|  PREDICTED: NF-X1-type zinc finger protein NF...  53.9    2e-05   
ref|XP_006599548.1|  PREDICTED: uncharacterized protein LOC100801...  52.4    2e-05   
gb|EEE61156.1|  hypothetical protein OsJ_15122                        52.4    2e-05   
dbj|BAA98186.1|  ATFP4-like                                           52.8    2e-05   
gb|AAF81309.1|AC061957_5  Contains a weak similarity to a farnesy...  53.5    2e-05   
ref|XP_008344728.1|  PREDICTED: uncharacterized protein LOC103407605  52.8    2e-05   
ref|XP_008344729.1|  PREDICTED: uncharacterized protein LOC103407607  52.4    2e-05   
ref|XP_009760311.1|  PREDICTED: patellin-2                            52.0    2e-05   
emb|CDY15173.1|  BnaC05g00520D                                        54.7    2e-05   
ref|XP_007142458.1|  hypothetical protein PHAVU_008G282300g           52.0    3e-05   
ref|XP_008348575.1|  PREDICTED: heavy metal-associated isoprenyla...  52.4    3e-05   
ref|NP_568695.1|  heavy metal transport/detoxification domain-con...  53.1    3e-05   
ref|XP_010671618.1|  PREDICTED: uncharacterized protein LOC104888367  52.0    3e-05   
gb|EMT22474.1|  hypothetical protein F775_26296                       51.6    3e-05   
gb|KEH26288.1|  heavy metal-associated domain protein                 52.8    3e-05   
gb|EMT27977.1|  hypothetical protein F775_30185                       52.4    3e-05   
gb|KDO76198.1|  hypothetical protein CISIN_1g036889mg                 51.6    3e-05   
gb|AAO22725.1|  unknown protein                                       53.1    3e-05   
ref|XP_008660565.1|  PREDICTED: uncharacterized protein LOC103639...  51.6    3e-05   
gb|EAY88246.1|  hypothetical protein OsI_09697                        52.0    3e-05   
ref|XP_006439565.1|  hypothetical protein CICLE_v10023788mg           51.6    3e-05   
ref|XP_004234217.1|  PREDICTED: copper transport protein CCH          52.8    3e-05   
ref|XP_011038421.1|  PREDICTED: uncharacterized protein LOC105135...  52.4    3e-05   
ref|XP_003549024.1|  PREDICTED: uncharacterized protein LOC100801...  52.4    3e-05   
gb|EMT17919.1|  hypothetical protein F775_02491                       52.0    3e-05   
gb|EMT27976.1|  hypothetical protein F775_43817                       52.4    3e-05   
gb|EMS50209.1|  hypothetical protein TRIUR3_19269                     52.8    3e-05   
gb|KHN09293.1|  hypothetical protein glysoja_029064                   52.8    3e-05   
ref|XP_009368729.1|  PREDICTED: FK506-binding protein 4               52.0    3e-05   
ref|XP_010522947.1|  PREDICTED: uncharacterized protein LOC104801392  52.8    3e-05   
ref|XP_009377561.1|  PREDICTED: FK506-binding protein 4-like          52.0    3e-05   
gb|AFK43139.1|  unknown                                               52.0    3e-05   
ref|XP_002447997.1|  hypothetical protein SORBIDRAFT_06g019480        51.6    4e-05   
ref|XP_002321040.2|  hypothetical protein POPTR_0014s08550g           52.8    4e-05   
emb|CDX85325.1|  BnaC07g26360D                                        53.9    4e-05   
ref|XP_009632025.1|  PREDICTED: uncharacterized protein LOC104121679  52.0    4e-05   
ref|XP_002465028.1|  hypothetical protein SORBIDRAFT_01g030730        52.4    4e-05   
emb|CDP05138.1|  unnamed protein product                              52.8    4e-05   
ref|XP_006351639.1|  PREDICTED: high mobility group nucleosome-bi...  52.4    4e-05   
ref|XP_004145901.1|  PREDICTED: uncharacterized protein LOC101215695  52.0    4e-05   
ref|XP_009625095.1|  PREDICTED: uncharacterized protein LOC104116030  52.4    4e-05   
ref|XP_007143476.1|  hypothetical protein PHAVU_007G075100g           52.0    4e-05   
ref|XP_011038420.1|  PREDICTED: uncharacterized protein LOC105135...  52.0    4e-05   
ref|XP_004160362.1|  PREDICTED: uncharacterized protein LOC101225301  52.0    4e-05   
ref|NP_001065011.1|  Os10g0506100                                     52.0    4e-05   
ref|XP_006660482.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  52.8    4e-05   
ref|XP_008794190.1|  PREDICTED: uncharacterized protein LOC103710302  51.2    4e-05   
ref|XP_004496520.1|  PREDICTED: uncharacterized protein LOC101510144  52.0    4e-05   
gb|KDO64068.1|  hypothetical protein CISIN_1g0009451mg                54.7    4e-05   
ref|XP_004983835.1|  PREDICTED: glutamic acid-rich protein-like       52.0    4e-05   
ref|XP_010644661.1|  PREDICTED: uncharacterized protein LOC100264...  51.6    4e-05   
ref|XP_010909580.1|  PREDICTED: microtubule-associated protein 1B...  51.2    4e-05   
ref|XP_004982665.1|  PREDICTED: UPF0329 protein ECU05_1680/ECU11_...  51.2    4e-05   
gb|ABA40464.1|  unknown                                               52.0    5e-05   
ref|XP_006649256.1|  PREDICTED: nucleolar protein 58-like isoform X2  51.2    5e-05   
ref|XP_004978067.1|  PREDICTED: uncharacterized protein LOC101771574  51.6    5e-05   
gb|ABK23619.1|  unknown                                               51.6    5e-05   
ref|XP_003592192.1|  hypothetical protein MTR_1g099810                51.6    5e-05   
gb|KDP45151.1|  hypothetical protein JCGZ_15016                       51.6    5e-05   
gb|KEH26285.1|  heavy metal-associated domain protein                 51.6    5e-05   
ref|XP_003619372.1|  hypothetical protein MTR_6g051680                51.2    5e-05   
ref|XP_009791152.1|  PREDICTED: putative late blight resistance p...  51.6    5e-05   
ref|XP_003549023.1|  PREDICTED: uncharacterized protein LOC100800537  51.2    6e-05   
tpg|DAA37389.1|  TPA: hypothetical protein ZEAMMB73_588334            51.2    6e-05   
ref|XP_002533038.1|  metal ion binding protein, putative              51.2    6e-05   
ref|XP_006373565.1|  hypothetical protein POPTR_0016s00440g           50.4    6e-05   
gb|KEH43672.1|  heavy metal transport/detoxification superfamily ...  51.2    6e-05   
gb|EAY86456.1|  hypothetical protein OsI_07838                        51.2    6e-05   
ref|XP_002448002.1|  hypothetical protein SORBIDRAFT_06g019520        50.8    6e-05   
ref|XP_008363364.1|  PREDICTED: uncharacterized protein LOC103427075  51.2    6e-05   
ref|NP_001275225.1|  uncharacterized protein LOC102577570             51.6    6e-05   
ref|XP_007139783.1|  hypothetical protein PHAVU_008G058500g           52.0    6e-05   
gb|ABK23861.1|  unknown                                               51.2    6e-05   
ref|XP_010934499.1|  PREDICTED: uncharacterized protein LOC105054633  51.2    6e-05   
gb|EAZ25325.1|  hypothetical protein OsJ_09136                        50.8    6e-05   
emb|CBI33095.3|  unnamed protein product                              54.3    7e-05   
ref|NP_001047265.1|  Os02g0585200                                     51.2    7e-05   
ref|XP_010036113.1|  PREDICTED: uncharacterized protein LOC104425192  50.8    7e-05   
ref|XP_009621979.1|  PREDICTED: nucleolar protein 9-like              50.8    7e-05   
ref|XP_004969029.1|  PREDICTED: tyrosine-protein kinase JAK2-like...  53.9    7e-05   
ref|XP_010644660.1|  PREDICTED: uncharacterized protein LOC100257...  50.8    7e-05   
ref|XP_002510790.1|  metal ion binding protein, putative              50.8    7e-05   
gb|KEH26287.1|  heavy metal-associated domain protein                 50.8    7e-05   
ref|XP_010241736.1|  PREDICTED: uncharacterized protein LOC104586261  50.4    7e-05   
gb|ADE80947.1|  NBS-LRR class disease resistance protein              53.9    7e-05   
gb|KHN42453.1|  hypothetical protein glysoja_033921                   50.8    7e-05   
ref|XP_003592187.1|  hypothetical protein MTR_1g099640                51.2    7e-05   
ref|XP_007201520.1|  hypothetical protein PRUPE_ppa015586mg           50.8    8e-05   
ref|XP_004293421.1|  PREDICTED: uncharacterized protein LOC101306992  50.1    8e-05   
ref|XP_010457118.1|  PREDICTED: transcription initiation factor T...  51.6    8e-05   
ref|XP_007135133.1|  hypothetical protein PHAVU_010G103800g           51.2    8e-05   
ref|XP_008238952.1|  PREDICTED: putative late blight resistance p...  50.8    8e-05   
ref|XP_010474748.1|  PREDICTED: transcription initiation factor T...  51.6    9e-05   



>ref|XP_009796821.1| PREDICTED: uncharacterized protein LOC104243344 [Nicotiana sylvestris]
Length=132

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 76/131 (58%), Gaps = 10/131 (8%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            KQK+VI +S+   DQK R+KAFKIAVS  GV+SA+++ E K QLEVVGD +DAV L S L
Sbjct  2    KQKVVIKLSLNGNDQKYRSKAFKIAVSQPGVESAAMRGEEKNQLEVVGDEIDAVTLTSLL  61

Query  538  RKRLGQAELLSVGSAek------keekkdETPKPQSVTITTydpsasyhyaapyqyhayP  377
            RK LGQAEL+SVG A         +   D  P+  +  +  +     Y       Y    
Sbjct  62   RKNLGQAELVSVGPASAAGGENKNKAGSDTKPQASAAAVAQWQTPYYYTLPQYPVYQVRD  121

Query  376  VQDQQPGCSIM  344
              D QPGCSIM
Sbjct  122  SYDHQPGCSIM  132



>ref|XP_006348967.1| PREDICTED: uncharacterized protein LOC102605417 [Solanum tuberosum]
Length=131

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGDVDAVALASQLR  536
            KQK+VI +S+   DQK RTKAFKIAVS SGV+SA+I  + K QLEVVG+VDAVAL   LR
Sbjct  2    KQKVVIRLSLNGNDQKCRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAVALMMLLR  61

Query  535  KRLGQAELLSVGSA  494
            K LGQA+L+SVG A
Sbjct  62   KNLGQADLVSVGPA  75



>ref|XP_009625092.1| PREDICTED: uncharacterized protein LOC104116026 [Nicotiana tomentosiformis]
Length=132

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 77/131 (59%), Gaps = 10/131 (8%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQL  539
            KQK+VI +S+   DQK R+KAFKIAVS  GV+SA+++  EK QLEVVGD +DAV L + L
Sbjct  2    KQKVVIKLSLNGNDQKYRSKAFKIAVSQPGVESAAMKGEEKNQLEVVGDEIDAVTLTNLL  61

Query  538  RKRLGQAELLSVGSA------ekkeekkdETPKPQSVTITTydpsasyhyaapyqyhayP  377
            RK LGQA+L+SVG A       K +   D  P+  +  +T +     Y       Y    
Sbjct  62   RKNLGQAQLVSVGPASTGGGENKDKAGSDTKPQASAAAVTQWQTPYYYTLPQYPVYQVRD  121

Query  376  VQDQQPGCSIM  344
              D QP CSIM
Sbjct  122  SYDDQPVCSIM  132



>ref|XP_002524590.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF37798.1| metal ion binding protein, putative [Ricinus communis]
Length=125

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +SM  QK+R+KA KIAVS+SGV+SAS+   +K Q+EVVGD VDAV LA+ LRK
Sbjct  2    KQKVVIRVSMNGQKSRSKALKIAVSVSGVESASLGGQDKSQIEVVGDGVDAVELATMLRK  61

Query  532  RLGQAELLSV  503
             +G AEL+SV
Sbjct  62   NVGHAELVSV  71



>ref|XP_004243215.1| PREDICTED: uncharacterized protein LOC101251005 [Solanum lycopersicum]
Length=129

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = -3

Query  706  KQKIVIGISMKD--QKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGDVDAVALASQLR  536
            KQK+VI +S+    QK RTKAFKIAVS SGV+SA+I  + K QLEVVG+VDA  L S LR
Sbjct  2    KQKVVIRLSLNGNGQKDRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLR  61

Query  535  KRLGQAELLSVGSA  494
            K LGQA+L+SVG A
Sbjct  62   KNLGQADLVSVGPA  75



>ref|XP_009625093.1| PREDICTED: uncharacterized protein LOC104116027 [Nicotiana tomentosiformis]
Length=128

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGDVDAVALASQLR  536
            KQK+VI +S+   DQK RTKA KIAVS  GV+SA++  E K QLEVVG++DA  L S LR
Sbjct  2    KQKVVIRLSLNGNDQKYRTKALKIAVSQPGVESAAMTGEEKNQLEVVGEIDAADLTSLLR  61

Query  535  KRLGQAELLSVGSA  494
            K LGQAEL+SVG A
Sbjct  62   KNLGQAELVSVGPA  75



>ref|XP_004243216.1| PREDICTED: uncharacterized protein LOC101251303 [Solanum lycopersicum]
Length=127

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGDVDAVALASQLR  536
            KQKIVI +S+   DQK RTKAFKIAVS SGV+SA+I  + K QLEVVG+VDA  L S LR
Sbjct  2    KQKIVIRLSLNGNDQKYRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLR  61

Query  535  KRLGQAELLS  506
            K LG+A+L+S
Sbjct  62   KNLGKADLVS  71



>ref|XP_009793872.1| PREDICTED: uncharacterized protein LOC104240694 [Nicotiana sylvestris]
Length=132

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 76/131 (58%), Gaps = 10/131 (8%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            KQK+VI +S    DQK R+KAFKIAVS  GV+SA+++ + K QLEVVGD +DAV L + L
Sbjct  2    KQKVVIKLSFNGNDQKYRSKAFKIAVSQPGVESAAMRGDGKNQLEVVGDDIDAVTLTNLL  61

Query  538  RKRLGQAELLSVGSAekk------eekkdETPKPQSVTITTydpsasyhyaapyqyhayP  377
            RK L QAEL+SVG A         +   D  P+  +  ++ +     Y Y     Y    
Sbjct  62   RKNLRQAELVSVGPASAAGGGNKDKAGSDTKPQASAAAMSQWQTPYYYTYPQYPVYQVRD  121

Query  376  VQDQQPGCSIM  344
              D QPGCSIM
Sbjct  122  SYDHQPGCSIM  132



>ref|XP_009796820.1| PREDICTED: uncharacterized protein LOC104243343 [Nicotiana sylvestris]
Length=129

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGDVDAVALASQLR  536
            KQK+VI + +   DQK RTKAFKIAVS  GV+SA++   EK QLEVVG++DA  L S LR
Sbjct  2    KQKVVIRLFLNGNDQKYRTKAFKIAVSQPGVESAAMTGQEKNQLEVVGEIDAADLTSLLR  61

Query  535  KRLGQAELLSVGSA  494
            K LGQAEL+SVG A
Sbjct  62   KNLGQAELVSVGPA  75



>ref|XP_006348965.1| PREDICTED: uncharacterized protein LOC102604739 [Solanum tuberosum]
Length=127

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGDVDAVALASQLR  536
            KQK+VI +S+   +QK RTKAFKIAVS SGV+SA+I  + K QLEVVG+VDA  L S LR
Sbjct  2    KQKVVIRLSLNGNNQKYRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAATLTSLLR  61

Query  535  KRLGQAELLS  506
            K LGQA+L+S
Sbjct  62   KNLGQADLVS  71



>ref|XP_006348966.1| PREDICTED: uncharacterized protein LOC102605080 [Solanum tuberosum]
Length=119

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGDVDAVALASQLR  536
            KQK+VI +++   D+K RTKAFKIA S SGV+SA+I  + K QLEVVG+VDAV L S LR
Sbjct  2    KQKVVIRLTLNGNDRKYRTKAFKIAASQSGVESAAITGDGKNQLEVVGEVDAVTLTSLLR  61

Query  535  KRLGQAELLSV  503
            K LG A+L+SV
Sbjct  62   KNLGLADLVSV  72



>gb|EYU41174.1| hypothetical protein MIMGU_mgv1a016413mg [Erythranthe guttata]
Length=123

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVG-DVDAVALASQLRK  533
            K KIV+ +SM D K+RTKA +I+V +SGV+SA++   E+ ++EVVG DVDAV L  QLRK
Sbjct  2    KTKIVVKVSMNDDKSRTKAMQISVGISGVESAALTGQERDRVEVVGDDVDAVELTRQLRK  61

Query  532  RLGQAELLSVGSA  494
             +  AEL+SVG A
Sbjct  62   NVAYAELVSVGEA  74



>gb|EYU33985.1| hypothetical protein MIMGU_mgv1a016390mg [Erythranthe guttata]
 gb|EYU33987.1| hypothetical protein MIMGU_mgv1a016402mg [Erythranthe guttata]
Length=123

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVG-DVDAVALASQLRK  533
            K KIV+ +SM D K+RTKA +I+V +SGV+SA++   E+ ++EVVG DVDAV L  QLRK
Sbjct  2    KTKIVVKVSMNDDKSRTKAMQISVGISGVESAALTGQERDRVEVVGDDVDAVELTRQLRK  61

Query  532  RLGQAELLSVGSA  494
             +  AEL+SVG A
Sbjct  62   NVAYAELVSVGEA  74



>ref|XP_002263660.1| PREDICTED: uncharacterized protein LOC100258045 [Vitis vinifera]
Length=127

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVG-DVDAVALASQLRK  533
            KQK+VI ++M  QK+RTKA KIAV +SGV+SA+++  EK ++EV G ++D VAL   LRK
Sbjct  2    KQKVVIKVAMNGQKSRTKALKIAVGVSGVESAALKGQEKDEIEVTGEEIDVVALTFLLRK  61

Query  532  RLGQAELLSVGSA  494
             +G AE++SVG+A
Sbjct  62   NVGNAEVVSVGAA  74



>emb|CDP06147.1| unnamed protein product [Coffea canephora]
Length=128

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +SM D+K+R KAFK  V  +GV+S ++Q  EK Q+EVVGD +DAV LA+ LRK
Sbjct  2    KQKVVIKLSMNDEKSRKKAFKTVVGHAGVESTALQGKEKDQIEVVGDGIDAVKLATLLRK  61

