BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23505_g2_i3 len=1769 path=[2624:0-464 @3089@!:465-1316
12217:1317-1657 7270:1658-1658 7271:1659-1768]

Length=1769
                                                                      Score     E

ref|XP_009621646.1|  PREDICTED: mitogen-activated protein kinase 15     661   0.0      
ref|XP_009787613.1|  PREDICTED: mitogen-activated protein kinase 15     659   0.0      
gb|AFP20219.1|  MAP kinase                                              657   0.0      
gb|AEH42670.1|  mitogen-activated protein kinase 13                     652   0.0      
ref|XP_004229459.1|  PREDICTED: mitogen-activated protein kinase ...    652   0.0      
ref|XP_010322768.1|  PREDICTED: mitogen-activated protein kinase ...    652   0.0      
ref|XP_006339417.1|  PREDICTED: mitogen-activated protein kinase ...    652   0.0      
ref|XP_010322774.1|  PREDICTED: mitogen-activated protein kinase ...    646   0.0      
ref|XP_010322764.1|  PREDICTED: mitogen-activated protein kinase ...    647   0.0      
ref|XP_010322760.1|  PREDICTED: mitogen-activated protein kinase ...    646   0.0      
ref|XP_002516796.1|  big map kinase/bmk, putative                       619   0.0      Ricinus communis
ref|XP_002279719.2|  PREDICTED: mitogen-activated protein kinase 15     610   0.0      Vitis vinifera
ref|XP_011009014.1|  PREDICTED: mitogen-activated protein kinase ...    609   0.0      
ref|XP_006378132.1|  hypothetical protein POPTR_0010s03070g             605   0.0      
gb|KDP40088.1|  hypothetical protein JCGZ_02086                         608   0.0      
gb|AHX99574.1|  mitogen-activated protein kinase 16                     606   0.0      
ref|XP_011009013.1|  PREDICTED: mitogen-activated protein kinase ...    606   0.0      
ref|XP_011009012.1|  PREDICTED: mitogen-activated protein kinase ...    606   0.0      
ref|XP_002314421.1|  mitogen-activated protein kinase                   605   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006378133.1|  hypothetical protein POPTR_0010s03070g             605   0.0      
emb|CDO98980.1|  unnamed protein product                                604   0.0      
ref|XP_007147789.1|  hypothetical protein PHAVU_006G155300g             602   0.0      
ref|XP_002312737.2|  mitogen-activated protein kinase                   602   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO74863.1|  hypothetical protein CISIN_1g0075411mg                  594   0.0      
ref|XP_007034572.1|  Mitogen-activated protein kinase 16 isoform 1      597   0.0      
gb|KDO74859.1|  hypothetical protein CISIN_1g0075411mg                  597   0.0      
ref|XP_008458545.1|  PREDICTED: mitogen-activated protein kinase ...    597   0.0      
ref|XP_008458544.1|  PREDICTED: mitogen-activated protein kinase ...    596   0.0      
ref|XP_010278805.1|  PREDICTED: mitogen-activated protein kinase ...    595   0.0      
ref|XP_006419783.1|  hypothetical protein CICLE_v10004660mg             595   0.0      
gb|KDO74861.1|  hypothetical protein CISIN_1g0075411mg                  595   0.0      
ref|XP_011013680.1|  PREDICTED: mitogen-activated protein kinase ...    595   0.0      
ref|XP_011013681.1|  PREDICTED: mitogen-activated protein kinase ...    595   0.0      
ref|XP_010278789.1|  PREDICTED: mitogen-activated protein kinase ...    594   0.0      
ref|XP_006489246.1|  PREDICTED: mitogen-activated protein kinase ...    593   0.0      
ref|XP_006489245.1|  PREDICTED: mitogen-activated protein kinase ...    595   0.0      
ref|XP_011071519.1|  PREDICTED: mitogen-activated protein kinase ...    593   0.0      
ref|XP_004168571.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    593   0.0      
ref|XP_004144959.1|  PREDICTED: mitogen-activated protein kinase ...    593   0.0      
gb|KGN46161.1|  hypothetical protein Csa_6G061230                       593   0.0      
gb|KHN37556.1|  Mitogen-activated protein kinase 16                     590   0.0      
ref|XP_003542896.1|  PREDICTED: mitogen-activated protein kinase ...    590   0.0      
ref|XP_006597569.1|  PREDICTED: mitogen-activated protein kinase ...    585   0.0      
ref|XP_003546123.1|  PREDICTED: mitogen-activated protein kinase ...    586   0.0      
gb|KHN33077.1|  Mitogen-activated protein kinase 16                     587   0.0      
ref|XP_010103450.1|  Mitogen-activated protein kinase 16                585   0.0      
ref|XP_007227726.1|  hypothetical protein PRUPE_ppa005596mg             580   0.0      
ref|XP_008223026.1|  PREDICTED: mitogen-activated protein kinase 16     583   0.0      
ref|XP_004296956.1|  PREDICTED: mitogen-activated protein kinase ...    578   0.0      
ref|XP_003594097.1|  Mitogen activated protein kinase 16-2              577   0.0      
gb|AJA29664.1|  mitogen-activated protein kinase 4                      577   0.0      
gb|ADI52623.1|  mitogen-activated protein kinase 16                     575   0.0      
gb|KHG23130.1|  Mitogen-activated protein kinase 16                     575   0.0      
ref|XP_010035838.1|  PREDICTED: mitogen-activated protein kinase 15     575   0.0      
ref|XP_007154166.1|  hypothetical protein PHAVU_003G095900g             575   0.0      
gb|KDO74855.1|  hypothetical protein CISIN_1g0075411mg                  575   0.0      
ref|XP_004486112.1|  PREDICTED: mitogen-activated protein kinase ...    574   0.0      
gb|KHN03429.1|  Mitogen-activated protein kinase 16                     565   0.0      
ref|XP_009352134.1|  PREDICTED: mitogen-activated protein kinase ...    568   0.0      
ref|XP_010255857.1|  PREDICTED: mitogen-activated protein kinase ...    566   0.0      
ref|XP_010695309.1|  PREDICTED: mitogen-activated protein kinase ...    566   0.0      
ref|XP_008353245.1|  PREDICTED: mitogen-activated protein kinase ...    566   0.0      
ref|XP_010695308.1|  PREDICTED: mitogen-activated protein kinase ...    565   0.0      
ref|XP_009365785.1|  PREDICTED: mitogen-activated protein kinase 16     565   0.0      
ref|XP_009339928.1|  PREDICTED: mitogen-activated protein kinase ...    564   0.0      
ref|XP_006584059.1|  PREDICTED: mitogen-activated protein kinase ...    562   0.0      
ref|XP_006584058.1|  PREDICTED: mitogen-activated protein kinase ...    561   0.0      
ref|XP_010931939.1|  PREDICTED: mitogen-activated protein kinase 15     560   0.0      
ref|XP_003529601.1|  PREDICTED: mitogen-activated protein kinase ...    559   0.0      
gb|KEH32220.1|  MAP kinase-like protein                                 558   0.0      
ref|XP_008793663.1|  PREDICTED: mitogen-activated protein kinase 15     556   0.0      
ref|XP_008390809.1|  PREDICTED: mitogen-activated protein kinase 15     555   0.0      
ref|XP_006600319.1|  PREDICTED: mitogen-activated protein kinase ...    553   0.0      
ref|XP_011090812.1|  PREDICTED: mitogen-activated protein kinase 16     545   0.0      
ref|XP_010921949.1|  PREDICTED: mitogen-activated protein kinase ...    543   0.0      
ref|XP_008790997.1|  PREDICTED: mitogen-activated protein kinase ...    542   0.0      
ref|XP_010524786.1|  PREDICTED: mitogen-activated protein kinase ...    538   0.0      
ref|XP_010524784.1|  PREDICTED: mitogen-activated protein kinase ...    538   0.0      
ref|XP_008790998.1|  PREDICTED: mitogen-activated protein kinase ...    538   0.0      
ref|XP_004508354.1|  PREDICTED: mitogen-activated protein kinase ...    535   0.0      
ref|XP_006400455.1|  hypothetical protein EUTSA_v10013120mg             528   4e-178   
ref|XP_004960458.1|  PREDICTED: mitogen-activated protein kinase ...    522   4e-176   
ref|XP_004960457.1|  PREDICTED: mitogen-activated protein kinase ...    523   4e-176   
gb|AGT16879.1|  mitogen activated protein kinase                        523   4e-176   
ref|XP_008670546.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    522   7e-176   
gb|KFK26139.1|  hypothetical protein AALP_AA8G208500                    522   7e-176   
gb|KFK26138.1|  hypothetical protein AALP_AA8G208500                    522   1e-175   
ref|XP_006289614.1|  hypothetical protein CARUB_v10003167mg             521   2e-175   
ref|NP_001105238.1|  LOC542143                                          520   8e-175   Zea mays [maize]
ref|XP_010420681.1|  PREDICTED: mitogen-activated protein kinase 16     517   8e-174   
sp|Q75KK8.1|MPK14_ORYSJ  RecName: Full=Mitogen-activated protein ...    516   8e-174   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78500.1|  hypothetical protein OsI_18423                          516   9e-174   Oryza sativa Indica Group [Indian rice]
ref|XP_010454159.1|  PREDICTED: mitogen-activated protein kinase ...    517   1e-173   
gb|EYU45605.1|  hypothetical protein MIMGU_mgv1a003935mg                516   1e-173   
gb|AGA37181.1|  mitogen-activated protein kinase 16.1                   516   2e-173   
gb|ACF06191.1|  mitogen activated protein kinase 16-1                   515   2e-173   Oryza sativa Indica Group [Indian rice]
emb|CDY13942.1|  BnaC09g38840D                                          515   3e-173   
ref|XP_006654030.1|  PREDICTED: mitogen-activated protein kinase ...    514   5e-173   
emb|CDY66706.1|  BnaAnng22780D                                          514   6e-173   
ref|XP_002873923.1|  mitogen-activated protein kinase 16                514   7e-173   
ref|XP_009120928.1|  PREDICTED: mitogen-activated protein kinase 16     514   9e-173   
ref|NP_197402.1|  mitogen-activated protein kinase 16                   514   1e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131716.1|  PREDICTED: mitogen-activated protein kinase ...    513   2e-172   
gb|AAL32607.1|  Unknown protein                                         513   2e-172   
ref|XP_009131715.1|  PREDICTED: mitogen-activated protein kinase ...    513   2e-172   
ref|XP_010496745.1|  PREDICTED: mitogen-activated protein kinase ...    516   4e-172   
gb|ABG54343.1|  double HA-tagged mitogen activated protein kinase 16    512   1e-171   
emb|CDX70861.1|  BnaC03g09450D                                          511   2e-171   
ref|XP_006850807.1|  hypothetical protein AMTR_s00025p00113840          509   6e-171   
ref|XP_010231730.1|  PREDICTED: mitogen-activated protein kinase 14     504   5e-169   
ref|XP_007034573.1|  Mitogen-activated protein kinase 16 isoform 2      500   2e-168   
ref|XP_010255858.1|  PREDICTED: mitogen-activated protein kinase ...    490   2e-164   
dbj|BAK06412.1|  predicted protein                                      486   8e-164   
gb|EMS68017.1|  Mitogen-activated protein kinase 14                     491   2e-163   
ref|XP_004979153.1|  PREDICTED: mitogen-activated protein kinase ...    489   2e-163   
gb|ABC54585.1|  mitogen-activated protein kinase 2                      489   3e-163   Triticum aestivum [Canadian hard winter wheat]
gb|ABG22446.1|  Extracellular signal-regulated kinase 1, putative...    484   3e-163   
ref|XP_004979154.1|  PREDICTED: mitogen-activated protein kinase ...    484   4e-163   
dbj|BAJ88123.1|  predicted protein                                      488   1e-162   
dbj|BAJ85440.1|  predicted protein                                      488   1e-162   
ref|XP_010546824.1|  PREDICTED: mitogen-activated protein kinase ...    486   2e-162   
ref|XP_010546821.1|  PREDICTED: mitogen-activated protein kinase ...    486   2e-162   
gb|KHN03034.1|  Mitogen-activated protein kinase 16                     481   2e-162   
ref|NP_001067677.2|  Os11g0271100                                       484   6e-162   Oryza sativa Japonica Group [Japonica rice]
sp|Q53N72.1|MPK15_ORYSJ  RecName: Full=Mitogen-activated protein ...    484   6e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979151.1|  PREDICTED: mitogen-activated protein kinase ...    485   7e-162   
gb|ABC54584.1|  mitogen-activated protein kinase 2                      485   2e-161   Triticum aestivum [Canadian hard winter wheat]
gb|EEC67992.1|  hypothetical protein OsI_35774                          486   3e-161   Oryza sativa Indica Group [Indian rice]
gb|EMT19997.1|  Mitogen-activated protein kinase 14                     489   1e-160   
ref|XP_004508355.1|  PREDICTED: mitogen-activated protein kinase ...    482   2e-160   
gb|ACD76441.1|  mitogen activated protein kinase 16-2                   479   5e-160   Oryza sativa Indica Group [Indian rice]
ref|XP_006662904.1|  PREDICTED: mitogen-activated protein kinase ...    479   6e-160   
gb|ABC54586.1|  mitogen-activated protein kinase 2                      479   3e-159   Triticum aestivum [Canadian hard winter wheat]
gb|KEH32219.1|  MAP kinase-like protein                                 474   7e-158   
gb|EEE51955.1|  hypothetical protein OsJ_33603                          464   1e-153   Oryza sativa Japonica Group [Japonica rice]
gb|KEH36745.1|  MAP kinase-like protein                                 445   9e-148   
ref|XP_010546826.1|  PREDICTED: mitogen-activated protein kinase ...    446   2e-147   
ref|XP_010546825.1|  PREDICTED: mitogen-activated protein kinase ...    446   2e-147   
ref|XP_007034574.1|  Mitogen-activated protein kinase 16 isoform 3      431   3e-142   
ref|XP_008340961.1|  PREDICTED: mitogen-activated protein kinase ...    426   1e-141   
gb|ABK24488.1|  unknown                                                 432   1e-140   Picea sitchensis
gb|KDP33076.1|  hypothetical protein JCGZ_13613                         424   1e-136   
ref|XP_002961155.1|  mitogen activated protein kinase 16                421   2e-136   
ref|XP_010272645.1|  PREDICTED: mitogen-activated protein kinase ...    416   1e-133   
gb|AHY20717.1|  mitogen-activated protein kinase                        410   1e-131   
ref|XP_008797488.1|  PREDICTED: mitogen-activated protein kinase ...    410   2e-131   
ref|XP_007210883.1|  hypothetical protein PRUPE_ppa002837mg             409   5e-131   
ref|XP_001765894.1|  predicted protein                                  402   7e-131   
ref|XP_008240170.1|  PREDICTED: mitogen-activated protein kinase ...    408   1e-130   
ref|NP_001146342.1|  uncharacterized protein LOC100279919               400   2e-130   Zea mays [maize]
ref|XP_006477803.1|  PREDICTED: mitogen-activated protein kinase ...    406   5e-130   
ref|XP_010926676.1|  PREDICTED: mitogen-activated protein kinase ...    406   5e-130   
ref|XP_006442323.1|  hypothetical protein CICLE_v10019362mg             406   6e-130   
tpg|DAA41368.1|  TPA: putative MAP kinase family protein                394   2e-129   
gb|ACJ85654.1|  unknown                                                 397   3e-129   Medicago truncatula
ref|XP_004303866.1|  PREDICTED: mitogen-activated protein kinase ...    404   4e-129   
ref|XP_011098082.1|  PREDICTED: mitogen-activated protein kinase ...    403   7e-129   
ref|XP_001766825.1|  predicted protein                                  398   7e-129   
ref|XP_003532097.1|  PREDICTED: mitogen-activated protein kinase ...    403   7e-129   
gb|EYU29585.1|  hypothetical protein MIMGU_mgv1a003728mg                402   7e-129   
ref|XP_008672728.1|  PREDICTED: uncharacterized protein LOC100279...    402   8e-129   
