BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23509_g2_i1 len=612 path=[2444:0-611]

Length=612
                                                                      Score     E

emb|CBI33621.3|  unnamed protein product                              61.6    2e-09   
ref|XP_002284213.1|  PREDICTED: non-specific lipid-transfer prote...  61.6    3e-09   Vitis vinifera
gb|AFP49331.1|  non-specific lipid-transfer protein type 2            58.5    2e-08   
ref|XP_006367504.1|  PREDICTED: probable non-specific lipid-trans...  58.5    3e-08   
gb|AFK45248.1|  unknown                                               58.5    3e-08   
ref|XP_009777694.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    3e-08   
ref|XP_006391441.1|  hypothetical protein EUTSA_v10019362mg           58.5    4e-08   
dbj|BAJ25798.1|  putative non-specific lipid-transfer protein typ...  58.2    4e-08   
ref|XP_008362493.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    5e-08   
ref|XP_009804692.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    5e-08   
ref|XP_008444081.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    6e-08   
ref|XP_009599113.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    6e-08   
ref|XP_003555069.1|  PREDICTED: probable non-specific lipid-trans...  57.8    6e-08   
ref|XP_009346593.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    7e-08   
ref|XP_009781752.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    9e-08   
ref|XP_009626576.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    1e-07   
ref|XP_010528992.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    1e-07   
ref|XP_010528502.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    1e-07   
emb|CDP02751.1|  unnamed protein product                              56.6    1e-07   
ref|XP_009613979.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    2e-07   
gb|AAA33933.1|  lipid transfer protein                                56.2    2e-07   Senecio odorus
ref|XP_008229268.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    3e-07   
ref|XP_006357827.1|  PREDICTED: probable non-specific lipid-trans...  55.8    4e-07   
ref|XP_008229267.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    4e-07   
ref|XP_007139181.1|  hypothetical protein PHAVU_008G008200g           55.5    4e-07   
ref|XP_002305838.1|  hypothetical protein POPTR_0004s09510g           55.5    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007217198.1|  hypothetical protein PRUPE_ppa013890mg           55.5    5e-07   
ref|XP_004234577.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    5e-07   
ref|XP_010279351.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    5e-07   
ref|XP_004232333.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    6e-07   
ref|XP_011035101.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    6e-07   
ref|XP_004154719.1|  PREDICTED: probable non-specific lipid-trans...  55.1    6e-07   
sp|P82353.1|NLTP2_PRUAR  RecName: Full=Non-specific lipid-transfe...  54.3    7e-07   Prunus armeniaca
ref|XP_008444080.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    7e-07   
ref|XP_009386356.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    7e-07   
emb|CDY61300.1|  BnaCnng37660D                                        54.7    8e-07   
ref|XP_006482207.1|  PREDICTED: probable non-specific lipid-trans...  54.7    8e-07   
emb|CDY52889.1|  BnaC06g27820D                                        54.7    9e-07   
ref|XP_006383409.1|  hypothetical protein POPTR_0005s15210g           54.7    9e-07   
ref|XP_011021288.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    1e-06   
ref|NP_198633.1|  bifunctional inhibitor/lipid-transfer protein/s...  54.7    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011097163.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    1e-06   
ref|XP_010062206.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    1e-06   
ref|XP_006654745.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    1e-06   
emb|CDY61301.1|  BnaCnng37670D                                        54.3    1e-06   
gb|ACJ68112.1|  hypothetical protein                                  54.3    1e-06   Brassica napus [oilseed rape]
ref|XP_009110931.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    1e-06   
ref|XP_006589067.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    1e-06   
ref|XP_010108883.1|  hypothetical protein L484_027077                 53.9    1e-06   
ref|XP_002317903.2|  protease inhibitor/seed storage/lipid transf...  53.9    1e-06   Populus trichocarpa [western balsam poplar]
gb|ABK95885.1|  unknown                                               53.9    2e-06   Populus trichocarpa [western balsam poplar]
gb|KEH21557.1|  Nodule Cysteine-Rich (NCR) secreted peptide           53.9    2e-06   
ref|XP_010062205.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-06   
gb|KHN41531.1|  Non-specific lipid-transfer protein 2                 53.9    2e-06   
ref|XP_004299573.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-06   
gb|KDP32977.1|  hypothetical protein JCGZ_13008                       53.9    2e-06   
gb|AAG60123.1|AC073555_7  lipid transfer protein, putative            53.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357787.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    2e-06   
ref|XP_010317725.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    2e-06   
ref|XP_003633726.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    2e-06   
ref|XP_002322068.2|  protease inhibitor/seed storage/lipid transf...  53.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|NP_564532.1|  bifunctional inhibitor/lipid-transfer protein/s...  53.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ABK92836.1|  unknown                                               53.5    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010252340.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    2e-06   
ref|XP_006362367.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    2e-06   
ref|NP_001056241.1|  Os05g0550300                                     53.5    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418081.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-06   
ref|XP_006442592.1|  hypothetical protein CICLE_v10023053mg           53.1    3e-06   
emb|CDY50600.1|  BnaC02g16970D                                        53.1    3e-06   
ref|XP_010317750.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    3e-06   
gb|KFK43095.1|  hypothetical protein AALP_AA1G079200                  53.1    3e-06   
ref|XP_003524566.1|  PREDICTED: probable non-specific lipid-trans...  53.1    3e-06   
gb|KHN27477.1|  Non-specific lipid-transfer protein 2                 53.1    3e-06   
gb|KGN53815.1|  hypothetical protein Csa_4G141230                     53.1    3e-06   
ref|NP_001238401.1|  uncharacterized protein LOC100306409 precursor   53.1    3e-06   
ref|XP_008444077.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-06   
ref|XP_008381283.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-06   
ref|XP_010036906.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-06   
ref|XP_009357786.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-06   
gb|AGC08429.1|  lipid transfer protein                                53.1    3e-06   
ref|XP_002863289.1|  hypothetical protein ARALYDRAFT_333050           53.1    3e-06   
gb|ACG48207.1|  nonspecific lipid-transfer protein precursor          53.1    3e-06   Zea mays [maize]
ref|XP_009105236.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    3e-06   
ref|XP_009127492.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    4e-06   
dbj|BAA25680.1|  Lipid transfer protein                               52.8    4e-06   Brassica rapa
ref|XP_010528993.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    5e-06   
ref|XP_010279350.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    5e-06   
ref|NP_001148293.1|  LOC100281901 precursor                           52.8    5e-06   Zea mays [maize]
ref|XP_002440195.1|  hypothetical protein SORBIDRAFT_09g027590        52.8    5e-06   Sorghum bicolor [broomcorn]
ref|NP_188456.1|  Bifunctional inhibitor/lipid-transfer protein/s...  52.8    5e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KGN63840.1|  hypothetical protein Csa_1G024245                     52.8    5e-06   
emb|CDP02752.1|  unnamed protein product                              52.4    5e-06   
ref|XP_006430726.1|  hypothetical protein CICLE_v10013191mg           52.4    5e-06   
ref|XP_006482208.1|  PREDICTED: probable non-specific lipid-trans...  52.4    6e-06   
emb|CDY51937.1|  BnaAnng11140D                                        52.4    7e-06   
emb|CDX75963.1|  BnaC03g40460D                                        52.0    7e-06   
ref|XP_008240231.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    7e-06   
ref|XP_006430725.1|  hypothetical protein CICLE_v10013188mg           52.0    8e-06   
emb|CDY40472.1|  BnaC09g14300D                                        52.0    8e-06   
ref|XP_007211115.1|  hypothetical protein PRUPE_ppa025024mg           52.0    8e-06   
ref|XP_010528501.1|  PREDICTED: probable non-specific lipid-trans...  52.0    8e-06   
ref|XP_009135573.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    8e-06   
ref|XP_007226001.1|  hypothetical protein PRUPE_ppa013833mg           52.0    9e-06   
emb|CDY15627.1|  BnaA08g29110D                                        52.0    9e-06   
gb|KHN42434.1|  Putative non-specific lipid-transfer protein AKCS9    52.0    9e-06   
ref|XP_007150888.1|  hypothetical protein PHAVU_004G002600g           51.6    9e-06   
ref|XP_007033193.1|  Bifunctional inhibitor/lipid-transfer protei...  52.0    1e-05   
ref|XP_008243280.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    1e-05   
ref|XP_010044111.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    1e-05   
gb|KFK26688.1|  hypothetical protein AALP_AA8G280300                  51.6    1e-05   
ref|XP_008453433.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    1e-05   
ref|XP_002870865.1|  hypothetical protein ARALYDRAFT_916549           51.6    1e-05   
emb|CDY12874.1|  BnaA09g14000D                                        51.6    1e-05   
ref|XP_009113158.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    1e-05   
ref|XP_007142957.1|  hypothetical protein PHAVU_007G031600g           51.2    1e-05   
ref|XP_009148019.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    1e-05   
ref|XP_008810040.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    2e-05   
ref|XP_009128605.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    2e-05   
gb|KFK41090.1|  hypothetical protein AALP_AA2G084400                  51.2    2e-05   
emb|CDM81734.1|  unnamed protein product                              51.2    2e-05   
ref|XP_009107339.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    2e-05   
ref|XP_006406624.1|  hypothetical protein EUTSA_v10021828mg           51.2    2e-05   
ref|XP_004492965.1|  PREDICTED: probable non-specific lipid-trans...  50.8    2e-05   
gb|ACJ68106.1|  hypothetical protein                                  51.2    2e-05   Brassica napus [oilseed rape]
ref|XP_010665172.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    2e-05   
gb|KDP32978.1|  hypothetical protein JCGZ_13009                       51.2    2e-05   
ref|XP_009613748.1|  PREDICTED: non-specific lipid-transfer prote...  50.8    2e-05   
ref|XP_007044235.1|  Bifunctional inhibitor/lipid-transfer protei...  50.8    2e-05   
ref|XP_007152725.1|  hypothetical protein PHAVU_004G154200g           50.8    2e-05   
dbj|BAA06462.1|  TED4                                                 50.8    2e-05   Zinnia violacea [garden zinnia]
emb|CDX77289.1|  BnaC08g03340D                                        50.8    2e-05   
ref|NP_001236829.1|  uncharacterized protein LOC100500614 precursor   50.8    2e-05   
emb|CDX92224.1|  BnaA05g21830D                                        50.8    2e-05   
ref|XP_003552717.1|  PREDICTED: probable non-specific lipid-trans...  50.8    2e-05   
ref|NP_001150566.1|  nonspecific lipid-transfer protein precursor     50.8    3e-05   Zea mays [maize]
ref|XP_010479305.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
ref|XP_009145909.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
ref|XP_003620406.1|  Non-specific lipid-transfer protein              50.4    3e-05   
gb|AFK34114.1|  unknown                                               50.4    3e-05   
ref|XP_010461704.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
ref|XP_009360132.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
ref|XP_010500416.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
emb|CDY16462.1|  BnaA08g03050D                                        50.4    3e-05   
emb|CDX95132.1|  BnaC05g05390D                                        50.4    3e-05   
emb|CDY24453.1|  BnaC05g35010D                                        50.4    3e-05   
ref|XP_008393327.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
ref|XP_006299714.1|  hypothetical protein CARUB_v10015906mg           50.4    3e-05   
ref|XP_010320740.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
ref|NP_001235108.1|  uncharacterized protein LOC100306442 precursor   50.1    3e-05   
gb|EAY79130.1|  hypothetical protein OsI_34237                        50.4    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003567951.1|  PREDICTED: non-specific lipid-transfer prote...  50.4    3e-05   
gb|AAB47967.1|  nonspecific lipid transfer protein                    50.4    3e-05   Hordeum vulgare [barley]
emb|CDX93626.1|  BnaA06g04220D                                        50.4    4e-05   
emb|CDX95131.1|  BnaC05g05400D                                        50.4    4e-05   
ref|XP_004512892.1|  PREDICTED: probable non-specific lipid-trans...  50.1    4e-05   
ref|XP_009418385.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    4e-05   
ref|XP_010926507.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    4e-05   
emb|CDM83892.1|  unnamed protein product                              50.1    4e-05   
emb|CDM81735.1|  unnamed protein product                              50.1    4e-05   
gb|KGN53818.1|  hypothetical protein Csa_4G146250                     50.1    5e-05   
gb|KGN53816.1|  hypothetical protein Csa_4G141240                     50.1    5e-05   
emb|CDP00664.1|  unnamed protein product                              49.7    5e-05   
ref|XP_010317751.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    5e-05   
ref|XP_008460998.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    5e-05   
ref|XP_003567950.1|  PREDICTED: non-specific lipid-transfer prote...  50.1    5e-05   
ref|XP_004137484.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    5e-05   
ref|NP_001275625.1|  probable non-specific lipid-transfer protein...  49.7    5e-05   
gb|KEH44195.1|  Lipid transfer protein                                49.7    5e-05   
gb|AFK37583.1|  unknown                                               49.7    6e-05   
ref|XP_009347476.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    6e-05   
ref|XP_009357223.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    6e-05   
ref|XP_010474155.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    7e-05   
ref|XP_008339633.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    7e-05   
ref|XP_010419026.1|  PREDICTED: non-specific lipid-transfer prote...  49.7    7e-05   
ref|XP_008782311.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    7e-05   
dbj|BAM05643.1|  lipid transfer protein                               49.3    7e-05   
gb|EMT00048.1|  Putative non-specific lipid-transfer protein AKCS9    49.3    8e-05   
ref|XP_010064822.1|  PREDICTED: uncharacterized protein LOC104451978  49.7    8e-05   
ref|XP_004234576.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    8e-05   
gb|KHN44569.1|  Putative non-specific lipid-transfer protein AKCS9    49.3    8e-05   
ref|XP_008374782.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    8e-05   
ref|XP_002878145.1|  protease inhibitor/seed storage/lipid transf...  49.3    9e-05   
gb|EMS65828.1|  putative non-specific lipid-transfer protein AKCS9    49.3    9e-05   
ref|XP_010506694.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    9e-05   
ref|XP_010534224.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    9e-05   
ref|XP_010511588.1|  PREDICTED: non-specific lipid-transfer prote...  49.3    9e-05   
ref|XP_010506674.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    1e-04   
ref|XP_008389256.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    1e-04   
ref|NP_001065005.1|  Os10g0504900                                     48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54510.1|  Nonspecific lipid-transfer protein 2, putative        48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010032280.1|  PREDICTED: non-specific lipid-transfer prote...  48.9    1e-04   
sp|P86809.1|NLTP2_APIGA  RecName: Full=Non-specific lipid-transfe...  48.1    1e-04   
gb|AAP54508.1|  Nonspecific lipid-transfer protein 2, putative        48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ACM78620.1|  non-specific lipid-transfer protein type 2            48.5    1e-04   Tamarix hispida
ref|XP_006367505.1|  PREDICTED: uncharacterized protein LOC102587705  50.1    1e-04   
gb|AAX95718.1|  Protease inhibitor/seed storage/LTP family, putative  48.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009111220.1|  PREDICTED: probable non-specific lipid-trans...  48.5    1e-04   
ref|XP_004235834.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    1e-04   
gb|AAS79106.1|  probable lipid transfer protein family protein        48.5    1e-04   Tamarix androssowii
gb|EMT19327.1|  Putative non-specific lipid-transfer protein AKCS9    48.5    2e-04   
ref|XP_006365399.1|  PREDICTED: probable non-specific lipid-trans...  48.5    2e-04   
ref|XP_009792617.1|  PREDICTED: non-specific lipid-transfer prote...  48.5    2e-04   
ref|XP_004241634.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    2e-04   
ref|XP_009589151.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    2e-04   
gb|EMT28561.1|  Non-specific lipid-transfer protein 2                 48.1    2e-04   
ref|XP_002887080.1|  hypothetical protein ARALYDRAFT_475781           48.1    2e-04   
ref|XP_009113462.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-04   
ref|XP_004288629.1|  PREDICTED: non-specific lipid-transfer prote...  48.1    3e-04   
ref|XP_010440916.1|  PREDICTED: probable non-specific lipid-trans...  48.1    3e-04   
tpg|DAA42889.1|  TPA: nonspecific lipid-transfer protein              47.8    3e-04   
ref|XP_006468752.1|  PREDICTED: probable non-specific lipid-trans...  47.8    3e-04   
ref|XP_006855793.1|  hypothetical protein AMTR_s00044p00214770        47.8    3e-04   
ref|XP_009804140.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-04   
ref|XP_008809159.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-04   
gb|EAY79133.1|  hypothetical protein OsI_34240                        47.8    3e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006482397.1|  PREDICTED: probable non-specific lipid-trans...  47.8    3e-04   
gb|KFK39166.1|  hypothetical protein AALP_AA3G208800                  47.8    3e-04   
ref|XP_010667862.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-04   
ref|XP_006448406.1|  hypothetical protein CICLE_v10017614mg           47.4    3e-04   
ref|XP_006405794.1|  hypothetical protein EUTSA_v10028094mg           47.8    3e-04   
ref|NP_001148304.1|  LOC100281913 precursor                           47.8    3e-04   Zea mays [maize]
ref|XP_009589620.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-04   
dbj|BAM05641.1|  lipid transfer protein                               47.4    3e-04   
ref|XP_010232168.1|  PREDICTED: non-specific lipid-transfer prote...  47.8    3e-04   
ref|XP_006430727.1|  hypothetical protein CICLE_v10013181mg           47.8    4e-04   
ref|XP_008809160.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    4e-04   
ref|XP_010435719.1|  PREDICTED: probable non-specific lipid-trans...  47.8    4e-04   
ref|XP_003624386.1|  Non-specific lipid-transfer protein              47.4    4e-04   
ref|XP_006292190.1|  hypothetical protein CARUB_v10018396mg           47.4    4e-04   
emb|CDY48021.1|  BnaA04g26690D                                        47.4    4e-04   
gb|EYU41301.1|  hypothetical protein MIMGU_mgv1a021579mg              47.4    4e-04   
gb|KDP35032.1|  hypothetical protein JCGZ_09320                       47.4    5e-04   
ref|XP_004961319.1|  PREDICTED: non-specific lipid-transfer prote...  47.4    5e-04   
emb|CDO98408.1|  unnamed protein product                              47.0    5e-04   
gb|AAT08689.1|  lipid transfer protein                                47.0    5e-04   Hyacinthus orientalis [common hyacinth]
gb|AAT08737.1|  auxin-induced lipid transfer protein                  47.0    5e-04   Hyacinthus orientalis [common hyacinth]
ref|XP_010110085.1|  hypothetical protein L484_013260                 47.0    5e-04   
emb|CDY40833.1|  BnaC01g31230D                                        47.0    6e-04   
ref|NP_001065007.1|  Os10g0505500                                     47.0    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006300368.1|  hypothetical protein CARUB_v10022343mg           47.0    7e-04   
gb|ACI26699.1|  lipid transfer protein                                47.0    7e-04   Gossypium hirsutum [American cotton]
emb|CDY04317.1|  BnaC05g25790D                                        46.6    7e-04   
ref|XP_010440915.1|  PREDICTED: non-specific lipid-transfer prote...  47.0    7e-04   
gb|KDO63208.1|  hypothetical protein CISIN_1g036197mg                 46.6    9e-04   
ref|XP_006304814.1|  hypothetical protein CARUB_v10012448mg           46.2    0.001   
ref|XP_009113157.1|  PREDICTED: probable non-specific lipid-trans...  46.2    0.001   
ref|XP_010450959.1|  PREDICTED: probable non-specific lipid-trans...  46.6    0.001   
emb|CDP02750.1|  unnamed protein product                              46.2    0.001   