Query  532  RLGQAELLSV  503
             +G AEL++V
Sbjct  62   NVGYAELVTV  71



>gb|KDP22991.1| hypothetical protein JCGZ_01713 [Jatropha curcas]
Length=123

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM  QK+R+KA KIAV ++GV+SA+++  +K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVSMSSQKSRSKAMKIAVGVAGVESAALRGQDKSQIEVVGDGVDAVKLTTLLRK  61

Query  532  RLGQAELLSV  503
            ++G +EL+SV
Sbjct  62   QIGYSELVSV  71



>ref|XP_004294695.1| PREDICTED: uncharacterized protein LOC101309518 [Fragaria vesca 
subsp. vesca]
Length=127

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQK+VI +S+ D+K+R+KA K AV + GVDSAS+  +K Q+EV G DVD V L + LRK 
Sbjct  2    KQKVVIKLSVHDEKSRSKAMKTAVGVDGVDSASLPMDKDQIEVTGNDVDVVLLTTLLRKT  61

Query  529  LGQAELLSVGS  497
            +  AE++SVG+
Sbjct  62   VKHAEVVSVGA  72



>ref|XP_010107367.1| hypothetical protein L484_006882 [Morus notabilis]
 gb|EXC15618.1| hypothetical protein L484_006882 [Morus notabilis]
Length=132

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQK+VI +S+ D+K+RTKA K AV + GV  A++QA+K Q+EV G+ +D V LA+ LR
Sbjct  1    MTKQKVVIKVSLNDRKSRTKAIKTAVGVDGVTQAALQADKDQIEVTGEGIDVVCLATLLR  60

Query  535  KRLGQAELLSV  503
            K L  AE++SV
Sbjct  61   KSLKYAEVVSV  71



>emb|CDP06148.1| unnamed protein product [Coffea canephora]
Length=128

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +SM D+K+R KAFK  V  +GV+S ++Q  EK Q+EVVGD +DAV LA+ LRK
Sbjct  2    KQKVVIRLSMSDEKSRKKAFKTVVGHAGVESTALQGKEKDQIEVVGDGIDAVKLATLLRK  61

Query  532  RLGQAELLSV  503
             +G AEL++V
Sbjct  62   NVGFAELVTV  71



>gb|KDP22996.1| hypothetical protein JCGZ_01718 [Jatropha curcas]
Length=115

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 2/72 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI ISM  QK+R+KA KIAV ++GV+SA++   +K ++EVVGD VD+V L + LRK
Sbjct  2    KQKIVIKISMSSQKSRSKAMKIAVGVAGVESAALGGQDKSEIEVVGDGVDSVKLTTLLRK  61

Query  532  RLGQAELLSVGS  497
            ++G +ELLSV S
Sbjct  62   QVGYSELLSVSS  73



>ref|XP_010942541.1| PREDICTED: uncharacterized protein LOC105060501 [Elaeis guineensis]
Length=113

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 2/72 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQL  539
            MGKQK+VI +SM D K R+KA KI V L GV SAS+   EK Q+ VVGD +D+ AL  +L
Sbjct  1    MGKQKVVIRLSMVDAKKRSKALKIVVGLDGVTSASVDGNEKDQIVVVGDGIDSFALVRKL  60

Query  538  RKRLGQAELLSV  503
            RKR+  AEL+SV
Sbjct  61   RKRMKYAELVSV  72



>ref|XP_004502101.1| PREDICTED: uncharacterized protein LOC101495677 [Cicer arietinum]
Length=127

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            M KQKIVI +SM ++K+++KA  I V +SGV+ ASI  E K Q+EV G+ VD+V +A  L
Sbjct  1    MAKQKIVIKVSMNNKKSKSKAMTIVVGVSGVEGASIIGESKDQIEVTGEGVDSVKVACLL  60

Query  538  RKRLGQAELLSVG  500
            RK+ G AEL+SVG
Sbjct  61   RKKFGHAELVSVG  73



>gb|KHF99125.1| Fimbrial [Gossypium arboreum]
Length=115

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQ +V+ ++M D+K+R+KA K+ V  SGV+SAS++  +K Q+EV GD VDAV L S+LRK
Sbjct  2    KQTMVVKVTMSDEKSRSKALKVVVGFSGVESASLKGDDKSQIEVTGDGVDAVQLTSRLRK  61

Query  532  RLGQAELLSV  503
             +G AEL+SV
Sbjct  62   SVGHAELVSV  71



>gb|KDP22994.1| hypothetical protein JCGZ_01716 [Jatropha curcas]
Length=119

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 56/70 (80%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM  QK+R+KA KIAV ++GV+SA++   +K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVSMSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVVGDGVDAVKLTTLLRK  61

Query  532  RLGQAELLSV  503
            ++G +EL+SV
Sbjct  62   QVGYSELVSV  71



>ref|XP_003601491.1| ATFP4-like protein [Medicago truncatula]
 gb|AES71742.1| metal ion-binding protein, putative [Medicago truncatula]
Length=115

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            M KQKIVI +SM +QK R+KA  IA  +SGV+  +IQ E K Q+EV G+ +D+V L S L
Sbjct  1    MTKQKIVIKVSMNNQKLRSKAMTIAAGVSGVEGTAIQGENKDQIEVTGEQIDSVRLTSLL  60

Query  538  RKRLGQAELLSVG  500
            RK+   AEL+SVG
Sbjct  61   RKKFCHAELVSVG  73



>ref|XP_002263769.1| PREDICTED: uncharacterized protein LOC100252914 [Vitis vinifera]
 emb|CBI28484.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI ++M  QK+R+KA KIAV +SGV+S + +  E  ++EV+GD +DA  L S LRK
Sbjct  2    KQKVVIKVAMNGQKSRSKAMKIAV-VSGVESVAFKGKEMDEVEVIGDGIDAAVLTSLLRK  60

Query  532  RLGQAELLSVGSA  494
             +G AELLSVGSA
Sbjct  61   NVGHAELLSVGSA  73



>ref|XP_007206533.1| hypothetical protein PRUPE_ppa019605mg [Prunus persica]
 gb|EMJ07732.1| hypothetical protein PRUPE_ppa019605mg [Prunus persica]
Length=115

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIV+ + M   K RTKA KIA +  GV+  SI+ +KG +EV+GD VD+V L S LRK+
Sbjct  2    KQKIVVSVPMHCDKCRTKALKIAAAAHGVNKVSIEVDKGHMEVIGDGVDSVCLTSLLRKK  61

Query  529  LGQAELLSV  503
            LG A ++ V
Sbjct  62   LGFATIVKV  70



>ref|XP_006469401.1| PREDICTED: uncharacterized protein LOC102626749 isoform X2 [Citrus 
sinensis]
Length=124

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRKR  530
            QK+VI ++++  K+R+KA KIAV +SGV+SAS++  +K Q+EV GD +D V L S LRK+
Sbjct  3    QKVVIKLTLEGHKSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKK  62

Query  529  LGQAELLSVGSA  494
            +G AEL+SVG A
Sbjct  63   VGYAELVSVGPA  74



>ref|XP_011032087.1| PREDICTED: uncharacterized protein LOC105131028 isoform X2 [Populus 
euphratica]
 ref|XP_011032089.1| PREDICTED: uncharacterized protein LOC105131029 isoform X2 [Populus 
euphratica]
Length=114

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI ++   QK+R+KA +IAV LSGV+SA +  E K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVTGNGQKSRSKALQIAVGLSGVESAGLGGEDKSQVEVVGDGVDAVQLTNLLRK  61

Query  532  RLGQAELLSV  503
            ++G AEL SV
Sbjct  62   KVGYAELASV  71



>ref|XP_008380030.1| PREDICTED: uncharacterized protein LOC103443026 [Malus domestica]
Length=122

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQK+VI +S+ D++AR KA K AV + GV+SAS Q +K Q+EV+G+ +D V L + LRK 
Sbjct  2    KQKVVIKLSVHDERARAKAMKTAVGVDGVNSASYQQDKNQMEVMGEGIDVVLLTTSLRKN  61

Query  529  LGQAELLSV  503
            L  AE++SV
Sbjct  62   LKYAEVVSV  70



>ref|XP_002266819.2| PREDICTED: uncharacterized protein LOC100242530 [Vitis vinifera]
Length=152

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            K+K+VI ++M  +K+R+K+ K+AV ++GV+SA++Q  EK Q+EV+G+ +DAVAL + LRK
Sbjct  36   KKKMVIKVTMNGEKSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLLRK  95

Query  532  RLGQAELLSV  503
            ++G AEL+SV
Sbjct  96   KVGFAELVSV  105



>ref|XP_006379054.1| hypothetical protein POPTR_0009s05300g [Populus trichocarpa]
 gb|ERP56851.1| hypothetical protein POPTR_0009s05300g [Populus trichocarpa]
Length=118

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI ++    K+RTKA +IAV LSGV+SA +  E K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVTGNGPKSRTKALRIAVGLSGVESARLGGEDKSQIEVVGDGVDAVQLTNLLRK  61

Query  532  RLGQAELLSV  503
            ++G AEL SV
Sbjct  62   KVGYAELASV  71



>ref|XP_006447867.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
 gb|ESR61107.1| hypothetical protein CICLE_v10017001mg [Citrus clementina]
Length=164

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRKR  530
            QK+VI ++++  K+R+KA KIAV +SGV+SAS++  +K Q+EV GD +D V L S LRK+
Sbjct  43   QKVVIKLTLEGHKSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRKK  102

Query  529  LGQAELLSVGSA  494
            +G AEL+SVG A
Sbjct  103  VGYAELVSVGPA  114



>ref|XP_006469400.1| PREDICTED: uncharacterized protein LOC102626749 isoform X1 [Citrus 
sinensis]
Length=145

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            +QK+VI ++++  K+R+KA KIAV +SGV+SAS++  +K Q+EV GD +D V L S LRK
Sbjct  23   QQKVVIKLTLEGHKSRSKALKIAVGVSGVESASLKGDDKSQIEVTGDGMDPVLLTSLLRK  82

Query  532  RLGQAELLSVGSA  494
            ++G AEL+SVG A
Sbjct  83   KVGYAELVSVGPA  95



>ref|XP_009768957.1| PREDICTED: uncharacterized protein LOC104219891 [Nicotiana sylvestris]
Length=125

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 78/125 (62%), Gaps = 5/125 (4%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQL  539
            KQK+VI +SM   DQK+R+KAFKIAVS  GV+SA+IQ  EK QLEV G+ +DAV L   L
Sbjct  2    KQKVVIRLSMNGNDQKSRSKAFKIAVSQPGVESAAIQGGEKNQLEVEGEQIDAVTLTKLL  61

Query  538  RKRLGQAELLSVGSAekkeekkdETPKPQSVTITTydpsasyhyaapyqyhayPVQDQQP  359
            RK+L QAELLSVG  EKK+  K E PK   V +T +      +Y  P           QP
Sbjct  62   RKKLKQAELLSVGPVEKKDGDKKEGPK-MEVAMTQWPSYNYPYYVVPQFSVYEVRDSYQP  120

Query  358  GCSIM  344
             CSIM
Sbjct  121  CCSIM  125



>ref|XP_002313367.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
 gb|EEE87322.2| hypothetical protein POPTR_0009s05280g [Populus trichocarpa]
Length=114

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI ++ K  K+R+KA +IAV LSGV+SA +  E K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVTGKGPKSRSKALQIAVGLSGVESAGLGGEDKSQIEVVGDGVDAVQLTNLLRK  61

Query  532  RLGQAELLSV  503
            ++G AEL SV
Sbjct  62   KVGYAELASV  71



>ref|XP_011032085.1| PREDICTED: uncharacterized protein LOC105131026 [Populus euphratica]
Length=114

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI ++    K+RTKA +IAV LSGV+SA I   +K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVTGNGPKSRTKALQIAVGLSGVESAGIGGQDKSQIEVVGDGVDAVQLTNLLRK  61

Query  532  RLGQAELLSV  503
            ++G AEL SV
Sbjct  62   KVGYAELASV  71



>ref|XP_003589925.1| ATFP4-like protein [Medicago truncatula]
Length=117

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQL  539
            M KQKIVI + M +QK R KA  IAV +SGV+ A+I+ + K Q+EV G ++D+V LAS L
Sbjct  1    MTKQKIVIRVPMNNQKLRNKAMAIAVGVSGVEGATIKGDNKDQIEVTGEEIDSVKLASLL  60

Query  538  RKRLGQAELLSV  503
            RK+ G A+L+S+
Sbjct  61   RKKFGYADLVSI  72



>ref|XP_008794762.1| PREDICTED: uncharacterized protein LOC103710688 [Phoenix dactylifera]
Length=111

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQL  539
            MGKQK+VI + M D K R+KA K  V  +G+ SAS+   EK Q+ VVGD +D V L  +L
Sbjct  1    MGKQKVVIRLGMVDAKQRSKALKTVVGFNGITSASLDGKEKDQIVVVGDGIDPVTLVKKL  60

Query  538  RKRLGQAELLSVGSA  494
            RKR+  AELLSV  A
Sbjct  61   RKRMNYAELLSVAPA  75



>ref|XP_011032086.1| PREDICTED: uncharacterized protein LOC105131028 isoform X1 [Populus 
euphratica]
 ref|XP_011032088.1| PREDICTED: uncharacterized protein LOC105131029 isoform X1 [Populus 
euphratica]
Length=128

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 13/92 (14%)
 Frame = -3

Query  772  FLSLIPYPIFSTLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-  596
            FL LI Y          AK + +QKIVI ++   QK+R+KA +IAV LSGV+SA +  E 
Sbjct  5    FLLLISY----------AK-LWQQKIVIKVTGNGQKSRSKALQIAVGLSGVESAGLGGED  53

Query  595  KGQLEVVGD-VDAVALASQLRKRLGQAELLSV  503
            K Q+EVVGD VDAV L + LRK++G AEL SV
Sbjct  54   KSQVEVVGDGVDAVQLTNLLRKKVGYAELASV  85



>ref|NP_001150530.1| heavy metal-associated domain containing protein [Zea mays]
 gb|ACF85248.1| unknown [Zea mays]
 gb|ACG39424.1| heavy metal-associated domain containing protein [Zea mays]
 tpg|DAA60837.1| TPA: heavy metal-associated domain containing protein [Zea mays]
Length=167

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            MGKQKIV+ + + D++ R KAFK AV ++GV SA+++ +K  + VVGD VD + L + LR
Sbjct  1    MGKQKIVLKLPLDDERKRRKAFKAAVGMNGVTSATMEGDK--ITVVGDGVDPITLTTILR  58

Query  535  KRLGQAELLSVGSA  494
            + LG AELLSV S 
Sbjct  59   RSLGYAELLSVSSG  72



>ref|XP_008218909.1| PREDICTED: uncharacterized protein LOC103319169 [Prunus mume]
Length=104

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIV+ + +K +K RTKA KIA    GV   SI+ EK  +EV+GD VDAV LA  L+K+
Sbjct  2    KQKIVMKVQLKSEKCRTKALKIAAVAKGVSKVSIEVEKEHVEVIGDGVDAVDLAKSLKKK  61

Query  529  LGQAELLSVGS  497
            LG A ++SV  
Sbjct  62   LGYATIVSVAE  72



>ref|XP_007207854.1| hypothetical protein PRUPE_ppa022793mg [Prunus persica]
 gb|EMJ09053.1| hypothetical protein PRUPE_ppa022793mg [Prunus persica]
Length=104

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIV+ + +K +K RTKA KIA    GV   SI+ EK  +EV+GD VDAV LA  L+K+
Sbjct  2    KQKIVMKVQLKSEKCRTKALKIAAVAKGVSKVSIEMEKEHVEVIGDGVDAVDLAKSLKKK  61

Query  529  LGQAELLSV  503
            LG A ++SV
Sbjct  62   LGYATIVSV  70



>ref|XP_008342265.1| PREDICTED: uncharacterized protein LOC103405072 [Malus domestica]
Length=117

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQK+VI +S+ D++ R KA K AV ++GV+SAS Q +K Q+EV+G+ VD V L + LRK 
Sbjct  2    KQKVVIKLSVPDERTRAKAMKTAVGVAGVNSASYQHDKEQIEVMGEGVDVVVLTTSLRKS  61

Query  529  LGQAELLSV  503
            L  AE++SV
Sbjct  62   LKYAEVVSV  70



>emb|CBI28485.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 58/70 (83%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            K+K+VI ++M  +K+R+K+ K+AV ++GV+SA++Q  EK Q+EV+G+ +DAVAL + LRK
Sbjct  36   KKKMVIKVTMNGEKSRSKSLKVAVGVAGVESAALQGQEKNQIEVIGEGIDAVALTTLLRK  95

Query  532  RLGQAELLSV  503
            ++G AEL+SV
Sbjct  96   KVGFAELVSV  105



>ref|XP_007217188.1| hypothetical protein PRUPE_ppa013552mg [Prunus persica]
 gb|EMJ18387.1| hypothetical protein PRUPE_ppa013552mg [Prunus persica]
Length=117

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (61%), Gaps = 9/123 (7%)
 Frame = -3

Query  706  KQKIVIGIS-MKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +S + D+K+R KA K AV + GV+SAS+Q +KG +EV GD VD V L + LRK
Sbjct  2    KQKVVIKLSALHDEKSRAKAMKTAVGVDGVNSASLQQDKGLIEVTGDGVDVVLLTTLLRK  61

Query  532  RLGQAELLSVGSAekkeekkdETPKPQSVTITTydpsasyhyaapyqyhayPVQDQQPGC  353
             L  A+++SV S E+K++++++  +P+++                        Q ++PGC
Sbjct  62   SLKHADVVSVNSVEEKKKEEEKKKEPEAII-------QYVMGCPAQYICPPCPQYEEPGC  114

Query  352  SIM  344
            SIM
Sbjct  115  SIM  117



>gb|KDP22993.1| hypothetical protein JCGZ_01715 [Jatropha curcas]
Length=125

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI  S+  QK+R+KA KIAV ++GV+SA++   +K Q+EV+GD VDAV L + LRK
Sbjct  2    KQKIVIKFSLSSQKSRSKAMKIAVGVAGVESAALGGQDKSQIEVIGDGVDAVQLTTLLRK  61

Query  532  RLGQAELLSV  503
             +G +E++SV
Sbjct  62   HVGYSEIMSV  71



>ref|XP_004956437.1| PREDICTED: 5'-3' exoribonuclease 2-like isoform X2 [Setaria italica]
Length=158

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            MGKQKIV+ + + D++ + KAFK AV ++GV SA+++ +K  + VVGD VD + L + LR
Sbjct  1    MGKQKIVLKLPLDDERKKRKAFKAAVGMNGVTSATMEGDK--IIVVGDGVDPITLTTMLR  58