ref|XP_010924325.1|  PREDICTED: mitogen-activated protein kinase ...    403   1e-128   
gb|KDO52122.1|  hypothetical protein CISIN_1g008729mg                   400   1e-128   
ref|XP_008672727.1|  PREDICTED: uncharacterized protein LOC100279...    401   1e-128   
ref|XP_008672726.1|  PREDICTED: uncharacterized protein LOC100279...    401   2e-128   
ref|XP_010663665.1|  PREDICTED: mitogen-activated protein kinase ...    399   2e-128   
gb|AIU98489.1|  mitogen-activated protein kinase                        401   4e-128   
gb|KHM99625.1|  Mitogen-activated protein kinase 10                     401   5e-128   
gb|ABR17985.1|  unknown                                                 400   8e-128   Picea sitchensis
ref|XP_009406270.1|  PREDICTED: mitogen-activated protein kinase ...    400   9e-128   
ref|XP_007149430.1|  hypothetical protein PHAVU_005G069800g             400   9e-128   
ref|XP_004969449.1|  PREDICTED: mitogen-activated protein kinase ...    400   9e-128   
ref|XP_004969450.1|  PREDICTED: mitogen-activated protein kinase ...    399   1e-127   
emb|CBI31754.3|  unnamed protein product                                396   1e-127   
ref|XP_009377530.1|  PREDICTED: mitogen-activated protein kinase 20     399   3e-127   
ref|XP_007216974.1|  hypothetical protein PRUPE_ppa002953mg             399   3e-127   
ref|XP_004294176.1|  PREDICTED: mitogen-activated protein kinase ...    399   4e-127   
ref|XP_010924832.1|  PREDICTED: mitogen-activated protein kinase ...    395   4e-127   
ref|XP_003634202.1|  PREDICTED: mitogen-activated protein kinase ...    398   4e-127   
ref|XP_003602111.1|  Mitogen activated protein kinase 20-4              399   4e-127   
ref|XP_011082915.1|  PREDICTED: mitogen-activated protein kinase ...    399   5e-127   
ref|XP_008656722.1|  PREDICTED: mitogen-activated protein kinase ...    397   6e-127   
gb|KEH33588.1|  MAP kinase-like protein                                 398   6e-127   
ref|XP_008229412.1|  PREDICTED: mitogen-activated protein kinase 20     398   6e-127   
ref|XP_008656723.1|  PREDICTED: mitogen-activated protein kinase ...    397   7e-127   
ref|XP_002283794.2|  PREDICTED: mitogen-activated protein kinase ...    398   7e-127   Vitis vinifera
ref|XP_008348358.1|  PREDICTED: mitogen-activated protein kinase ...    398   7e-127   
ref|XP_010656933.1|  PREDICTED: mitogen-activated protein kinase ...    398   8e-127   
ref|XP_010924825.1|  PREDICTED: mitogen-activated protein kinase ...    395   9e-127   
ref|NP_001288504.1|  uncharacterized protein LOC103636141               397   1e-126   
ref|XP_006644481.1|  PREDICTED: mitogen-activated protein kinase ...    395   1e-126   
ref|XP_006644480.1|  PREDICTED: mitogen-activated protein kinase ...    396   1e-126   
ref|XP_006644479.1|  PREDICTED: mitogen-activated protein kinase ...    396   2e-126   
ref|XP_008456351.1|  PREDICTED: mitogen-activated protein kinase ...    397   2e-126   
ref|XP_010247564.1|  PREDICTED: mitogen-activated protein kinase ...    397   2e-126   
ref|XP_008368560.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    396   3e-126   
ref|XP_009356626.1|  PREDICTED: mitogen-activated protein kinase ...    396   4e-126   
gb|KDO60938.1|  hypothetical protein CISIN_1g0070502mg                  396   5e-126   
ref|XP_004969240.1|  PREDICTED: mitogen-activated protein kinase ...    396   5e-126   
gb|KDO60937.1|  hypothetical protein CISIN_1g0070502mg                  396   5e-126   
ref|XP_010261263.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    395   7e-126   
gb|ABH01192.1|  mitogen activated protein kinase 20-4                   394   7e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_002300882.2|  mitogen-activated protein kinase                   395   9e-126   Populus trichocarpa [western balsam poplar]
emb|CDM83592.1|  unnamed protein product                                394   9e-126   
ref|XP_006598124.1|  PREDICTED: mitogen-activated protein kinase ...    395   9e-126   
ref|XP_006437188.1|  hypothetical protein CICLE_v10030977mg             395   1e-125   
ref|XP_003546736.1|  PREDICTED: mitogen-activated protein kinase ...    395   1e-125   
sp|Q5SN53.2|MPK8_ORYSJ  RecName: Full=Mitogen-activated protein k...    393   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009383467.1|  PREDICTED: mitogen-activated protein kinase ...    395   1e-125   
ref|XP_011009093.1|  PREDICTED: mitogen-activated protein kinase ...    394   1e-125   
ref|XP_004503296.1|  PREDICTED: mitogen-activated protein kinase ...    391   1e-125   
ref|XP_008456353.1|  PREDICTED: mitogen-activated protein kinase ...    395   1e-125   
ref|XP_007141393.1|  hypothetical protein PHAVU_008G191500g             395   2e-125   
ref|XP_004516460.1|  PREDICTED: mitogen-activated protein kinase ...    394   2e-125   
gb|KHN47491.1|  Mitogen-activated protein kinase 19                     395   2e-125   
ref|NP_001043794.1|  Os01g0665200                                       393   2e-125   Oryza sativa Japonica Group [Japonica rice]
gb|ABF69963.1|  mitogen-activated protein kinase (MAPK), putative       393   2e-125   Musa acuminata [banana]
ref|XP_003551917.1|  PREDICTED: mitogen-activated protein kinase ...    394   3e-125   
gb|KEH21420.1|  MAP kinase-like protein                                 394   3e-125   
ref|XP_003569512.1|  PREDICTED: mitogen-activated protein kinase ...    393   3e-125   
dbj|BAJ96852.1|  predicted protein                                      393   3e-125   
gb|EYU31578.1|  hypothetical protein MIMGU_mgv1a003659mg                392   4e-125   
ref|XP_010232110.1|  PREDICTED: mitogen-activated protein kinase ...    392   4e-125   
ref|XP_010657062.1|  PREDICTED: mitogen-activated protein kinase ...    390   4e-125   
ref|XP_011009092.1|  PREDICTED: mitogen-activated protein kinase ...    393   5e-125   
ref|XP_004503294.1|  PREDICTED: mitogen-activated protein kinase ...    392   6e-125   
gb|ABE80150.1|  Serine/threonine protein kinase, active site            393   6e-125   Medicago truncatula
ref|XP_004503295.1|  PREDICTED: mitogen-activated protein kinase ...    392   7e-125   
ref|XP_006377705.1|  mitogen-activated protein kinase homologue         392   7e-125   
ref|XP_004241638.1|  PREDICTED: mitogen-activated protein kinase ...    390   7e-125   
gb|KHF98072.1|  Mitogen-activated protein kinase 20                     392   7e-125   
ref|XP_004143173.1|  PREDICTED: mitogen-activated protein kinase ...    393   8e-125   
gb|AET36534.1|  mitogen-activated protein kinase                        392   1e-124   
ref|XP_010657027.1|  PREDICTED: mitogen-activated protein kinase ...    390   2e-124   
emb|CDP06180.1|  unnamed protein product                                392   2e-124   
ref|XP_011082811.1|  PREDICTED: mitogen-activated protein kinase ...    392   2e-124   
ref|XP_006644399.1|  PREDICTED: mitogen-activated protein kinase ...    392   2e-124   
ref|XP_011044799.1|  PREDICTED: mitogen-activated protein kinase ...    392   2e-124   
ref|XP_008449538.1|  PREDICTED: mitogen-activated protein kinase ...    392   2e-124   
ref|XP_010657002.1|  PREDICTED: mitogen-activated protein kinase ...    392   2e-124   
ref|XP_009416542.1|  PREDICTED: mitogen-activated protein kinase ...    391   2e-124   
gb|KDO52123.1|  hypothetical protein CISIN_1g008729mg                   385   2e-124   
gb|KDO60939.1|  hypothetical protein CISIN_1g0070502mg                  391   2e-124   
ref|XP_003519551.1|  PREDICTED: mitogen-activated protein kinase ...    390   3e-124   
ref|XP_004512727.1|  PREDICTED: mitogen-activated protein kinase ...    389   4e-124   
ref|XP_008449539.1|  PREDICTED: mitogen-activated protein kinase ...    389   4e-124   
ref|XP_010322620.1|  PREDICTED: mitogen-activated protein kinase ...    390   5e-124   
ref|XP_006575663.1|  PREDICTED: mitogen-activated protein kinase ...    387   6e-124   
gb|KHN18099.1|  Mitogen-activated protein kinase 10                     392   6e-124   
ref|XP_004162404.1|  PREDICTED: mitogen-activated protein kinase ...    388   6e-124   
gb|AIU98493.1|  mitogen-activated protein kinase                        390   9e-124   
ref|XP_008798323.1|  PREDICTED: mitogen-activated protein kinase ...    390   1e-123   
ref|XP_009799688.1|  PREDICTED: mitogen-activated protein kinase ...    386   1e-123   
ref|XP_004961205.1|  PREDICTED: mitogen-activated protein kinase ...    389   2e-123   
ref|XP_011026270.1|  PREDICTED: mitogen-activated protein kinase ...    389   2e-123   
ref|XP_011026271.1|  PREDICTED: mitogen-activated protein kinase ...    389   3e-123   
gb|KHN38316.1|  Mitogen-activated protein kinase 20                     388   3e-123   
ref|XP_006575662.1|  PREDICTED: mitogen-activated protein kinase ...    388   3e-123   
ref|XP_006575660.1|  PREDICTED: mitogen-activated protein kinase ...    388   4e-123   
ref|XP_009415810.1|  PREDICTED: mitogen-activated protein kinase ...    387   5e-123   
ref|NP_001043642.1|  Os01g0629900                                       388   5e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71132.1|  hypothetical protein OsI_02947                          388   6e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_002966854.1|  hypothetical protein SELMODRAFT_86578              383   7e-123   
ref|XP_010916073.1|  PREDICTED: mitogen-activated protein kinase ...    387   9e-123   
ref|XP_009597023.1|  PREDICTED: mitogen-activated protein kinase ...    387   9e-123   
ref|XP_009799687.1|  PREDICTED: mitogen-activated protein kinase ...    387   9e-123   
ref|XP_009597022.1|  PREDICTED: mitogen-activated protein kinase ...    387   1e-122   
ref|XP_008784412.1|  PREDICTED: mitogen-activated protein kinase ...    387   1e-122   
ref|XP_007048849.1|  MAP kinase 20                                      387   1e-122   
ref|XP_006365407.1|  PREDICTED: mitogen-activated protein kinase ...    381   1e-122   
ref|XP_010036945.1|  PREDICTED: mitogen-activated protein kinase ...    383   1e-122   
ref|XP_004140142.1|  PREDICTED: mitogen-activated protein kinase ...    387   2e-122   
ref|XP_010036944.1|  PREDICTED: mitogen-activated protein kinase ...    383   2e-122   
gb|ABI95363.1|  mitogen-activated protein kinase 20                     386   2e-122   
ref|XP_010053360.1|  PREDICTED: mitogen-activated protein kinase 20     386   2e-122   
ref|XP_002528547.1|  big map kinase/bmk, putative                       387   2e-122   Ricinus communis
gb|AIU98491.1|  mitogen-activated protein kinase                        385   3e-122   
ref|XP_009624184.1|  PREDICTED: mitogen-activated protein kinase ...    385   3e-122   
gb|KHG25958.1|  Mitogen-activated protein kinase 19                     385   3e-122   
ref|XP_008654767.1|  PREDICTED: uncharacterized protein LOC100278...    385   5e-122   
gb|KCW89712.1|  hypothetical protein EUGRSUZ_A01974                     385   5e-122   
ref|XP_008784413.1|  PREDICTED: mitogen-activated protein kinase ...    385   5e-122   
gb|KHN11959.1|  Mitogen-activated protein kinase 20                     385   5e-122   
ref|XP_006595489.1|  PREDICTED: MAPK isoform X1                         385   5e-122   
ref|XP_008782396.1|  PREDICTED: mitogen-activated protein kinase ...    382   5e-122   
ref|XP_006451652.1|  hypothetical protein CICLE_v10007788mg             382   6e-122   
ref|XP_006490752.1|  PREDICTED: mitogen-activated protein kinase ...    385   6e-122   
ref|XP_006451653.1|  hypothetical protein CICLE_v10007788mg             385   6e-122   
ref|XP_011082812.1|  PREDICTED: mitogen-activated protein kinase ...    385   6e-122   
ref|XP_006296012.1|  hypothetical protein CARUB_v10025156mg             385   7e-122   
gb|KHG25231.1|  Mitogen-activated protein kinase 19                     384   8e-122   
gb|AAX20165.1|  putative MAPK protein kinase                            384   8e-122   
gb|AFP20228.1|  MAP kinase                                              385   9e-122   
gb|KHG03445.1|  Mitogen-activated protein kinase 9                      384   9e-122   
ref|XP_010036943.1|  PREDICTED: mitogen-activated protein kinase ...    384   1e-121   
gb|ACD76443.1|  mitogen activated protein kinase 20-1                   385   1e-121   
ref|XP_006584896.1|  PREDICTED: mitogen-activated protein kinase ...    384   1e-121   
ref|XP_006580404.1|  PREDICTED: mitogen-activated protein kinase ...    384   1e-121   
ref|XP_009611062.1|  PREDICTED: mitogen-activated protein kinase ...    384   1e-121   
ref|XP_003631085.1|  Mitogen-activated protein kinase 21-2              385   1e-121   
gb|KCW48597.1|  hypothetical protein EUGRSUZ_K02264                     382   1e-121   
gb|AAX20166.1|  putative MAPK protein kinase                            383   1e-121   
ref|XP_008800904.1|  PREDICTED: mitogen-activated protein kinase ...    381   1e-121   
ref|XP_011039113.1|  PREDICTED: mitogen-activated protein kinase 9      383   2e-121   
ref|XP_010106732.1|  Mitogen-activated protein kinase 19                383   2e-121   
gb|ABC54587.1|  mitogen-activated protein kinase                        383   2e-121   
emb|CAH10190.2|  mitogen-activated protein kinase 2                     380   2e-121   
gb|KCW48596.1|  hypothetical protein EUGRSUZ_K02264                     384   2e-121   
gb|ABD97883.1|  mitogen-activated protein kinase                        382   2e-121   
gb|KHN36943.1|  Mitogen-activated protein kinase 19                     382   3e-121   
ref|XP_008800903.1|  PREDICTED: mitogen-activated protein kinase ...    380   3e-121   
ref|XP_006378448.1|  hypothetical protein POPTR_0010s12240g             375   3e-121   
ref|XP_007152692.1|  hypothetical protein PHAVU_004G151200g             380   3e-121   
ref|XP_008351926.1|  PREDICTED: mitogen-activated protein kinase ...    383   4e-121   
ref|XP_009786579.1|  PREDICTED: mitogen-activated protein kinase ...    383   4e-121   
ref|XP_009786578.1|  PREDICTED: mitogen-activated protein kinase ...    384   4e-121   
ref|XP_006365406.1|  PREDICTED: mitogen-activated protein kinase ...    383   4e-121   
ref|XP_002307544.2|  hypothetical protein POPTR_0005s22350g             382   4e-121   
ref|XP_003567884.1|  PREDICTED: mitogen-activated protein kinase ...    382   5e-121   
gb|AJA29662.1|  mitogen-activated protein kinase 1                      382   6e-121   
gb|KHN21663.1|  Mitogen-activated protein kinase 9                      382   6e-121   
ref|XP_009360090.1|  PREDICTED: mitogen-activated protein kinase ...    383   6e-121   
ref|XP_008810980.1|  PREDICTED: mitogen-activated protein kinase ...    379   6e-121   
ref|XP_007160514.1|  hypothetical protein PHAVU_002G328300g             381   7e-121   
sp|Q67C40.1|MPK7_ORYSJ  RecName: Full=Mitogen-activated protein k...    381   7e-121   
ref|NP_001234664.1|  mitogen-activated protein kinase 12                383   7e-121   
ref|XP_008782395.1|  PREDICTED: mitogen-activated protein kinase ...    382   7e-121   
ref|XP_009396075.1|  PREDICTED: mitogen-activated protein kinase ...    379   8e-121   
dbj|BAJ88795.1|  predicted protein                                      380   1e-120   