>emb|CBI33621.3| unnamed protein product [Vitis vinifera]
Length=81

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI DP L  Y+N  N R V++TCGVP P C
Sbjct  41   KLREQRPCLCGYIRDPNLSQYVNSANARRVASTCGVPFPNC  81



>ref|XP_002284213.1| PREDICTED: non-specific lipid-transfer protein 2-like [Vitis 
vinifera]
Length=92

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI DP L  Y+N  N R V++TCGVP P C
Sbjct  52   KLREQRPCLCGYIRDPNLSQYVNSANARRVASTCGVPFPNC  92



>gb|AFP49331.1| non-specific lipid-transfer protein type 2, partial [Olea europaea]
Length=82

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI DP LG Y+N  N + V+++CGV VP C
Sbjct  42   KLQEQKPCLCGYIKDPNLGKYVNSPNAKKVASSCGVAVPNC  82



>ref|XP_006367504.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLCGY NDP L PY+   N + V  TCGVP+P C
Sbjct  56   KLKEQVPCLCGYFNDPTLKPYVGSPNAQKVFQTCGVPIPKC  96



>gb|AFK45248.1| unknown [Lotus japonicus]
Length=104

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L PY+N    R V++TCG+P P C
Sbjct  64   KLREQKPCLCGYLRNPSLAPYVNSPGARAVASTCGIPYPRC  104



>ref|XP_009777694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=97

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L PY+N  N + V+ +CGVP P+C
Sbjct  57   KLKEQKPCLCGYLKNPNLRPYVNSPNAKRVAKSCGVPTPSC  97



>ref|XP_006391441.1| hypothetical protein EUTSA_v10019362mg [Eutrema salsugineum]
 gb|ESQ28727.1| hypothetical protein EUTSA_v10019362mg [Eutrema salsugineum]
Length=98

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCG+  +P    YIN  N++ V A CGVP+P+C
Sbjct  58   KLKEQQPCLCGFAKNPAFAQYINSANSQKVLAACGVPLPSC  98



>dbj|BAJ25798.1| putative non-specific lipid-transfer protein type 2 subfamily 
[Nicotiana tabacum]
Length=97

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L PY+N  N + V+ +CGVP P+C
Sbjct  57   KLKEQKPCLCGYLKNPNLRPYVNSPNAKRVAKSCGVPTPSC  97



>ref|XP_008362493.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLC YI +P L PYIN  N + V+  CGVP P C
Sbjct  57   KLKEQQPCLCEYIKNPALKPYINNPNAKKVAXACGVPFPQC  97



>ref|XP_009804692.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+ QQPCLCGY+ DP L  Y+N  N R V+++CGV +P+C
Sbjct  54   RLRAQQPCLCGYMRDPNLRQYVNSSNARKVASSCGVSIPSC  94



>ref|XP_008444081.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=94

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK+Q+ CLCGYI +P LGPY+N    + V++ CGVP+P+C
Sbjct  54   KLKQQKACLCGYIKNPALGPYVNSPGAKNVASKCGVPIPSC  94



>ref|XP_009599113.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQQPCLCGY+ DP L  Y+N  N R V+  CGV VP+C
Sbjct  54   KMREQQPCLCGYMKDPSLRQYVNSPNARRVANACGVAVPSC  94



>ref|XP_003555069.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Glycine max]
 gb|KHN19692.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=97

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLCGY+ +P L PY+N   +R V+++CGVP PTC
Sbjct  57   KVREQRPCLCGYLKNPSLRPYVNSPGSRRVASSCGVPFPTC  97