Query  535  KRLGQAELLSVGS  497
            + LG AELLSV S
Sbjct  59   RSLGYAELLSVSS  71



>gb|EYU21092.1| hypothetical protein MIMGU_mgv1a023329mg, partial [Erythranthe 
guttata]
Length=101

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +S+   K R+KA KIAV +SGV+S ++   E+ Q+EVVGD +D+V L  +LRK
Sbjct  2    KQKIVIKMSVHCDKCRSKALKIAVGISGVESVALTGQERDQVEVVGDGIDSVELTRRLRK  61

Query  532  RLGQAELLSVG  500
             +  AEL+SVG
Sbjct  62   NVAHAELVSVG  72



>ref|XP_006387353.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
 gb|ERP46267.1| hypothetical protein POPTR_1183s00200g [Populus trichocarpa]
Length=128

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 13/92 (14%)
 Frame = -3

Query  772  FLSLIPYPIFSTLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-E  596
            FL LI Y          AK++ +QKIVI ++ K  K+R+KA +IAV LSGV+SA +   +
Sbjct  5    FLLLINY----------AKSL-QQKIVIKVTGKGPKSRSKALQIAVGLSGVESAGLGGQD  53

Query  595  KGQLEVVGD-VDAVALASQLRKRLGQAELLSV  503
            K Q+EVVGD VDAV L + LRK++G AEL SV
Sbjct  54   KSQIEVVGDGVDAVQLTNLLRKKVGYAELASV  85



>ref|XP_004243774.1| PREDICTED: uncharacterized protein LOC101249661 [Solanum lycopersicum]
Length=124

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 55/72 (76%), Gaps = 4/72 (6%)
 Frame = -3

Query  706  KQKIVIG--ISMKDQKARTKAFKIAVSLSGVDSASI-QAEKGQLEVVGD-VDAVALASQL  539
            KQ+++I   I   ++K+RTKAFKIAVS  GV+SA+I + E  +LE+VG+ +DAV L + L
Sbjct  2    KQRVIIKLFIDRNNRKSRTKAFKIAVSQPGVESAAIKEGEDFELEIVGEHIDAVVLTNCL  61

Query  538  RKRLGQAELLSV  503
            RK+LG A+LLS+
Sbjct  62   RKKLGHAQLLSM  73



>ref|XP_010942540.1| PREDICTED: uncharacterized protein LOC105060500 [Elaeis guineensis]
Length=112

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ +SM D K R+KA K AV  +GV SA I  +K  +EV GD VD++AL + LR
Sbjct  1    MVKQKIVMKVSMDDSKKRSKALKSAVGSTGVISAKIDGDK--MEVEGDGVDSIALTTTLR  58

Query  535  KRLGQAELLSVGS  497
            KR+G AEL+SV +
Sbjct  59   KRMGYAELVSVAA  71



>ref|XP_006469399.1| PREDICTED: uncharacterized protein LOC102626447 [Citrus sinensis]
Length=127

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEK-GQLEVVGD-VDAVALASQLRK  533
            KQK+VI + M   K+R+KA K+AV  SGV+S +++ +   Q+EV GD VDAVAL + LRK
Sbjct  2    KQKMVIKVYMNKHKSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLRK  61

Query  532  RLGQAELLSV  503
            ++G AE++SV
Sbjct  62   KVGYAEVVSV  71



>ref|XP_002320539.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE98854.2| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=123

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +++   K+R+K+ +IAV  SGV+SA +   +K Q+EVVGD VDAV L ++LRK
Sbjct  4    KQKIVIKVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNRLRK  63

Query  532  RLGQAELLSV  503
            ++G AE++SV
Sbjct  64   KVGYAEIVSV  73



>emb|CBI22645.3| unnamed protein product [Vitis vinifera]
Length=163

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = -3

Query  757  PYPIFSTLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEV  578
            P P+ S+L+F    +M K+KIV+     D K + KA K   S SGV+SAS+  ++ +L V
Sbjct  8    PTPL-SSLTF-SRTSMAKKKIVLKFEFNDDKTKQKAMKNVCSHSGVESASVDMKEKKLTV  65

Query  577  VGDVDAVALASQLRKRLGQAELLSVGSA  494
            VGDVD + +  QLRK L   EL++VGSA
Sbjct  66   VGDVDIIIMVKQLRK-LCHTELVTVGSA  92



>ref|XP_011012621.1| PREDICTED: uncharacterized protein LOC105116833 [Populus euphratica]
Length=121

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +++   K+R+K+ +IAV  SGV+SA +   +K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIMVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRK  61

Query  532  RLGQAELLSV  503
            ++G AEL+SV
Sbjct  62   KVGYAELVSV  71



>ref|XP_011012623.1| PREDICTED: uncharacterized protein LOC105116834 [Populus euphratica]
Length=121

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +++   K+R+K+ +IAV  SGV+SA +   +K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIMVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRK  61

Query  532  RLGQAELLSV  503
            ++G AEL+SV
Sbjct  62   KVGYAELVSV  71



>ref|XP_007049439.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOX93596.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQK+V+ +++   K+R+KA KIAV L+GV+SAS++  +K Q+E+ G+ VD V L S LRK
Sbjct  2    KQKMVVKVTLNGHKSRSKALKIAVGLAGVESASLKGDDKSQIEITGEGVDPVQLTSLLRK  61

Query  532  RLGQAELLSV  503
             +G AEL+SV
Sbjct  62   SVGHAELVSV  71



>ref|XP_009395840.1| PREDICTED: uncharacterized protein LOC103980998 [Musa acuminata 
subsp. malaccensis]
Length=118

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQ++V+ ++M+D K R+KA KIAV L GV SA +  +K  + VVGD VD++ L + LR
Sbjct  1    MVKQEMVMKLTMEDAKKRSKALKIAVGLPGVISAKLDGDK--IVVVGDGVDSIVLTTMLR  58

Query  535  KRLGQAELLSVGSA  494
            K++G  EL+ VGSA
Sbjct  59   KKMGHVELVKVGSA  72



>gb|EEC84223.1| hypothetical protein OsI_30639 [Oryza sativa Indica Group]
Length=173

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ + M  ++ + KAFK AV ++GV SAS+  +K  L V+GD VD +AL + LR
Sbjct  1    MAKQKIVVKMPMDTERKKRKAFKAAVGMTGVTSASLDGDK--LLVIGDGVDPIALTTMLR  58

Query  535  KRLGQAELLSVGS  497
            + LG AELLSV S
Sbjct  59   RSLGHAELLSVSS  71



>ref|XP_007026099.1| Uncharacterized protein TCM_030240 [Theobroma cacao]
 gb|EOY28721.1| Uncharacterized protein TCM_030240 [Theobroma cacao]
Length=663

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQK+V  + M ++K+RTKA KIA SL GV+S +I+ A++ Q+EV GD  DAV L S LRK
Sbjct  2    KQKVVFKVVMNNEKSRTKALKIAASLPGVNSVAIRPADQSQMEVTGDGFDAVRLVSLLRK  61

Query  532  RLGQAELLSV  503
            R+G AE +S+
Sbjct  62   RVGHAEQISI  71



>gb|EYU34048.1| hypothetical protein MIMGU_mgv1a020264mg [Erythranthe guttata]
Length=118

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = -3

Query  679  MKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVG-DVDAVALASQLRKRLGQAELLS  506
            M D K+RTKA +I+V +SGV+SA+I   E+ ++EVVG DVDAV L  QLRK +  AEL+S
Sbjct  1    MNDDKSRTKAMQISVGISGVESAAITGQERDRVEVVGDDVDAVELTRQLRKNVAYAELVS  60

Query  505  VGSA  494
            VG A
Sbjct  61   VGEA  64



>ref|XP_008218899.1| PREDICTED: uncharacterized protein LOC103319162 [Prunus mume]
Length=122

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 67/127 (53%), Gaps = 9/127 (7%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLR  536
            M +QKIV+ + M  +K RT A KIA    GV   SI+AEK Q+EV+G  VD   L   LR
Sbjct  1    MVQQKIVMKLQMNCEKHRTNALKIAAVAKGVSKVSIEAEKEQMEVIGAGVDTTRLTMSLR  60

Query  535  KRLGQAELLSVGSAekkeekkdETPKPQSVTITTydpsasyhyaapyqyhayPVQDQQP-  359
            K+LG A ++SV   +   E++  TP     T T Y  S+  H+      H   V D+ P 
Sbjct  61   KKLGSAAIISVEPVKANAEEEKPTP-----TTTQYWTSSYVHHPRHRSTHYRVVHDESPQ  115

Query  358  --GCSIM  344
               CSIM
Sbjct  116  QINCSIM  122



>gb|ABK96536.1| unknown [Populus trichocarpa x Populus deltoides]
Length=113

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQKIVI + M  +K RTKA KIA +  GV S +++A K Q+ V+G +VD+V LA  LRK+
Sbjct  2    KQKIVIKVHMHCEKCRTKAKKIAATACGVTSVALEAAKDQIVVIGEEVDSVKLAKSLRKK  61

Query  529  LGQAELLSV  503
            +G A L+SV
Sbjct  62   VGHAVLMSV  70



>ref|XP_003577912.1| PREDICTED: uncharacterized protein LOC100824539 isoform X2 [Brachypodium 
distachyon]
Length=143

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ +   D++ R KAFK AV ++GV SA+++ +K  + +VGD +D ++L + LR
Sbjct  1    MVKQKIVLKLQADDERKRRKAFKAAVGIAGVTSATMEGDK--MIIVGDGIDPISLTTMLR  58

Query  535  KRLGQAELLSVGS  497
            +RLG AELLSV S
Sbjct  59   RRLGHAELLSVSS  71



>ref|XP_002299059.1| hypothetical protein POPTR_0001s47250g [Populus trichocarpa]
 gb|EEE83864.1| hypothetical protein POPTR_0001s47250g [Populus trichocarpa]
Length=115

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQKIVI + M  +K RTKA KIA +  GV S +++A K Q+ V+G +VD+V LA  LRK+
Sbjct  2    KQKIVIKVHMHCEKCRTKAKKIAATACGVTSVALEAAKDQIVVIGEEVDSVKLAKSLRKK  61

Query  529  LGQAELLSV  503
            +G A L+SV
Sbjct  62   VGHAVLMSV  70



>ref|XP_003601487.1| hypothetical protein MTR_3g082210 [Medicago truncatula]
Length=115

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -3

Query  712  MGKQKIVIGIS-MKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQ  542
            M KQKIVI +S M   K+R+KA KIAV +SGV+SA+++ + K Q+EV G+ +DA  L   
Sbjct  1    MAKQKIVIKVSIMNSHKSRSKAMKIAVGVSGVESAAVKGDSKDQIEVTGEQIDAAKLTCL  60

Query  541  LRKRLGQAELLSVG  500
            LRK+   A+L+SVG
Sbjct  61   LRKKFCHADLVSVG  74



>gb|EMT28218.1| hypothetical protein F775_20960 [Aegilops tauschii]
Length=204

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ +++ D++ R KAFK AV +SGV SA+++ EK  + +VGD VD + L + LR
Sbjct  1    MVKQKIVLKLALDDERKRRKAFKAAVGMSGVTSAAMEGEK--IIIVGDSVDPITLTTVLR  58

Query  535  KRLGQAELLSVGS  497
            + LG AELLSV S
Sbjct  59   RSLGYAELLSVSS  71



>ref|XP_011009814.1| PREDICTED: uncharacterized protein LOC105114819 [Populus euphratica]
Length=121

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +++   K+R+K+ +IAV  SGV+SA +   +K Q+EVVGD VDAV L + LRK
Sbjct  2    KQKIVIKVTVSGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGDGVDAVELTNCLRK  61

Query  532  RLGQAELLSV  503
            ++G AE++SV
Sbjct  62   KVGYAEIVSV  71



>dbj|BAK01008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ +++ D++ R KAFK AV +SGV SA+++ +K  + +VGD VD + L + LR
Sbjct  1    MVKQKIVLKLALDDERKRRKAFKAAVGMSGVTSATMEGDK--IIIVGDGVDPITLTTMLR  58

Query  535  KRLGQAELLSVGS  497
            + LG AELLSV S
Sbjct  59   RSLGYAELLSVSS  71



>dbj|BAD26132.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD26204.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ43997.1| hypothetical protein OsJ_28619 [Oryza sativa Japonica Group]
Length=176

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ + M  ++ + KAFK AV ++GV SAS+  +K  L V+GD VD +AL + LR
Sbjct  1    MAKQKIVVKMPMDTERKKRKAFKAAVGMTGVTSASLDGDK--LIVIGDGVDPIALTTILR  58

Query  535  KRLGQAELLSVGS  497
            + LG AELLSV S
Sbjct  59   RSLGHAELLSVSS  71



>ref|XP_011039897.1| PREDICTED: uncharacterized protein LOC105136306, partial [Populus 
euphratica]
Length=87

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQKIVI + M  +K RTKA KIA +  GV S +++A K Q+ V+G +VD+V LA  LRK+
Sbjct  2    KQKIVIKVQMHCEKCRTKAKKIAATACGVTSVALEAAKDQIVVIGEEVDSVKLAKSLRKK  61

Query  529  LGQAELLSV  503
            +G A L+SV
Sbjct  62   VGHAVLMSV  70



>ref|XP_009361504.1| PREDICTED: uncharacterized protein LOC103951779 [Pyrus x bretschneideri]
Length=109

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQK+VI +S+ D++ + KA K AV + GV+SAS Q +K Q+EV G+ VD V L + LRK 
Sbjct  2    KQKVVIKLSVHDERTKAKAMKTAVGVDGVNSASYQRDKEQIEVTGEGVDVVVLTTSLRKS  61

Query  529  LGQAELLSV  503
            L  A++LSV
Sbjct  62   LKYADVLSV  70



>ref|XP_011095815.1| PREDICTED: uncharacterized protein LOC105175165 [Sesamum indicum]
Length=113

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIVI ++M   KA++KA KIAV++ GV S S+  +  QL+VVG+ VD+V LA  LRK+
Sbjct  2    KQKIVIKVAMGSDKAKSKAMKIAVAMEGVSSVSVGKDNDQLQVVGEGVDSVCLAKSLRKK  61

Query  529  LGQAELLSV  503
               A+++SV
Sbjct  62   FCFADIVSV  70



>gb|EMS63592.1| hypothetical protein TRIUR3_12405 [Triticum urartu]
Length=168

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M +QKIV+ +++ D++ R KAFK AV +SGV SA+++ EK  + +VGD VD + L + LR
Sbjct  1    MLQQKIVLKLALDDERKRRKAFKAAVGMSGVTSAAMEGEK--IIIVGDGVDPITLTTVLR  58

Query  535  KRLGQAELLSVGS  497
            + LG AELLSV S
Sbjct  59   RSLGYAELLSVSS  71



>gb|EMT28219.1| hypothetical protein F775_25180 [Aegilops tauschii]
Length=112

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ +++ D++ R KAFK AV +SGV SA+++ +K  + +VGD VD + L + LR
Sbjct  1    MVKQKIVLKLALDDERKRRKAFKAAVGMSGVTSATMEGDK--IIIVGDGVDPITLTTMLR  58

Query  535  KRLGQAELLSV  503
            + LG AELLSV
Sbjct  59   RSLGYAELLSV  69



>ref|XP_009339282.1| PREDICTED: uncharacterized protein LOC103931496 [Pyrus x bretschneideri]
Length=112

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIV+ + +  +K RTKA KIA    GV + SI+AEK  + V+GD VDAV LA  L+K+
Sbjct  2    KQKIVMKVQLSSEKCRTKALKIAAVAKGVSTVSIEAEKEHVVVIGDGVDAVDLAKSLKKK  61

Query  529  LGQAELLSVGSAekkeekkdETPKP  455
            LG   ++SV   +K EEK  E P+P
Sbjct  62   LGSGTIVSVEEVKKPEEKPAELPEP  86



>dbj|BAD17465.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD29339.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ23593.1| hypothetical protein OsJ_07292 [Oryza sativa Japonica Group]
Length=119

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            M KQKIVI ++M   K R+KA  +  S +GVDS ++  + K QL VVGD VD++ L + L
Sbjct  1    MAKQKIVIKMNMASDKCRSKAMALVASTTGVDSVALAGDGKDQLVVVGDGVDSIELTTAL  60

Query  538  RKRLGQAELLSVG  500
            RK++G A L++VG
Sbjct  61   RKKVGHATLMTVG  73



>ref|XP_011095605.1| PREDICTED: uncharacterized protein LOC105175010 isoform X1 [Sesamum 
indicum]
Length=109

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQ+IVI + M+ +K ++KA KIAV + GV+S  +  +K +LEV+G+ VD+V LA  LRK+
Sbjct  2    KQRIVINVPMQSEKGKSKAMKIAVGMQGVNSVIVVKDKDRLEVIGEGVDSVCLAKSLRKK  61

Query  529  LGQAELLSVG  500
               A+++S+G
Sbjct  62   FCFADIVSIG  71



>ref|XP_008809611.1| PREDICTED: uncharacterized protein LOC103721258 [Phoenix dactylifera]
Length=117

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRL  527
            K+++VI + M  +K R+KA ++A S +GVDS  +  EK QL VVG+VD V L   LRK++
Sbjct  2    KKEMVINVQMNCEKCRSKAMQLAAS-AGVDSVKVDGEKSQLVVVGEVDPVILTGNLRKKI  60

Query  526  GQAELLSVGSAekkeekkdETPK  458
            G +E++ V   +K +E K E PK
Sbjct  61   GHSEIVKVADVKKDDETKSEEPK  83



>ref|XP_007208514.1| hypothetical protein PRUPE_ppa026247mg [Prunus persica]
 gb|EMJ09713.1| hypothetical protein PRUPE_ppa026247mg [Prunus persica]
Length=116

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQKI++ + M   K RTKA KIA +  GV   SI+ A+K  +EV+GD VD+V LAS LRK
Sbjct  2    KQKILLSVPMHCDKCRTKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLASLLRK  61

Query  532  RLGQAELLSV  503
            +LG A ++ V
Sbjct  62   KLGFAAIVKV  71



>ref|XP_006375589.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
 gb|ERP53386.1| hypothetical protein POPTR_0014s16960g [Populus trichocarpa]
Length=121

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +++   K+R+K+ +IAV  SGV+SA +   +K Q+EVVG  VDAV L + LRK
Sbjct  2    KQKIVIKVTVNGPKSRSKSLQIAVGFSGVESAGLGGQDKSQIEVVGHGVDAVELTNCLRK  61

Query  532  RLGQAELLSV  503
            ++G AE++SV
Sbjct  62   KVGYAEIVSV  71



>gb|KDO42092.1| hypothetical protein CISIN_1g033335mg [Citrus sinensis]
Length=121