ref|XP_011045567.1|  PREDICTED: mitogen-activated protein kinase 19     382   1e-120   
ref|XP_010323595.1|  PREDICTED: mitogen-activated protein kinase ...    382   1e-120   
ref|XP_007146354.1|  hypothetical protein PHAVU_006G033600g             381   1e-120   
ref|NP_001056342.1|  Os05g0566400                                       381   1e-120   
ref|XP_002317882.2|  hypothetical protein POPTR_0012s04590g             380   2e-120   
ref|XP_010508512.1|  PREDICTED: mitogen-activated protein kinase ...    381   2e-120   
ref|XP_008810979.1|  PREDICTED: mitogen-activated protein kinase ...    379   2e-120   
gb|EEC79708.1|  hypothetical protein OsI_21010                          381   2e-120   
ref|XP_010232054.1|  PREDICTED: mitogen-activated protein kinase ...    381   2e-120   
ref|XP_010506131.1|  PREDICTED: mitogen-activated protein kinase ...    381   2e-120   
ref|XP_010936807.1|  PREDICTED: mitogen-activated protein kinase ...    381   2e-120   
emb|CBI26902.3|  unnamed protein product                                381   2e-120   
ref|XP_010232053.1|  PREDICTED: mitogen-activated protein kinase ...    381   2e-120   
emb|CDO98368.1|  unnamed protein product                                380   2e-120   
emb|CDX79842.1|  BnaA05g03140D                                          381   3e-120   
ref|XP_002881877.1|  ATMPK20                                            380   3e-120   
ref|XP_010535017.1|  PREDICTED: mitogen-activated protein kinase ...    380   3e-120   
gb|KDP41137.1|  hypothetical protein JCGZ_03628                         381   4e-120   
gb|KHG14795.1|  Mitogen-activated protein kinase 19                     380   4e-120   
ref|XP_011084399.1|  PREDICTED: mitogen-activated protein kinase 9      380   4e-120   
ref|XP_006411560.1|  hypothetical protein EUTSA_v10016406mg             380   4e-120   
dbj|BAJ85722.1|  predicted protein                                      379   5e-120   
gb|AAU95462.1|  mitogen-activated protein kinase 9                      377   5e-120   
gb|KHG26548.1|  Mitogen-activated protein kinase 9                      384   5e-120   
ref|XP_009376706.1|  PREDICTED: mitogen-activated protein kinase ...    380   7e-120   
ref|XP_010694749.1|  PREDICTED: mitogen-activated protein kinase 19     379   7e-120   
ref|XP_002882891.1|  ATMPK19                                            379   8e-120   
ref|XP_009376705.1|  PREDICTED: mitogen-activated protein kinase ...    380   8e-120   
emb|CDX92190.1|  BnaA05g22170D                                          379   8e-120   
gb|KHG26547.1|  Mitogen-activated protein kinase 9                      383   9e-120   
ref|XP_009145940.1|  PREDICTED: mitogen-activated protein kinase 9      379   9e-120   
ref|XP_006378449.1|  hypothetical protein POPTR_0010s12240g             375   1e-119   
emb|CDY49620.1|  BnaCnng17720D                                          379   1e-119   
ref|NP_974331.1|  mitogen-activated protein kinase 9                    373   1e-119   
ref|XP_009625502.1|  PREDICTED: mitogen-activated protein kinase ...    379   1e-119   
gb|AAZ83349.1|  MAP kinase                                              376   1e-119   
gb|ACD76445.1|  mitogen activated protein kinase 20-5                   378   2e-119   
ref|XP_011038643.1|  PREDICTED: mitogen-activated protein kinase ...    375   2e-119   
gb|AFW83352.1|  putative MAP kinase family protein                      375   2e-119   
ref|XP_008374834.1|  PREDICTED: mitogen-activated protein kinase ...    379   2e-119   
ref|XP_002883103.1|  hypothetical protein ARALYDRAFT_898157             375   2e-119   
ref|XP_010517835.1|  PREDICTED: mitogen-activated protein kinase ...    378   2e-119   
gb|KFK38826.1|  hypothetical protein AALP_AA3G165500                    378   2e-119   
ref|XP_011008338.1|  PREDICTED: mitogen-activated protein kinase 9      380   3e-119   
emb|CDY60195.1|  BnaCnng35780D                                          380   3e-119   
dbj|BAJ92365.1|  predicted protein                                      378   3e-119   
ref|XP_002528477.1|  big map kinase/bmk, putative                       378   3e-119   
ref|XP_010540021.1|  PREDICTED: mitogen-activated protein kinase ...    377   3e-119   
ref|XP_011038644.1|  PREDICTED: mitogen-activated protein kinase ...    374   3e-119   
ref|XP_002322093.2|  MAP KINASE 9 family protein                        378   3e-119   
ref|NP_565989.1|  mitogen-activated protein kinase 20                   378   3e-119   
ref|XP_010549073.1|  PREDICTED: mitogen-activated protein kinase ...    377   4e-119   
ref|XP_010549070.1|  PREDICTED: mitogen-activated protein kinase ...    378   4e-119   
ref|XP_010549069.1|  PREDICTED: mitogen-activated protein kinase ...    378   4e-119   
ref|NP_566595.1|  mitogen-activated protein kinase 9                    374   4e-119   
ref|XP_009356057.1|  PREDICTED: mitogen-activated protein kinase ...    379   4e-119   
ref|XP_010537489.1|  PREDICTED: mitogen-activated protein kinase ...    377   4e-119   
gb|EMS62641.1|  Mitogen-activated protein kinase 9                      377   5e-119   
ref|XP_010549071.1|  PREDICTED: mitogen-activated protein kinase ...    377   5e-119   
emb|CDP06066.1|  unnamed protein product                                378   5e-119   
ref|XP_009133552.1|  PREDICTED: mitogen-activated protein kinase ...    377   5e-119   
ref|XP_010540020.1|  PREDICTED: mitogen-activated protein kinase ...    377   6e-119   
gb|AJA29682.1|  mitogen-activated protein kinase 28                     376   9e-119   
ref|XP_002441528.1|  hypothetical protein SORBIDRAFT_09g028690          376   9e-119   
gb|EYU17652.1|  hypothetical protein MIMGU_mgv1a005228mg                373   9e-119   
emb|CDX83515.1|  BnaA03g19910D                                          378   1e-118   
ref|XP_004137337.1|  PREDICTED: mitogen-activated protein kinase ...    378   1e-118   
ref|XP_004160419.1|  PREDICTED: mitogen-activated protein kinase ...    378   1e-118   
ref|XP_010471434.1|  PREDICTED: mitogen-activated protein kinase 15     376   1e-118   
emb|CAD42638.1|  putative MAP kinase                                    375   1e-118   
ref|XP_008453470.1|  PREDICTED: mitogen-activated protein kinase ...    378   1e-118   
emb|CDY42817.1|  BnaC03g23890D                                          377   1e-118   
ref|XP_010487271.1|  PREDICTED: mitogen-activated protein kinase ...    376   1e-118   
dbj|BAB02016.1|  MAP kinase                                             377   1e-118   
ref|XP_011023414.1|  PREDICTED: mitogen-activated protein kinase ...    372   2e-118   
ref|XP_010416184.1|  PREDICTED: mitogen-activated protein kinase ...    375   2e-118   
gb|AFW83486.1|  putative MAP kinase family protein                      370   2e-118   
ref|XP_004301256.1|  PREDICTED: mitogen-activated protein kinase ...    376   2e-118   
ref|XP_002887497.1|  ATMPK15                                            375   2e-118   
ref|XP_008226354.1|  PREDICTED: mitogen-activated protein kinase 19     376   2e-118   
ref|XP_006655621.1|  PREDICTED: mitogen-activated protein kinase ...    374   2e-118   
ref|XP_010032740.1|  PREDICTED: mitogen-activated protein kinase ...    376   2e-118   
ref|XP_007022043.1|  Mitogen-activated protein kinase 18 isoform 1      375   3e-118   
ref|XP_008449540.1|  PREDICTED: mitogen-activated protein kinase ...    371   3e-118   
gb|ABG54347.1|  HA-tagged mitogen activated protein kinase 20           376   3e-118   
ref|XP_002984293.1|  mitogen activated protein kinase 9                 369   3e-118   
ref|XP_002526023.1|  big map kinase/bmk, putative                       372   3e-118   
gb|ABG54336.1|  double HA-tagged mitogen activated protein kinase 9     373   3e-118   
ref|XP_006392783.1|  hypothetical protein EUTSA_v10011329mg             375   3e-118   
ref|XP_009142884.1|  PREDICTED: mitogen-activated protein kinase 20     375   3e-118   
gb|EPS73375.1|  hypothetical protein M569_01377                         371   3e-118   
gb|KFK41813.1|  hypothetical protein AALP_AA2G174800                    374   3e-118   
ref|XP_006406661.1|  hypothetical protein EUTSA_v10020306mg             375   4e-118   
dbj|BAA92223.1|  ATMPK9                                                 372   5e-118   
gb|EMT10806.1|  Mitogen-activated protein kinase 7                      378   5e-118   
gb|KFK35723.1|  hypothetical protein AALP_AA4G028400                    375   5e-118   
ref|XP_010487270.1|  PREDICTED: mitogen-activated protein kinase ...    375   5e-118   
ref|XP_010102161.1|  Mitogen-activated protein kinase 10                368   6e-118   
gb|EEE64795.1|  hypothetical protein OsJ_19651                          370   6e-118   
gb|AIE11757.1|  mitogen-activated protein kinase                        374   6e-118   
ref|XP_008345139.1|  PREDICTED: mitogen-activated protein kinase ...    375   6e-118   
ref|XP_010465879.1|  PREDICTED: mitogen-activated protein kinase ...    375   8e-118   
ref|XP_010506302.1|  PREDICTED: mitogen-activated protein kinase ...    374   1e-117   
ref|XP_010060767.1|  PREDICTED: mitogen-activated protein kinase ...    374   1e-117   
gb|KDP39771.1|  hypothetical protein JCGZ_04930                         374   1e-117   
ref|XP_010487718.1|  PREDICTED: mitogen-activated protein kinase 9      374   1e-117   
ref|NP_188090.2|  mitogen-activated protein kinase 19                   373   2e-117   
ref|XP_006301238.1|  hypothetical protein CARUB_v10021638mg             373   2e-117   
ref|XP_002285641.1|  PREDICTED: mitogen-activated protein kinase 19     373   2e-117   
ref|XP_004488688.1|  PREDICTED: mitogen-activated protein kinase ...    374   2e-117   
ref|XP_010428302.1|  PREDICTED: mitogen-activated protein kinase ...    373   2e-117   
ref|XP_002458224.1|  hypothetical protein SORBIDRAFT_03g029340          367   2e-117   
gb|EYU26289.1|  hypothetical protein MIMGU_mgv1a003441mg                372   2e-117   
dbj|BAB02403.1|  mitogen-activated protein kinase                       373   2e-117   
ref|XP_002298926.1|  mitogen-activated protein kinase homologue         373   3e-117   
ref|XP_006407051.1|  hypothetical protein EUTSA_v10020339mg             373   3e-117   
gb|KEH38513.1|  MAP kinase-like protein                                 370   3e-117   
gb|KGN64165.1|  hypothetical protein Csa_1G042720                       369   4e-117   
ref|XP_004969294.1|  PREDICTED: mitogen-activated protein kinase ...    369   4e-117   
ref|XP_009410318.1|  PREDICTED: mitogen-activated protein kinase ...    372   4e-117   
ref|XP_004163818.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    368   5e-117   
ref|XP_006297267.1|  hypothetical protein CARUB_v10013281mg             372   5e-117   
gb|AAT39148.1|  putative mitogen-activated protein kinase               371   5e-117   
ref|XP_007045137.1|  MAP kinase 17 isoform 1                            369   5e-117   
ref|NP_001056404.1|  Os05g0576800                                       371   5e-117   
gb|KHN23721.1|  Mitogen-activated protein kinase 9                      366   6e-117   
ref|XP_006654799.1|  PREDICTED: mitogen-activated protein kinase ...    372   7e-117   
ref|XP_008463306.1|  PREDICTED: mitogen-activated protein kinase ...    368   7e-117   
emb|CDY45117.1|  BnaC06g06380D                                          371   7e-117   
ref|XP_008463378.1|  PREDICTED: mitogen-activated protein kinase ...    368   7e-117   
ref|XP_006297202.1|  hypothetical protein CARUB_v10013210mg             372   8e-117   
ref|XP_008647727.1|  PREDICTED: LOC100279766 isoform X2                 368   9e-117   
ref|XP_009387431.1|  PREDICTED: mitogen-activated protein kinase ...    372   9e-117   
ref|XP_008463177.1|  PREDICTED: mitogen-activated protein kinase ...    367   9e-117   
ref|XP_004137496.1|  PREDICTED: mitogen-activated protein kinase ...    365   9e-117   
gb|KEH38512.1|  MAP kinase-like protein                                 368   1e-116   
ref|XP_008647726.1|  PREDICTED: LOC100279766 isoform X1                 369   1e-116   
gb|ABG54346.1|  double HA-tagged mitogen activated protein kinase 19    372   1e-116   
gb|EPS67880.1|  hypothetical protein M569_06894                         364   1e-116   
gb|AAD28617.1|AF129087_1  mitogen-activated protein kinase homologue    371   1e-116   
ref|XP_009344615.1|  PREDICTED: mitogen-activated protein kinase 19     371   1e-116   
ref|NP_565070.2|  mitogen-activated protein kinase 15                   370   1e-116   
ref|XP_009773215.1|  PREDICTED: mitogen-activated protein kinase 19     371   1e-116   
ref|XP_002972463.1|  mitogen activated protein kinase 9                 369   2e-116   
ref|XP_006348951.1|  PREDICTED: mitogen-activated protein kinase ...    371   2e-116   
ref|XP_010487272.1|  PREDICTED: mitogen-activated protein kinase ...    371   2e-116   
gb|AFW75830.1|  putative MAP kinase family protein                      368   2e-116   
ref|XP_006348950.1|  PREDICTED: mitogen-activated protein kinase ...    371   2e-116   
ref|XP_010502048.1|  PREDICTED: mitogen-activated protein kinase ...    370   2e-116   
gb|KFK39130.1|  hypothetical protein AALP_AA3G204800                    370   2e-116   
gb|KEH26925.1|  MAP kinase-like protein                                 369   3e-116   
ref|XP_006644427.1|  PREDICTED: mitogen-activated protein kinase ...    367   3e-116   
ref|XP_002437560.1|  hypothetical protein SORBIDRAFT_10g029400          369   3e-116   
ref|XP_003638417.1|  Mitogen-activated protein kinase                   370   3e-116   
gb|AFZ84574.1|  mitogen-activated protein kinase 16                     355   4e-116   
ref|XP_006587476.1|  PREDICTED: mitogen-activated protein kinase ...    367   4e-116   
dbj|BAK04331.1|  predicted protein                                      367   4e-116   
gb|KEH38511.1|  MAP kinase-like protein                                 370   4e-116   
gb|ABG22445.1|  Extracellular signal-regulated kinase 1, putative...    362   4e-116   
ref|XP_006587477.1|  PREDICTED: mitogen-activated protein kinase ...    367   5e-116   
ref|XP_010924187.1|  PREDICTED: mitogen-activated protein kinase 9      367   5e-116   
ref|XP_009394701.1|  PREDICTED: mitogen-activated protein kinase ...    367   6e-116   
ref|XP_010326968.1|  PREDICTED: mitogen-activated protein kinase ...    369   6e-116   
ref|XP_008368478.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    370   7e-116   
gb|ABG54342.1|  double HA-tagged mitogen activated protein kinase 15    369   7e-116   
emb|CDY11098.1|  BnaC06g23500D                                          368   8e-116   
ref|NP_001146196.1|  LOC100279766                                       368   8e-116   
ref|XP_010232078.1|  PREDICTED: mitogen-activated protein kinase 16     365   1e-115   
ref|XP_010465369.1|  PREDICTED: mitogen-activated protein kinase ...    369   1e-115   
ref|XP_007022044.1|  MAP kinase 19 isoform 2                            364   1e-115   
emb|CAB61750.1|  MAP kinase protein                                     365   2e-115   