>ref|XP_009346593.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPC C YI +P+L PYI+  N + V++ CGVP P C
Sbjct  57   KLKEQQPCFCEYIKNPVLKPYIDNPNAKKVASACGVPFPQC  97



>ref|XP_009781752.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=94

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQQPCLCGY+ DP L  Y+N  N R V+  CGV VP+C
Sbjct  54   KMREQQPCLCGYMKDPSLRQYVNSPNARRVANACGVAVPSC  94



>ref|XP_009626576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=97

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L PY+N  N + V+ +CGVP P+C
Sbjct  57   KLREQKPCLCGYLKNPNLRPYVNSPNAKRVARSCGVPTPSC  97



>ref|XP_010528992.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCGY  +P    Y+N  N R V + CGVP+P C
Sbjct  52   KLKEQQPCLCGYAKNPAFSQYVNSPNARKVLSACGVPIPKC  92



>ref|XP_010528502.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=97

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCGYI +P L  Y++  N R V + CGVP P+C
Sbjct  57   KLKEQQPCLCGYIKNPALSQYVSSPNARKVLSACGVPYPSC  97



>emb|CDP02751.1| unnamed protein product [Coffea canephora]
Length=95

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ DP L  Y+N  N R V+++CGVP P C
Sbjct  55   KLREQRPCLCGYLRDPNLRQYVNSPNARRVASSCGVPTPRC  95



>ref|XP_009613979.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=94

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+ QQPCLCGY+ DP L  Y+N  N R V+++CGV +P+C
Sbjct  54   RLRGQQPCLCGYMRDPNLRQYVNSPNARKVASSCGVSIPSC  94



>gb|AAA33933.1| lipid transfer protein, partial [Senecio odorus]
Length=89

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLCGY+ +P L  YI   N + V++TCGVP+P C
Sbjct  49   KLKEQSPCLCGYLKNPTLKQYITNPNAKKVTSTCGVPIPNC  89



>ref|XP_008229268.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=98

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ DP L  Y++    R V++TCGVP P C
Sbjct  58   KLREQKPCLCGYLKDPALKQYVSSPTARKVASTCGVPFPQC  98



>ref|XP_006357827.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=96

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLK QQPC+CG++ DP L  Y+N  N R V+  CGV +P+C
Sbjct  56   RLKSQQPCICGFMKDPNLKQYVNSPNARKVAGQCGVSIPSC  96



>ref|XP_008229267.1| PREDICTED: non-specific lipid-transfer protein 2 [Prunus mume]
Length=98

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+N  N R +++ CGVPVP C
Sbjct  58   KLREQRPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC  98



>ref|XP_007139181.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
 gb|ESW11175.1| hypothetical protein PHAVU_008G008200g [Phaseolus vulgaris]
Length=98

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC YIN+P L  Y+N    + V  TCGVP PTC
Sbjct  58   KLKEQKPCLCSYINNPALKQYVNSPRAKAVLKTCGVPYPTC  98



>ref|XP_002305838.1| hypothetical protein POPTR_0004s09510g [Populus trichocarpa]
 gb|EEE86349.1| hypothetical protein POPTR_0004s09510g [Populus trichocarpa]
Length=93

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ DP L  +++    R V++ CGVP P+C
Sbjct  53   KLKEQKPCLCGYLKDPALKQFVSSPGARKVASACGVPYPSC  93



>ref|XP_007217198.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
 gb|EMJ18397.1| hypothetical protein PRUPE_ppa013890mg [Prunus persica]
Length=98

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+N  N R +++ CGVPVP C
Sbjct  58   KLREQRPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC  98



>ref|XP_004234577.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=92

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  Y+N  N + V+ TCGV  P+C
Sbjct  52   KLKEQKPCLCGYLKNPSLKQYVNSPNAKKVAKTCGVSTPSC  92



>ref|XP_010279351.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=92

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   IN  N + V++TCG+P P+C
Sbjct  52   KLKEQRPCLCKYLKDPNLQKLINTPNAKKVASTCGIPFPSC  92



>ref|XP_004232333.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=96

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLK QQPC+CG++ DP L  Y+N  N R V+  CGV +P+C
Sbjct  56   RLKNQQPCICGFMKDPNLRQYVNSPNARKVAGQCGVSIPSC  96



>ref|XP_011035101.1| PREDICTED: non-specific lipid-transfer protein 2-like [Populus 
euphratica]
Length=94

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ DP L  +++   +R V++ CGVP P+C
Sbjct  54   KLKEQKPCLCGYLKDPSLKQFVSSPGSRKVASACGVPYPSC  94



>ref|XP_004154719.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cucumis sativus]
Length=94

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQQ CLCGYI +P L PY+N    + V++ CGVP P C
Sbjct  54   KLREQQQCLCGYIKNPALSPYVNSPGAKHVASKCGVPTPRC  94



>sp|P82353.1|NLTP2_PRUAR RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2 [Prunus armeniaca]
Length=68

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+N  N R +++ CGVPVP C
Sbjct  28   KLREQRPCLCGYLKNPSLRQYVNSPNARKLASNCGVPVPQC  68



>ref|XP_008444080.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=96

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQQPC CGY+ +P LG Y+     + + +TCGVP+P C
Sbjct  56   KLREQQPCFCGYMKNPSLGGYVKSARAKAIISTCGVPLPKC  96



>ref|XP_009386356.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y  +P L  YIN  N++ VS +CGVP+P+C
Sbjct  51   KLKEQRPCLCEYRKNPNLKGYINSDNSKKVSKSCGVPIPSC  91



>emb|CDY61300.1| BnaCnng37660D [Brassica napus]
Length=97

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGYI +P+   Y+   N   V ATCG+P PTC
Sbjct  57   KLKEQESCLCGYIQNPLFSQYVTSENAHKVLATCGIPYPTC  97



>ref|XP_006482207.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=100

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L++Q+PCLCGY+ DP L  Y+N  N + V ATCG+P P C
Sbjct  60   KLRQQRPCLCGYLRDPNLKQYVNSPNAKRVVATCGIPYPRC  100



>emb|CDY52889.1| BnaC06g27820D [Brassica napus]
Length=96

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCG+  +P    YI+  N+R V + CG+P P+C
Sbjct  56   KLKEQQPCLCGFAKNPAFAQYISSPNSRKVLSACGIPYPSC  96



>ref|XP_006383409.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
 gb|ERP61206.1| hypothetical protein POPTR_0005s15210g [Populus trichocarpa]
Length=94

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ DP L  +++    R V++ CGVP P+C
Sbjct  54   KLKEQKPCLCGYLKDPSLKQFVSSPGARKVASDCGVPYPSC  94



>ref|XP_011021288.1| PREDICTED: non-specific lipid-transfer protein 2 [Populus euphratica]
Length=94

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ DP L  Y++    R V + CGVP P+C
Sbjct  54   KLKEQKPCLCGYLKDPSLKQYVSSPGARKVVSACGVPYPSC  94



>ref|NP_198633.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 dbj|BAB11284.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42030.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAO50624.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AED94275.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=103

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPC C YI DP    Y+   N +   ATCGVP PTC
Sbjct  63   KLKEQQPCFCTYIKDPRYSQYVGSANAKKTLATCGVPYPTC  103



>ref|XP_011097163.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53930.1| lipid transfer protein [Sesamum indicum]
Length=96

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PC C Y+ +P+  PY++  N + V+ATCGV  PTC
Sbjct  56   KLKEQVPCFCDYVKNPVFKPYVDSPNAKKVAATCGVAFPTC  96



>ref|XP_010062206.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69298.1| hypothetical protein EUGRSUZ_F02789 [Eucalyptus grandis]
Length=103

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI DP L  Y    N + V++TCGV  PTC
Sbjct  63   KLREQRPCLCGYIKDPNLKQYFTSPNAKRVASTCGVASPTC  103



>ref|XP_006654745.1| PREDICTED: non-specific lipid-transfer protein 2-like [Oryza 
brachyantha]
Length=98

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+KEQQPCLC Y  DP L  Y+N  N + V A C VPVPTC
Sbjct  58   RMKEQQPCLCQYARDPNLQRYVNSPNGKKVMAACRVPVPTC  98



>emb|CDY61301.1| BnaCnng37670D [Brassica napus]
Length=105

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGYI +P+   Y+   N   V ATCG+P PTC
Sbjct  65   KLKEQESCLCGYIQNPLFSQYVTSENAHKVLATCGIPYPTC  105



>gb|ACJ68112.1| hypothetical protein [Brassica napus]
Length=105

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGYI +P+   Y+   N   V ATCG+P PTC
Sbjct  65   KLKEQESCLCGYIQNPLFSQYVTSENAHKVLATCGIPYPTC  105



>ref|XP_009110931.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
 emb|CDY15628.1| BnaA08g29120D [Brassica napus]
Length=97

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGYI +P+   Y+   N   + ATCG+P PTC
Sbjct  57   KLKEQESCLCGYIQNPLFSQYVTSENAHKILATCGIPYPTC  97



>ref|XP_006589067.1| PREDICTED: non-specific lipid-transfer protein 2-like [Glycine 
max]
Length=100

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLCGY+ +P L  Y+N   +R V+++CGVP PTC
Sbjct  60   KVREQRPCLCGYLQNPSLRQYVNSPGSRRVASSCGVPFPTC  100



>ref|XP_010108883.1| hypothetical protein L484_027077 [Morus notabilis]
 gb|EXC20523.1| hypothetical protein L484_027077 [Morus notabilis]
Length=98

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+EQ+PCLCGY+ DP L  Y+N  N + V++ CGV  P C
Sbjct  57   RLREQRPCLCGYLKDPNLRQYVNSPNAKKVASVCGVSYPKC  97



>ref|XP_002317903.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|ABK92986.1| unknown [Populus trichocarpa]
 gb|EEE96123.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=93

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +IN  N R V++TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPKLQKFINTPNARKVASTCGTPFPKC  93



>gb|ABK95885.1| unknown [Populus trichocarpa]
Length=93

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +IN  N R V++TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPKLQKFINTPNARKVASTCGTPFPKC  93



>gb|KEH21557.1| Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula]
Length=98

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  YI     R V+++CGVP PTC
Sbjct  58   KLREQRPCLCGYLKNPSLKKYIYSPGARRVASSCGVPFPTC  98



>ref|XP_010062205.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW69297.1| hypothetical protein EUGRSUZ_F02788 [Eucalyptus grandis]
Length=103

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI +P L  Y+   N + V+ TCGVP PTC
Sbjct  63   KLREQRPCLCGYIRNPNLRQYVTSPNAKRVARTCGVPYPTC  103



>gb|KHN41531.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=98

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLCGY+ +P L  Y+N   +R V+++CGVP PTC
Sbjct  58   KVREQRPCLCGYLQNPSLRQYVNSPGSRRVASSCGVPFPTC  98



>ref|XP_004299573.1| PREDICTED: non-specific lipid-transfer protein 2-like [Fragaria 
vesca subsp. vesca]
Length=96

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLC Y+N+P L  ++N  N R V+ TCG P P C
Sbjct  55   KLREQKPCLCQYLNNPNLKKFVNTPNARKVARTCGTPFPRC  95



>gb|KDP32977.1| hypothetical protein JCGZ_13008 [Jatropha curcas]
Length=96

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y++    R V+ +CGVP+PTC
Sbjct  56   KLREQKPCLCGYLKNPSLKQYVSSPGARRVANSCGVPIPTC  96



>gb|AAG60123.1|AC073555_7 lipid transfer protein, putative [Arabidopsis thaliana]
Length=87