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 50/67 (75%), Gaps = 2/67 (3%)
 Frame = -3

Query  697  IVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEK-GQLEVVGD-VDAVALASQLRKRLG  524
            +VI +SM   K+R+KA K+AV  SGV+S +++ +   Q+EV GD VDAVAL + LRK++G
Sbjct  1    MVIKVSMNKHKSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLRKKVG  60

Query  523  QAELLSV  503
             AE++SV
Sbjct  61   YAEVVSV  67



>ref|XP_010237995.1| PREDICTED: uncharacterized protein LOC100824539 isoform X1 [Brachypodium 
distachyon]
Length=226

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            +  QKIV+ +   D++ R KAFK AV ++GV SA+++ +K  + +VGD +D ++L + LR
Sbjct  84   LPPQKIVLKLQADDERKRRKAFKAAVGIAGVTSATMEGDK--MIIVGDGIDPISLTTMLR  141

Query  535  KRLGQAELLSVGS  497
            +RLG AELLSV S
Sbjct  142  RRLGHAELLSVSS  154



>ref|XP_010246562.1| PREDICTED: uncharacterized protein LOC104589819 [Nelumbo nucifera]
Length=116

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQL  539
            M KQKIV+ +S++  K R+KA +  V +SGV++A++Q  +K Q+ V+G+ +D++ L + L
Sbjct  1    MAKQKIVVKVSLQSAKDRSKAMRTVVGVSGVETAALQGDDKNQIAVIGEGIDSIELTTSL  60

Query  538  RKRLGQAELLSVG  500
            RK+ G A+LL+VG
Sbjct  61   RKKFGYADLLTVG  73



>ref|XP_011095818.1| PREDICTED: uncharacterized protein LOC105175168 [Sesamum indicum]
Length=119

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIVI ++M   KA++KA KIAV++ GV S S+  +  QL+VVG+ VD+V LA  LRK+
Sbjct  2    KQKIVIKVAMGSDKAKSKAMKIAVAMEGVSSVSVGKDNDQLQVVGEGVDSVCLAKSLRKK  61

Query  529  LGQAELLSV  503
               A+++SV
Sbjct  62   FCFADIVSV  70



>gb|EMS63591.1| hypothetical protein TRIUR3_12404 [Triticum urartu]
Length=187

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 3/71 (4%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            +QKIV+ +++ D++ R KAFK AV +SGV SA+++ +K  + +VGD VD + L + LR+ 
Sbjct  15   QQKIVLKLALDDERKRRKAFKAAVGMSGVTSATMEGDK--IIIVGDGVDPITLTTMLRRS  72

Query  529  LGQAELLSVGS  497
            LG AELLSV S
Sbjct  73   LGYAELLSVSS  83



>ref|XP_007208673.1| hypothetical protein PRUPE_ppa023968mg [Prunus persica]
 gb|EMJ09872.1| hypothetical protein PRUPE_ppa023968mg [Prunus persica]
Length=107

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLR  536
            MG QKIVI + +  Q  RTKA KIA    GV + SI  EK  +EV+G  VDAV+LA  L 
Sbjct  1    MG-QKIVIKVQLTSQNCRTKALKIAAEAKGVSNVSIDVEKAVVEVIGIGVDAVSLAQSLE  59

Query  535  KRLGQAELLSVG  500
            K+LG A ++SVG
Sbjct  60   KQLGFASIVSVG  71



>ref|XP_008809608.1| PREDICTED: uncharacterized protein LOC103721256 [Phoenix dactylifera]
Length=117

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRL  527
            K+++VI + M ++K+R+KA ++A S +GVDS  +  EK QL VVG+VD V L + LRK++
Sbjct  2    KKEMVINVQMHNEKSRSKAMQLAAS-AGVDSVKVDGEKNQLVVVGEVDPVILTAILRKKI  60

Query  526  GQAELLSVGS  497
            G ++++ V  
Sbjct  61   GHSDIVKVAD  70



>ref|NP_001151460.1| ATFP4 [Zea mays]
 gb|ACG42942.1| ATFP4 [Zea mays]
Length=133

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQKIVI +SM  Q++RTKA  +A   +GV S +I  EK  LEVVG DVD V LAS LR++
Sbjct  2    KQKIVIKVSMPCQRSRTKAMTLAAGANGVISVAIAGEK--LEVVGDDVDPVRLASCLRRK  59

Query  529  LGQAELLSV  503
            +G A++L V
Sbjct  60   VGHADILHV  68



>ref|XP_003601492.1| ATFP4 [Medicago truncatula]
Length=220

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            +QKIVI + M +QK R KA  IAV +SGV+  +I+ + K Q+EV G ++D+V LAS LRK
Sbjct  106  QQKIVIRVPMNNQKLRNKAMAIAVGVSGVEGTTIKGDNKDQIEVTGEEIDSVKLASLLRK  165

Query  532  RLGQAELLSV  503
            + G A+L+S+
Sbjct  166  KFGYADLVSI  175



>ref|XP_007216846.1| hypothetical protein PRUPE_ppa022086mg [Prunus persica]
 gb|EMJ18045.1| hypothetical protein PRUPE_ppa022086mg [Prunus persica]
Length=119

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = -3

Query  700  KIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKRLG  524
            ++VI +S+ D+K+R KA K AV + GV+SAS+Q +K  +EV G+ +D V L +QLRK L 
Sbjct  2    QVVIKLSVHDEKSRAKAMKAAVGVDGVNSASLQQDKDLIEVTGEGIDVVLLTNQLRKSLK  61

Query  523  QAELLSVG  500
             AE++SV 
Sbjct  62   YAEVVSVN  69



>ref|NP_001053041.1| Os04g0469000 [Oryza sativa Japonica Group]
 emb|CAE06007.3| OSJNBa0016O02.17 [Oryza sativa Japonica Group]
 dbj|BAF14955.1| Os04g0469000 [Oryza sativa Japonica Group]
 emb|CAH67375.1| OSIGBa0128P10.9 [Oryza sativa Indica Group]
 emb|CAH67424.1| OSIGBa0150F01.4 [Oryza sativa Indica Group]
 gb|EAY94479.1| hypothetical protein OsI_16249 [Oryza sativa Indica Group]
 gb|EAZ31037.1| hypothetical protein OsJ_15120 [Oryza sativa Japonica Group]
 dbj|BAG88453.1| unnamed protein product [Oryza sativa Japonica Group]
Length=122

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM  +K+R+KA K+ V  SGV S  +  + K +L+VVGD VDA  L + LRK
Sbjct  2    KQKIVIKVSMPCEKSRSKAMKLVVMASGVSSVEVTGDGKDRLQVVGDGVDAACLVTCLRK  61

Query  532  RLGQAELL  509
            ++G AEL+
Sbjct  62   KIGHAELV  69



>ref|XP_003572271.1| PREDICTED: uncharacterized protein LOC100826249 [Brachypodium 
distachyon]
Length=167

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 52/74 (70%), Gaps = 3/74 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ +++ D++ R KAFK AV  +GV SA+++ +K  + +VGD VD + L + LR
Sbjct  1    MVKQKIVLRLALDDERKRRKAFKAAVGTTGVTSATLEGDK--IIIVGDGVDPITLTTMLR  58

Query  535  KRLGQAELLSVGSA  494
            + LG AELLSV S 
Sbjct  59   RGLGYAELLSVSSG  72



>dbj|BAJ88821.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=170

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKI + +++ D++ R KAFK AV +SGV SA+++ +K  + +VGD VD + L + LR
Sbjct  1    MVKQKIALKLALDDERERRKAFKAAVGMSGVTSATMEGDK--IIIVGDGVDPITLTTMLR  58

Query  535  KRLGQAELLSVGS  497
              LG AELLSV S
Sbjct  59   CSLGYAELLSVSS  71



>gb|EYU27493.1| hypothetical protein MIMGU_mgv1a016643mg [Erythranthe guttata]
Length=113

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIVI + M+  K ++KA +IAV++ GV S SI  E  ++EV+G+ VD+V LA  LRK+
Sbjct  2    KQKIVIKVPMQSDKDKSKAMQIAVTMQGVSSVSIGKEGDRIEVIGEGVDSVCLAKSLRKK  61

Query  529  LGQAELLSVG  500
               A+++SVG
Sbjct  62   FCFADIVSVG  71



>gb|AAO63778.1| unknown [Populus tremuloides]
Length=132

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D+KA+TKA K   SLSGVDS S+  +  +L V+GDVD V + S+LRK L 
Sbjct  2    KKAVLKLDLHDEKAKTKAMKKVSSLSGVDSISMDMKDKKLTVIGDVDPVHIVSKLRK-LC  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   NTEIITVGPA  70



>ref|XP_008794753.1| PREDICTED: uncharacterized protein LOC103710677 [Phoenix dactylifera]
Length=113

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ ++M+D K R+KA K AV   GV SAS+  +K  +E  GD +D++AL + LR
Sbjct  1    MVKQKIVMKVTMEDSKKRSKALKSAVGSPGVISASVDGDKIVVE--GDGIDSIALTTTLR  58

Query  535  KRLGQAELLSVGS  497
            KR+G  EL+SV +
Sbjct  59   KRMGYVELVSVAA  71



>ref|XP_006447868.1| hypothetical protein CICLE_v10018068mg [Citrus clementina]
 gb|ESR61108.1| hypothetical protein CICLE_v10018068mg [Citrus clementina]
Length=123

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 49/67 (73%), Gaps = 2/67 (3%)
 Frame = -3

Query  697  IVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEK-GQLEVVGD-VDAVALASQLRKRLG  524
            +VI + M   K+R+KA K+AV  SGV+S +++ +   Q+EV GD VDAVAL + LRK++G
Sbjct  1    MVIKVYMNKHKSRSKALKVAVGFSGVESVALKGDDMSQIEVTGDGVDAVALTTSLRKKVG  60

Query  523  QAELLSV  503
             AE++SV
Sbjct  61   YAEVVSV  67



>ref|XP_008218443.1| PREDICTED: uncharacterized protein LOC103318786 [Prunus mume]
Length=116

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQK+V+ + M+  K R KA KIA +  GV   SI+ A+K  +EV+GD VD+V L S LRK
Sbjct  2    KQKLVVSVPMRCDKCRNKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLTSLLRK  61

Query  532  RLGQAELLSV  503
            +LG A ++ V
Sbjct  62   KLGFATIVKV  71



>tpg|DAA37388.1| TPA: ATFP4 [Zea mays]
Length=136

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQKIVI +SM  +++RTKA  +A   +GV S +I  EK  LEVVG DVD V LAS LR++
Sbjct  2    KQKIVIKVSMPCERSRTKAMTLAAGANGVISVAIAGEK--LEVVGDDVDPVRLASCLRRK  59

Query  529  LGQAELLSV  503
            +G A++L V
Sbjct  60   VGHADILQV  68



>ref|XP_006447866.1| hypothetical protein CICLE_v10017259mg [Citrus clementina]
 gb|ESR61106.1| hypothetical protein CICLE_v10017259mg [Citrus clementina]
Length=108

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = -3

Query  781  FQIFLSLIPYPIFSTLSFYPAKTMG--KQKIVIGISMKDQKARTKAFKIAVSLSGVDSAS  608
            F IF     + +F++ S  P+K +   KQK+VI +S++  K+R+KA KIAV +SGV+S +
Sbjct  2    FTIFFKRACF-LFASSS--PSKQLKPMKQKVVIKLSLEGHKSRSKALKIAVRVSGVESVA  58

Query  607  IQA-EKGQLEVVGD-VDAVALASQLRKRLGQAELLSV  503
            ++  ++ Q+EV GD +D V L S LRK +  AELL+V
Sbjct  59   LKGDDRSQIEVTGDGMDPVLLTSLLRKTMRFAELLTV  95



>ref|XP_006422046.1| hypothetical protein CICLE_v10006246mg [Citrus clementina]
 ref|XP_006490624.1| PREDICTED: uncharacterized protein LOC102626260 [Citrus sinensis]
 gb|ESR35286.1| hypothetical protein CICLE_v10006246mg [Citrus clementina]
 gb|KDO56810.1| hypothetical protein CISIN_1g033568mg [Citrus sinensis]
Length=116

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V  + + D+KARTK  K  V L+GVD+AS+  ++ +L V+GD+D V+L S+L K+L 
Sbjct  2    KKAVFKVGVDDKKARTKVLKTMVGLAGVDTASMDEKEKKLTVIGDIDLVSLVSKL-KKLC  60

Query  523  QAELLSVGSA  494
             AE++SVG A
Sbjct  61   HAEIVSVGPA  70



>ref|XP_004956436.1| PREDICTED: 5'-3' exoribonuclease 2-like isoform X1 [Setaria italica]
Length=173

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 3/71 (4%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            +QKIV+ + + D++ + KAFK AV ++GV SA+++ +K  + VVGD VD + L + LR+ 
Sbjct  18   QQKIVLKLPLDDERKKRKAFKAAVGMNGVTSATMEGDK--IIVVGDGVDPITLTTMLRRS  75

Query  529  LGQAELLSVGS  497
            LG AELLSV S
Sbjct  76   LGYAELLSVSS  86



>gb|KDP22988.1| hypothetical protein JCGZ_01710 [Jatropha curcas]
Length=134

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASI-QAEKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI + M   K+R+KA +IAV + GV+SA++ + +K QLEV+G+ VD V L + LRK
Sbjct  2    KQKMVIRVCMNGDKSRSKALQIAVGIYGVESAALGEKDKNQLEVIGEGVDPVKLTASLRK  61

Query  532  RLGQAELLSV  503
            ++ +  LLS 
Sbjct  62   KMAKPNLLSC  71



>ref|XP_002305267.1| hypothetical protein POPTR_0004s07140g [Populus trichocarpa]
 gb|ABK95093.1| unknown [Populus trichocarpa]
 gb|EEE85778.1| hypothetical protein POPTR_0004s07140g [Populus trichocarpa]
Length=132

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D+KA+TKA K   SLSGVDS S+  +  +L V+GDVD V + S+LRK L 
Sbjct  2    KKAVLKLDLHDEKAKTKAMKKVSSLSGVDSISMDMKDKKLTVIGDVDPVDIVSKLRK-LC  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   NTEIITVGPA  70



>ref|XP_010542497.1| PREDICTED: uncharacterized protein LOC104815685 [Tarenaya hassleriana]
Length=136

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQ-KARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRK  533
            +Q+IV+ ++M D  K+R+KA KIA   SGV S SIQ E  QL V+G ++D V L  +LRK
Sbjct  2    RQRIVLKVAMTDSPKSRSKAMKIASGTSGVRSVSIQGENDQLVVLGEEIDTVELTRELRK  61

Query  532  RLGQAELLSVGSA  494
            ++G A++++V +A
Sbjct  62   KVGHAKIVTVQAA  74



>ref|XP_009339286.1| PREDICTED: uncharacterized protein LOC103931499 [Pyrus x bretschneideri]
Length=112

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIV+ + +  +K RTKA KIA    G  + SI+ EK  + V+GD +DAV LA  L+K+
Sbjct  2    KQKIVMKVQLNSEKCRTKALKIAAVAKGASTVSIEVEKEHVVVIGDGIDAVDLAKSLKKK  61

Query  529  LGQAELLSVGSAekkeekkdETPKP  455
            LG   ++SV   +K EEK  E P+P
Sbjct  62   LGSGTIVSVEEVKKPEEKPAEQPEP  86



>ref|XP_011035351.1| PREDICTED: FK506-binding protein 4-like isoform X1 [Populus euphratica]
Length=129

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D KA+TKA K   SLSGVDS S+  +  +L V+GDVD V + S+LRK L 
Sbjct  2    KKAVLKLDLHDDKAKTKAMKKVSSLSGVDSISMDMKDKKLTVIGDVDPVHIVSKLRK-LC  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   NTEIITVGPA  70



>emb|CDY07985.1| BnaC03g35380D [Brassica napus]
Length=174

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            +QKI+I ISM D K R KA K AV   GV  A I+ + + Q+EV G +VD + L + LRK
Sbjct  45   QQKILIRISMTDDKTRAKAMKTAVQFQGVLGAEIKGDHRNQIEVTGVEVDMICLTNTLRK  104

Query  532  RLGQAELLSVGSAekkeekkdETPKP  455
            ++  AEL+SV   E  +  +++ P+P
Sbjct  105  KVAFAELVSVNKVEPPKTPEEKKPEP  130



>ref|XP_009134984.1| PREDICTED: uncharacterized protein LOC103859232 isoform X2 [Brassica 
rapa]
Length=131

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI+I ISM D K R KA K AV   GV  A I+ + + Q+EV G +VD + L + LRK
Sbjct  2    KQKILIRISMTDDKTRAKAMKTAVQFQGVLGAEIKGDHRNQIEVTGVEVDMICLTNTLRK  61

Query  532  RLGQAELLSVG  500
            ++  AEL+SV 
Sbjct  62   KVAFAELVSVN  72



>gb|EMT24129.1| hypothetical protein F775_26351 [Aegilops tauschii]
Length=171

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ + +  ++ R KAFK AV ++GV SA+++ +K  + +VGD VD +AL + LR
Sbjct  1    MVKQKIVLKLPLDGERNRRKAFKAAVGMAGVTSATLEGDK--IIIVGDGVDPIALTTMLR  58

Query  535  KRLGQAELLSVGSA  494
            + LG+AEL+S+ S 
Sbjct  59   RSLGKAELVSISSG  72



>ref|XP_004296129.1| PREDICTED: uncharacterized protein LOC101294055 [Fragaria vesca 
subsp. vesca]
Length=126

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = -3

Query  769  LSLIPYPIFSTLS---FYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA  599
            L+L  + +FS  S    + + +  KQKIVI +    +K +T+AFK+A    GV + S++A
Sbjct  2    LNLGSWDLFSCCSDSSVHCSASSVKQKIVIKVQFSSEKRKTEAFKVAAGFRGVSNVSVEA  61

Query  598  EKGQLEVVG-DVDAVALASQLRKRLGQAELLS  506
            +K Q+ V+G  +D+V LA  LRK+L  A ++S
Sbjct  62   DKDQVVVIGVGIDSVCLAKSLRKKLSYAVIVS  93



>ref|XP_008794752.1| PREDICTED: uncharacterized protein LOC103710676 [Phoenix dactylifera]
Length=113

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            M KQKIV+ ++M+D + R+KA + AV   GV SAS+  +K  +E  GD +D VAL + LR
Sbjct  1    MVKQKIVMKVTMEDSRKRSKALRSAVGSPGVISASVDGDKIVVE--GDGIDPVALTATLR  58

Query  535  KRLGQAELLSVGS  497
            KR+G  EL+SV +
Sbjct  59   KRMGYVELVSVAA  71



>ref|XP_008803071.1| PREDICTED: uncharacterized protein LOC103716727 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008803072.1| PREDICTED: uncharacterized protein LOC103716727 isoform X2 [Phoenix 
dactylifera]
Length=121