>ref|XP_009621646.1| PREDICTED: mitogen-activated protein kinase 15 [Nicotiana tomentosiformis]
Length=565

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/381 (85%), Positives = 350/381 (92%), Gaps = 7/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLE+MLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLEKMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT+FMYPSAVDKFKKQFAYLEEHYGKGG VAPPERQ +SSLPR  VLYSDNS
Sbjct  365   KEFLEGQEPTNFMYPSAVDKFKKQFAYLEEHYGKGGAVAPPERQHSSSLPRACVLYSDNS  424

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQNP EVANDLSKCSIKEG++  +DR+S IP TRLPLQVP   QG AARPGR+VSSVMRY
Sbjct  425   VQNPVEVANDLSKCSIKEGEKPHVDRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVMRY  484

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-PK  610
             N+ G+AVTA++AIEQR++ RNP    QY ISN SY RRHPSCKNERGED ++GSN V  K
Sbjct  485   NNCGAAVTAADAIEQRKIARNPGGPTQYPISNASYPRRHPSCKNERGEDSSDGSNGVQAK  544

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P+QYMARKVAAAPGG G+QWY
Sbjct  545   PEQYMARKVAAAPGGPGSQWY  565


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_009787613.1| PREDICTED: mitogen-activated protein kinase 15 [Nicotiana sylvestris]
Length=566

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/382 (85%), Positives = 350/382 (92%), Gaps = 8/382 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLE+MLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLEKMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGK-GGVVAPPERQQASSLPRPSVLYSDN  952
             KEF+EG EPT+FMYPSAVDKFKKQFAYLEEHYGK GG VAPPERQ +SSLPR  VLYSDN
Sbjct  365   KEFLEGQEPTNFMYPSAVDKFKKQFAYLEEHYGKGGGAVAPPERQHSSSLPRACVLYSDN  424

Query  951   SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMR  787
             SVQNP EVANDLSKCSIKEG++  +DR+S IP TRLPLQVP   QG AARPGR+VSSVMR
Sbjct  425   SVQNPVEVANDLSKCSIKEGEKPHVDRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVMR  484

Query  786   YNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-P  613
             YN+ G+AVTA+E IEQR++ RNP    QY ISN SY RRHPSCKNERGED ++GSN V P
Sbjct  485   YNNCGAAVTAAEVIEQRKIARNPGGPTQYPISNASYPRRHPSCKNERGEDSSDGSNGVQP  544

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP+QYMARKVAAAPGG G+QWY
Sbjct  545   KPEQYMARKVAAAPGGPGSQWY  566


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|AFP20219.1| MAP kinase [Nicotiana tabacum]
Length=566

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/382 (85%), Positives = 349/382 (91%), Gaps = 8/382 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLE+MLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLEKMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGK-GGVVAPPERQQASSLPRPSVLYSDN  952
             KEF+EG EPT+FMYPSAVDKFKKQFAYLEEHYGK GG VAPPERQ +SSLPR  VLYSDN
Sbjct  365   KEFLEGQEPTNFMYPSAVDKFKKQFAYLEEHYGKGGGAVAPPERQHSSSLPRACVLYSDN  424

Query  951   SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMR  787
             SVQNP EVANDLSKCSIKEG++  +DR+S IP TRLPLQVP   QG AARPGR+VSSVMR
Sbjct  425   SVQNPVEVANDLSKCSIKEGEKPHVDRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVMR  484

Query  786   YNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-P  613
             YN+ G+AVTA E IEQR++ RNP    QY ISN SY RRHPSCKNERGED ++GSN V P
Sbjct  485   YNNCGAAVTAVEVIEQRKIARNPGGPTQYPISNASYPRRHPSCKNERGEDSSDGSNGVQP  544

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP+QYMARKVAAAPGG G+QWY
Sbjct  545   KPEQYMARKVAAAPGGPGSQWY  566


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|AEH42670.1| mitogen-activated protein kinase 13, partial [Solanum lycopersicum]
Length=494

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/381 (85%), Positives = 342/381 (90%), Gaps = 7/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  114   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  173

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  174   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  233

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  234   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  293

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLPR  VLYSDNS
Sbjct  294   KEFLEGQEPTGFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRACVLYSDNS  353

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVP   QG AARPGR+VSSV+RY
Sbjct  354   VQNPLEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVLRY  413

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-PK  610
             N+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V PK
Sbjct  414   NNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGVQPK  473

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P+QY+ARKVAAAPGG GNQWY
Sbjct  474   PEQYIARKVAAAPGGPGNQWY  494


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  38    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  74



>ref|XP_004229459.1| PREDICTED: mitogen-activated protein kinase 15 isoform X4 [Solanum 
lycopersicum]
Length=565

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/381 (85%), Positives = 342/381 (90%), Gaps = 7/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLPR  VLYSDNS
Sbjct  365   KEFLEGQEPTGFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRACVLYSDNS  424

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVP   QG AARPGR+VSSV+RY
Sbjct  425   VQNPLEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVLRY  484

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-PK  610
             N+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V PK
Sbjct  485   NNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGVQPK  544

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P+QY+ARKVAAAPGG GNQWY
Sbjct  545   PEQYIARKVAAAPGGPGNQWY  565


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010322768.1| PREDICTED: mitogen-activated protein kinase 15 isoform X3 [Solanum 
lycopersicum]
Length=566

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/382 (85%), Positives = 342/382 (90%), Gaps = 8/382 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLPR  VLYSDNS
Sbjct  365   KEFLEGQEPTGFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRACVLYSDNS  424

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSVMR  787
             VQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVPQ    G AARPGR+VSSV+R
Sbjct  425   VQNPLEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQAGGAARPGRVVSSVLR  484

Query  786   YNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-P  613
             YN+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V P
Sbjct  485   YNNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGVQP  544

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP+QY+ARKVAAAPGG GNQWY
Sbjct  545   KPEQYIARKVAAAPGGPGNQWY  566


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006339417.1| PREDICTED: mitogen-activated protein kinase 16-like [Solanum 
tuberosum]
Length=565

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/381 (85%), Positives = 342/381 (90%), Gaps = 7/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPTSFMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLPR  VLYSDNS
Sbjct  365   KEFLEGQEPTSFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRACVLYSDNS  424

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVP   QG AARPGR+VSSV+RY
Sbjct  425   VQNPVEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVLRY  484

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-PK  610
             N+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V  K
Sbjct  485   NNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGVQSK  544

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P+QY+ARKVAAAPGG GNQWY
Sbjct  545   PEQYIARKVAAAPGGPGNQWY  565


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010322774.1| PREDICTED: mitogen-activated protein kinase 16 isoform X5 [Solanum 
lycopersicum]
Length=460

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/384 (84%), Positives = 342/384 (89%), Gaps = 10/384 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  137   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  197   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP--RPSVLYSD  955
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLP  R  VLYSD
Sbjct  257   KEFLEGQEPTGFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRYRACVLYSD  316

Query  954   NSVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSV  793
             NSVQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVPQ    G AARPGR+VSSV
Sbjct  317   NSVQNPLEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQAGGAARPGRVVSSV  376

Query  792   MRYNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV  616
             +RYN+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V
Sbjct  377   LRYNNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGV  436

Query  615   -PKPDQYMARKVAAAPGGSGNQWY  547
              PKP+QY+ARKVAAAPGG GNQWY
Sbjct  437   QPKPEQYIARKVAAAPGGPGNQWY  460


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  37



>ref|XP_010322764.1| PREDICTED: mitogen-activated protein kinase 15 isoform X2 [Solanum 
lycopersicum]
Length=567

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/383 (84%), Positives = 342/383 (89%), Gaps = 9/383 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP--RPSVLYSD  955
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLP  R  VLYSD
Sbjct  365   KEFLEGQEPTGFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRYRACVLYSD  424

Query  954   NSVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVM  790
             NSVQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVP   QG AARPGR+VSSV+
Sbjct  425   NSVQNPLEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQGGAARPGRVVSSVL  484

Query  789   RYNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-  616
             RYN+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V 
Sbjct  485   RYNNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGVQ  544

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PKP+QY+ARKVAAAPGG GNQWY
Sbjct  545   PKPEQYIARKVAAAPGGPGNQWY  567


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010322760.1| PREDICTED: mitogen-activated protein kinase 15 isoform X1 [Solanum 
lycopersicum]
Length=568

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/384 (84%), Positives = 342/384 (89%), Gaps = 10/384 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLSSMRKKKP+PFS+KFP+ADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPSPESIARIRNEKARRYLSSMRKKKPVPFSHKFPHADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRNLA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PNAEEALADPYFRNLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP--RPSVLYSD  955
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHYGKGG  APPERQ +SSLP  R  VLYSD
Sbjct  365   KEFLEGQEPTGFMYPSAVDKFKKQFAYLEEHYGKGGAAAPPERQHSSSLPRYRACVLYSD  424

Query  954   NSVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSV  793
             NSVQNP EVANDLSKCSIKE ++   DR+S IP TRLPLQVPQ    G AARPGR+VSSV
Sbjct  425   NSVQNPLEVANDLSKCSIKEDEKPQADRSSMIPMTRLPLQVPQNVQAGGAARPGRVVSSV  484