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQQPCLCGY+ +P L  Y++  N R VS +C +P P+C
Sbjct  47   KLREQQPCLCGYMRNPTLRQYVSSPNARKVSNSCKIPSPSC  87



>ref|XP_009357787.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI +P L  Y+   N R +++ CGVP+P C
Sbjct  57   KLREQRPCLCGYIKNPALRTYVTSPNARKLASACGVPIPQC  97



>ref|XP_010317725.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=100

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC C ++ +P+  PY+N    R V A CGVP P C
Sbjct  60   KLKEQEPCFCDFLKNPLAKPYVNSTRAREVLAICGVPFPQC  100



>ref|XP_003633726.1| PREDICTED: non-specific lipid-transfer protein 2 [Vitis vinifera]
 emb|CBI33623.3| unnamed protein product [Vitis vinifera]
Length=92

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ DP    Y+N      +++TCGV  P C
Sbjct  52   KLKEQKPCLCGYLKDPNFSQYVNSAKANRIASTCGVQFPNC  92



>ref|XP_002322068.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
 gb|EEF06195.2| protease inhibitor/seed storage/lipid transfer family protein 
[Populus trichocarpa]
Length=93

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +IN  N R V++TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPNLQKFINTPNARKVASTCGTPFPKC  93



>ref|NP_564532.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAK76553.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AAM14109.1| putative lipid transfer protein [Arabidopsis thaliana]
 gb|AEE32344.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=94

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQQPCLCGY+ +P L  Y++  N R VS +C +P P+C
Sbjct  54   KLREQQPCLCGYMRNPTLRQYVSSPNARKVSNSCKIPSPSC  94



>gb|ABK92836.1| unknown [Populus trichocarpa]
Length=93

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +IN  N R V++TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPNLQKFINTPNARKVASTCGTPFPKC  93



>ref|XP_010252340.1| PREDICTED: non-specific lipid-transfer protein 2 [Nelumbo nucifera]
Length=92

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   IN  N + V+ TCG P+P+C
Sbjct  52   KLKEQRPCLCKYLKDPNLQKLINTPNAKKVANTCGTPIPSC  92



>ref|XP_006362367.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=92

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+N  N + V+ TCGV  P+C
Sbjct  52   KLREQKPCLCGYLKNPSLKQYVNSPNAQRVAKTCGVSTPSC  92



>ref|NP_001056241.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|AAT39264.1| putative lipid transfer protein [Oryza sativa Japonica Group]
 dbj|BAF18155.1| Os05g0550300 [Oryza sativa Japonica Group]
 gb|EAY98926.1| hypothetical protein OsI_20881 [Oryza sativa Indica Group]
 dbj|BAG88327.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+KEQQPCLC Y  DP L  Y+N  N + V A C VPVP+C
Sbjct  54   RMKEQQPCLCQYARDPNLQRYVNSPNGKKVLAACHVPVPSC  94



>ref|XP_009418081.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC C Y  +P L  YIN  N++ V+ +CGVP+PTC
Sbjct  51   KLKEQRPCFCQYKQNPNLKGYINSDNSKKVAKSCGVPIPTC  91



>ref|XP_006442592.1| hypothetical protein CICLE_v10023053mg [Citrus clementina]
 ref|XP_006477780.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|ESR55832.1| hypothetical protein CICLE_v10023053mg [Citrus clementina]
 gb|KDO49801.1| hypothetical protein CISIN_1g034465mg [Citrus sinensis]
Length=94

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +IN  N R V++TCG P P C
Sbjct  54   KIKEQKPCLCQYLRNPSLRKFINTPNARRVASTCGTPFPKC  94



>emb|CDY50600.1| BnaC02g16970D [Brassica napus]
Length=98

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCG+  +P    YI+  N+R V   CG+P P+C
Sbjct  58   KLKEQQPCLCGFAKNPAFAQYISSPNSRKVLTACGIPYPSC  98



>ref|XP_010317750.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=70

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVV-NTRTVSATCGVPVPTC  388
            +LKE+QPC+CG+I DP L PYI      + V  TCGVP+P C
Sbjct  21   KLKEEQPCICGFIEDPKLKPYIKFTPQAKKVFKTCGVPLPNC  62



>gb|KFK43095.1| hypothetical protein AALP_AA1G079200 [Arabis alpina]
Length=99

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC YI +P+ G Y++  N + +   CGVP+PTC
Sbjct  58   KLKEQESCLCEYIKNPLFGQYVSSANAQKILGACGVPLPTC  98



>ref|XP_003524566.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Glycine max]
Length=100

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+ CLCGY+ +P L PY N   +R V+++CGVP PTC
Sbjct  60   KVREQRQCLCGYLKNPSLRPYANSPGSRRVASSCGVPFPTC  100



>gb|KHN27477.1| Non-specific lipid-transfer protein 2 [Glycine soja]
Length=96

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+ CLCGY+ +P L PY N   +R V+++CGVP PTC
Sbjct  56   KVREQRQCLCGYLKNPSLRPYANSPGSRRVASSCGVPFPTC  96



>gb|KGN53815.1| hypothetical protein Csa_4G141230 [Cucumis sativus]
Length=102

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC C Y+  P+  PY+   N + ++ +C VP+PTC
Sbjct  62   KLKEQEPCFCAYLKSPVFKPYLESPNAKKIATSCRVPIPTC  102



>ref|NP_001238401.1| uncharacterized protein LOC100306409 precursor [Glycine max]
 gb|ACU14566.1| unknown [Glycine max]
 gb|KHN47234.1| Putative non-specific lipid-transfer protein AKCS9-like protein 
[Glycine soja]
Length=95

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK+Q+PCLCGY+ +  L  Y+N  N R   A+CG+P PTC
Sbjct  55   KLKQQKPCLCGYLKNASLKQYVNSPNARKTVASCGIPFPTC  95



>ref|XP_008444077.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
melo]
Length=102

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC C Y+  PI   Y+   N + ++++CG+P+PTC
Sbjct  62   KLKEQEPCFCEYLKSPIFKRYLESPNAKKIASSCGIPIPTC  102



>ref|XP_008381283.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=95

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI +P L  Y+   N R +++ CGVP P C
Sbjct  55   KLREQRPCLCGYIKNPALRTYVTSPNARKLASACGVPTPQC  95



>ref|XP_010036906.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW48562.1| hypothetical protein EUGRSUZ_K02234 [Eucalyptus grandis]
Length=92

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++N  N R V++TCG P P C
Sbjct  52   KIKEQKPCLCQYLKNPSLKKFVNSPNARKVASTCGTPFPKC  92



>ref|XP_009357786.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=95

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI +P L  Y+   N R +++ CGVP P C
Sbjct  55   KLREQRPCLCGYIKNPALRTYVTSPNARKLASACGVPTPQC  95



>gb|AGC08429.1| lipid transfer protein [Gossypium hirsutum]
Length=96

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK Q+PCLCGYI +P L  Y+N  N + V++TCGV  P C
Sbjct  56   KLKAQKPCLCGYIKNPSLKQYVNSPNAKNVASTCGVTYPKC  96



>ref|XP_002863289.1| hypothetical protein ARALYDRAFT_333050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39548.1| hypothetical protein ARALYDRAFT_333050 [Arabidopsis lyrata subsp. 
lyrata]
Length=95

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQ CLC Y+ DP++ PYI V   + + A+CG+P P+C
Sbjct  57   KLKEQQSCLCAYLKDPLVAPYITVA--KIILASCGIPFPSC  95



>gb|ACG48207.1| nonspecific lipid-transfer protein precursor [Zea mays]
Length=101

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLKEQQPCLC Y  DP L  Y+N  N +   A C VPVP+C
Sbjct  61   RLKEQQPCLCTYARDPNLQRYVNSPNGKKAMAACKVPVPSC  101



>ref|XP_009105236.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LKEQQPCLCG+  +P    Y++  N+R V + CGVP P+C
Sbjct  57   LKEQQPCLCGFSKNPAFAQYVSSPNSRKVVSACGVPYPSC  96



>ref|XP_009127492.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
 emb|CDY12591.1| BnaA02g12590D [Brassica napus]
Length=98

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCG+  +P    YI+  N+R V   CG+P P+C
Sbjct  58   KLKEQQPCLCGFSKNPAFAQYISSPNSRKVLTACGIPYPSC  98



>dbj|BAA25680.1| Lipid transfer protein [Brassica rapa]
Length=86

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCG+  +P    YI+  N+R V   CG+P P+C
Sbjct  46   KLKEQQPCLCGFSKNPAFAQYISSPNSRKVLTACGIPYPSC  86



>ref|XP_010528993.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=92

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGYI +P    Y++  N R V + CGVP P+C
Sbjct  52   KLKEQESCLCGYIKNPAFAQYVSSPNARKVLSACGVPYPSC  92



>ref|XP_010279350.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nelumbo 
nucifera]
Length=93

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PC C Y+ DP LG Y+N  N + V ++CGV +P C
Sbjct  53   KLREQRPCFCQYLRDPSLGQYVNSPNAKKVVSSCGVSIPNC  93



>ref|NP_001148293.1| LOC100281901 precursor [Zea mays]
 gb|ACG30429.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACN28858.1| unknown [Zea mays]
 gb|AFW77366.1| nonspecific lipid-transfer protein [Zea mays]
Length=101

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLKEQQPCLC Y  DP L  Y+N  N +   A C VPVP+C
Sbjct  61   RLKEQQPCLCTYARDPNLQRYVNSPNGKKAMAACKVPVPSC  101



>ref|XP_002440195.1| hypothetical protein SORBIDRAFT_09g027590 [Sorghum bicolor]
 gb|EES18625.1| hypothetical protein SORBIDRAFT_09g027590 [Sorghum bicolor]
Length=97

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLKEQQPCLC Y  DP L  Y+N  N +   A C VPVP+C
Sbjct  57   RLKEQQPCLCTYARDPNLQRYVNSPNGKKAMAACKVPVPSC  97



>ref|NP_188456.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 dbj|BAB01177.1| lipid transfer protein [Arabidopsis thaliana]
 gb|AAK64007.1| AT3g18280/MIE15_7 [Arabidopsis thaliana]
 gb|AAL76158.1| AT3g18280/MIE15_7 [Arabidopsis thaliana]
 gb|AEE76075.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=96

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS +C +P+P C
Sbjct  56   KLKEQRPCLCGYMRNPSLRRFVSTPNARKVSKSCKLPIPRC  96



>gb|KGN63840.1| hypothetical protein Csa_1G024245 [Cucumis sativus]
Length=100

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLCGY+ +PIL  +++  N R V+  CG P P C
Sbjct  60   KIKEQKPCLCGYLKNPILKSFVSSPNARKVANDCGTPFPNC  100



>emb|CDP02752.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PC CGY+ DP L  Y+N  N R  ++ CGVP P C
Sbjct  50   KLREQRPCFCGYLRDPYLRQYVNTPNGRREASFCGVPSPRC  90



>ref|XP_006430726.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
 gb|ESR43966.1| hypothetical protein CICLE_v10013191mg [Citrus clementina]
Length=99

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++++Q+PCLCG++ DP L  Y+N  N + V ATCG+P P C
Sbjct  59   KMRQQRPCLCGFLRDPNLKQYVNSPNAKRVIATCGIPYPRC  99



>ref|XP_006482208.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=99

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++++Q+PCLCG++ DP L  Y+N  N + V ATCG+P P C
Sbjct  59   KMRQQRPCLCGFLRDPNLKQYVNSPNAKRVIATCGIPYPRC  99