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRL  527
            K+KIV+ + + D KA+TKA     SL G+DS +I   + +L V GDVD V +   LRKR 
Sbjct  5    KKKIVLKLYLHDDKAKTKAMARVSSLQGIDSLAIDMNEQKLTVTGDVDPVDVVRNLRKRW  64

Query  526  GQAELLSVGSA  494
              AE+LSVG A
Sbjct  65   -YAEILSVGPA  74



>ref|XP_004294919.1| PREDICTED: uncharacterized protein LOC101303978 [Fragaria vesca 
subsp. vesca]
Length=107

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQKIV+ +    QK RT A KIA   +GV + SI+A+K Q+ V+GD VD+V L   LRK+
Sbjct  2    KQKIVMKVQFSCQKRRTDALKIAAGTTGVSNVSIEADKDQIVVIGDGVDSVCLVKSLRKK  61

Query  529  LGQAELLS  506
            L   E++S
Sbjct  62   LRYVEIVS  69



>ref|XP_006439474.1| hypothetical protein CICLE_v10022806mg [Citrus clementina]
 gb|ESR52714.1| hypothetical protein CICLE_v10022806mg [Citrus clementina]
Length=135

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D KA+ KA K   S+SG++S +I  +  +L VVGDVD + +  +LRK+  
Sbjct  2    KKVVLKLDLHDDKAKQKAMKAVSSISGIESIAIDMKDNKLTVVGDVDPIDVVKKLRKKQW  61

Query  523  QAELLSVGSA  494
             AE+L+VG A
Sbjct  62   YAEILTVGPA  71



>ref|XP_008809609.1| PREDICTED: uncharacterized protein LOC103721257 isoform X1 [Phoenix 
dactylifera]
Length=117

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRL  527
            K+++VI + M  +K R+KA ++A S  GVDS  +  EK QL VVG+ D V L   LRK++
Sbjct  2    KKEMVINVQMNCEKCRSKAMQLAASAGGVDSVKVDGEKNQLVVVGEADPVILTGILRKKI  61

Query  526  GQAELLSV  503
            G + ++ V
Sbjct  62   GHSVIVKV  69



>ref|XP_003594348.1| hypothetical protein MTR_2g027600 [Medicago truncatula]
 gb|ABN08867.1| Heavy metal transport/detoxification protein [Medicago truncatula]
 gb|AES64599.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=77

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIV+ + M+ QK RTKA ++    +GV+   ++  EK ++ V+GD VDAV L   LRK
Sbjct  2    KQKIVMRVHMRCQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRK  61

Query  532  RLGQAELLSVGS  497
            ++GQ E++S+G 
Sbjct  62   KVGQTEIVSLGE  73



>emb|CDX74037.1| BnaA03g30100D [Brassica napus]
Length=168

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 10/95 (11%)
 Frame = -3

Query  778  QIFLSLIPYPIFSTLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA  599
            Q F S IP   FS           +QKI+I ISM D K R KA K AV   GV  A I+ 
Sbjct  23   QKFTSNIPSNWFSNRV--------QQKILIRISMTDDKTRAKAMKTAVQFQGVLGAEIKG  74

Query  598  E-KGQLEVVG-DVDAVALASQLRKRLGQAELLSVG  500
            + + Q+EV G +VD + L + LRK++  AEL+SV 
Sbjct  75   DHRNQIEVTGVEVDMICLTNTLRKKVAFAELVSVN  109



>ref|XP_009803996.1| PREDICTED: uncharacterized protein LOC104249299 [Nicotiana sylvestris]
Length=119

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 50/72 (69%), Gaps = 11/72 (15%)
 Frame = -3

Query  706  KQKIVIGISM--KDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLR  536
            KQK+VI + M   DQ+ARTKAFKIA S  GV      +E  +LEV+G+ +DAV   + LR
Sbjct  2    KQKVVIKLYMDRNDQRARTKAFKIAASQPGV------SENYELEVLGEQIDAV--INSLR  53

Query  535  KRLGQAELLSVG  500
            K+LGQA+ +SVG
Sbjct  54   KKLGQAQPVSVG  65



>ref|XP_009124284.1| PREDICTED: early nodulin-75-like [Brassica rapa]
Length=172

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI+I ++M D KAR KA K AV   GV +  I+ + + Q+EV G +VD + L + LR+
Sbjct  2    KQKILIRVTMTDDKARAKAMKTAVKFKGVSAVEIKGDHRNQIEVTGVEVDMIGLTNTLRR  61

Query  532  RLGQAELLSVG  500
            ++  AEL+SV 
Sbjct  62   KVACAELVSVN  72



>ref|XP_002268731.1| PREDICTED: uncharacterized protein LOC100255094 [Vitis vinifera]
Length=124

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
 Frame = -3

Query  706  KQKIVIGISMK-DQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLR  536
            KQK+VI + M  ++K R+KA + AV + GV+S +++ E K Q+ V+GD VD+V L   LR
Sbjct  2    KQKMVIRVPMNGEKKCRSKAMQTAVGVPGVESIALEGEDKNQIVVIGDSVDSVNLTCLLR  61

Query  535  KRLGQAELLSV  503
            K+ G AELLSV
Sbjct  62   KKFGSAELLSV  72



>ref|XP_011015695.1| PREDICTED: uncharacterized protein LOC105119269, partial [Populus 
euphratica]
Length=131

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            QK V+ + + D+KA+ KA KI   LSGVD+ SI  +  ++ V GD+D V + ++LRK L 
Sbjct  10   QKAVLKVELHDEKAKKKAMKIVSGLSGVDTVSIDMKDKKMTVTGDIDPVCIVAKLRK-LC  68

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  69   CTEIVTVGPA  78



>ref|NP_001062737.1| Os09g0272000 [Oryza sativa Japonica Group]
 dbj|BAF24651.1| Os09g0272000, partial [Oryza sativa Japonica Group]
Length=173

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = -3

Query  700  KIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKRLG  524
            KIV+ + M  ++ + KAFK AV ++GV SAS+  +K  L V+GD VD +AL + LR+ LG
Sbjct  2    KIVVKMPMDTERKKRKAFKAAVGMTGVTSASLDGDK--LIVIGDGVDPIALTTILRRSLG  59

Query  523  QAELLSVGS  497
             AELLSV S
Sbjct  60   HAELLSVSS  68



>ref|XP_010279042.1| PREDICTED: FK506-binding protein 4-like [Nelumbo nucifera]
Length=131

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ +++ D KA+ KA K   +L G+DS S+  ++ +L VVGDVD V + S+LRK L 
Sbjct  2    KKVVLKLNLHDDKAKQKAMKAVSTLQGIDSISVDMKENKLTVVGDVDPVQIVSKLRK-LS  60

Query  523  QAELLSVG  500
             A+++SVG
Sbjct  61   YADIVSVG  68



>gb|KDP25385.1| hypothetical protein JCGZ_20541 [Jatropha curcas]
Length=170

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = -3

Query  754  YPIFSTLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVV  575
            YP    LS +  +T   +K+V+ +++ D KA+ KA K   SLSG+DS +I  + G+L V+
Sbjct  33   YPQLDDLSIH-VETF--KKVVLKLNLHDDKAKQKAMKAVSSLSGIDSIAIDMKDGKLTVI  89

Query  574  GDVDAVALASQLRKRLGQAELLSVGSA  494
            G VD V + S+LRK     E+L+VG A
Sbjct  90   GAVDPVEVVSKLRKGW-HTEILTVGPA  115



>gb|AES76597.2| hypothetical protein MTR_6g082180 [Medicago truncatula]
Length=187

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 2/69 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM ++K RTKA K A  + GV S S++  +K ++ V GD VD V LA+QL+K
Sbjct  2    KQKIVIKLSMDNEKCRTKALKTAAEVKGVTSVSLEGDDKDRVCVTGDNVDIVCLANQLKK  61

Query  532  RLGQAELLS  506
            +     +L+
Sbjct  62   KFNNVTILT  70



>ref|XP_010036115.1| PREDICTED: uncharacterized protein LOC104425195 [Eucalyptus grandis]
 gb|KCW47635.1| hypothetical protein EUGRSUZ_K01377 [Eucalyptus grandis]
Length=129

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 10/78 (13%)
 Frame = -3

Query  706  KQKIVIGISMKDQKAR----------TKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAV  557
            KQK+VI +SMKD   R          +KA K+A    GV S ++  ++ ++EV GDVDAV
Sbjct  2    KQKVVINVSMKDHATRFFCFSPRNPHSKALKLAGGFQGVQSVALVGDQDRIEVTGDVDAV  61

Query  556  ALASQLRKRLGQAELLSV  503
             L + LRK++G A++++V
Sbjct  62   NLTTLLRKKVGFAKIVTV  79



>ref|XP_009134983.1| PREDICTED: uncharacterized protein LOC103859232 isoform X1 [Brassica 
rapa]
Length=138

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            +QKI+I ISM D K R KA K AV   GV  A I+ + + Q+EV G +VD + L + LRK
Sbjct  9    QQKILIRISMTDDKTRAKAMKTAVQFQGVLGAEIKGDHRNQIEVTGVEVDMICLTNTLRK  68

Query  532  RLGQAELLSVG  500
            ++  AEL+SV 
Sbjct  69   KVAFAELVSVN  79



>ref|XP_007206826.1| hypothetical protein PRUPE_ppa026184mg [Prunus persica]
 gb|EMJ08025.1| hypothetical protein PRUPE_ppa026184mg [Prunus persica]
Length=114

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQKI++ + M   K RTKA KIA S  GV   SI+ A +  +EV+GD VD+V L   LRK
Sbjct  2    KQKILVKVQMHCDKCRTKALKIAASAYGVSKVSIEGANRDHVEVIGDGVDSVCLTELLRK  61

Query  532  RLGQAELLSV  503
            +LG A ++ V
Sbjct  62   KLGFAAIVKV  71



>gb|KEH21133.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=127

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +KIV+ + + D KA+ KA K   SLSG+DS ++  ++ +L VVGD+D V + S+LRK   
Sbjct  2    KKIVVKLDLHDDKAKQKAMKSVSSLSGIDSIAMDMKEKKLTVVGDIDPVDVVSKLRKTW-  60

Query  523  QAELLSVGSA  494
              E+L+VG A
Sbjct  61   HTEILTVGPA  70



>ref|XP_006476499.1| PREDICTED: putative late blight resistance protein homolog R1B-19-like 
[Citrus sinensis]
Length=135

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D KA+ KA K   S+SG++S +I  +  +L VVGDVD + +  +LRK+  
Sbjct  2    KKVVLKLDLHDDKAKQKAMKAVSSISGIESIAIDTKDNKLTVVGDVDPIDVVKKLRKKQW  61

Query  523  QAELLSVGSA  494
              E+L+VG A
Sbjct  62   YPEILTVGPA  71



>ref|XP_002865298.1| hypothetical protein ARALYDRAFT_917047 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41557.1| hypothetical protein ARALYDRAFT_917047 [Arabidopsis lyrata subsp. 
lyrata]
Length=86

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI++ ++M D K R KA K AV   GV++  I+ + + Q+EV G +VD +AL + LRK
Sbjct  2    KQKILLRVAMTDDKTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLRK  61

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  62   KVAFAELVSV  71



>ref|XP_004975911.1| PREDICTED: uncharacterized protein LOC101766713 [Setaria italica]
Length=188

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM  +K+R+KA ++     GV S  +    K QLEVVGD VD V L   LRK
Sbjct  78   KQKIVIKVSMSSEKSRSKAMELVARADGVSSMGVTGNGKDQLEVVGDGVDTVCLVKCLRK  137

Query  532  RLGQAELLSV  503
            +LG A++L V
Sbjct  138  KLGHADILKV  147



>ref|XP_007160106.1| hypothetical protein PHAVU_002G292900g [Phaseolus vulgaris]
 gb|ESW32100.1| hypothetical protein PHAVU_002G292900g [Phaseolus vulgaris]
Length=138

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D KA+ KA K   SLSG+DS S+  ++ +L VVGD+D V++ S+LRK   
Sbjct  2    KKVVVKLDLHDDKAKQKAMKSVSSLSGIDSISMDMKEKKLTVVGDIDPVSVVSKLRKSW-  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   HTEIVTVGPA  70



>ref|XP_010671617.1| PREDICTED: uncharacterized protein LOC104888366 [Beta vulgaris 
subsp. vulgaris]
Length=132

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D+K + KA K+A +LSG+DS S+  ++ +L + GD+D VA+ S+LRK + 
Sbjct  2    KKVVLKLDVHDEKCKQKAMKMASTLSGLDSISMDMKEKKLTLTGDIDPVAIVSKLRK-VY  60

Query  523  QAELLSVGSA  494
              E++SVG A
Sbjct  61   HTEIVSVGPA  70



>gb|EMT17916.1| hypothetical protein F775_42527 [Aegilops tauschii]
Length=127

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM   K+R+KA  +A   +GV S  I  + + QLEVVGD VD V L S LRK
Sbjct  2    KQKIVIQLSMSCDKSRSKALTLAARAAGVTSMGITGDGRDQLEVVGDGVDPVCLVSCLRK  61

Query  532  RLGQAELL  509
            +LG A+++
Sbjct  62   KLGHAQII  69



>ref|XP_007020579.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12104.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=155

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM   K RTKA KIA +  GV S  +Q  EK +L +VGD +DA  L   LRK
Sbjct  2    KQKIVIKVSMHCDKCRTKALKIAAAADGVISVELQGPEKDKLMIVGDGIDAACLTWYLRK  61

Query  532  RLGQAEL  512
            +L  A L
Sbjct  62   KLSHASL  68



>ref|XP_011095606.1| PREDICTED: uncharacterized protein LOC105175010 isoform X2 [Sesamum 
indicum]
Length=106

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 50/70 (71%), Gaps = 4/70 (6%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKR  530
            KQ+IVI + M+ +K ++KA KIAV   GV+S  +  +K +LEV+G+ VD+V LA  LRK+
Sbjct  2    KQRIVINVPMQSEKGKSKAMKIAV---GVNSVIVVKDKDRLEVIGEGVDSVCLAKSLRKK  58

Query  529  LGQAELLSVG  500
               A+++S+G
Sbjct  59   FCFADIVSIG  68



>ref|XP_010551977.1| PREDICTED: uncharacterized protein LOC104822446 isoform X1 [Tarenaya 
hassleriana]
Length=152

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKI+I +SM D K R +A   AV  +GV +  I+ + + Q+EV GD VD +AL  +LRK
Sbjct  2    KQKILIRVSMTDDKTRARAMNKAVQFTGVTAVEIKGDHRNQIEVTGDEVDMIALTRKLRK  61

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  62   QVAFAELVSV  71



>gb|EYU21091.1| hypothetical protein MIMGU_mgv1a018053mg [Erythranthe guttata]
Length=123

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = -3

Query  685  ISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRKRLGQAEL  512
            +S+   K R+KA K AV +SGV+S ++   +K Q+E+VGD +D+V L  QLRK +  AEL
Sbjct  1    MSIHSDKCRSKALKNAVGISGVESVTVTGQDKDQVELVGDGIDSVELTRQLRKNVAHAEL  60

Query  511  LSVG  500
            LSVG
Sbjct  61   LSVG  64



>ref|XP_010251773.1| PREDICTED: uncharacterized protein LOC104593570 [Nelumbo nucifera]
Length=134

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 2/67 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQK+VI + +   K+RTK  KIAV + GV+SAS+Q E K Q+ V G+ +D++ L   LRK
Sbjct  2    KQKVVIKVPVNGSKSRTKNHKIAVGIQGVESASLQGEDKSQIVVEGEWIDSITLTVSLRK  61

Query  532  RLGQAEL  512
             LG AEL
Sbjct  62   SLGSAEL  68



>emb|CAD41036.1| OSJNBa0060P14.7 [Oryza sativa Japonica Group]
 gb|EAY94438.1| hypothetical protein OsI_16209 [Oryza sativa Indica Group]
 gb|EAY94440.1| hypothetical protein OsI_16211 [Oryza sativa Indica Group]
 gb|EAZ31005.1| hypothetical protein OsJ_15087 [Oryza sativa Japonica Group]
Length=119

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            M KQKIVI +SM  +K+R+KA  +    SGV+S  +  + K +L+VVGD VD V L + L
Sbjct  1    MTKQKIVIKVSMPCEKSRSKAMALVARASGVNSMEVTGDGKDRLQVVGDGVDPVCLVACL  60

Query  538  RKRLGQAELLSV  503
            R+++G AE++ V
Sbjct  61   RRKIGYAEIVQV  72



>gb|EMT17914.1| hypothetical protein F775_22425 [Aegilops tauschii]
Length=172

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM   K R+KA  +A   +GV S  I  + + QLEVVGD VD V L S LRK
Sbjct  54   KQKIVIQLSMSCDKRRSKALTLASRAAGVTSMGITGDARDQLEVVGDGVDPVCLVSCLRK  113

Query  532  RLGQAELL  509
            +LG A ++
Sbjct  114  KLGHAHII  121



>ref|XP_006407818.1| hypothetical protein EUTSA_v10021695mg [Eutrema salsugineum]
 gb|ESQ49271.1| hypothetical protein EUTSA_v10021695mg [Eutrema salsugineum]
Length=152

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI+I +SM D   R K  K AV   GV +  I+ + + Q+EV G +VD +AL + LRK
Sbjct  2    KQKILIRVSMTDDSTRAKVMKTAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIALTNTLRK  61

Query  532  RLGQAELLSVG  500
            ++  AEL+SV 
Sbjct  62   KIAPAELVSVN  72



>gb|AFK44478.1| unknown [Lotus japonicus]
Length=140

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D KA+ KA K   SLSG+DS ++  ++ +L VVGD+D V + S+LRK   
Sbjct  2    KKVVVKLDLHDDKAKQKAMKTVSSLSGIDSIAMDMKEKKLTVVGDIDPVDVVSKLRKTW-  60

Query  523  QAELLSVG  500
              E+LSVG
Sbjct  61   HTEILSVG  68



>gb|EMS57369.1| hypothetical protein TRIUR3_01188 [Triticum urartu]
Length=110

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI + M   K+R+KA  +A   +GV S  I  + + QLEVVGD VD+V L S LRK
Sbjct  2    KQKIVIQLGMSCDKSRSKALTMAARAAGVTSMEITGDARDQLEVVGDGVDSVCLVSCLRK  61

Query  532  RLGQAELL  509
            +LG A+++
Sbjct  62   KLGHAQII  69



>gb|KEH15709.1| heavy metal transport/detoxification superfamily protein, partial 
[Medicago truncatula]
Length=75