Query  792   MRYNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV  616
             +RYN+ G+A TA+E IEQRR+ RNP    QY ISN SY RRHPSCKNERGED  E SN V
Sbjct  485   LRYNNCGAAATAAEVIEQRRIARNPGGPTQYPISNTSYPRRHPSCKNERGEDSTEVSNGV  544

Query  615   -PKPDQYMARKVAAAPGGSGNQWY  547
              PKP+QY+ARKVAAAPGG GNQWY
Sbjct  545   QPKPEQYIARKVAAAPGGPGNQWY  568


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_002516796.1| big map kinase/bmk, putative [Ricinus communis]
 gb|EEF45410.1| big map kinase/bmk, putative [Ricinus communis]
Length=564

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/382 (81%), Positives = 335/382 (88%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWS+GCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PK+R
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALHLLERMLAFEPKNR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPTSFMYPSAVD FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEYLEGSEPTSFMYPSAVDHFKKQFAYLEEHYGNGATVAPPERQHA-SLPRPCVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQ+ AEVANDLSKCSIKE ++  +DR+ GIP TRLPLQVP   Q  AARPG++V SV+RY
Sbjct  424   VQSSAEVANDLSKCSIKEMEKPQVDRSGGIPMTRLPLQVPQSIQASAARPGKVVGSVLRY  483

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-P  613
             N+ G+  T  EA+EQRRM+RNP    QY  +N SY RR+P CKNERGED G EGS  + P
Sbjct  484   NNCGATATTVEALEQRRMVRNPAISTQYTAANCSYPRRNPVCKNERGEDEGVEGSGGLQP  543

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QYMARKVAAA GG GN WY
Sbjct  544   KP-QYMARKVAAAQGGPGNHWY  564


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_002279719.2| PREDICTED: mitogen-activated protein kinase 15 [Vitis vinifera]
 emb|CBI26170.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 333/381 (87%), Gaps = 9/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIP S KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPLSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVR+LIYREILEYHPKML
Sbjct  305   PSAEEALADPYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRDLIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EGTEPTSFMYPSAVD+FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDNS
Sbjct  365   KEYLEGTEPTSFMYPSAVDQFKKQFAYLEEHYGNGATVAPPERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             + N AEVA+DLSKC IKE ++  +DR+ GIP  RLPLQVP   QG AARPG++V SV+RY
Sbjct  424   LHNSAEVADDLSKCCIKEVEKPHMDRSCGIPMARLPLQVPQSTQGGAARPGKVVGSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PK  610
             N+  A  A+E +EQRRM+RNP    QY  S+ SY RR+ SCKNERG++ G EGSN + PK
Sbjct  484   NNCGAAAAAEVLEQRRMVRNPPVASQYNASSCSYPRRNSSCKNERGDNEGVEGSNGLQPK  543

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GGSG+ WY
Sbjct  544   P-QYMARKVAAAQGGSGSHWY  563


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_011009014.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X3 
[Populus euphratica]
Length=559

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/378 (79%), Positives = 331/378 (88%), Gaps = 7/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPTPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE ++G+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPERQ A SLPR  VLYSDN+
Sbjct  365   KEHLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVTPPERQHA-SLPRACVLYSDNA  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             +QN AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVPQ  AARPG++VSSV+RYN+ 
Sbjct  424   IQNSAEVTNDLSKCSIKEIEKPHVDRSGGVPMTRLPLQVPQAGAARPGKVVSSVLRYNNC  483

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PKPDQ  601
              A + SE ++QRRM+RNP    QY  +N S+ RR+P+CKNERGED G E SN + PKP Q
Sbjct  484   GAAS-SENLDQRRMVRNPAISTQYTTANCSHPRRNPACKNERGEDEGVESSNGLQPKP-Q  541

Query  600   YMARKVAAAPGGSGNQWY  547
             YMARKVAAA GG GN WY
Sbjct  542   YMARKVAAAQGGPGNHWY  559


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006378132.1| hypothetical protein POPTR_0010s03070g [Populus trichocarpa]
 gb|ERP55929.1| hypothetical protein POPTR_0010s03070g [Populus trichocarpa]
Length=454

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 332/381 (87%), Gaps = 10/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  137   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  197   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPT FMYPSAVD FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  257   KEFLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNT  315

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +Q  AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVP   Q  AAR G++ SSV+RY
Sbjct  316   IQKSAEVTNDLSKCSIKEIEKPHVDRSDGMPMTRLPLQVPQSIQAGAARSGKVASSVLRY  375

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PK  610
             N+  A  A+E ++Q+RM+RNP    QYA +N SY RR+P+CKNERGED G EG N + PK
Sbjct  376   NNCGAA-AAENLDQQRMVRNPAISTQYATANCSYPRRNPACKNERGEDEGVEGPNGLQPK  434

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GG GN WY
Sbjct  435   P-QYMARKVAAAQGGPGNHWY  454


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  37



>gb|KDP40088.1| hypothetical protein JCGZ_02086 [Jatropha curcas]
Length=560

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/381 (80%), Positives = 329/381 (86%), Gaps = 12/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLE+MLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLEKMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPERQ A SLPRP VLYSDN+
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGATVTPPERQHA-SLPRPCVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQN  EV NDLSKCSIK+ ++  +DR+ GIP TRLPLQVP   Q  AARPG++V SV+RY
Sbjct  424   VQNSVEVTNDLSKCSIKDIEKPHMDRSGGIPMTRLPLQVPQSIQAGAARPGKVVGSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PK  610
             N+     A+EA+EQRRM+RNP    QY  +N SY RR+  CKNERGED G EGS  + PK
Sbjct  484   NN---CAAAEALEQRRMVRNPAISTQYTAANCSYPRRNSVCKNERGEDEGVEGSGGLQPK  540

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GG GN WY
Sbjct  541   P-QYMARKVAAAQGGPGNHWY  560


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|AHX99574.1| mitogen-activated protein kinase 16 [Betula platyphylla]
Length=563

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 327/381 (86%), Gaps = 10/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGK LFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKALFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLALCLLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALCLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGG-VVAPPERQQASSLPRPSVLYSDN  952
             KEF+EG+EPT FMYPSAVD FKKQFA+LEEHYGKGG  VAPPERQ A SLPR  VLYSDN
Sbjct  365   KEFLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGKGGSAVAPPERQHA-SLPRACVLYSDN  423

Query  951   SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMR  787
             S QN AEV +DLSKC I+E ++   DR+ GIP  RLPLQVP   QG AARPG++V SV+R
Sbjct  424   SAQNSAEVTDDLSKCCIRETEKPHTDRSCGIPMARLPLQVPPSIQGVAARPGKVVGSVLR  483

Query  786   YNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-P  613
             YN+     A+E +EQRRM+RNP    QY  SN SY RR+P+CKNERGED   E SN + P
Sbjct  484   YNNCGVAAAAEVLEQRRMVRNPAGTTQYTASNGSYPRRNPNCKNERGEDDMVESSNGLQP  543

Query  612   KPDQYMARKVAAAPGGSGNQW  550
             KP QY+ARKVAAA GGSG  W
Sbjct  544   KP-QYLARKVAAAQGGSGGHW  563


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_011009013.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X2 
[Populus euphratica]
Length=561

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/380 (79%), Positives = 332/380 (87%), Gaps = 9/380 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPTPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE ++G+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPERQ A SLPR  VLYSDN+
Sbjct  365   KEHLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVTPPERQHA-SLPRACVLYSDNA  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG--DAARPGRIVSSVMRYN  781
             +QN AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVPQG   AARPG++VSSV+RYN
Sbjct  424   IQNSAEVTNDLSKCSIKEIEKPHVDRSGGVPMTRLPLQVPQGIQGAARPGKVVSSVLRYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PKP  607
             +  A + SE ++QRRM+RNP    QY  +N S+ RR+P+CKNERGED G E SN + PKP
Sbjct  484   NCGAAS-SENLDQRRMVRNPAISTQYTTANCSHPRRNPACKNERGEDEGVESSNGLQPKP  542

Query  606   DQYMARKVAAAPGGSGNQWY  547
              QYMARKVAAA GG GN WY
Sbjct  543   -QYMARKVAAAQGGPGNHWY  561


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_011009012.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Populus euphratica]
Length=562

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/381 (79%), Positives = 332/381 (87%), Gaps = 10/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPTPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE ++G+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPERQ A SLPR  VLYSDN+
Sbjct  365   KEHLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVTPPERQHA-SLPRACVLYSDNA  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG---DAARPGRIVSSVMRY  784
             +QN AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVPQG    AARPG++VSSV+RY
Sbjct  424   IQNSAEVTNDLSKCSIKEIEKPHVDRSGGVPMTRLPLQVPQGIQAGAARPGKVVSSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PK  610
             N+  A + SE ++QRRM+RNP    QY  +N S+ RR+P+CKNERGED G E SN + PK
Sbjct  484   NNCGAAS-SENLDQRRMVRNPAISTQYTTANCSHPRRNPACKNERGEDEGVESSNGLQPK  542

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GG GN WY
Sbjct  543   P-QYMARKVAAAQGGPGNHWY  562


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_002314421.1| mitogen-activated protein kinase [Populus trichocarpa]
 gb|EEF00592.1| mitogen-activated protein kinase [Populus trichocarpa]
Length=562

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 332/381 (87%), Gaps = 10/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPT FMYPSAVD FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEFLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +Q  AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVP   Q  AAR G++ SSV+RY
Sbjct  424   IQKSAEVTNDLSKCSIKEIEKPHVDRSDGMPMTRLPLQVPQSIQAGAARSGKVASSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PK  610
             N+  A  A+E ++Q+RM+RNP    QYA +N SY RR+P+CKNERGED G EG N + PK
Sbjct  484   NNCGA-AAAENLDQQRMVRNPAISTQYATANCSYPRRNPACKNERGEDEGVEGPNGLQPK  542

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GG GN WY
Sbjct  543   P-QYMARKVAAAQGGPGNHWY  562


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006378133.1| hypothetical protein POPTR_0010s03070g [Populus trichocarpa]
 gb|ERP55930.1| hypothetical protein POPTR_0010s03070g [Populus trichocarpa]
Length=561

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/380 (80%), Positives = 332/380 (87%), Gaps = 9/380 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPT FMYPSAVD FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEFLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG--DAARPGRIVSSVMRYN  781
             +Q  AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVPQ    AAR G++ SSV+RYN
Sbjct  424   IQKSAEVTNDLSKCSIKEIEKPHVDRSDGMPMTRLPLQVPQSIQGAARSGKVASSVLRYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PKP  607
             +  A  A+E ++Q+RM+RNP    QYA +N SY RR+P+CKNERGED G EG N + PKP
Sbjct  484   NCGA-AAAENLDQQRMVRNPAISTQYATANCSYPRRNPACKNERGEDEGVEGPNGLQPKP  542

Query  606   DQYMARKVAAAPGGSGNQWY  547
              QYMARKVAAA GG GN WY
Sbjct  543   -QYMARKVAAAQGGPGNHWY  561


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>emb|CDO98980.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/382 (81%), Positives = 334/382 (87%), Gaps = 8/382 (2%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM
Sbjct  184   IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  243

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS EAIARIRNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAFDPKD
Sbjct  244   TDLLGTPSSEAIARIRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFDPKD  303

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RP AEEALADPYFRNLA+VEREPSAQPV+KMEFEFERRRITKEDVRELIYREILEYHPKM
Sbjct  304   RPNAEEALADPYFRNLAKVEREPSAQPVSKMEFEFERRRITKEDVRELIYREILEYHPKM  363

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LKE++EGTEPT+FMYPSAVDKFKKQFAYLEE YG GG  APPERQQASSLPRPSVLYSDN
Sbjct  364   LKEYLEGTEPTNFMYPSAVDKFKKQFAYLEERYGNGGAAAPPERQQASSLPRPSVLYSDN  423

Query  951   SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMR  787
             S QN AEVANDLSK  IKE ++   DR SGIP +RLPLQVP   Q  AARPG++V SV+R
Sbjct  424   STQNVAEVANDLSKFCIKEVEKSNTDRISGIPMSRLPLQVPPSIQAGAARPGKVVGSVLR  483

Query  786   YNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-P  613
             YN+ G+A  A+EAIEQRRM RN     QY +S  SY +RHPS K+++ E+  EG N + P
Sbjct  484   YNNCGAAAAAAEAIEQRRMARNSAVPNQYGVSASSYPKRHPSYKSDK-EESIEGPNPLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP+QYMARKVAAA  GSG+QWY
Sbjct  543   KPEQYMARKVAAAQVGSGSQWY  564


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_007147789.1| hypothetical protein PHAVU_006G155300g [Phaseolus vulgaris]
 gb|ESW19783.1| hypothetical protein PHAVU_006G155300g [Phaseolus vulgaris]
Length=563

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/383 (80%), Positives = 334/383 (87%), Gaps = 13/383 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIF+ELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFSELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKP+PFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPVPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ A SLPRP VLYSDN 
Sbjct  365   KEFLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVAPPERQHA-SLPRPCVLYSDNK  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             + N +EVA+DLSKC IKE +R  +DR++ IP +RLPLQ P   QG AARPG++V SVMRY
Sbjct  424   IHNTSEVADDLSKCCIKEVERQPVDRSNVIPMSRLPLQAPQNIQGVAARPGKVVGSVMRY  483

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG--EDGNEGSNTV-  616
             N+ G AVTA    EQRRM+RNP+   Q+A S+ SY RR+P  K+ERG  +DG EGS+ + 
Sbjct  484   NNCGVAVTAE--TEQRRMVRNPSVPAQFAASSCSYPRRNPGYKSERGAEDDGIEGSSGLQ  541

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PKP QYMARKVAAAPGG G QWY
Sbjct  542   PKP-QYMARKVAAAPGGPGGQWY  563


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_002312737.2| mitogen-activated protein kinase [Populus trichocarpa]
 gb|EEE90104.2| mitogen-activated protein kinase [Populus trichocarpa]
Length=562

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/381 (79%), Positives = 331/381 (87%), Gaps = 10/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIF+ELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFSELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PEAIAR+RNEKARRYLSSMRKKKP+PFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPTPEAIARVRNEKARRYLSSMRKKKPVPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE ++G+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPERQ A SLPR  VLYSDN+
Sbjct  365   KEHLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGAPVTPPERQHA-SLPRACVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +QN AEV NDLSKCSIKE ++  +DR+ GIP TRLPLQVP   Q  AARPG++VSSV+RY
Sbjct  424   IQNSAEVTNDLSKCSIKEIEKPHVDRSGGIPMTRLPLQVPQSIQAGAARPGKVVSSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDG-NEGSNTV-PK  610
             N+  A +A E ++QRRM+RNP    QY  +N S+ RR+P+CKNERGED   EGSN + PK
Sbjct  484   NNCGAPSA-ENLDQRRMVRNPAISTQYTTANSSHPRRNPACKNERGEDEVVEGSNGLQPK  542