>emb|CDY51937.1| BnaAnng11140D [Brassica napus]
Length=96

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC+CGY+ +P L  YI+  N R VS TC  P+P C
Sbjct  56   KLKEQKPCICGYMRNPSLRRYISSPNARKVSNTCKFPMPRC  96



>emb|CDX75963.1| BnaC03g40460D [Brassica napus]
Length=96

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC+CGY+ +P L  YI+  N R VS TC  P+P C
Sbjct  56   KLKEQKPCICGYMRNPSLRRYISSPNARKVSNTCKFPMPRC  96



>ref|XP_008240231.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=96

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++K+Q+PCLC Y+N+P L  ++N  N R V+ TCG P P C
Sbjct  56   KIKQQKPCLCQYLNNPNLKKFVNTPNARKVARTCGTPFPKC  96



>ref|XP_006430725.1| hypothetical protein CICLE_v10013188mg [Citrus clementina]
 gb|ESR43965.1| hypothetical protein CICLE_v10013188mg [Citrus clementina]
 gb|KDO63207.1| hypothetical protein CISIN_1g034237mg [Citrus sinensis]
Length=100

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L++Q+PCLCGY+ +P L  Y+N  N + + ATCG+P P C
Sbjct  60   KLRQQRPCLCGYLRNPNLRQYVNSPNAKRIVATCGIPYPRC  100



>emb|CDY40472.1| BnaC09g14300D [Brassica napus]
Length=97

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQ CLCGYI +P  G +I   N++ V   CGVP PTC
Sbjct  59   KLKEQQSCLCGYIQNPTFGQFIK--NSQNVFTACGVPYPTC  97



>ref|XP_007211115.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
 gb|EMJ12314.1| hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]
Length=94

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++K+Q+PCLC Y+N+P L  ++N  N R V+ TCG P P C
Sbjct  54   KIKQQKPCLCQYLNNPNLKKFVNTPNARKVARTCGTPFPKC  94



>ref|XP_010528501.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Tarenaya hassleriana]
Length=92

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGY+ +P    Y++  N R V + CGVP P+C
Sbjct  52   KLKEQESCLCGYVKNPAFAQYVSSPNARKVLSACGVPYPSC  92



>ref|XP_009135573.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=96

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC+CGY+ +P L  YI+  N R VS TC  P+P C
Sbjct  56   KLKEQKPCICGYMRNPSLRRYISSPNARKVSNTCKFPMPRC  96



>ref|XP_007226001.1| hypothetical protein PRUPE_ppa013833mg [Prunus persica]
 gb|EMJ27200.1| hypothetical protein PRUPE_ppa013833mg [Prunus persica]
Length=100

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   +N  N + V++TCG P P+C
Sbjct  58   KLKEQRPCLCKYVKDPNLQKLVNSPNAKKVASTCGSPFPSC  98



>emb|CDY15627.1| BnaA08g29110D [Brassica napus]
Length=105

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLCGYI +P+   Y+   N   V ATCG+  PTC
Sbjct  65   KLKEQESCLCGYIQNPLFSQYVTSENAHKVLATCGISYPTC  105



>gb|KHN42434.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   +N  N R V+  CG P PTC
Sbjct  55   KLKEQRPCLCQYLKDPNLKKLVNSPNARMVANACGSPFPTC  95



>ref|XP_007150888.1| hypothetical protein PHAVU_004G002600g [Phaseolus vulgaris]
 gb|ESW22882.1| hypothetical protein PHAVU_004G002600g [Phaseolus vulgaris]
Length=93

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLC Y+ +P L  Y+N   +R V+++CGVP PTC
Sbjct  53   KVREQRPCLCDYLKNPSLKNYVNSPGSRRVASSCGVPFPTC  93



>ref|XP_007033193.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY04119.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=118

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  ++N  N R V++TCGV  P C
Sbjct  78   KLREQKPCLCGYLQNPNLKQFVNNPNARKVASTCGVTYPQC  118



>ref|XP_008243280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Prunus 
mume]
Length=100

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   +N  N + V++TCG P P+C
Sbjct  58   KLKEQRPCLCKYVKDPNLQKLVNSPNAKKVASTCGSPFPSC  98



>ref|XP_010044111.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 gb|KCW86149.1| hypothetical protein EUGRSUZ_B02852 [Eucalyptus grandis]
Length=90

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ +P L  +IN  N+R V+  CG P P+C
Sbjct  50   KLKEQRPCLCQYMKNPNLQKFINSPNSRNVAIKCGSPFPSC  90



>gb|KFK26688.1| hypothetical protein AALP_AA8G280300 [Arabis alpina]
Length=97

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+EQQPCLCGY+ +P L  Y++  N + VS +C +P P C
Sbjct  57   RLREQQPCLCGYMRNPSLRQYVSSPNAKKVSNSCRIPSPNC  97



>ref|XP_008453433.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=100

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLCGY+ +P L  +++  N R V+  CG P P C
Sbjct  60   KIKEQKPCLCGYLKNPFLKSFVSSPNARKVANDCGTPFPNC  100



>ref|XP_002870865.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47124.1| hypothetical protein ARALYDRAFT_916549 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPT  385
            +LKEQQPC C YI DP    Y+   N +   ATCGVP PT
Sbjct  63   KLKEQQPCFCTYIKDPKYSQYVGTPNAKKTLATCGVPYPT  102



>emb|CDY12874.1| BnaA09g14000D [Brassica napus]
Length=97

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQ CLCGYI++P+ G +    N + V   CGVP PTC
Sbjct  59   KLKEQQSCLCGYISNPVFGQFYK--NAQNVFKACGVPYPTC  97



>ref|XP_009113158.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQ CLCGYI++P+ G +    N + V   CGVP PTC
Sbjct  59   KLKEQQSCLCGYISNPVFGQFYK--NAQNVFKACGVPYPTC  97



>ref|XP_007142957.1| hypothetical protein PHAVU_007G031600g [Phaseolus vulgaris]
 gb|ESW14951.1| hypothetical protein PHAVU_007G031600g [Phaseolus vulgaris]
Length=94

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   +N  N R V+  CG P PTC
Sbjct  54   KLKEQRPCLCQYLKDPNLKRLVNSPNARKVANACGSPFPTC  94



>ref|XP_009148019.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Brassica 
rapa]
Length=99

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK+++PCLCGYINDP+ G YI   N     ++CG+P  +C
Sbjct  60   LKKEEPCLCGYINDPVYGQYIKSKNAHKAFSSCGIPPLSC  99



>ref|XP_008810040.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=92

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PC C Y  +P L  YIN  N++ V++ CGVP+P C
Sbjct  52   KLKEQTPCFCQYKKNPKLQNYINSKNSKRVASACGVPMPNC  92



>ref|XP_009128605.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
 emb|CDY26874.1| BnaA02g18990D [Brassica napus]
Length=97

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKE++ CLCGYI +P+   Y+   N   V  TCG+P P+C
Sbjct  57   KLKEEESCLCGYIQNPLFSQYVTSANVHMVLVTCGIPYPSC  97



>gb|KFK41090.1| hypothetical protein AALP_AA2G084400 [Arabis alpina]
Length=102

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPCLCG+   P    YI+  N+R V A CGV  P+C
Sbjct  62   KLKEQQPCLCGFAKIPAFAQYISSPNSRKVLAACGVAYPSC  102



>emb|CDM81734.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQQPC+C Y  DP L  Y++  N + V A C VPVP+C
Sbjct  56   KMKEQQPCMCQYARDPNLKQYVDSPNGKKVMAACKVPVPSC  96



>ref|XP_009107339.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+N  N + V+++C V  P C
Sbjct  57   KLREQKPCLCGYLRNPALSQYVNSPNAKKVASSCNVATPKC  97



>ref|XP_006406624.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
 gb|ESQ48077.1| hypothetical protein EUTSA_v10021828mg [Eutrema salsugineum]
Length=97

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS  C +P+P C
Sbjct  57   KLKEQKPCLCGYMRNPSLRRFVSSSNARKVSNRCKLPIPRC  97



>ref|XP_004492965.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLCGY+ +P L  Y+N   ++ V++TCGV +P C
Sbjct  52   KLKEQTPCLCGYLKNPNLRQYVNSPGSKQVASTCGVTIPKC  92



>gb|ACJ68106.1| hypothetical protein [Brassica napus]
Length=97

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQ CLCGYI++P+ G +    N + V  TCGVP P C
Sbjct  59   KLKEQQSCLCGYISNPVFGQFYK--NAQNVFKTCGVPYPKC  97



>ref|XP_010665172.1| PREDICTED: non-specific lipid-transfer protein 2-like [Vitis 
vinifera]
Length=92

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC Y+ +P L  +IN  N R V++TCG P P C
Sbjct  52   KLKEQRSCLCQYVKNPNLQKFINSPNARKVASTCGSPFPNC  92



>gb|KDP32978.1| hypothetical protein JCGZ_13009 [Jatropha curcas]
Length=99

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PC CGY+ +P L  Y++    R V  +CGVP PTC
Sbjct  59   KLREQRPCFCGYVKNPSLRQYVSSPRAREVVKSCGVPFPTC  99



>ref|XP_009613748.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
tomentosiformis]
Length=94

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   I+  N + V++TCG P P C
Sbjct  54   KLKEQRPCLCQYMKDPRLQKMISSPNAKKVASTCGSPFPKC  94



>ref|XP_007044235.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
 gb|EOY00067.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein, putative [Theobroma cacao]
Length=95

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   +N  N R V++ CG P P C
Sbjct  55   KLKEQRPCLCNYVKDPNLQKLVNSPNARKVASICGSPFPNC  95



>ref|XP_007152725.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
 gb|ESW24719.1| hypothetical protein PHAVU_004G154200g [Phaseolus vulgaris]
Length=92

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N R V++TCG P P C
Sbjct  52   KIKEQKPCLCKYLKNPNLKKFVDSPNARKVASTCGTPFPRC  92



>dbj|BAA06462.1| TED4 [Zinnia elegans]
 gb|AAB06586.1| putative nonspecific lipid transfer; auxin induced gene [Zinnia 
violacea]
Length=95

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  Y++  N + V+  CGVP+P C
Sbjct  55   KIKEQKPCLCQYMKNPSLKAYVSSPNAKKVANACGVPIPKC  95



>emb|CDX77289.1| BnaC08g03340D [Brassica napus]
Length=97

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+N  N + V+++C V  P C
Sbjct  57   KLREQKPCLCGYLRNPTLSQYVNSPNAKKVASSCNVATPKC  97



>ref|NP_001236829.1| uncharacterized protein LOC100500614 precursor [Glycine max]
 gb|ACU15740.1| unknown [Glycine max]
Length=95

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   +N  N R  +  CG P PTC
Sbjct  55   KLKEQRPCLCQYLKDPNLKKLVNSPNARMAANACGSPFPTC  95



>emb|CDX92224.1| BnaA05g21830D [Brassica napus]
Length=96

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS  C +P+P C
Sbjct  56   KLKEQKPCLCGYMRNPSLRRFVSSPNARKVSNRCKLPIPRC  96



>ref|XP_003552717.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Glycine max]
 gb|KHN17291.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
 gb|KHN33030.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=95

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC CGY+ +P L  Y+N  N +   ++CG+  PTC
Sbjct  55   KLKEQKPCFCGYLKNPSLKQYVNSPNAKKTVSSCGIAYPTC  95



>ref|NP_001150566.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACF85955.1| unknown [Zea mays]
 gb|ACF88293.1| unknown [Zea mays]
 gb|ACG39591.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|AFW79027.1| nonspecific lipid-transfer protein [Zea mays]
Length=101