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRKR  530
            QKIV+ + M+ QK RTKA ++    +GV+   ++  EK ++ V+GD VDAV L   LRK+
Sbjct  1    QKIVMRVHMRCQKCRTKALEVVAGANGVNFVGLEGDEKDKIVVIGDGVDAVTLTKCLRKK  60

Query  529  LGQAELLSVGS  497
            +GQ E++S+G 
Sbjct  61   VGQTEIVSLGE  71



>ref|XP_010251978.1| PREDICTED: uncharacterized protein LOC104593713 [Nelumbo nucifera]
Length=157

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQK+VI + +   K+R KA KIAV + GV+SAS+Q E K Q+ V G+ +D++ LA  LRK
Sbjct  2    KQKVVIKVPVNGSKSRIKALKIAVGIQGVESASLQGEDKSQIVVEGEGIDSITLAVSLRK  61

Query  532  RLGQAEL  512
             LG AEL
Sbjct  62   SLGSAEL  68



>gb|EMT17917.1| hypothetical protein F775_02489 [Aegilops tauschii]
Length=112

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM   K R+KA  +A   +GV S  I  + + QLEVVGD VD+V L S LRK
Sbjct  2    KQKIVIQLSMSCDKRRSKALTLAARAAGVTSMGITGDARDQLEVVGDGVDSVCLVSCLRK  61

Query  532  RLGQAELL  509
            +LG A+++
Sbjct  62   KLGHAQII  69



>gb|EMS57367.1| hypothetical protein TRIUR3_01185 [Triticum urartu]
Length=113

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM   K R+KA  +A   +GV S  I  + + QLEVVGD VD V L S LRK
Sbjct  2    KQKIVIQLSMSCDKRRSKALTLAARAAGVTSMGITGDARDQLEVVGDGVDPVCLVSCLRK  61

Query  532  RLGQAELL  509
            +LG A+++
Sbjct  62   KLGHAQII  69



>ref|NP_187417.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF13078.1|AC009176_5 unknown protein [Arabidopsis thaliana]
 gb|AEE74572.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=157

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI+I I+M D   R KA K AV   GV++  I+ + + Q+EV G +VD +AL + LRK
Sbjct  2    KQKILIRIAMTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLRK  61

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  62   KVAFAELVSV  71



>ref|XP_008234832.1| PREDICTED: FK506-binding protein 4-like [Prunus mume]
Length=127

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D+KA+ KA +    L G+DS S+  +  +L V+GDVD V L S+LRK L 
Sbjct  2    KKVVLKLELYDEKAKKKAMRAVSGLEGLDSISMDMKDKKLTVIGDVDPVNLVSKLRK-LC  60

Query  523  QAELLSVGSA  494
              E++SVG A
Sbjct  61   HTEIVSVGPA  70



>ref|XP_009101379.1| PREDICTED: uncharacterized protein LOC103827613 [Brassica rapa]
Length=115

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (57%), Gaps = 2/99 (2%)
 Frame = -3

Query  793  LNQHFQIFLSLIPYPIFSTLSFYPA-KTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVD  617
            LN    +  +L+   I   LSF P  + M KQ IV+ I M+  K RTKAFKI     GV 
Sbjct  14   LNNPLLVSRALLFSEINHHLSFSPQLQDMAKQTIVLKIRMRCDKCRTKAFKIIAGTFGVM  73

Query  616  SASIQAEKGQLEVVGD-VDAVALASQLRKRLGQAELLSV  503
            S  ++ E+G+L V G+ V+   LA  L K++G+ E++ V
Sbjct  74   SVRLEREQGKLVVEGEQVEIAVLAQTLTKKVGRTEIVHV  112



>ref|XP_009609542.1| PREDICTED: uncharacterized protein LOC104103349 isoform X2 [Nicotiana 
tomentosiformis]
Length=126

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 5/74 (7%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVG-DVDAVALASQL  539
            KQKIVI +     DQK+R+KA KIAVS  GV+SA++Q  E   LEV G  +DAV L   L
Sbjct  2    KQKIVIRLCTNGNDQKSRSKALKIAVSQRGVESAAMQGGENNLLEVEGVQIDAVKLTKLL  61

Query  538  RKRLGQ-AELLSVG  500
            RK+  Q AELLSVG
Sbjct  62   RKKSKQAAELLSVG  75



>ref|XP_008355039.1| PREDICTED: uncharacterized protein LOC103418705 [Malus domestica]
Length=101

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = -3

Query  685  ISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKRLGQAEL  512
            + +  +K RTKA KIA +  GV   +I+AEKG++EV+G+ VDAV LA  L+ +LG A +
Sbjct  3    VQLNSEKCRTKALKIAATTKGVSKVAIEAEKGEVEVIGNGVDAVCLAKSLKNKLGFATI  61



>ref|XP_002448006.1| hypothetical protein SORBIDRAFT_06g019560 [Sorghum bicolor]
 gb|EES12334.1| hypothetical protein SORBIDRAFT_06g019560 [Sorghum bicolor]
Length=111

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKIVI +SM  +K+R+KA  +     GV S  I  + K +LEVVG DVD V L + LRK
Sbjct  2    KQKIVIKVSMSSEKSRSKAMALVARADGVSSMGIVGDGKDRLEVVGVDVDTVCLVTCLRK  61

Query  532  RLGQAELLSVGSAekkeekkdETP-KPQSVTI  440
            +LG A++L V   + K+ ++ + P KP+ V +
Sbjct  62   KLGHADILLVDEVKDKKAEEKKQPEKPKVVEL  93



>ref|XP_010464391.1| PREDICTED: uncharacterized protein LOC104744951 isoform X1 [Camelina 
sativa]
Length=152

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI++ ++M D K R KA K AV   GV++  I+ + + Q+EV G +VD +AL + LRK
Sbjct  2    KQKILLRVAMTDDKTRAKALKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLRK  61

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  62   KVAFAELVSV  71



>gb|KDO41138.1| hypothetical protein CISIN_1g041984mg, partial [Citrus sinensis]
Length=98

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 50/68 (74%), Gaps = 2/68 (3%)
 Frame = -3

Query  700  KIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRKRL  527
            K+VI +S++  K+R+KA KIAV +SGV+S +++  ++ Q+EV GD +D V L S LRK +
Sbjct  23   KVVIKLSLEGHKSRSKALKIAVRVSGVESVALKGDDRSQIEVTGDGMDPVLLTSLLRKTM  82

Query  526  GQAELLSV  503
              AELL+V
Sbjct  83   RFAELLTV  90



>ref|XP_010644659.1| PREDICTED: uncharacterized protein LOC100257941 isoform X1 [Vitis 
vinifera]
Length=113

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQKIV+ + M   K RTKA KIA    GV S +I+ AEK ++ V+GD VD+ +L   LRK
Sbjct  2    KQKIVVKVQMNCDKCRTKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTCCLRK  61

Query  532  RLGQAELLSV  503
            +LG A L+SV
Sbjct  62   KLGYATLVSV  71



>gb|AES60176.2| metal ion-binding protein, putative [Medicago truncatula]
Length=106

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -3

Query  679  MKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRKRLGQAELLS  506
            M +QK R KA  IAV +SGV+ A+I+ + K Q+EV G ++D+V LAS LRK+ G A+L+S
Sbjct  1    MNNQKLRNKAMAIAVGVSGVEGATIKGDNKDQIEVTGEEIDSVKLASLLRKKFGYADLVS  60

Query  505  V  503
            +
Sbjct  61   I  61



>ref|XP_010097269.1| U-box domain-containing protein 4 [Morus notabilis]
 gb|EXB67421.1| U-box domain-containing protein 4 [Morus notabilis]
Length=680

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 56/77 (73%), Gaps = 4/77 (5%)
 Frame = -3

Query  721  AKTMGK-QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD--VDAVA  554
            A+T+ K QK+VI + MK +K R+KA +IAV+  GV S +I+ E K ++EV+G+  VDA  
Sbjct  596  AETLRKTQKVVIEVEMKCKKCRSKALEIAVAKDGVTSVAIKGERKNRIEVIGEGFVDAAG  655

Query  553  LASQLRKRLGQAELLSV  503
            LA  LRK++G A+L+SV
Sbjct  656  LAETLRKKVGFADLVSV  672



>gb|KHN21789.1| hypothetical protein glysoja_027673, partial [Glycine soja]
Length=135

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            QK+V+ + + + K + KA K+   +SGV+S S+  +  +L V+GD+D V +A++LRK L 
Sbjct  1    QKVVLKVEVHEDKIKQKAMKVVSGISGVESVSVDMKDKKLTVIGDIDPVKVAAKLRK-LC  59

Query  523  QAELLSVGSA  494
             AE++SVG A
Sbjct  60   HAEIVSVGPA  69



>ref|XP_009415399.1| PREDICTED: uncharacterized protein LOC103996246 [Musa acuminata 
subsp. malaccensis]
Length=130

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEV-VGD-VDAVALASQLRK  533
            KQKIVI + M   + R+KA K AV   G+++ SI+ E+  L V +G+ VD+VALA  LRK
Sbjct  2    KQKIVIRVQMNCDRCRSKAMKTAVGNHGIETVSIEGEERDLLVIIGERVDSVALACSLRK  61

Query  532  RLGQAELLSV  503
            +L  A++L+V
Sbjct  62   KLHCADILTV  71



>ref|XP_003547302.1| PREDICTED: uncharacterized protein LOC100776617 [Glycine max]
Length=77

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIV+ + M  QK RTKA K+  + SGV+   ++  EK +L V+GD VD V L + LRK
Sbjct  2    KQKIVMKVHMNCQKCRTKALKVVAAASGVNFVGLEGEEKDKLVVIGDEVDPVKLTNSLRK  61

Query  532  RLGQAELLSV  503
            ++G  +++S+
Sbjct  62   KVGHTDIISL  71



>ref|XP_002447998.1| hypothetical protein SORBIDRAFT_06g019490 [Sorghum bicolor]
 gb|EES12326.1| hypothetical protein SORBIDRAFT_06g019490 [Sorghum bicolor]
Length=128

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +SM  +++R+KA  +A    GV S +I  + + +LEVVGD VD V L S LR+
Sbjct  2    KQKMVIKVSMPCERSRSKAMTLAARADGVISMAITGDAREKLEVVGDGVDPVRLVSCLRR  61

Query  532  RLGQAELLSV  503
            ++G AE+L V
Sbjct  62   KVGHAEILQV  71



>gb|AAD09508.1| ATFP4, partial [Arabidopsis thaliana]
Length=179

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI+I I+M D   R KA K AV   GV++  I+ + + Q+EV G +VD +AL + LRK
Sbjct  24   KQKILIRIAMTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLRK  83

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  84   KVAFAELVSV  93



>gb|ABK20952.1| unknown [Picea sitchensis]
 gb|ACN41078.1| unknown [Picea sitchensis]
Length=136

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V   +M+D ++RTKA K AV+  GVDS +   ++G++ VVGD D V LA +LRK   
Sbjct  2    KKMVFKSTMEDDRSRTKAMK-AVAGCGVDSITTDMKEGKITVVGDADPVRLAKKLRKLGY  60

Query  523  QAELLSV  503
            +AELLSV
Sbjct  61   RAELLSV  67



>ref|XP_011046029.1| PREDICTED: uncharacterized protein LOC105140762 isoform X1 [Populus 
euphratica]
Length=131

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRK  533
            M  +K V+ + + D+KA+ KA K    LSGVDS SI  +  +L V+GD+D V + ++LRK
Sbjct  1    MEMKKAVLKLELHDEKAKKKAMKTVSGLSGVDSVSIDMKDKKLTVIGDMDPVHIVAKLRK  60

Query  532  RLGQAELLSVGSA  494
             L   E+ +VG A
Sbjct  61   -LCHTEIATVGPA  72



>ref|XP_006372383.1| hypothetical protein POPTR_0017s01100g [Populus trichocarpa]
 gb|ERP50180.1| hypothetical protein POPTR_0017s01100g [Populus trichocarpa]
Length=125

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRK  533
            M  +K V+ + + D+KA+ KA  I   LSGVDS SI  +  ++ V+GD+D V + ++LRK
Sbjct  1    MEIKKAVLKLELHDKKAKKKAMTIVSGLSGVDSVSIDMKDKKMTVIGDIDPVCIVAKLRK  60

Query  532  RLGQAELLSVGSA  494
              G  E+++VG A
Sbjct  61   LCG-TEIVTVGPA  72



>gb|KHN44736.1| hypothetical protein glysoja_032075 [Glycine soja]
Length=127

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRKR  530
            +KIVI + M++ K R+KA KIA +  GV S +++ E + Q+ V GD +D+V L ++ RK+
Sbjct  2    KKIVIQVHMENDKCRSKALKIAAASQGVHSVALEGESRDQVVVTGDTIDSVCLTNKFRKK  61

Query  529  LGQAELLSVGSA  494
               A L+SV  A
Sbjct  62   FSNATLISVADA  73



>ref|XP_008219472.1| PREDICTED: uncharacterized protein LOC103319678 [Prunus mume]
Length=322

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -3

Query  724  PAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVAL  551
            P+   G QKI++ + M   K RTKA KIA S  GV   SI+ A +  +EV+GD VD+V L
Sbjct  104  PSMYYGVQKILVKVQMHCDKCRTKALKIAASAYGVSKVSIEGANRDHVEVIGDGVDSVCL  163

Query  550  ASQLRKRLGQAELLSV  503
               LRK+LG A ++ V
Sbjct  164  TELLRKKLGFAAIVKV  179


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            +QKI++ + M   K RTKA KIA +  GV   SI+ A+K  +EV+GD VD+V L   LRK
Sbjct  2    QQKILVKVPMHFDKCRTKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLTRLLRK  61

Query  532  RLGQAELLSV  503
            +L  A ++ V
Sbjct  62   KLRSATIVKV  71



>ref|XP_003610793.1| ATFP4 [Medicago truncatula]
 gb|AES93751.1| hypothetical protein MTR_5g007070 [Medicago truncatula]
Length=97

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 14/82 (17%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSL------------SGVDSASIQAE-KGQLEVVGD-V  566
            QKIVI +SM  QK+R+KA   + SL            SGV+SA+I+ + K Q+E+ G+ +
Sbjct  7    QKIVIKVSMNSQKSRSKAMSWSFSLIIKVQTNHVQKYSGVESAAIKGDSKDQIEITGEQI  66

Query  565  DAVALASQLRKRLGQAELLSVG  500
            D+V L   LRK+   AEL+SVG
Sbjct  67   DSVRLTFLLRKKFCHAELVSVG  88



>ref|XP_006301602.1| hypothetical protein CARUB_v10022041mg [Capsella rubella]
 gb|EOA34500.1| hypothetical protein CARUB_v10022041mg [Capsella rubella]
Length=112

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  697  IVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLGQA  518
            +++ + + DQK++ K  KI + L+G+D + I  ++G L V+GDVD VA+ ++LR++ G+A
Sbjct  1    MIVSVGVYDQKSKDKIMKILIGLAGIDFSYIDLKEGTLIVIGDVDPVAIVAKLRRKWGRA  60

Query  517  EL  512
             L
Sbjct  61   NL  62



>gb|ABK21992.1| unknown [Picea sitchensis]
Length=140

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V   +M+D ++RTKA K AV+  GVDS +   ++G++ VVGD D V LA +LRK   
Sbjct  2    KKMVFKSTMEDDRSRTKAMK-AVAGCGVDSITTDMKEGKITVVGDADPVRLAKKLRKLGY  60

Query  523  QAELLSV  503
            +AELLSV
Sbjct  61   RAELLSV  67



>ref|XP_011088106.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=120

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRK  533
            M  +KI + + +  +K +T+  K    L GVD  ++ AEKG L VVG VD V + +Q+RK
Sbjct  1    MSAKKIELKVGIYCEKCKTRVLKAVAKLKGVDEITVNAEKGILTVVGSVDPVCVTTQVRK  60

Query  532  RLGQAELLSVG  500
                AE++SVG
Sbjct  61   AGNYAEIMSVG  71



>ref|XP_010551978.1| PREDICTED: uncharacterized protein LOC104822446 isoform X2 [Tarenaya 
hassleriana]
Length=152

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            +QKI+I +SM D K R +A   AV  +GV +  I+ + + Q+EV GD VD +AL  +LRK
Sbjct  2    QQKILIRVSMTDDKTRARAMNKAVQFTGVTAVEIKGDHRNQIEVTGDEVDMIALTRKLRK  61

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  62   QVAFAELVSV  71



>ref|XP_007020383.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11908.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=114

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRKR  530
            QKIVI +++  +K RTKA KIA +  GV+  +I+ + + +L V+G+ VD+V LA  LRK+
Sbjct  3    QKIVIKVNIHCEKCRTKALKIAATTHGVNEVAIKGKARDELTVIGNEVDSVKLACSLRKK  62

Query  529  LGQAELLSV  503
            L  A ++SV
Sbjct  63   LRNATIVSV  71



>ref|XP_010537144.1| PREDICTED: uncharacterized protein LOC104811951 [Tarenaya hassleriana]
Length=124

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            QK V+G+ + D+K + KA        GV+S S+  +  +L VVGD+D+V +  +LRK + 
Sbjct  2    QKAVLGLELYDEKIKQKALLTVCGFHGVESISVDMKDKKLTVVGDIDSVIIVKKLRK-IC  60

Query  523  QAELLSVGSAekkeekkdETPKPQSVT  443
             A +L+VG A++ E+K D+ P P+  T
Sbjct  61   HATILTVGPAKEPEKKPDKNPAPEGTT  87



>ref|XP_008344748.1| PREDICTED: uncharacterized protein LOC103407626 [Malus domestica]
Length=115

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = -3

Query  700  KIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVG-DVDAVALASQLRKRL  527
            KIV+ + M   K RTKA KIA +  GV   SI+ A K  +EV+G DVD+V L   LRK+L
Sbjct  6    KIVVKVPMHCDKCRTKALKIAAAAHGVSKVSIEGANKDHVEVIGDDVDSVCLTRSLRKKL  65

Query  526  G  524
            G
Sbjct  66   G  66



>gb|KDO64067.1| hypothetical protein CISIN_1g0009451mg [Citrus sinensis]
Length=1125

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -3

Query  739   TLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDA  560
             +LS     T  KQK V+ + +  +KAR KAF I    +GV S     +  ++ V+GD+DA
Sbjct  1018  SLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDA  1077

Query  559   VALASQLRKRLGQAELLSVGSA  494
             V +  +LRK+L   EL+S+G A
Sbjct  1078  VPVVRKLRKQLCATELVSIGPA  1099



>gb|KDO64073.1| hypothetical protein CISIN_1g0009451mg, partial [Citrus sinensis]
Length=947