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GG GN WY
Sbjct  543   P-QYMARKVAAAQGGPGNHWY  562


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KDO74863.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
Length=449

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/378 (80%), Positives = 332/378 (88%), Gaps = 9/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDR
Sbjct  137   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+ML
Sbjct  197   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +
Sbjct  257   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGTTVAPPERQHA-SLPRPCVLYSDKT  315

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             VQN A V +DLSKCSIKE ++  +DR SGIP  RLP+QVPQG AARPG++VSSV+RYN+ 
Sbjct  316   VQNSAAVTDDLSKCSIKEVEKPPMDRTSGIPMARLPIQVPQG-AARPGKVVSSVLRYNNC  374

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKPDQ  601
              A  A+EA++QRR++RNP    QYA S  SY RR  +CKNER  D + EGSN + PKP Q
Sbjct  375   GAAAAAEALDQRRVVRNPAVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP-Q  431

Query  600   YMARKVAAAPGGSGNQWY  547
             Y+ARKVAAA GGSG+ WY
Sbjct  432   YIARKVAAAQGGSGSNWY  449


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  37



>ref|XP_007034572.1| Mitogen-activated protein kinase 16 isoform 1 [Theobroma cacao]
 gb|EOY05498.1| Mitogen-activated protein kinase 16 isoform 1 [Theobroma cacao]
Length=563

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/381 (78%), Positives = 328/381 (86%), Gaps = 9/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYG G   AP ERQ A SLPRP VLYSDNS
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQN  +V ++LSKCSIKE ++   +R+ GIP +RLPLQVP   Q  AARPG++V SV+RY
Sbjct  424   VQNSTDVTDNLSKCSIKETEKPHTERSCGIPMSRLPLQVPQSIQAGAARPGKVVGSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDG-NEGSNTV-PK  610
             N+  A   +E +E RR +RNPT   QY  +N SY RR+P CKN+RGED   EGSN + PK
Sbjct  484   NNCGAAAVAETLEPRRTVRNPTVPTQYTATNCSYPRRNPVCKNDRGEDEVVEGSNGLQPK  543

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARKVAAA GGSG+QWY
Sbjct  544   P-QYMARKVAAAQGGSGSQWY  563


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KDO74859.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
 gb|KDO74860.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
Length=558

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/378 (80%), Positives = 331/378 (88%), Gaps = 8/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+ML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +
Sbjct  365   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGTTVAPPERQHA-SLPRPCVLYSDKT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             VQN A V +DLSKCSIKE ++  +DR SGIP  RLP+QVPQ  AARPG++VSSV+RYN+ 
Sbjct  424   VQNSAAVTDDLSKCSIKEVEKPPMDRTSGIPMARLPIQVPQAGAARPGKVVSSVLRYNNC  483

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKPDQ  601
              A  A+EA++QRR++RNP    QYA S  SY RR  +CKNER  D + EGSN + PKP Q
Sbjct  484   GAAAAAEALDQRRVVRNPAVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP-Q  540

Query  600   YMARKVAAAPGGSGNQWY  547
             Y+ARKVAAA GGSG+ WY
Sbjct  541   YIARKVAAAQGGSGSNWY  558


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008458545.1| PREDICTED: mitogen-activated protein kinase 15 isoform X2 [Cucumis 
melo]
Length=565

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/383 (78%), Positives = 329/383 (86%), Gaps = 11/383 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTP+ EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DFLGTPNAEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE+++G+EPT FMYPSAVD FKKQFA+LEEHYG G  VAPPERQ A SLPRP VLYSDN 
Sbjct  365   KEYLDGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGATVAPPERQHA-SLPRPCVLYSDNM  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQN A+VANDLSKCSIKE +R  +DRN  IP  R+P+QVP   QG+ ARPG++V SV+RY
Sbjct  424   VQNSAQVANDLSKCSIKEVERPQVDRNCNIPLARVPIQVPQSIQGNGARPGKVVGSVLRY  483

Query  783   NSG--SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER-GEDGNEGSNTV-  616
             N G  +A  A E +EQRRM RNP+  PQYA +N SY RR+ SCKNER  E+  EG N + 
Sbjct  484   NCGATAAAVAPEVLEQRRMTRNPSIPPQYAGNNCSYPRRNSSCKNERTDEEAIEGPNGLQ  543

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PKP QY+ARKVAAA GG GN WY
Sbjct  544   PKP-QYIARKVAAAQGGPGNNWY  565


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008458544.1| PREDICTED: mitogen-activated protein kinase 15 isoform X1 [Cucumis 
melo]
Length=566

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/384 (78%), Positives = 329/384 (86%), Gaps = 12/384 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTP+ EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DFLGTPNAEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE+++G+EPT FMYPSAVD FKKQFA+LEEHYG G  VAPPERQ A SLPRP VLYSDN 
Sbjct  365   KEYLDGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGATVAPPERQHA-SLPRPCVLYSDNM  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSVMR  787
             VQN A+VANDLSKCSIKE +R  +DRN  IP  R+P+QVPQ    G+ ARPG++V SV+R
Sbjct  424   VQNSAQVANDLSKCSIKEVERPQVDRNCNIPLARVPIQVPQSIQAGNGARPGKVVGSVLR  483

Query  786   YNSG--SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER-GEDGNEGSNTV  616
             YN G  +A  A E +EQRRM RNP+  PQYA +N SY RR+ SCKNER  E+  EG N +
Sbjct  484   YNCGATAAAVAPEVLEQRRMTRNPSIPPQYAGNNCSYPRRNSSCKNERTDEEAIEGPNGL  543

Query  615   -PKPDQYMARKVAAAPGGSGNQWY  547
              PKP QY+ARKVAAA GG GN WY
Sbjct  544   QPKP-QYIARKVAAAQGGPGNNWY  566


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010278805.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X2 
[Nelumbo nucifera]
Length=560

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/379 (79%), Positives = 326/379 (86%), Gaps = 8/379 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDL+T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFR LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD+FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEFLEGTESTGFMYPSAVDQFKKQFAYLEEHYGNGATVAPPERQHA-SLPRPCVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDRL--DRNSGIPTTRLPLQVPQG-DAARPGRIVSSVMRYNS  778
              Q+ AEV  DLSKCSIKE ++   DR  GIPTTR+PLQVPQ    A+PG++V SV+RYN+
Sbjct  424   AQSSAEVTGDLSKCSIKEVEKTQPDRGCGIPTTRVPLQVPQRLQGAKPGKVVGSVLRYNN  483

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE-DGNEGSNTV-PKPD  604
                  A+EA+EQRRM RN     Q A S  SY RR+P CKNE GE +G EGSN+V PKP 
Sbjct  484   CGVAAATEALEQRRMARNTAVTAQCAPSC-SYPRRNPGCKNESGESEGLEGSNSVQPKP-  541

Query  603   QYMARKVAAAPGGSGNQWY  547
             Q++ARKVAAA GG G+ WY
Sbjct  542   QFLARKVAAAQGGPGSNWY  560


 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHFQFFLYQLLRGLKYIHTA  145



>ref|XP_006419783.1| hypothetical protein CICLE_v10004660mg [Citrus clementina]
 gb|ESR33023.1| hypothetical protein CICLE_v10004660mg [Citrus clementina]
Length=557

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/378 (80%), Positives = 332/378 (88%), Gaps = 9/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+ML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +
Sbjct  365   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGSTVAPPERQHA-SLPRPCVLYSDKT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             VQN A V +DLSKCSIKE ++  +DR SGIP  RLP+QVPQG AARPG++VSSV+RYN+ 
Sbjct  424   VQNSAAVTDDLSKCSIKEVEKPPMDRTSGIPMARLPIQVPQG-AARPGKVVSSVLRYNNC  482

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKPDQ  601
              A  A+EA++QRR++RNP    QYA S  SY RR  +CKNER  D + EGSN + PKP Q
Sbjct  483   GAAAAAEALDQRRVVRNPAVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP-Q  539

Query  600   YMARKVAAAPGGSGNQWY  547
             Y+ARKVAAA GGSG+ WY
Sbjct  540   YIARKVAAAQGGSGSNWY  557


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KDO74861.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
 gb|KDO74862.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
Length=557

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/378 (80%), Positives = 332/378 (88%), Gaps = 9/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+ML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +
Sbjct  365   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGTTVAPPERQHA-SLPRPCVLYSDKT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             VQN A V +DLSKCSIKE ++  +DR SGIP  RLP+QVPQG AARPG++VSSV+RYN+ 
Sbjct  424   VQNSAAVTDDLSKCSIKEVEKPPMDRTSGIPMARLPIQVPQG-AARPGKVVSSVLRYNNC  482

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKPDQ  601
              A  A+EA++QRR++RNP    QYA S  SY RR  +CKNER  D + EGSN + PKP Q
Sbjct  483   GAAAAAEALDQRRVVRNPAVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP-Q  539

Query  600   YMARKVAAAPGGSGNQWY  547
             Y+ARKVAAA GGSG+ WY
Sbjct  540   YIARKVAAAQGGSGSNWY  557


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_011013680.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Populus euphratica]
Length=564

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/382 (78%), Positives = 332/382 (87%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPTPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EP  FMYPSAVD FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEFLDGSEPIGFMYPSAVDHFKKQFAYLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNA  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +QN AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVP   Q  AA   ++ SSV+RY
Sbjct  424   IQNSAEVTNDLSKCSIKEIEKPHVDRSDGMPMTRLPLQVPQSIQAGAAGSVKVASSVLRY  483

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-P  613
             N+ G+A  A+E ++Q+RM+RNP    QYA +N SY RR+P+CKNERGED G EG N + P
Sbjct  484   NNCGAAAAAAENLDQQRMVRNPAISTQYATANCSYPRRNPACKNERGEDEGVEGPNGLQP  543

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QYMARK+AAA GG GN WY
Sbjct  544   KP-QYMARKLAAAQGGPGNHWY  564


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_011013681.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X2 
[Populus euphratica]
Length=563

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/381 (78%), Positives = 332/381 (87%), Gaps = 9/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPTPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREP+AQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPTAQPVTKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EP  FMYPSAVD FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEFLDGSEPIGFMYPSAVDHFKKQFAYLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNA  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG--DAARPGRIVSSVMRYN  781
             +QN AEV NDLSKCSIKE ++  +DR+ G+P TRLPLQVPQ    AA   ++ SSV+RYN
Sbjct  424   IQNSAEVTNDLSKCSIKEIEKPHVDRSDGMPMTRLPLQVPQSIQGAAGSVKVASSVLRYN  483

Query  780   S-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED-GNEGSNTV-PK  610
             + G+A  A+E ++Q+RM+RNP    QYA +N SY RR+P+CKNERGED G EG N + PK
Sbjct  484   NCGAAAAAAENLDQQRMVRNPAISTQYATANCSYPRRNPACKNERGEDEGVEGPNGLQPK  543

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P QYMARK+AAA GG GN WY
Sbjct  544   P-QYMARKLAAAQGGPGNHWY  563


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010278789.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010278797.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Nelumbo nucifera]
Length=561

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/380 (79%), Positives = 326/380 (86%), Gaps = 9/380 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDL+T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFR LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD+FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYSDN+
Sbjct  365   KEFLEGTESTGFMYPSAVDQFKKQFAYLEEHYGNGATVAPPERQHA-SLPRPCVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDRL--DRNSGIPTTRLPLQVPQ--GDAARPGRIVSSVMRYN  781
              Q+ AEV  DLSKCSIKE ++   DR  GIPTTR+PLQVPQ     A+PG++V SV+RYN
Sbjct  424   AQSSAEVTGDLSKCSIKEVEKTQPDRGCGIPTTRVPLQVPQRLQVGAKPGKVVGSVLRYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE-DGNEGSNTV-PKP  607
             +     A+EA+EQRRM RN     Q A S  SY RR+P CKNE GE +G EGSN+V PKP
Sbjct  484   NCGVAAATEALEQRRMARNTAVTAQCAPSC-SYPRRNPGCKNESGESEGLEGSNSVQPKP  542

Query  606   DQYMARKVAAAPGGSGNQWY  547
              Q++ARKVAAA GG G+ WY
Sbjct  543   -QFLARKVAAAQGGPGSNWY  561


 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHFQFFLYQLLRGLKYIHTA  145



>ref|XP_006489246.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Citrus sinensis]
 gb|KDO74857.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
 gb|KDO74858.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
Length=560

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 332/380 (87%), Gaps = 10/380 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+ML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +
Sbjct  365   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGTTVAPPERQHA-SLPRPCVLYSDKT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG--DAARPGRIVSSVMRYN  781
             VQN A V +DLSKCSIKE ++  +DR SGIP  RLP+QVPQG   AARPG++VSSV+RYN
Sbjct  424   VQNSAAVTDDLSKCSIKEVEKPPMDRTSGIPMARLPIQVPQGMQGAARPGKVVSSVLRYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKP  607
             +  A  A+EA++QRR++RNP    QYA S  SY RR  +CKNER  D + EGSN + PKP
Sbjct  484   NCGAAAAAEALDQRRVVRNPAVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP  541

Query  606   DQYMARKVAAAPGGSGNQWY  547
              QY+ARKVAAA GGSG+ WY
Sbjct  542   -QYIARKVAAAQGGSGSNWY  560


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006489245.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Citrus sinensis]
Length=586

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/378 (80%), Positives = 332/378 (88%), Gaps = 9/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  214   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  273

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDR
Sbjct  274   DLLGTPSPEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDR  333

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+ML
Sbjct  334   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQML  393

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +
Sbjct  394   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGTTVAPPERQHA-SLPRPCVLYSDKT  452

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             VQN A V +DLSKCSIKE ++  +DR SGIP  RLP+QVPQG AARPG++VSSV+RYN+ 
Sbjct  453   VQNSAAVTDDLSKCSIKEVEKPPMDRTSGIPMARLPIQVPQG-AARPGKVVSSVLRYNNC  511

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKPDQ  601
              A  A+EA++QRR++RNP    QYA S  SY RR  +CKNER  D + EGSN + PKP Q
Sbjct  512   GAAAAAEALDQRRVVRNPAVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP-Q  568