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+EQQPCLC Y  DP L  Y++  N +   A C VPVP+C
Sbjct  61   RLREQQPCLCTYARDPKLQRYVSSPNGKNAMAACKVPVPSC  101



>ref|XP_010479305.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  YIN  N R V+++C +  P C
Sbjct  57   KLREQKPCLCGYLRNPSLRQYINSPNARKVTSSCQIATPNC  97



>ref|XP_009145909.1| PREDICTED: non-specific lipid-transfer protein 2 [Brassica rapa]
Length=96

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS  C +P+P C
Sbjct  56   KLKEQKPCLCGYMRNPSLRRFVSSPNARKVSNRCKLPIPRC  96



>ref|XP_003620406.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|ACJ85882.1| unknown [Medicago truncatula]
 gb|AES76624.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=92

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++N  N R V+ TCG P P C
Sbjct  52   KIKEQRPCLCQYMKNPNLRKFVNTPNARKVANTCGTPFPRC  92



>gb|AFK34114.1| unknown [Medicago truncatula]
Length=92

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++N  N R V+ TCG P P C
Sbjct  52   KIKEQRPCLCQYMKNPNLTKFVNTPNARKVANTCGTPFPRC  92



>ref|XP_010461704.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  YIN  N R V+++C +  P C
Sbjct  57   KLREQKPCLCGYLRNPSLRQYINSPNARKVTSSCQIATPNC  97



>ref|XP_009360132.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L   +N  N R V++TCG P P C
Sbjct  57   KIKEQKPCLCQYLKNPNLKKLVNTPNARKVASTCGTPFPKC  97



>ref|XP_010500416.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  YIN  N R V+++C +  P C
Sbjct  57   KLREQKPCLCGYLRNPSLRQYINSPNARKVTSSCQIATPNC  97



>emb|CDY16462.1| BnaA08g03050D [Brassica napus]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ PCLCGY+ +P L  Y+N  N + V+++C V  P C
Sbjct  57   KLREQNPCLCGYLRNPALSQYVNSPNAKKVASSCNVATPKC  97



>emb|CDX95132.1| BnaC05g05390D [Brassica napus]
Length=99

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK+++PCLCGY+NDP+ G YI   N     + CG+P  +C
Sbjct  60   LKKEEPCLCGYVNDPVYGQYIKSKNAHKAFSACGIPPLSC  99



>emb|CDY24453.1| BnaC05g35010D [Brassica napus]
Length=96

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS  C +P+P C
Sbjct  56   KLKEQKPCLCGYMRNPSLRRFVSSPNARKVSNRCKLPIPRC  96



>ref|XP_008393327.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L   +N  N R V++TCG P P C
Sbjct  57   KIKEQKPCLCQYLKNPNLKKLVNTPNARKVASTCGTPFPKC  97



>ref|XP_006299714.1| hypothetical protein CARUB_v10015906mg [Capsella rubella]
 gb|EOA32612.1| hypothetical protein CARUB_v10015906mg [Capsella rubella]
Length=97

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS  C +P+P C
Sbjct  57   KLKEQKPCLCGYMRNPSLRRFVSSPNARKVSNHCRLPIPRC  97



>ref|XP_010320740.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=95

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L   I+  N + V+ TCG P P C
Sbjct  55   KLKEQRPCLCKYMKDPRLQKMISSPNAKKVATTCGSPFPNC  95



>ref|NP_001235108.1| uncharacterized protein LOC100306442 precursor [Glycine max]
 gb|ACU14623.1| unknown [Glycine max]
 gb|KHN23756.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N R V++TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPNLKKFVDSPNARRVASTCGTPFPRC  93



>gb|EAY79130.1| hypothetical protein OsI_34237 [Oryza sativa Indica Group]
Length=98

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
             LK QQ C C Y  DP+   YIN  N R + ATCG+P+P C
Sbjct  57   SLKAQQGCFCQYAKDPMYASYINSTNARKMIATCGIPLPNC  97



>ref|XP_003567951.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=98

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+K Q+PCLC Y  DP L  Y+N  N + V A C VPVP+C
Sbjct  58   RMKAQEPCLCDYAKDPNLQRYVNSPNGKKVMAACKVPVPSC  98



>gb|AAB47967.1| nonspecific lipid transfer protein [Hordeum vulgare]
 dbj|BAJ91523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=96

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQQPC+C Y  DP L  Y++  N + V A C VPVP+C
Sbjct  56   KMREQQPCMCQYARDPNLKQYVDSPNGKKVMAACKVPVPSC  96



>emb|CDX93626.1| BnaA06g04220D [Brassica napus]
Length=99

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK+QQ CLCGYI DP  G Y+       V +TCGVP P C
Sbjct  60   LKKQQSCLCGYIKDPRFGQYVKSKYAHMVLSTCGVPYPKC  99



>emb|CDX95131.1| BnaC05g05400D [Brassica napus]
Length=99

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK+QQ CLCGYI DP  G Y+       V +TCGVP P C
Sbjct  60   LKKQQSCLCGYIKDPRFGQYVKSKYAHMVLSTCGVPYPKC  99



>ref|XP_004512892.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Cicer arietinum]
Length=92

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++N  N + V++TCG P P C
Sbjct  52   KIKEQRPCLCQYLKNPNLRKFVNSPNAKKVASTCGTPYPKC  92



>ref|XP_009418385.1| PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=91

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPC C Y  +P L  Y+N  N +     CGVP+P+C
Sbjct  51   KLKEQQPCFCQYKKNPSLKDYVNSDNGKKALKACGVPIPSC  91



>ref|XP_010926507.1| PREDICTED: non-specific lipid-transfer protein 2-like [Elaeis 
guineensis]
Length=92

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK QQPC C Y  +P L  YIN  N+R V A CGV  P+C
Sbjct  52   KLKAQQPCFCQYAKNPSLKGYINSPNSRKVLAACGVSTPSC  92



>emb|CDM83892.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+EQ+ CLC Y  DP LG YIN   ++ V+A C V VP C
Sbjct  56   RLREQRRCLCTYARDPYLGKYINSQTSKEVAAACRVRVPMC  96



>emb|CDM81735.1| unnamed protein product [Triticum aestivum]
Length=96

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+K Q+PC+C Y +DP L  Y+N  N + V A C VPVP+C
Sbjct  56   RMKAQRPCMCQYAHDPNLKQYVNSPNGKKVLAACKVPVPSC  96



>gb|KGN53818.1| hypothetical protein Csa_4G146250 [Cucumis sativus]
Length=96

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQQPC C Y+ +P LG Y+     + + ++CGVP P C
Sbjct  56   KLREQQPCFCQYMKNPSLGGYVKSARAKAIISSCGVPYPKC  96



>gb|KGN53816.1| hypothetical protein Csa_4G141240 [Cucumis sativus]
Length=96

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQQPC C Y+ +P LG Y+     + + ++CGVP P C
Sbjct  56   KLREQQPCFCQYMKNPSLGGYVKSARAKAIISSCGVPYPKC  96



>emb|CDP00664.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +I+  N R V+ TCG P P C
Sbjct  50   KIKEQRPCLCSYMRNPNLKKFISSPNARKVANTCGTPFPQC  90



>ref|XP_010317751.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=96

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            L EQ+PCLCGYI DP L PY+   NT+ +   C VP P C
Sbjct  57   LIEQKPCLCGYIKDPKLKPYMEYPNTQKIYIFCRVPFPQC  96



>ref|XP_008460998.1| PREDICTED: non-specific lipid-transfer protein 2 [Cucumis melo]
Length=90

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++   N + V++TCG P P C
Sbjct  50   KIKEQRPCLCKYMQNPTLKKFVASPNAKKVASTCGTPFPKC  90



>ref|XP_003567950.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=100

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+K QQPCLC Y  DP L  Y++  N + V A C VPVP+C
Sbjct  60   RMKAQQPCLCQYAKDPNLQRYVSSPNGKKVMAACKVPVPSC  100



>ref|XP_004137484.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
sativus]
 ref|XP_004166305.1| PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis 
sativus]
 gb|KGN64146.1| hypothetical protein Csa_1G042560 [Cucumis sativus]
Length=90

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++   N R V+ TCG P P C
Sbjct  50   KIKEQKPCLCKYMQNPTLKKFVASPNARKVANTCGTPFPKC  90



>ref|NP_001275625.1| probable non-specific lipid-transfer protein AKCS9-like precursor 
[Solanum tuberosum]
 dbj|BAC23052.1| putative lipid transfer protein [Solanum tuberosum]
Length=93

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R++EQ+PCLC Y+ +P L  Y+N    + V+ TCGVP P C
Sbjct  53   RIREQKPCLCTYLKNPTLRNYVNSPGAKKVARTCGVPYPKC  93



>gb|KEH44195.1| Lipid transfer protein [Medicago truncatula]
Length=92

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC Y+ DP L  ++N  N   VS  CG P P C
Sbjct  52   KLKEQKPCLCQYLKDPNLKKFVNSPNAIKVSDACGSPFPIC  92



>gb|AFK37583.1| unknown [Lotus japonicus]
Length=93

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N R V+ TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPYLRKFVSSPNARKVANTCGTPFPRC  93



>ref|XP_009347476.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=98

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L   +N  N R V+ TCG P P C
Sbjct  58   KIKEQKPCLCQYLKNPNLKKLVNTPNARNVARTCGTPFPKC  98



>ref|XP_009357223.1| PREDICTED: non-specific lipid-transfer protein 2-like [Pyrus 
x bretschneideri]
Length=99

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLC Y+ +P L   +N  N + V+ TCG P PTC
Sbjct  59   KLKEQSPCLCQYVKNPNLQKLVNSPNAKKVADTCGSPFPTC  99



>ref|XP_010474155.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L EQQ CLCG+  +P    YI+  N+R V A CGV  PTC
Sbjct  62   KLTEQQSCLCGFAKNPAFAQYISSPNSRKVLAACGVAYPTC  102



>ref|XP_008339633.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=99

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLC Y+ +P L   +N  N + V+ TCG P PTC
Sbjct  59   KLKEQSPCLCQYVKNPNLQKLVNSPNAKKVADTCGSPFPTC  99



>ref|XP_010419026.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L EQQ CLCG+  +P    YI+  N+R V A CGV  PTC
Sbjct  62   KLTEQQSCLCGFAKNPAFAQYISSPNSRKVLAACGVAYPTC  102



>ref|XP_008782311.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=94

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK QQPC C Y  +P L  YIN  N+R V A CGV +P C
Sbjct  54   KLKAQQPCFCQYTKNPSLRGYINSPNSRKVVAACGVSIPRC  94



>dbj|BAM05643.1| lipid transfer protein [Eucalyptus pyrocarpa]
Length=95

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +I+  N + V++TCG P P C
Sbjct  55   KIKEQKPCLCQYLQNPNLKKFISSPNAKKVASTCGTPFPKC  95



>gb|EMT00048.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=96

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+K Q+PC+C Y  DP L  Y+N  N + V A C VPVP+C
Sbjct  56   RMKAQRPCMCQYARDPNLKQYVNSPNGKKVLAACKVPVPSC  96



>ref|XP_010064822.1| PREDICTED: uncharacterized protein LOC104451978, partial [Eucalyptus 
grandis]
Length=124

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLCGYI +P L  Y+   + + V   CGVP PTC
Sbjct  84   KMREQRPCLCGYIRNPNLRKYLTSADGKRVMRVCGVPYPTC  124



>ref|XP_004234576.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=97

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLC Y  DP++ PY++  N + V   CGV  P C
Sbjct  57   KLKEQVPCLCIYFKDPMMKPYVDSPNAKKVFQACGVTTPKC  97