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -3

Query  739  TLSFYPAKTMGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDA  560
            +LS     T  KQK V+ + +  +KAR KAF I    +GV S     +  ++ V+GD+DA
Sbjct  840  SLSLSSCSTRTKQKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDA  899

Query  559  VALASQLRKRLGQAELLSVGSA  494
            V +  +LRK+L   EL+S+G A
Sbjct  900  VPVVRKLRKQLCATELVSIGPA  921



>gb|EMS57368.1| hypothetical protein TRIUR3_01187 [Triticum urartu]
Length=112

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +S+   K R+KA  +A   +GV S  I  + + QLEVVGD VD V L S LRK
Sbjct  2    KQKIVIQLSLSCDKRRSKALTMAARAAGVTSMEITGDARDQLEVVGDGVDPVCLVSCLRK  61

Query  532  RLGQAELL  509
            +LG A+++
Sbjct  62   KLGHAQII  69



>ref|XP_002447999.1| hypothetical protein SORBIDRAFT_06g019500 [Sorghum bicolor]
 gb|EES12327.1| hypothetical protein SORBIDRAFT_06g019500 [Sorghum bicolor]
Length=133

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQK VI +SM   ++R+KA  +A    GV S  I   +K +LEVVGD VD V L S LR+
Sbjct  2    KQKTVIKVSMPCDRSRSKALTLAARADGVISVEITGGDKDKLEVVGDGVDTVCLVSCLRR  61

Query  532  RLGQAELLSV  503
            +LG A++L V
Sbjct  62   KLGHADILQV  71



>ref|XP_010644663.1| PREDICTED: uncharacterized protein LOC100853541 [Vitis vinifera]
Length=120

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            KQKI++ + M   K RTKA KIA    GV S +I+ AEK ++ V+GD VD+ +L   LRK
Sbjct  2    KQKIIVKVQMNCDKCRTKAMKIAAVEEGVISVAIEGAEKDRVVVIGDGVDSASLTHCLRK  61

Query  532  RLGQAELLSV  503
            +LG A L+SV
Sbjct  62   KLGYATLVSV  71



>ref|XP_002303608.1| hypothetical protein POPTR_0003s13210g [Populus trichocarpa]
 gb|EEE78587.1| hypothetical protein POPTR_0003s13210g [Populus trichocarpa]
Length=149

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D K + KA K    LSG+DS S+  ++ ++ VVGD+D V + S+LRK + 
Sbjct  2    KKVVLKLDLHDDKGKQKAMKAVSRLSGIDSISMDMKEKKMTVVGDIDPVDVVSKLRK-IW  60

Query  523  QAELLSVGSA  494
             AE+L+VG A
Sbjct  61   HAEILTVGPA  70



>ref|XP_008809610.1| PREDICTED: uncharacterized protein LOC103721257 isoform X2 [Phoenix 
dactylifera]
Length=116

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRL  527
            K+++VI + M  +K R+KA ++A S +GVDS  +  EK QL VVG+ D V L   LRK++
Sbjct  2    KKEMVINVQMNCEKCRSKAMQLAAS-AGVDSVKVDGEKNQLVVVGEADPVILTGILRKKI  60

Query  526  GQAELLSVGS  497
            G + ++ V  
Sbjct  61   GHSVIVKVAE  70



>ref|XP_007206993.1| hypothetical protein PRUPE_ppb021408mg [Prunus persica]
 gb|EMJ08192.1| hypothetical protein PRUPE_ppb021408mg [Prunus persica]
Length=123

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVGD-VDAVALASQLRK  533
            +QKI++ + M   K RTKA KIA +  GV   SI+ A+K  +EV+GD VD+V L   LRK
Sbjct  2    QQKILVKVPMHCDKCRTKALKIAAAAHGVSKVSIEGADKDHIEVIGDGVDSVCLTRLLRK  61

Query  532  RLGQAELLSV  503
            +L  A ++ V
Sbjct  62   KLRSATIVKV  71



>ref|XP_010064973.1| PREDICTED: uncharacterized protein LOC104452160 [Eucalyptus grandis]
Length=104

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKR  530
            KQKIVI + M  +KAR+KA KIA    GV S +++ +K  L V+G  VDA +L   LRK+
Sbjct  2    KQKIVIKLCMDCEKARSKAMKIAADAHGVISVAVEIDKSHLVVIGVGVDAASLTGALRKK  61

Query  529  LGQAELLSVG  500
               A ++SV 
Sbjct  62   FSHATIVSVA  71



>ref|XP_009339284.1| PREDICTED: uncharacterized protein LOC103931498 [Pyrus x bretschneideri]
Length=123

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            +QKI++ + M   K RTKA KIA +  GV   S++ E K  LEV+G DVD V L   LRK
Sbjct  2    QQKILVKVQMHCDKCRTKALKIAAAAYGVSKVSLEGENKDHLEVIGDDVDFVCLTRSLRK  61

Query  532  RLG  524
            +LG
Sbjct  62   KLG  64



>ref|XP_007020387.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
 gb|EOY11912.1| Heavy metal transport/detoxification superfamily protein, putative 
[Theobroma cacao]
Length=121

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKIVI + M   K RTKA KIA   +GV S +I   +K Q+ V G+ +D+  L   LRK
Sbjct  2    KQKIVIKVPMHCDKCRTKAMKIAAVANGVSSVAIAGNDKDQVVVTGEGIDSANLTCLLRK  61

Query  532  RLGQAELLSVG  500
            +LG A ++SVG
Sbjct  62   KLGYAAIISVG  72



>emb|CBI22646.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            QKI++ + + D KA+TKA K    L GV S S+  +  ++ V+GDVD V++  +LRK L 
Sbjct  3    QKIILKVEVFDDKAKTKALKNVSCLPGVRSISMDMKDKKMTVIGDVDPVSIVGRLRK-LC  61

Query  523  QAELLSVGSA  494
              E+LSVG A
Sbjct  62   HPEILSVGPA  71



>ref|XP_011046030.1| PREDICTED: uncharacterized protein LOC105140762 isoform X2 [Populus 
euphratica]
Length=129

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D+KA+ KA K    LSGVDS SI  +  +L V+GD+D V + ++LRK L 
Sbjct  2    KKAVLKLELHDEKAKKKAMKTVSGLSGVDSVSIDMKDKKLTVIGDMDPVHIVAKLRK-LC  60

Query  523  QAELLSVGSA  494
              E+ +VG A
Sbjct  61   HTEIATVGPA  70



>gb|AES71738.2| metal ion-binding protein, putative [Medicago truncatula]
Length=103

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = -3

Query  679  MKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRKRLGQAELLS  506
            M   K+R+KA KIAV +SGV+SA+++ + K Q+EV G+ +DA  L   LRK+   A+L+S
Sbjct  1    MNSHKSRSKAMKIAVGVSGVESAAVKGDSKDQIEVTGEQIDAAKLTCLLRKKFCHADLVS  60

Query  505  VG  500
            VG
Sbjct  61   VG  62



>gb|EMT17918.1| hypothetical protein F775_02490 [Aegilops tauschii]
Length=183

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI +SM   K+R+KA  +A   +GV S  I  + + +LEVVGD VD V L S LRK
Sbjct  58   KQKIVIQLSMSCDKSRSKALTLAARAAGVTSMGITGDARDKLEVVGDGVDPVCLVSCLRK  117

Query  532  RLGQAELL  509
            +LG A+++
Sbjct  118  KLGHAQII  125



>ref|XP_004503674.1| PREDICTED: uncharacterized protein LOC101514701 [Cicer arietinum]
Length=134

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +KIV+ + + D KA+ KA K   SL+G+DS ++  ++ +L V+GD+D V + S+LRK   
Sbjct  2    RKIVVKLDLHDDKAKQKAMKSVSSLTGIDSIAMDMKEKKLTVIGDIDPVDVVSKLRKTW-  60

Query  523  QAELLSVGSA  494
              ++L+VG A
Sbjct  61   HTDILTVGPA  70



>ref|XP_008353240.1| PREDICTED: uncharacterized protein LOC103416792 [Malus domestica]
Length=111

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = -3

Query  700  KIVIGISMKDQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVG-DVDAVALASQLRKRL  527
            KIV+ + M   K RTKA KIA +  GV   SI+ A K  +EV+G DVD+V L   LRK+L
Sbjct  6    KIVVKVPMHCDKCRTKALKIAAAAHGVSKVSIEGANKDHVEVIGDDVDSVCLTRSLRKKL  65

Query  526  G  524
            G
Sbjct  66   G  66



>ref|XP_010464393.1| PREDICTED: uncharacterized protein LOC104744951 isoform X2 [Camelina 
sativa]
Length=152

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            +QKI++ ++M D K R KA K AV   GV++  I+ + + Q+EV G +VD +AL + LRK
Sbjct  2    QQKILLRVAMTDDKTRAKALKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLRK  61

Query  532  RLGQAELLSVG  500
            ++  AEL+SV 
Sbjct  62   KVAFAELVSVA  72



>gb|KHN14404.1| hypothetical protein glysoja_012442, partial [Glycine soja]
Length=77

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            +QKIV+ + M  QK RTKA K+  + SGV+   ++  EK +L V+GD VD V L + LRK
Sbjct  2    QQKIVMKVHMNCQKCRTKALKVVAAASGVNYVGLEGEEKDKLVVIGDEVDPVKLTNSLRK  61

Query  532  RLGQAELLSV  503
            ++G  +++S+
Sbjct  62   KVGHTDIISL  71



>ref|XP_009609541.1| PREDICTED: uncharacterized protein LOC104103349 isoform X1 [Nicotiana 
tomentosiformis]
Length=131

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 5/74 (7%)
 Frame = -3

Query  706  KQKIVIGISMK--DQKARTKAFKIAVSLSGVDSASIQ-AEKGQLEVVG-DVDAVALASQL  539
            +QKIVI +     DQK+R+KA KIAVS  GV+SA++Q  E   LEV G  +DAV L   L
Sbjct  7    QQKIVIRLCTNGNDQKSRSKALKIAVSQRGVESAAMQGGENNLLEVEGVQIDAVKLTKLL  66

Query  538  RKRLGQ-AELLSVG  500
            RK+  Q AELLSVG
Sbjct  67   RKKSKQAAELLSVG  80



>gb|AES71743.2| hypothetical protein MTR_3g082260 [Medicago truncatula]
Length=106

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -3

Query  679  MKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRKRLGQAELLS  506
            M +QK R KA  IAV +SGV+  +I+ + K Q+EV G ++D+V LAS LRK+ G A+L+S
Sbjct  1    MNNQKLRNKAMAIAVGVSGVEGTTIKGDNKDQIEVTGEEIDSVKLASLLRKKFGYADLVS  60

Query  505  V  503
            +
Sbjct  61   I  61



>ref|XP_008229766.1| PREDICTED: uncharacterized protein LOC103329115 [Prunus mume]
Length=119

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = -3

Query  706  KQKIVIGIS-MKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +S + D+K+R KA K AV + GV+SAS+Q +KG +EV GD VD   L   LRK
Sbjct  2    KQKMVIKLSAVHDEKSRAKAMKTAVGVDGVNSASLQQDKGLIEVTGDGVDVALLTYLLRK  61

Query  532  RLGQA  518
             L  A
Sbjct  62   SLKHA  66



>ref|NP_001238668.1| uncharacterized protein LOC100306170 [Glycine max]
 gb|ACU14223.1| unknown [Glycine max]
Length=136

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + + K + KA K+   +SGV+S S+  +  +L V+GD+D V +A++LRK L 
Sbjct  2    KKVVLKVEVHEDKIKQKAMKVVSGISGVESVSVDMKDKKLTVIGDIDPVKVAAKLRK-LC  60

Query  523  QAELLSVGSA  494
             AE++SVG A
Sbjct  61   HAEIVSVGPA  70



>ref|XP_009391790.1| PREDICTED: uncharacterized protein LOC103977867 [Musa acuminata 
subsp. malaccensis]
Length=124

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI + +   K R+KA ++  S  GVDS +++ E K QL +VGD VD   L   LRK
Sbjct  2    KQKIVIKVQINCNKCRSKAMRLVASAEGVDSVAVEGEDKDQLVLVGDGVDPADLTCTLRK  61

Query  532  RLGQAELLSV  503
            ++G A ++ V
Sbjct  62   KVGHAYIVKV  71



>gb|KCW47638.1| hypothetical protein EUGRSUZ_K01380 [Eucalyptus grandis]
Length=132

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 58/101 (57%), Gaps = 14/101 (14%)
 Frame = -3

Query  706  KQKIVIGISMKD----------QKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAV  557
            KQK+VI +SM D          + +R KA ++A    GV+S      K Q+E+ G+ D+V
Sbjct  2    KQKVVIKVSMNDNTPRFCCFNLRSSRAKALRVAGGFRGVESVKTGDGKDQIEMTGNFDSV  61

Query  556  ALASQLRKRLGQAELLSVGSAekkeekkdETPK----PQSV  446
            AL + LRK++G AE+++V  A+ K  K ++ PK    PQ V
Sbjct  62   ALTNLLRKKVGFAEIIAVSEADAKPSKGEDKPKENKEPQPV  102



>ref|XP_004952918.1| PREDICTED: uncharacterized protein LOC101784893 [Setaria italica]
Length=139

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI + M   + R+KA  +  +  GVDS ++  + + QL VVGD VD++ LAS LRK
Sbjct  2    KQKIVIRVEMTCDRCRSKALSLVAATRGVDSVALAGDARDQLVVVGDGVDSICLASALRK  61

Query  532  RLGQAELLSVGS  497
            ++G AE++ V +
Sbjct  62   KVGPAEIVQVAA  73



>ref|XP_010089046.1| Putative late blight resistance-like protein [Morus notabilis]
 gb|EXB37293.1| Putative late blight resistance-like protein [Morus notabilis]
Length=134

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D KA+ KA K   +L+G+DS S+  ++ +L VVGDVD V + ++LRK   
Sbjct  2    KKVVVKLDLHDDKAKQKALKKVSTLTGIDSISMDMKEKKLTVVGDVDPVEIVNKLRKTWF  61

Query  523  QAELLSVGSA  494
              E++SVG A
Sbjct  62   -TEIVSVGPA  70



>emb|CAN77999.1| hypothetical protein VITISV_002984 [Vitis vinifera]
Length=132

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRK  533
            M  +KI++ + + D KA+ KA K   SL GV S S+  +  +L V+GDVD V + S+LRK
Sbjct  1    MEIKKIILKLEVFDDKAKQKAMKNVSSLPGVTSISVDMKDKKLTVIGDVDPVCIVSKLRK  60

Query  532  RLGQAELLSVGSA  494
               + E+LSVG A
Sbjct  61   -FCRTEILSVGPA  72



>emb|CBI22643.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRK  533
            M  +KI++ + + D KA+ KA K   SL GV S S+  +  +L V+GDVD V + S+LRK
Sbjct  1    MEIKKIILKLEVFDDKAKQKAMKNVSSLPGVTSISVDMKDKKLTVIGDVDPVCIVSKLRK  60

Query  532  RLGQAELLSVGSA  494
               + E+LSVG A
Sbjct  61   -FCRTEILSVGPA  72



>ref|XP_008232983.1| PREDICTED: FK506-binding protein 4 [Prunus mume]
Length=165

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D +A+ KA K   +LSG+DS S+  ++ +L V+G VD V + S+LRK   
Sbjct  2    KKFVLKLDLHDDRAKQKALKTVSTLSGIDSISMDMKEKKLTVIGSVDPVNVVSKLRK-YW  60

Query  523  QAELLSVGSA  494
            Q ++LSVG A
Sbjct  61   QTDILSVGPA  70



>gb|EMT11065.1| hypothetical protein F775_02341 [Aegilops tauschii]
Length=105

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQK+VI + M   K R+KA  +  S+ GV+   IQ  ++ QL VVGD VDA  L + LRK
Sbjct  2    KQKMVIRVQMTCDKCRSKAMGLVASVHGVERVEIQGDDRDQLAVVGDGVDAANLTACLRK  61

Query  532  RLGQAELLSV  503
            ++G A+LL++
Sbjct  62   KIGNADLLTL  71



>ref|XP_004952921.1| PREDICTED: uncharacterized protein LOC101786087 isoform X2 [Setaria 
italica]
Length=125

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQL  539
            M KQKIVI + M   K R+KA  +  S  GVDS ++  + K Q+ VVG+ VD++ L   L
Sbjct  1    MAKQKIVIKVQMSSDKCRSKAMALVASTGGVDSVALAGDGKDQVVVVGEGVDSIKLTEAL  60

Query  538  RKRLGQAELLSVG  500
            RK++G A+L+ VG
Sbjct  61   RKKVGDAQLVQVG  73



>ref|XP_002268343.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI35176.3| unnamed protein product [Vitis vinifera]
Length=109

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +KIV+ +++  QK +    K    L+G++  ++  EKG L VVGDVD V L   +RK   
Sbjct  2    KKIVLKVNIHCQKCKRDVLKAVTKLTGINQVTVDGEKGTLTVVGDVDPVLLTETVRKSGK  61

Query  523  QAELLSVGSA  494
             AE++SVG  
Sbjct  62   VAEIMSVGPP  71



>ref|XP_006652383.1| PREDICTED: uncharacterized protein LOC102714171 [Oryza brachyantha]
Length=115

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            +QKIVI +SM  +K+R+K   +   +SGV S  +  + + +L+VVGD VD V L   LRK
Sbjct  2    QQKIVIKVSMPCEKSRSKGMALVARVSGVSSVEVTGDCRDRLQVVGDGVDPVCLVHCLRK  61

Query  532  RLGQAELLSV  503
            ++G AE++ V
Sbjct  62   KVGHAEIVQV  71



>ref|XP_004492796.1| PREDICTED: FK506-binding protein 4-like [Cicer arietinum]
Length=172

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D KA+ KA K   +LSG+D+ ++  ++ +L VVG VD V++ S+LRK   
Sbjct  2    KKFVLKLDLADDKAKQKALKAVSTLSGIDAITMDMKEKKLTVVGTVDPVSVVSKLRK-YW  60

Query  523  QAELLSVGSA  494
            QA+L+SVG A
Sbjct  61   QADLISVGPA  70



>gb|ABK22997.1| unknown [Picea sitchensis]
Length=141

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V   +M+D ++RTKA K AV+  GVDS +   ++G++ VVG+ D V LA +LRK   
Sbjct  2    KKMVFKSTMEDDRSRTKAMK-AVAECGVDSITTDMKEGKITVVGEADPVRLAKKLRKLGY  60

Query  523  QAELLSV  503
            +AELLSV
Sbjct  61   RAELLSV  67



>emb|CAH67426.1| OSIGBa0150F01.6 [Oryza sativa Indica Group]
Length=132

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQK+VI +SM   K R+KA  +    +GV S  +  + K +L+VVGD VD V + ++LRK
Sbjct  2    KQKMVIKVSMPCGKCRSKAMALVAGATGVSSVEVTGDGKDRLQVVGDGVDPVCVVNRLRK  61