Query  600   YMARKVAAAPGGSGNQWY  547
             Y+ARKVAAA GGSG+ WY
Sbjct  569   YIARKVAAAQGGSGSNWY  586


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  138   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  174



>ref|XP_011071519.1| PREDICTED: mitogen-activated protein kinase 15-like [Sesamum 
indicum]
Length=564

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/382 (78%), Positives = 325/382 (85%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE IARIRNEKARRYLSSMRKKK IP S+KFPNADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPPPETIARIRNEKARRYLSSMRKKKAIPLSHKFPNADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PSAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG EPTSFMYPSAVDKFKKQFAYLEEHYG G   APPERQ +SSLPRP VLYSDNS
Sbjct  365   KEYLEGAEPTSFMYPSAVDKFKKQFAYLEEHYGSGA-AAPPERQHSSSLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG----DAARPGRIVSSVMR  787
              QN ++V NDLSKCSIKE ++  +DR S +P TRLP+QVPQ      AARPG++V  V+R
Sbjct  424   NQNLSDVTNDLSKCSIKEVEKPQVDR-SVLPMTRLPVQVPQSIQARGAARPGKVVGPVLR  482

Query  786   YNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-P  613
             YN+ G A  + EA EQR+M+RNP    QY +   SY R+HP CK++ GE   EGSN + P
Sbjct  483   YNNCGVAAASMEATEQRKMVRNPGMPAQYIVPGSSYPRKHPGCKSDGGEGIAEGSNGLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KPD YMARKVAAA  G+G+ WY
Sbjct  543   KPDLYMARKVAAAQSGAGSHWY  564


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_004168571.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
16-like [Cucumis sativus]
Length=565

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/383 (78%), Positives = 330/383 (86%), Gaps = 11/383 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTP+ EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DFLGTPNAEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPT FMYPSAVD FKKQFA+LEEHYG G  VAPPERQ A SLPRP VLYSDN 
Sbjct  365   KEFLDGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNM  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQNPA+VANDLSKCSIKE +R  +DR   IP  R+P+QVP   QG+ ARPG++V SV+RY
Sbjct  424   VQNPAQVANDLSKCSIKEVERPPVDRTCNIPLARVPIQVPQSIQGNGARPGKVVGSVLRY  483

Query  783   NSGSAVTAS--EAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG-EDGNEGSNTV-  616
             N G+A  A   E +EQRRM RNP+  PQYA +N SY+RR+ SCKNER  E+  EG N + 
Sbjct  484   NCGAAAAAVAPEVLEQRRMTRNPSIPPQYAGNNCSYTRRNSSCKNERADEEAIEGPNGLQ  543

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PKP QY+ARKVAAA GG GN WY
Sbjct  544   PKP-QYIARKVAAAQGGPGNNWY  565


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_004144959.1| PREDICTED: mitogen-activated protein kinase 16-like [Cucumis 
sativus]
 ref|XP_004153181.1| PREDICTED: mitogen-activated protein kinase 16-like [Cucumis 
sativus]
Length=565

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/383 (78%), Positives = 330/383 (86%), Gaps = 11/383 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTP+ EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DFLGTPNAEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPT FMYPSAVD FKKQFA+LEEHYG G  VAPPERQ A SLPRP VLYSDN 
Sbjct  365   KEFLDGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNM  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQNPA+VANDLSKCSIKE +R  +DR   IP  R+P+QVP   QG+ ARPG++V SV+RY
Sbjct  424   VQNPAQVANDLSKCSIKEVERPPVDRTCNIPLARVPIQVPQSIQGNGARPGKVVGSVLRY  483

Query  783   NSGSAVTAS--EAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG-EDGNEGSNTV-  616
             N G+A  A   E +EQRRM RNP+  PQYA +N SY+RR+ SCKNER  E+  EG N + 
Sbjct  484   NCGAAAAAVAPEVLEQRRMTRNPSIPPQYAGNNCSYTRRNSSCKNERADEEAIEGPNGLQ  543

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PKP QY+ARKVAAA GG GN WY
Sbjct  544   PKP-QYIARKVAAAQGGPGNNWY  565


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KGN46161.1| hypothetical protein Csa_6G061230 [Cucumis sativus]
Length=566

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/384 (78%), Positives = 330/384 (86%), Gaps = 12/384 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTP+ EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DFLGTPNAEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPT FMYPSAVD FKKQFA+LEEHYG G  VAPPERQ A SLPRP VLYSDN 
Sbjct  365   KEFLDGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGAPVAPPERQHA-SLPRPCVLYSDNM  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSVMR  787
             VQNPA+VANDLSKCSIKE +R  +DR   IP  R+P+QVPQ    G+ ARPG++V SV+R
Sbjct  424   VQNPAQVANDLSKCSIKEVERPPVDRTCNIPLARVPIQVPQSIQAGNGARPGKVVGSVLR  483

Query  786   YNSGSAVTAS--EAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG-EDGNEGSNTV  616
             YN G+A  A   E +EQRRM RNP+  PQYA +N SY+RR+ SCKNER  E+  EG N +
Sbjct  484   YNCGAAAAAVAPEVLEQRRMTRNPSIPPQYAGNNCSYTRRNSSCKNERADEEAIEGPNGL  543

Query  615   -PKPDQYMARKVAAAPGGSGNQWY  547
              PKP QY+ARKVAAA GG GN WY
Sbjct  544   QPKP-QYIARKVAAAQGGPGNNWY  566


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KHN37556.1| Mitogen-activated protein kinase 16 [Glycine soja]
Length=557

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/382 (78%), Positives = 327/382 (86%), Gaps = 11/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  179   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  238

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKP+P S KFPNADPLAL LLE+MLAF+PKDR
Sbjct  239   DLLGTPSLEAIARVRNEKARRYLSSMRKKKPVPLSQKFPNADPLALRLLEKMLAFEPKDR  298

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  299   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  358

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKGG V PPERQ A SLPRP VLYSD+S
Sbjct  359   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVTPPERQHA-SLPRPCVLYSDHS  417

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +QN +EVA+DLSKC IKE ++  +D +S IP +RLPLQ P   QG AARPG++V SVMRY
Sbjct  418   MQNTSEVADDLSKCCIKEVEKQPIDSSSAIPMSRLPLQAPQNIQGVAARPGKVVGSVMRY  477

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG--EDGNEGSNTV-P  613
             N+      +EA EQRR++RNP+   QYA S+ SY RR+   K+ERG  E G EGSN + P
Sbjct  478   NNCGVAGTAEA-EQRRVVRNPSVSAQYAASSCSYPRRNSGYKSERGTEEGGIEGSNGLQP  536

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QYMARKVAAA  G G QWY
Sbjct  537   KP-QYMARKVAAAQAGPGGQWY  557


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  103   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  139



>ref|XP_003542896.1| PREDICTED: mitogen-activated protein kinase 16-like [Glycine 
max]
Length=563

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/382 (78%), Positives = 327/382 (86%), Gaps = 11/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKP+P S KFPNADPLAL LLE+MLAF+PKDR
Sbjct  245   DLLGTPSLEAIARVRNEKARRYLSSMRKKKPVPLSQKFPNADPLALRLLEKMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFAYLEEHYGKGG V PPERQ A SLPRP VLYSD+S
Sbjct  365   KEFLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVTPPERQHA-SLPRPCVLYSDHS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +QN +EVA+DLSKC IKE ++  +D +S IP +RLPLQ P   QG AARPG++V SVMRY
Sbjct  424   MQNTSEVADDLSKCCIKEVEKQPIDSSSAIPMSRLPLQAPQNIQGVAARPGKVVGSVMRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG--EDGNEGSNTV-P  613
             N+      +EA EQRR++RNP+   QYA S+ SY RR+   K+ERG  E G EGSN + P
Sbjct  484   NNCGVAGTAEA-EQRRVVRNPSVSAQYAASSCSYPRRNSGYKSERGTEEGGIEGSNGLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QYMARKVAAA  G G QWY
Sbjct  543   KP-QYMARKVAAAQAGPGGQWY  563


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_006597569.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Glycine max]
Length=453

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/382 (78%), Positives = 326/382 (85%), Gaps = 13/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADP AL LLERMLAF+PKDR
Sbjct  137   DLLGTPSLEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPRALRLLERMLAFEPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  197   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ A SLPRP VLYSD+S
Sbjct  257   KEFLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVAPPERQHA-SLPRPCVLYSDHS  315

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +QN +EVA+DLSKC IKE ++  ++R+S IP +RLPLQ P   QG AARP ++V SVMRY
Sbjct  316   MQNTSEVADDLSKCCIKEVEKQPIERSSAIPMSRLPLQAPQNIQGVAARPRKVVGSVMRY  375

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG--EDGNEGSNTV-P  613
             N+      +EA EQRR++RNP+   QYA S+ SY RR+P  KNERG  +DG EGSN + P
Sbjct  376   NNCGVAVTAEA-EQRRVVRNPSVSAQYAASSCSYPRRNPGYKNERGAEDDGIEGSNGLQP  434

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             K   YMARKVAAA  G G QWY
Sbjct  435   K---YMARKVAAAQAGPGGQWY  453


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  37



>ref|XP_003546123.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Glycine max]
Length=561

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/382 (78%), Positives = 326/382 (85%), Gaps = 13/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADP AL LLERMLAF+PKDR
Sbjct  245   DLLGTPSLEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPRALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ A SLPRP VLYSD+S
Sbjct  365   KEFLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVAPPERQHA-SLPRPCVLYSDHS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +QN +EVA+DLSKC IKE ++  ++R+S IP +RLPLQ P   QG AARP ++V SVMRY
Sbjct  424   MQNTSEVADDLSKCCIKEVEKQPIERSSAIPMSRLPLQAPQNIQGVAARPRKVVGSVMRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG--EDGNEGSNTV-P  613
             N+      +EA EQRR++RNP+   QYA S+ SY RR+P  KNERG  +DG EGSN + P
Sbjct  484   NNCGVAVTAEA-EQRRVVRNPSVSAQYAASSCSYPRRNPGYKNERGAEDDGIEGSNGLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             K   YMARKVAAA  G G QWY
Sbjct  543   K---YMARKVAAAQAGPGGQWY  561


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KHN33077.1| Mitogen-activated protein kinase 16 [Glycine soja]
Length=573

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/383 (78%), Positives = 326/383 (85%), Gaps = 13/383 (3%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM
Sbjct  196   IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  255

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS KFP+ADP AL LLERMLAF+PKD
Sbjct  256   TDLLGTPSLEAIARVRNEKARRYLSSMRKKKPVPFSQKFPHADPRALRLLERMLAFEPKD  315

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKM
Sbjct  316   RPTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKM  375

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LKEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ A SLPRP VLYSD+
Sbjct  376   LKEFLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVAPPERQHA-SLPRPCVLYSDH  434

Query  951   SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMR  787
             S+QN +EVA+DLSKC IKE ++  ++R+S IP +RLPLQ P   QG AARP ++V SVMR
Sbjct  435   SMQNTSEVADDLSKCCIKEVEKQPIERSSAIPMSRLPLQAPQNIQGVAARPRKVVGSVMR  494

Query  786   YNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG--EDGNEGSNTV-  616
             YN+      +EA EQRR++RNP+   QYA S+ SY RR+P  KNERG  +DG EGSN + 
Sbjct  495   YNNCGVAVTAEA-EQRRVVRNPSVSAQYAASSCSYPRRNPGYKNERGAEDDGIEGSNGLQ  553

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PK   YMARKVAAA  G G QWY
Sbjct  554   PK---YMARKVAAAQAGPGGQWY  573


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  121   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  157



>ref|XP_010103450.1| Mitogen-activated protein kinase 16 [Morus notabilis]
 gb|AHJ80970.1| mitogen-activated protein kinase 10 [Morus notabilis]
 gb|EXB95853.1| Mitogen-activated protein kinase 16 [Morus notabilis]
Length=554

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/383 (79%), Positives = 330/383 (86%), Gaps = 10/383 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGK LFPGKNVVHQLDLMT
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKALFPGKNVVHQLDLMT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  233   DMLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  293   PSAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD-N  952
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYGKG  VAPPERQ A SLPRP VLYSD N
Sbjct  353   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGKGSNVAPPERQHA-SLPRPCVLYSDNN  411

Query  951   SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMR  787
             SVQ  AEV +DLSKC IKE ++  +DR+ GIP TRLP+QVP   QG AARPG++V SV+R
Sbjct  412   SVQTSAEVTDDLSKCCIKEVEKPQVDRSCGIPMTRLPIQVPQNIQGGAARPGKVVGSVLR  471

Query  786   YNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRH-PSCKNERGED-GNEGSNTVP  613
             YN+  A  A+EA+EQRR  RNP+   QY  +  SY RR+ P CKNERGED G EGSN + 
Sbjct  472   YNNCGAAAAAEALEQRRASRNPSVPNQYTETGVSYPRRNPPVCKNERGEDQGVEGSNGMR  531

Query  612   KPDQY-MARKVAAAPGGSGNQWY  547
             +  QY MARKVAAA GGSG+QWY
Sbjct  532   QKPQYVMARKVAAAHGGSGSQWY  554


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/30 (97%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRG  1679
             MESDLHQVIKANDDLTPEHYQFFLYQLLR 
Sbjct  104   MESDLHQVIKANDDLTPEHYQFFLYQLLRA  133



>ref|XP_007227726.1| hypothetical protein PRUPE_ppa005596mg [Prunus persica]
 gb|EMJ28925.1| hypothetical protein PRUPE_ppa005596mg [Prunus persica]
Length=452

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 330/380 (87%), Gaps = 10/380 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAID+WSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDVWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKK IPFS+KFPNADPLAL LLE+MLAF+PKDR
Sbjct  137   DLLGTPSAEAIARVRNEKARRYLSSMRKKKQIPFSHKFPNADPLALRLLEKMLAFEPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  197   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPER  A SLPR  VLYSDN+
Sbjct  257   KEYLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGATVVPPERTHA-SLPRACVLYSDNT  315

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPL-QVPQGDAARPGRIVSSVMRYNS  778
             VQ+  EVA+DLSKC IKE ++  +DR+SGIPTTRLP+ Q  QG  ARPG++V SV+R+N+
Sbjct  316   VQHSTEVADDLSKCCIKEIEKPQIDRSSGIPTTRLPVPQTIQG-GARPGKVVGSVLRFNN  374

Query  777   GSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-PKP  607
               A  A+EA+EQRRM+RNPT  PQY A S  SY RR+P CKNERG+ +G EGSN + PKP
Sbjct  375   CGAAAAAEALEQRRMVRNPTAQPQYTATSTGSYPRRNPPCKNERGDCEGVEGSNGLQPKP  434