>gb|KHN44569.1| Putative non-specific lipid-transfer protein AKCS9 [Glycine soja]
Length=93

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N R V+ TCG P P C
Sbjct  53   KIKEQKPCLCQYLKNPNLKKFVDSPNARRVANTCGTPFPRC  93



>ref|XP_008374782.1| PREDICTED: non-specific lipid-transfer protein 2 [Malus domestica]
Length=98

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L   +N  N R V+ TCG P P C
Sbjct  58   KIKEQKPCLCQYLKNPNLKKLVNTPNARNVARTCGXPFPKC  98



>ref|XP_002878145.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54404.1| protease inhibitor/seed storage/lipid transfer protein family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=103

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LKEQQ CLCGYI  P  G Y+   N   + A CG+P P C
Sbjct  64   LKEQQSCLCGYIKTPAFGHYVIPKNAHKLLAACGIPYPKC  103



>gb|EMS65828.1| putative non-specific lipid-transfer protein AKCS9 [Triticum 
urartu]
Length=95

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+EQ+ CLC Y  +P LG YIN  N++ V+A C V VP C
Sbjct  55   RLREQRRCLCRYARNPDLGRYINSQNSKEVAAACRVRVPMC  95



>ref|XP_010506694.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=96

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLKEQ+PCLCGY+ +P L  +++  N R VS  C + +P C
Sbjct  56   RLKEQKPCLCGYMRNPSLRRFVSTPNARKVSNHCRLAIPRC  96



>ref|XP_010534224.1| PREDICTED: non-specific lipid-transfer protein 2-like [Tarenaya 
hassleriana]
Length=94

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  +++  N + VS  C +P P C
Sbjct  54   KLREQKPCLCGYLKNPTLRSFVSSPNAKKVSTKCNLPFPNC  94



>ref|XP_010511588.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=102

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L EQQ CLCG+  +P    YI+  N+R V A CGV  PTC
Sbjct  62   KLTEQQSCLCGFAKNPAFAQYISSPNSRKVLAACGVAYPTC  102



>ref|XP_010506674.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
 ref|XP_010497756.1| PREDICTED: non-specific lipid-transfer protein 2-like [Camelina 
sativa]
Length=96

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLKEQ+PCLCGY+ +P L  +++  N R VS  C + +P C
Sbjct  56   RLKEQKPCLCGYMRNPSLRRFVSTPNARKVSNHCRLAIPRC  96



>ref|XP_008389256.1| PREDICTED: non-specific lipid-transfer protein 2-like [Malus 
domestica]
Length=99

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PCLC Y+ +P L   +N  N + V+ TCG P PTC
Sbjct  59   KLKEQSPCLCQYVKNPNLQRLVNSPNAKKVADTCGSPFPTC  99



>ref|NP_001065005.1| Os10g0504900 [Oryza sativa Japonica Group]
 gb|ABB47857.1| Nonspecific lipid-transfer protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26919.1| Os10g0504900 [Oryza sativa Japonica Group]
Length=82

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 22/41 (54%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
             LK QQ C C Y  DP    YIN  N R + A CG+P P C
Sbjct  41   SLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPFPNC  81



>gb|AAP54510.1| Nonspecific lipid-transfer protein 2, putative [Oryza sativa 
Japonica Group]
 gb|AAX95717.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
Length=100

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
             LK QQ C C Y  DP+   YIN  N R + A CG+P+P C
Sbjct  59   SLKAQQGCFCQYAKDPMYASYINSTNARKMIAACGIPLPNC  99



>ref|XP_010032280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Eucalyptus 
grandis]
 dbj|BAM05644.1| lipid transfer protein [Eucalyptus globulus subsp. globulus]
 gb|KCW83938.1| hypothetical protein EUGRSUZ_B00824 [Eucalyptus grandis]
 emb|CEG03556.1| unnamed protein product [Fusarium acuminatum CS5907]
Length=95

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N + V++TCG P P C
Sbjct  55   KIKEQKPCLCQYLQNPNLKKFVSSPNAKKVASTCGTPFPKC  95



>sp|P86809.1|NLTP2_APIGA RecName: Full=Non-specific lipid-transfer protein 2; AltName: 
Full=Allergen Api g 6.0101; AltName: Allergen=Api g 6 [Apium 
graveolens Rapaceum Group]
Length=67

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGV  373
            +LKEQ+PCLCGY+ DP L  Y+N    R  +++CGV
Sbjct  28   KLKEQKPCLCGYLKDPNLKNYVNSPGARKTASSCGV  63



>gb|AAP54508.1| Nonspecific lipid-transfer protein 2, putative [Oryza sativa 
Japonica Group]
 gb|AAX95716.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|EAZ16615.1| hypothetical protein OsJ_32087 [Oryza sativa Japonica Group]
Length=100

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 23/41 (56%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
             LK QQ C C Y  DP    YIN  N R + A CG+P+P C
Sbjct  59   SLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPLPNC  99



>gb|ACM78620.1| non-specific lipid-transfer protein type 2 [Tamarix hispida]
Length=94

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPV  379
            RL+EQ PCLCGY  DP L  Y+N  N + V+ TCGV V
Sbjct  55   RLREQTPCLCGYYRDPNLRQYVNSPNAQKVARTCGVSV  92



>ref|XP_006367505.1| PREDICTED: uncharacterized protein LOC102587705 [Solanum tuberosum]
Length=174

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCG  370
            +LKEQ PCLCGY NDP L PY+   N + V  TCG
Sbjct  56   KLKEQVPCLCGYFNDPTLKPYVGSPNAQKVFQTCG  90



>gb|AAX95718.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|EAY79131.1| hypothetical protein OsI_34238 [Oryza sativa Indica Group]
 gb|EAZ16616.1| hypothetical protein OsJ_32088 [Oryza sativa Japonica Group]
Length=101

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 22/41 (54%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
             LK QQ C C Y  DP    YIN  N R + A CG+P P C
Sbjct  60   SLKAQQGCFCQYAKDPTYASYINSTNARKMIAACGIPFPNC  100



>ref|XP_009111220.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Brassica rapa]
Length=82

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC YIN  +  PY++  N + V A CG+P P C
Sbjct  40   KLKEQESCLCKYINKRLFPPYVSSANVQKVLAACGIPYPIC  80



>ref|XP_004235834.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=93

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R+++Q+PCLC Y+ +P L  Y+N    + V+ TCGVP P C
Sbjct  53   RIRQQKPCLCTYLKNPTLRNYVNSPGAKKVANTCGVPYPKC  93



>gb|AAS79106.1| probable lipid transfer protein family protein [Tamarix androssowii]
Length=94

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPV  379
            RL+EQ PCLCGY  DP L  Y+N  N + V+ TCGV V
Sbjct  55   RLREQTPCLCGYYRDPNLRQYVNSPNAQKVARTCGVSV  92



>gb|EMT19327.1| Putative non-specific lipid-transfer protein AKCS9 [Aegilops 
tauschii]
Length=95

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+ CLC Y  +P LG YIN  N++ V+A C V VP C
Sbjct  55   KLREQRRCLCRYARNPDLGKYINSQNSKEVAAACRVRVPMC  95



>ref|XP_006365399.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Solanum tuberosum]
Length=94

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++K+Q+PCLC Y+ +P L  Y+N    + V+ +CGVP P C
Sbjct  54   KIKQQKPCLCQYLKNPTLKKYVNSPGAKKVARSCGVPYPRC  94



>ref|XP_009792617.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++K+Q+PCLC Y+ +P L  Y+N    + V+ TCGVP P C
Sbjct  53   KIKQQKPCLCQYLKNPNLKKYVNSPAAKKVARTCGVPYPRC  93



>ref|XP_004241634.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=94

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++K+Q+PCLC Y+ +P L  Y+N    + V+ +CGVP P C
Sbjct  54   KIKQQKPCLCQYLKNPTLKKYVNSPGAKKVARSCGVPYPRC  94



>ref|XP_009589151.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++K+Q+PCLC Y+ +P L  Y+N    + V+ TCGVP P C
Sbjct  53   KIKQQKPCLCQYLKNPNLKKYVNSPAAKKVARTCGVPYPRC  93



>gb|EMT28561.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=96

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQQ C+C Y  DP L  Y++  N + V A C VPVP+C
Sbjct  56   KMKEQQTCMCQYARDPNLKQYVDSPNGKKVMAACKVPVPSC  96



>ref|XP_002887080.1| hypothetical protein ARALYDRAFT_475781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63339.1| hypothetical protein ARALYDRAFT_475781 [Arabidopsis lyrata subsp. 
lyrata]
Length=103

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L EQQ CLCG+  +P    YI+  N R V  TCGV  PTC
Sbjct  63   KLTEQQSCLCGFAKNPAFAQYISSPNARKVLVTCGVAYPTC  103



>ref|XP_009113462.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brassica 
rapa]
Length=97

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +  L  +++  N R VS  C +P+P C
Sbjct  57   KLKEQKPCLCGYMRNRSLRRFVSSPNARKVSNRCKLPIPRC  97



>ref|XP_004288629.1| PREDICTED: non-specific lipid-transfer protein 2-like [Fragaria 
vesca subsp. vesca]
Length=103

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK Q PCLCGYI +P    Y+   N + +S+ CGVP P C
Sbjct  63   KLKGQVPCLCGYIKNPAFKKYVTGPNAQKLSSNCGVPFPRC  103



>ref|XP_010440916.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=104

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLC YI +P+   Y++  N R     C VP PTC
Sbjct  64   KLKEQEPCLCFYIKNPLYSTYVSSPNARKTLEACKVPYPTC  104



>tpg|DAA42889.1| TPA: nonspecific lipid-transfer protein [Zea mays]
Length=98

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK QQ C C ++ +P  G YIN  N R V A+CGV VP C
Sbjct  59   LKAQQGCFCQFVKNPTYGRYINSPNARKVVASCGVSVPRC  98



>ref|XP_006468752.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
 gb|KDO76904.1| hypothetical protein CISIN_1g035485mg [Citrus sinensis]
Length=93

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC Y+ DP L  ++N  N R V+  CG P P C
Sbjct  53   KLKEQRICLCQYMKDPNLRKFVNSPNARKVATVCGSPFPRC  93



>ref|XP_006855793.1| hypothetical protein AMTR_s00044p00214770 [Amborella trichopoda]
 gb|ERN17260.1| hypothetical protein AMTR_s00044p00214770 [Amborella trichopoda]
Length=94

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RLKEQQPCLC YI +P     +N  N + V+ TC  P P C
Sbjct  54   RLKEQQPCLCQYIANPQFRSIVNSDNAKKVAQTCKSPFPKC  94



>ref|XP_009804140.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=93

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLC Y+ +P L  Y+N    + V+ TCGVP P C
Sbjct  53   KIREQKPCLCQYLKNPNLRNYVNSPGAKKVARTCGVPYPKC  93



>ref|XP_008809159.1| PREDICTED: non-specific lipid-transfer protein 2 [Phoenix dactylifera]
Length=93

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
             LK QQPC C Y  +P L  YIN  N+R   A CGV +P C
Sbjct  53   ELKAQQPCFCQYAKNPNLSGYINSPNSRKAVAACGVSIPRC  93



>gb|EAY79133.1| hypothetical protein OsI_34240 [Oryza sativa Indica Group]
Length=99

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 2/42 (5%)
 Frame = +2

Query  269  LKEQQP--CLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            L+EQQ   CLC Y  DP+   Y+N  N R   A CG+P+P+C
Sbjct  58   LREQQKEGCLCQYAKDPMYASYVNNTNARKTIAACGIPIPSC  99