Query  532  RLGQAELLSV  503
            ++G AE++ V
Sbjct  62   KIGHAEIVQV  71



>ref|XP_010928047.1| PREDICTED: uncharacterized protein LOC105049937 [Elaeis guineensis]
Length=120

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            K++IVI + M   K R+KA K+A S  GVDS  I  E K QL V+G+ VD V L   LRK
Sbjct  2    KKQIVIKVQMNCGKCRSKAMKLAASADGVDSIKIDGEDKNQLVVIGEGVDPVILTGILRK  61

Query  532  RLGQAELLSV  503
            ++G +E++ V
Sbjct  62   KMGHSEIVKV  71



>ref|XP_011046033.1| PREDICTED: uncharacterized protein LOC105140764 isoform X3 [Populus 
euphratica]
Length=118

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D+KA+ KA K   SLSGV S S++ ++ +L V+GD+D V + ++LRK L 
Sbjct  2    KKAVLRLDLHDEKAKKKAMKTVSSLSGVHSISMEMKEQKLTVIGDIDPVHIVAKLRK-LC  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   CTEIVTVGPA  70



>ref|XP_002307842.2| hypothetical protein POPTR_0006s00390g [Populus trichocarpa]
 gb|EEE91365.2| hypothetical protein POPTR_0006s00390g [Populus trichocarpa]
Length=77

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQ-LEVVGD-VDAVALASQLRK  533
            KQKIV  + M  ++ R K  K+     GVDS   + E+ + + V+GD VDA  LAS+LRK
Sbjct  4    KQKIVFKVQMNCERCRIKTLKVVSDADGVDSMGFEGERRENVVVIGDGVDAATLASRLRK  63

Query  532  RLGQAELLSVGSA  494
            ++G  E++SV  A
Sbjct  64   KVGHTEIISVALA  76



>gb|KHN21790.1| hypothetical protein glysoja_027674, partial [Glycine soja]
Length=133

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            QK+V+ + + D K + KA K+  +LSGV+S S+  ++ +L ++GD+D V    +LRK L 
Sbjct  1    QKVVLSVELHDDKIKKKAMKVVSNLSGVESVSVDMKEQKLTLIGDIDPVVAVGKLRK-LC  59

Query  523  QAELLSVGSA  494
              +++SVG A
Sbjct  60   HTDIVSVGPA  69



>gb|ADE80955.1| NBS-LRR class disease resistance protein [Oryza sativa Indica 
Group]
 gb|AET36551.1| NBS-LRR class disease resistance protein Pi7-1 [Oryza sativa 
Indica Group]
Length=1142

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -3

Query  727  YPAKTMG-KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAV  557
            +P +  G KQKIVI ++M+    R+KA  +  S  GVDS ++  + + ++EVVG  +D +
Sbjct  180  FPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPI  239

Query  556  ALASQLRKRLGQAELLSVGSA  494
             L S LRK++G AELL V  A
Sbjct  240  KLISALRKKVGDAELLQVSQA  260



>gb|KHM99946.1| Putative late blight resistance protein like R1B-19 [Glycine 
soja]
Length=136

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ +++ D KA+ KA K   SL+G+DS S+  ++ +L VVG++D V + S+LRK   
Sbjct  2    KKVVVKLNLHDDKAKQKAMKSVSSLAGIDSISMDMKEKKLTVVGEIDPVDVVSKLRKTW-  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   HPEIVTVGPA  70



>ref|XP_002276701.1| PREDICTED: FK506-binding protein 4 [Vitis vinifera]
 emb|CBI40403.3| unnamed protein product [Vitis vinifera]
Length=164

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D KA+ KA K   +L G+DS S+  ++ +L ++G VD V + S+LRK   
Sbjct  2    KKLVLKLDLHDDKAKQKALKTVSTLPGIDSISMDMKEKKLTIIGTVDPVNVVSKLRKYWP  61

Query  523  QAELLSVG  500
             A+L++VG
Sbjct  62   TADLVAVG  69



>ref|XP_003616824.1| hypothetical protein MTR_5g084660 [Medicago truncatula]
 gb|AES99782.1| metal ion-binding protein, putative [Medicago truncatula]
Length=134

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD--VDAVALASQLRK  533
            +KIVI + M+  K R+KA KIA +  GV S S++ E + Q+ V+GD  +D V L  +LRK
Sbjct  2    KKIVIQMHMESDKFRSKALKIAAAFQGVISVSLEGESRDQVVVIGDYQIDCVCLTKKLRK  61

Query  532  RLGQAELLSVGSA  494
            +     LLSV  A
Sbjct  62   KFCYVNLLSVEDA  74



>gb|ADE80954.1| NBS-LRR class disease resistance protein [Oryza sativa Indica 
Group]
Length=1142

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -3

Query  727  YPAKTMG-KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAV  557
            +P +  G KQKIVI ++M+    R+KA  +  S  GVDS ++  + + ++EVVG  +D +
Sbjct  180  FPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPI  239

Query  556  ALASQLRKRLGQAELLSVGSA  494
             L S LRK++G AELL V  A
Sbjct  240  KLISALRKKVGDAELLQVSQA  260



>gb|ADE80953.1| NBS-LRR class disease resistance protein [Oryza sativa Japonica 
Group]
 gb|AET36549.1| NBS-LRR class disease resistance protein Pikh-1 [Oryza sativa 
Japonica Group]
Length=1142

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -3

Query  727  YPAKTMG-KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAV  557
            +P +  G KQKIVI ++M+    R+KA  +  S  GVDS ++  + + ++EVVG  +D +
Sbjct  180  FPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPI  239

Query  556  ALASQLRKRLGQAELLSVGSA  494
             L S LRK++G AELL V  A
Sbjct  240  KLISALRKKVGDAELLQVSQA  260



>gb|ADV58352.1| resistance protein Pikp-1 [Oryza sativa Japonica Group]
Length=1142

 Score = 60.1 bits (144),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -3

Query  727  YPAKTMG-KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAV  557
            +P +  G KQKIVI ++M+    R+KA  +  S  GVDS ++  + + ++EVVG  +D +
Sbjct  180  FPLRKTGLKQKIVIKVAMEGNNCRSKAMALVASTGGVDSVALVGDLRDKIEVVGYGIDPI  239

Query  556  ALASQLRKRLGQAELLSVGSA  494
             L S LRK++G AELL V  A
Sbjct  240  KLISALRKKVGDAELLQVSQA  260



>ref|XP_009147052.1| PREDICTED: uncharacterized protein LOC103870652 [Brassica rapa]
Length=163

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI+I ++M D K R KA K A    GV +  I+ + + Q+EV G +V+ + L + LRK
Sbjct  4    KQKILIRVTMTDDKTRAKAMKTAAQFKGVSAVEIKGDHRNQIEVTGVEVNMICLTNTLRK  63

Query  532  RLGQAELLSVG  500
            ++  AEL+SV 
Sbjct  64   KVAFAELVSVN  74



>ref|XP_010036114.1| PREDICTED: uncharacterized protein LOC104425194 [Eucalyptus grandis]
 gb|KCW47633.1| hypothetical protein EUGRSUZ_K01375 [Eucalyptus grandis]
Length=121

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 12/81 (15%)
 Frame = -3

Query  706  KQKIVIGISMK------------DQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVD  563
            KQK+VI +SM              Q   ++A ++A    GV S ++  ++ Q+EV G+VD
Sbjct  2    KQKVVIKVSMNGNGHASSFFCFGPQSPHSRALRLASGFRGVQSVALVGDRDQIEVTGEVD  61

Query  562  AVALASQLRKRLGQAELLSVG  500
            +V L + LRK+ G AE+++VG
Sbjct  62   SVDLTNSLRKKFGSAEIVTVG  82



>gb|ADE80951.1| NBS-LRR class disease resistance protein [Oryza sativa Japonica 
Group]
 dbj|BAL63004.1| NBS-LRR class disease resistance protein [Oryza sativa Japonica 
Group]
 dbj|BAL63005.1| NBS-LRR class disease resistance protein [Oryza sativa Japonica 
Group]
Length=1143

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = -3

Query  724  PAKTMG--KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAV  557
            P + MG   QKIV  I M D K+RTKA  +  S  GV S +I  + + ++ VVGD +D++
Sbjct  181  PLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDEVVVVGDGIDSI  240

Query  556  ALASQLRKRLGQAELLSV  503
             L S LRK++G AELL V
Sbjct  241  NLVSALRKKVGHAELLQV  258



>ref|XP_006372382.1| hypothetical protein POPTR_0017s01090g [Populus trichocarpa]
 gb|ERP50179.1| hypothetical protein POPTR_0017s01090g [Populus trichocarpa]
Length=128

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D+KA+ KA K    LSGVDS SI  +  +L V+G +D V + ++LRK L 
Sbjct  2    KKAVLKLELHDEKAKKKAMKTVSGLSGVDSVSIDMKDKKLTVIGGIDPVHIVTKLRK-LC  60

Query  523  QAELLSVGSA  494
              E+++VG A
Sbjct  61   HTEIVTVGPA  70



>gb|ADZ48537.1| Pik-1 blast resistance protein [Oryza sativa Japonica Group]
Length=1143

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = -3

Query  724  PAKTMG--KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAV  557
            P + MG   QKIV  I M D K+RTKA  +  S  GV S +I  + + ++ VVGD +D++
Sbjct  181  PLRIMGGEMQKIVFKIPMVDDKSRTKAMSLVASTVGVHSVAIAGDLRDEVVVVGDGIDSI  240

Query  556  ALASQLRKRLGQAELLSV  503
             L S LRK++G AELL V
Sbjct  241  NLVSALRKKVGHAELLQV  258



>ref|NP_001053015.1| Os04g0464100 [Oryza sativa Japonica Group]
 dbj|BAF14929.1| Os04g0464100 [Oryza sativa Japonica Group]
 dbj|BAH00062.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            +QKIVI +SM  +K+R+KA  +    SGV+S  +  + K +L+VVGD VD V L + LR+
Sbjct  2    QQKIVIKVSMPCEKSRSKAMALVARASGVNSMEVTGDGKDRLQVVGDGVDPVCLVACLRR  61

Query  532  RLGQAELLSV  503
            ++G AE++ V
Sbjct  62   KIGYAEIVQV  71



>ref|XP_006474799.1| PREDICTED: uncharacterized protein LOC102607832 [Citrus sinensis]
Length=121

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            KQKIVI + M  +K R KA KIAV   GV    I+ E K +L V+G+ VD+V L   LRK
Sbjct  2    KQKIVIKVQMTCKKCRKKAMKIAVKADGVIKVEIKGEGKDELVVIGNEVDSVNLTRSLRK  61

Query  532  RLGQAELLSV  503
             LG A LLSV
Sbjct  62   GLGFASLLSV  71



>emb|CDY22124.1| BnaC01g39770D [Brassica napus]
Length=611

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRKR  530
            QKI+I ++M D KAR KA K AV   GV +  I+ + + Q+EV G +VD + L + LR++
Sbjct  442  QKILIRVTMTDDKARAKAMKTAVKFKGVSAVEIKGDHRNQIEVTGVEVDMIGLTNTLRRK  501

Query  529  LGQAELLSVG  500
            +  AEL+SV 
Sbjct  502  VACAELVSVN  511



>ref|XP_010928046.1| PREDICTED: uncharacterized protein LOC105049936 [Elaeis guineensis]
Length=117

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVGD-VDAVALASQLRK  533
            K++IVI + M   K R+KA ++A S+ GVDS  +  E K QL VVG+ VD V L   LRK
Sbjct  2    KKQIVIKVQMNCDKCRSKAMQLAASVDGVDSIKVDGEDKNQLVVVGEGVDPVILTRILRK  61

Query  532  RLGQAELLSVGS  497
             +G ++++ VG 
Sbjct  62   NIGHSDIVKVGE  73



>ref|XP_010671619.1| PREDICTED: uncharacterized protein LOC104888368 [Beta vulgaris 
subsp. vulgaris]
Length=112

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = -3

Query  703  QKIVIGISMKDQK-ARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRL  527
            QK+V+ + + D K  + KA K+  S++G+DS S+  ++ +L V+GD+D VA+ ++LRK +
Sbjct  2    QKVVLKLDVHDDKNCKKKALKLVSSVTGLDSISMDMKEKKLTVIGDMDPVAVVTKLRK-I  60

Query  526  GQAELLSVGSA  494
               E++SVG A
Sbjct  61   YNTEIVSVGPA  71



>ref|XP_010455734.1| PREDICTED: uncharacterized protein LOC104737261 isoform X1 [Camelina 
sativa]
Length=151

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAE-KGQLEVVG-DVDAVALASQLRK  533
            KQKI++ ++M + K R KA K AV   GV +  I+ + + Q+EV G +VD +AL + LRK
Sbjct  2    KQKILLRVAMTEDKTRAKALKTAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIALINTLRK  61

Query  532  RLGQAELLSV  503
            ++  AEL+SV
Sbjct  62   KVAFAELVSV  71



>gb|ABK25811.1| unknown [Picea sitchensis]
Length=129

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ +S++D+K++ +A +   ++ GV+S ++  +  ++ V+GD D V L  +LRK  G
Sbjct  5    KKMVLRVSIEDEKSKRRAMRTVAAVEGVESVAVDMKDRKITVIGDADPVCLTVKLRK-FG  63

Query  523  QAELLSVGSA  494
              ELLSVG A
Sbjct  64   FTELLSVGPA  73



>gb|AFK37005.1| unknown [Lotus japonicus]
 gb|AFK48228.1| unknown [Lotus japonicus]
Length=165

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K V+ + + D KA+ KA K   +L G+D+ S+  ++ +L VVG VD V + S+LRK   
Sbjct  2    KKFVLKLDLPDDKAKQKALKTVSTLPGIDAISMDMKEKKLTVVGTVDPVTVVSKLRK-YW  60

Query  523  QAELLSVGSA  494
            QA+L+SVG A
Sbjct  61   QADLVSVGPA  70



>ref|XP_008232364.1| PREDICTED: uncharacterized protein LOC103331515 isoform X2 [Prunus 
mume]
Length=121

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            KQKI I   ++  K R+KA KIAV+  GV S + Q   + ++ + GD VDAV +A+ LRK
Sbjct  2    KQKITIEAQIRCDKCRSKAMKIAVAEDGVISVAFQGPNRDKMVITGDGVDAVDMANSLRK  61

Query  532  RLGQAELLSV  503
            +LG A+L+SV
Sbjct  62   KLGYADLVSV  71



>gb|KCW70441.1| hypothetical protein EUGRSUZ_F03666, partial [Eucalyptus grandis]
Length=102

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVG-DVDAVALASQLRKRL  527
            QKIVI + M  +KAR+KA KIA    GV S +++ +K  L V+G  VDA +L   LRK+ 
Sbjct  1    QKIVIKLCMDCEKARSKAMKIAADAHGVISVAVEIDKSHLVVIGVGVDAASLTGALRKKF  60

Query  526  GQAELLSVG  500
              A ++SV 
Sbjct  61   SHATIVSVA  69



>dbj|BAO45868.1| hypothetical protein [Acacia mangium]
Length=120

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            QKIV+ + + D K + KA K    + GV+S  +  ++ ++ V+G +DAV +A +LRK L 
Sbjct  2    QKIVLKVELHDDKIKKKAMKAVSGMPGVESVEVDMKENKMTVIGGIDAVTVAGKLRK-LS  60

Query  523  QAELLSVGS  497
             AE++SVG 
Sbjct  61   HAEIVSVGP  69



>gb|ABK22901.1| unknown [Picea sitchensis]
Length=138

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +KIV+  +M+D++++ +A K AV+  GVDS ++  ++ ++ VVG+VD V L ++LRK   
Sbjct  2    KKIVLKSTMEDERSKRRAMK-AVAGIGVDSIAVDIKEEKITVVGEVDPVWLTTKLRKMGF  60

Query  523  QAELLSVGSAekkeekkdETPK  458
            +AELLSVG A+++++     PK
Sbjct  61   RAELLSVGPAKEEKKSDQGPPK  82



>emb|CDY49337.1| BnaA05g32990D [Brassica napus]
Length=67

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -3

Query  697  IVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGD-VDAVALASQLRKRLGQ  521
            +V+ ++M  +K RTKA KI V  SGV+   ++ E+G+L V G+ VD +ALA  L+K++G+
Sbjct  1    MVLKVNMSSEKYRTKAMKIVVGASGVNGVRLEKEQGKLMVEGEGVDVLALAQTLKKKVGK  60

Query  520  AELLSV  503
             E++ V
Sbjct  61   TEIIKV  66



>ref|XP_009398759.1| PREDICTED: uncharacterized protein LOC103983262 [Musa acuminata 
subsp. malaccensis]
Length=142

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = -3

Query  706  KQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQA-EKGQLEVVGD-VDAVALASQLRK  533
            +QKIVI I++   + R KA K+A S+ GV+S +IQ   + ++ V G+ VD+V L S LR+
Sbjct  2    EQKIVIKINVICDRCRNKALKLASSVRGVESVAIQGRNRNRVVVTGEGVDSVCLTSILRQ  61

Query  532  RLGQAELLSVGSAekkeekkdETPKPQSV  446
            ++G AE++ +  A   E ++ E P  Q V
Sbjct  62   KMGYAEIIGISRASFDEVQECEVPGHQEV  90



>ref|XP_002273341.2| PREDICTED: uncharacterized protein LOC100247478 [Vitis vinifera]
Length=131

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -3

Query  712  MGKQKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRK  533
            M  +KI++ + + D KA+ KA +    L GV S S+  +  +L V+GDVD V + S+LRK
Sbjct  1    METKKIILKLEVFDDKAKRKAMRNVSCLLGVTSISVDMKDKKLTVIGDVDPVCIVSKLRK  60

Query  532  RLGQAELLSVGSA  494
               + E+LSVG A
Sbjct  61   -FCRTEILSVGPA  72



>gb|AFK47311.1| unknown [Lotus japonicus]
Length=131

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -3

Query  703  QKIVIGISMKDQKARTKAFKIAVSLSGVDSASIQAEKGQLEVVGDVDAVALASQLRKRLG  524
            +K+V+ + + D K + KA K    LSGV+S S+  +  ++ ++GD+D V +  +LRK L 
Sbjct  2    KKVVLKVELYDDKIKKKAMKAVSGLSGVESVSVDMKDQKMTLIGDIDPVEVVEKLRK-LC  60

Query  523  QAELLSVGSA  494
             AE+LSVG A
Sbjct  61   HAEILSVGPA  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1499838010448