>ref|XP_006482397.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9-like 
[Citrus sinensis]
Length=103

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            L++Q+PCLC Y+ +P+   Y +  N+R ++ TCGVP P C
Sbjct  64   LRQQRPCLCTYLRNPLYKQYYDSPNSRRIAVTCGVPFPRC  103



>gb|KFK39166.1| hypothetical protein AALP_AA3G208800 [Arabis alpina]
Length=95

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +P L  +++  N R VS  C + +P C
Sbjct  55   KLKEQKPCLCGYMRNPSLRRFVSSPNARKVSNRCKLAIPRC  95



>ref|XP_010667862.1| PREDICTED: non-specific lipid-transfer protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  ++N  N   V+ +CG P P C
Sbjct  56   KIKEQRPCLCQYMKNPYLKKFVNTPNAWKVARSCGTPFPKC  96



>ref|XP_006448406.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
 gb|ESR61646.1| hypothetical protein CICLE_v10017614mg, partial [Citrus clementina]
Length=86

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC Y+ DP L  ++N  N R V+  CG P P C
Sbjct  46   KLKEQRICLCQYMKDPNLRKFVNSPNARKVATVCGSPFPRC  86



>ref|XP_006405794.1| hypothetical protein EUTSA_v10028094mg [Eutrema salsugineum]
 gb|ESQ47247.1| hypothetical protein EUTSA_v10028094mg [Eutrema salsugineum]
Length=102

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPC C YI +P+   Y+   N R V   C +P P+C
Sbjct  62   KLKEQQPCFCDYIKNPMYSMYVTSPNARKVLDACKIPFPSC  102



>ref|NP_001148304.1| LOC100281913 precursor [Zea mays]
 gb|ACG26594.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG27443.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG29399.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG29400.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG29407.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG30473.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG30477.1| nonspecific lipid-transfer protein precursor [Zea mays]
 gb|ACG30536.1| nonspecific lipid-transfer protein precursor [Zea mays]
Length=98

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK QQ C C ++ +P  G YIN  N R V A+CGV VP C
Sbjct  59   LKAQQGCFCQFVKNPTYGRYINSPNARKVVASCGVSVPRC  98



>ref|XP_009589620.1| PREDICTED: non-specific lipid-transfer protein 2 {ECO:0000303|PubMed:23913675}-like 
[Nicotiana tomentosiformis]
Length=93

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQ+PCLC Y+ +P L  Y+N    + V+ TCGVP P C
Sbjct  53   KIREQKPCLCQYLKNPNLRNYVNSPGAKKVARTCGVPYPKC  93



>dbj|BAM05641.1| lipid transfer protein [Eucalyptus pilularis]
 dbj|BAM05642.1| lipid transfer protein [Eucalyptus pilularis]
Length=95

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N + V+ TCG P P C
Sbjct  55   KIKEQKPCLCQYLQNPNLKKFVSSPNAKKVANTCGTPFPKC  95



>ref|XP_010232168.1| PREDICTED: non-specific lipid-transfer protein 2-like [Brachypodium 
distachyon]
Length=97

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+E +PCLC Y  +  LG YIN  ++R V+A CG+ VP C
Sbjct  57   KLRELKPCLCKYAKNRDLGKYINSRDSRKVAAACGLRVPIC  97



>ref|XP_006430727.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
 gb|ESR43967.1| hypothetical protein CICLE_v10013181mg [Citrus clementina]
Length=103

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            L++Q+PCLC Y+ +P+   Y +  N+R ++ TCGVP P C
Sbjct  64   LRQQRPCLCTYLRNPLYKQYYDSPNSRRIAVTCGVPFPRC  103



>ref|XP_008809160.1| PREDICTED: non-specific lipid-transfer protein 2-like [Phoenix 
dactylifera]
Length=93

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LK QQPC C Y  +P    Y+N  N R + + CGV VP C
Sbjct  53   KLKSQQPCFCQYKKNPSFSGYVNSSNARKIISACGVSVPRC  93



>ref|XP_010435719.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=104

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCL  YI +P+   Y++  N R   A C VP PTC
Sbjct  64   KLKEQEPCLSSYITNPLYSTYVSSPNARKTLAACNVPYPTC  104



>ref|XP_003624386.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES80604.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK45216.1| unknown [Medicago truncatula]
Length=94

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGYI +P L  Y+N   ++ V++ C V +P C
Sbjct  54   KLREQRPCLCGYIKNPNLRQYVNSPGSKRVASACNVVIPNC  94



>ref|XP_006292190.1| hypothetical protein CARUB_v10018396mg [Capsella rubella]
 gb|EOA25088.1| hypothetical protein CARUB_v10018396mg [Capsella rubella]
Length=100

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 23/40 (58%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LKEQ  CLCGYI  P  G Y+   N   + A CG+P P C
Sbjct  61   LKEQHSCLCGYIKTPAFGHYVIPKNAHKLLAACGIPYPKC  100



>emb|CDY48021.1| BnaA04g26690D [Brassica napus]
 emb|CDX95546.1| BnaC01g34380D [Brassica napus]
Length=96

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PCLCGY+ +  L  +++  N R VS  C +P+P C
Sbjct  56   KLKEQKPCLCGYMRNRSLRRFVSSPNARKVSNRCKLPIPRC  96



>gb|EYU41301.1| hypothetical protein MIMGU_mgv1a021579mg [Erythranthe guttata]
Length=96

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ PC C Y+ DP L  +I+  N + V+A CG+  P+C
Sbjct  56   KLKEQVPCFCTYLKDPTLRQFIDSPNAKKVAAACGLQQPSC  96



>gb|KDP35032.1| hypothetical protein JCGZ_09320 [Jatropha curcas]
Length=94

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVP  382
            +LKEQ+PCLC Y+ +P L   +N  N + V+ TCG P P
Sbjct  53   KLKEQKPCLCQYLKNPYLQKLVNSPNAKKVATTCGSPFP  91



>ref|XP_004961319.1| PREDICTED: non-specific lipid-transfer protein 2-like [Setaria 
italica]
Length=95

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +++EQQPC+C Y  DP L  Y++  N +   A C VPVP+C
Sbjct  55   KMREQQPCMCTYARDPNLQRYVSSPNGKKAMAACKVPVPSC  95



>emb|CDO98408.1| unnamed protein product [Coffea canephora]
Length=94

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P    ++   + + V+ TCGVP+P C
Sbjct  54   KIKEQKPCLCQYVKNPTFKQFVASPSAQKVAKTCGVPIPKC  94



>gb|AAT08689.1| lipid transfer protein [Hyacinthus orientalis]
Length=85

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPC C Y  DP L  YIN  N + V+A C V VP C
Sbjct  46   KLKEQQPCFCQYKKDPSLKGYINPANFKKVAA-CRVQVPKC  85



>gb|AAT08737.1| auxin-induced lipid transfer protein [Hyacinthus orientalis]
Length=85

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQQPC C Y  DP L  YIN  N + V+A C V VP C
Sbjct  46   KLKEQQPCFCQYKKDPSLKGYINPANFKKVAA-CRVQVPKC  85



>ref|XP_010110085.1| hypothetical protein L484_013260 [Morus notabilis]
 gb|EXC25172.1| hypothetical protein L484_013260 [Morus notabilis]
Length=94

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            ++KEQ+PCLC Y+ +P L  +++  N R V+ TC  P P C
Sbjct  54   KIKEQKPCLCQYLKNPNLKKFVDSPNARRVANTCKTPFPKC  94



>emb|CDY40833.1| BnaC01g31230D [Brassica napus]
 emb|CDY32103.1| BnaC04g44630D [Brassica napus]
Length=97

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+   N + VS +C V  P C
Sbjct  57   KLREQKPCLCGYMRNPSLRQYVTSPNAKKVSNSCKVASPHC  97



>ref|NP_001065007.1| Os10g0505500 [Oryza sativa Japonica Group]
 gb|AAP54517.1| nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|AAX95724.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 dbj|BAF26921.1| Os10g0505500 [Oryza sativa Japonica Group]
 gb|EAZ16618.1| hypothetical protein OsJ_32090 [Oryza sativa Japonica Group]
 dbj|BAG88356.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            R ++++ CLC Y  DP    Y+N  N R   A CG+P+P+C
Sbjct  54   RAQQKEGCLCQYAKDPTYASYVNNTNARKTIAACGIPIPSC  94



>ref|XP_006300368.1| hypothetical protein CARUB_v10022343mg [Capsella rubella]
 gb|EOA33266.1| hypothetical protein CARUB_v10022343mg [Capsella rubella]
Length=102

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L EQQ CLCG+  +P    YI+  N+R V + CGV  PTC
Sbjct  62   KLTEQQTCLCGFSKNPAFAQYISSPNSRKVLSACGVAYPTC  102



>gb|ACI26699.1| lipid transfer protein [Gossypium hirsutum]
Length=111

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            RL+EQ PC CGY+NDP L  + +    RTV   CGV  P C
Sbjct  71   RLREQTPCFCGYLNDPSLRQFADNPIIRTVGNACGVAYPQC  111



>emb|CDY04317.1| BnaC05g25790D [Brassica napus]
Length=97

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ+PCLCGY+ +P L  Y+   N + VS +C V  P C
Sbjct  57   KLREQKPCLCGYMRNPSLRQYVTSPNAKKVSNSCKVASPHC  97



>ref|XP_010440915.1| PREDICTED: non-specific lipid-transfer protein 2P-like [Camelina 
sativa]
Length=104

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC YI  P+ G Y+   N       CGVP P+C
Sbjct  64   KLKEQETCLCSYIKTPLYGSYVRSPNAHKTLEACGVPYPSC  104



>gb|KDO63208.1| hypothetical protein CISIN_1g036197mg [Citrus sinensis]
Length=103

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            L++Q+PCLC Y+ +P+   Y +  N R ++ TCGVP P C
Sbjct  64   LRQQRPCLCTYLRNPLYKQYYDSPNYRRIAVTCGVPFPRC  103



>ref|XP_006304814.1| hypothetical protein CARUB_v10012448mg [Capsella rubella]
 gb|EOA37712.1| hypothetical protein CARUB_v10012448mg [Capsella rubella]
Length=95

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +L+EQ PC CGY+ +P L  YIN  N+R VS+ C +  P C
Sbjct  55   KLREQTPCFCGYLRNPSLRGYINNPNSRKVSSICKISPPRC  95



>ref|XP_009113157.1| PREDICTED: probable non-specific lipid-transfer protein 2 [Brassica 
rapa]
 emb|CDY12875.1| BnaA09g13990D [Brassica napus]
Length=97

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 2/40 (5%)
 Frame = +2

Query  269  LKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            LK QQ CLCGYI +P+ G +    N  +V   CGVP PTC
Sbjct  60   LKAQQSCLCGYIQNPVYGGFFK--NAHSVFTGCGVPYPTC  97



>ref|XP_010450959.1| PREDICTED: probable non-specific lipid-transfer protein AKCS9 
[Camelina sativa]
Length=104

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+ CLC YI +P+   Y++  N R     C VP PTC
Sbjct  64   KLKEQESCLCSYIKNPLYSSYVSSPNARKTLEACTVPYPTC  104



>emb|CDP02750.1| unnamed protein product [Coffea canephora]
Length=96

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  266  RLKEQQPCLCGYINDPILGPYINVVNTRTVSATCGVPVPTC  388
            +LKEQ+PC CGYI +P    Y+N    + ++  C V +P C
Sbjct  56   KLKEQRPCFCGYIQNPTYAQYVNSPKAKGIAKACQVSIPNC  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 776559819808