Query  606   DQYMARKVAAAPGGSGNQWY  547
              QYM RKVAAA GGSG QWY
Sbjct  435   -QYMPRKVAAAQGGSG-QWY  452


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  37



>ref|XP_008223026.1| PREDICTED: mitogen-activated protein kinase 16 [Prunus mume]
Length=560

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/380 (79%), Positives = 331/380 (87%), Gaps = 10/380 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAID+WSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDVWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKK IPFS+KFPNADPLAL LLE+MLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKQIPFSHKFPNADPLALRLLEKMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFAYLEEHYG G  V PPER  A SLPR  VLYSDN+
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGATVVPPERTHA-SLPRACVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPL-QVPQGDAARPGRIVSSVMRYNS  778
             VQ+  EVA+DLSKC IKE ++  +DR+SGIPTTRLP+ Q  QG AARPG++V SV+R+N+
Sbjct  424   VQHSTEVADDLSKCCIKEIEKPQIDRSSGIPTTRLPVPQTIQG-AARPGKVVGSVLRFNN  482

Query  777   GSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-PKP  607
               A  A+EA+EQRRM+RNPT  PQY A S  SY RR+P CKNERG+ +G EGSN + PKP
Sbjct  483   CGAAAAAEALEQRRMVRNPTAQPQYTATSTGSYPRRNPPCKNERGDCEGVEGSNGLQPKP  542

Query  606   DQYMARKVAAAPGGSGNQWY  547
              QYM RKVAAA GGSG QWY
Sbjct  543   -QYMPRKVAAAQGGSG-QWY  560


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_004296956.1| PREDICTED: mitogen-activated protein kinase 16-like [Fragaria 
vesca subsp. vesca]
Length=561

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/379 (75%), Positives = 319/379 (84%), Gaps = 6/379 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  184   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  243

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKK+ IP S KFPNADPLAL LLERMLAF+PKDR
Sbjct  244   DLLGTPSAEAIARVRNEKARRYLSSMRKKRQIPLSQKFPNADPLALRLLERMLAFEPKDR  303

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  304   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  363

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE+++G+EPT FMYPSAVD FKKQFAYLEEHYG G V A PERQ A SLPR  V Y++NS
Sbjct  364   KEYLDGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGTVGAAPERQHA-SLPRACVSYTNNS  422

Query  948   VQNPAEVANDLSKCSIKEGDR-LDRNSGIPTTRLPLQVPQG--DAARPGRIVSSVMRYNS  778
             VQ P EV  DL+KC IKE ++ +DRN G P T+LP+Q PQ    AARPG++V SV+R+N+
Sbjct  423   VQQPTEVTEDLAKCCIKEIEKPVDRNCGFPATKLPIQAPQTMQGAARPGKVVGSVLRFNN  482

Query  777   GSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGEDGNEGSN-TVPKPD  604
               A  A+E +EQRRM+RNP    QY  ++  SY RR+ SCKNER ++  EGSN  +PKP 
Sbjct  483   CGAAAAAETLEQRRMVRNPAVPTQYTTVAGSSYPRRNASCKNEREDNEVEGSNGLLPKPP  542

Query  603   QYMARKVAAAPGGSGNQWY  547
             QY+ RKVAA  GGSG+QWY
Sbjct  543   QYIPRKVAATQGGSGSQWY  561


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  108   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  144



>ref|XP_003594097.1| Mitogen activated protein kinase 16-2 [Medicago truncatula]
 gb|AES64348.1| MAP kinase-like protein [Medicago truncatula]
Length=564

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/383 (79%), Positives = 332/383 (87%), Gaps = 12/383 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSP+AIAR+RNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAF+ KDR
Sbjct  245   DFLGTPSPDAIARVRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFEAKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ ASSLPR  VLYSDN+
Sbjct  365   KEFLEGAEPTGFMYPSAVDLFKKQFAYLEEHYGKGGTVAPPERQHASSLPRACVLYSDNT  424

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGI-PTTRLPLQVP---QGDAARPGRIVSSVMR  787
             +QN AEVA+DLSKC IKE +R  +DR+S I P TR+PLQ P   QG AARPG++V S MR
Sbjct  425   MQNTAEVADDLSKCCIKEVERPPVDRSSDIHPMTRIPLQAPQNMQGLAARPGKVVGSAMR  484

Query  786   YNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-  616
             YN+ G AVTA    EQRR++RNP    QYA S+ SY RR+P+ K+ER ED   EGSN + 
Sbjct  485   YNNCGVAVTAE--TEQRRVVRNPPVSSQYAASSCSYPRRNPNYKSERVEDDVIEGSNGLQ  542

Query  615   PKPDQYMARKVAAAPGGSGNQWY  547
             PKP QY+ARKVAAA GG+G QWY
Sbjct  543   PKP-QYIARKVAAAQGGAGGQWY  564


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|AJA29664.1| mitogen-activated protein kinase 4 [Gossypium hirsutum]
Length=549

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/379 (76%), Positives = 320/379 (84%), Gaps = 13/379 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  179   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  238

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIP S+KFPNADPLA+ LLERMLAF+PKDR
Sbjct  239   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPLSHKFPNADPLAVLLLERMLAFEPKDR  298

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  299   PSAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  358

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYG G   AP ERQ A SLPRP VLYSDNS
Sbjct  359   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHA-SLPRPCVLYSDNS  417

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQN  +V ++LSKCSIKE ++   +R+  IP +RLP QVP   Q  AARPG++V SV+RY
Sbjct  418   VQNSTDVTDNLSKCSIKETEKPQTERSFPIPMSRLPPQVPQSIQAGAARPGKVVGSVLRY  477

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPD  604
             N+  AV A EA+EQRRM RNP+   QY  +N SY RR+P CK+      +E +   PKP 
Sbjct  478   NNCGAVAAGEALEQRRMARNPSVPTQYTATNCSYPRRNPVCKD------DEENELQPKP-  530

Query  603   QYMARKVAAAPGGSGNQWY  547
             QYMARKVAAA GGS +QWY
Sbjct  531   QYMARKVAAAQGGSRSQWY  549


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  103   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  139



>gb|ADI52623.1| mitogen-activated protein kinase 16 [Gossypium hirsutum]
 gb|ADI52629.1| mitogen-activated protein kinase 16 [Gossypium hirsutum]
Length=554

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/378 (76%), Positives = 320/378 (85%), Gaps = 12/378 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIP S+KFPNADPLA+ LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPLSHKFPNADPLAVLLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PSAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYG G   AP ERQ A SLPRP VLYSDNS
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG--DAARPGRIVSSVMRYN  781
             VQN  +V ++LSKCSIKE ++   +R+  IP +RLP QVPQ    AARPG++V SV+RYN
Sbjct  424   VQNSTDVTDNLSKCSIKETEKPQPERSFPIPMSRLPPQVPQSIQGAARPGKVVGSVLRYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             +  AV A EA+EQRRM RNP+   QY  +N SY RR+P CK+      +E +   PKP Q
Sbjct  484   NCGAVAAGEALEQRRMARNPSVPTQYTATNCSYPRRNPVCKD------DEENELQPKP-Q  536

Query  600   YMARKVAAAPGGSGNQWY  547
             YMARKVAAA GGS +QWY
Sbjct  537   YMARKVAAAQGGSRSQWY  554


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KHG23130.1| Mitogen-activated protein kinase 16 [Gossypium arboreum]
Length=555

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/379 (76%), Positives = 320/379 (84%), Gaps = 13/379 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIP S+KFPNADPLA+ LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPLSHKFPNADPLAVRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+ LA+VEREPS+QPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PSAEEALADPYFKGLAKVEREPSSQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYG G   AP ERQ A SLPRP VLYSDNS
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQN  +V ++LSKCSIKE ++   +R+  IP +RLP QVP   Q  AARPG++V SV+RY
Sbjct  424   VQNSTDVTDNLSKCSIKEAEKPQTERSFPIPMSRLPPQVPQSIQAGAARPGKVVGSVLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPD  604
             N+  AV A EA+EQRRM RNP+   QY  +N SY RR+P CK+      +E +   PKP 
Sbjct  484   NNCGAVAAGEALEQRRMARNPSVPTQYTATNCSYPRRNPVCKD------DEENELQPKP-  536

Query  603   QYMARKVAAAPGGSGNQWY  547
             QYMARKVAAA GGS +QWY
Sbjct  537   QYMARKVAAAQGGSRSQWY  555


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010035838.1| PREDICTED: mitogen-activated protein kinase 15 [Eucalyptus grandis]
 gb|KCW84312.1| hypothetical protein EUGRSUZ_B01157 [Eucalyptus grandis]
Length=560

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 324/380 (85%), Gaps = 9/380 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL+T
Sbjct  184   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLIT  243

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI R+RNEKARRYLSSMRKK+PIP S KFPNADPLALCLLERMLAF+PKDR
Sbjct  244   DLLGTPSAEAIGRVRNEKARRYLSSMRKKRPIPLSQKFPNADPLALCLLERMLAFEPKDR  303

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  304   PSAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  363

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG+EPT FMYPSAVD FKKQFA+LEEHYGKG    P ERQ A SLPRP VLYSD S
Sbjct  364   KEFMEGSEPTGFMYPSAVDHFKKQFAFLEEHYGKGSTAPPLERQHA-SLPRPCVLYSD-S  421

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMR-YNS  778
             VQ   EV++D++KCSIKE D+   +RNS IP TRLPLQVPQ  AARPG+++SSV+R YN 
Sbjct  422   VQGSNEVSDDMAKCSIKETDKSHTERNSTIPMTRLPLQVPQSGAARPGKVISSVLRSYNC  481

Query  777   G-SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEG-SNTV-PKP  607
             G +A   +EA+EQRR +RNP    Q+A +  SYSRR+P CK+ER E+   G +N V PKP
Sbjct  482   GAAAAATTEAVEQRRTVRNPAIATQHASTGCSYSRRNPGCKSERAEEEGIGITNGVQPKP  541

Query  606   DQYMARKVAAAPGGSGNQWY  547
              QYM RKVAAA GG GN WY
Sbjct  542   -QYMPRKVAAANGGPGNNWY  560


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  108   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  144



>ref|XP_007154166.1| hypothetical protein PHAVU_003G095900g [Phaseolus vulgaris]
 ref|XP_007154167.1| hypothetical protein PHAVU_003G095900g [Phaseolus vulgaris]
 gb|ESW26160.1| hypothetical protein PHAVU_003G095900g [Phaseolus vulgaris]
 gb|ESW26161.1| hypothetical protein PHAVU_003G095900g [Phaseolus vulgaris]
Length=569

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/386 (74%), Positives = 315/386 (82%), Gaps = 13/386 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIAR+RNEKARRYLSSMRKKKP+PFS KFPN DPLAL +LE+MLAF+PKDR
Sbjct  245   DFLGTPSPEAIARVRNEKARRYLSSMRKKKPVPFSQKFPNVDPLALRVLEKMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE ++G EPT FMYPSAVD FKKQFAYLEEHYG+GG V PPERQ ASSLPRP VLYSDN 
Sbjct  365   KEHLDGEEPTGFMYPSAVDHFKKQFAYLEEHYGEGGTVTPPERQHASSLPRPCVLYSDNP  424

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPL-QVPQGD---------AARPGRI  805
              QN A VA+DLSKCSIKE D+  +D+   IP TR PL Q PQ           A RPG++
Sbjct  425   RQNMAVVADDLSKCSIKEVDKPAIDKTGAIPMTRPPLQQAPQNIRGVMTDRSVAPRPGKV  484

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGS  625
             V +V+RYN+      +E  EQRR  RNP+   +YA  + SY RR+P+CKNER  +G EG+
Sbjct  485   VGTVLRYNNCGVAVTTET-EQRRTGRNPSVSAKYAAQSCSYPRRNPNCKNERAVEGIEGA  543

Query  624   NTVPKPDQYMARKVAAAPGGSGNQWY  547
             N +    QY+ARKVAAA GG G  WY
Sbjct  544   NGLQTKPQYLARKVAAAQGGPGGSWY  569


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTAEHYQFFLYQLLRGLKYIHTA  145



>gb|KDO74855.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
 gb|KDO74856.1| hypothetical protein CISIN_1g0075411mg [Citrus sinensis]
Length=599

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/420 (72%), Positives = 332/420 (79%), Gaps = 51/420 (12%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARI------------------------------------------RNEK  1435
             DLLGTPSPEAIAR+                                          RNEK
Sbjct  245   DLLGTPSPEAIARVCLLLNIIWCGYDGFMCSVAPSCFLVFAIFFFFTEVLILHCQVRNEK  304

Query  1434  ARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDRPTAEEALADPYFRNLARV  1255
             ARRYLSSMRKKKPIPFS KFPNA+PLAL LLERMLAF+PKDRPTAEEALADPYF+ LA+V
Sbjct  305   ARRYLSSMRKKKPIPFSQKFPNANPLALRLLERMLAFEPKDRPTAEEALADPYFKGLAKV  364

Query  1254  EREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKMLKEFIEGTEPTSFMYPSAV  1075
             EREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHP+MLKEF+EG+EPT FMYPSAV
Sbjct  365   EREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPQMLKEFLEGSEPTGFMYPSAV  424

Query  1074  DKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNSVQNPAEVANDLSKCSIKE  895
             D FKKQFAYLEEHYGKG  VAPPERQ A SLPRP VLYSD +VQN A V +DLSKCSIKE
Sbjct  425   DHFKKQFAYLEEHYGKGTTVAPPERQHA-SLPRPCVLYSDKTVQNSAAVTDDLSKCSIKE  483

Query  894   GDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNP  721
              ++  +DR SGIP  RLP+QVPQG AARPG++VSSV+RYN+  A  A+EA++QRR++RNP
Sbjct  484   VEKPPMDRTSGIPMARLPIQVPQG-AARPGKVVSSVLRYNNCGAAAAAEALDQRRVVRNP  542

Query  720   TTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNTV-PKPDQYMARKVAAAPGGSGNQWY  547
                 QYA S  SY RR  +CKNER  D + EGSN + PKP QY+ARKVAAA GGSG+ WY
Sbjct  543   AVSTQYAAS--SYPRRSSACKNERVNDESVEGSNGLQPKP-QYIARKVAAAQGGSGSNWY  599


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_004486112.1| PREDICTED: mitogen-activated protein kinase 16-like [Cicer arietinum]
Length=563

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/381 (77%), Positives = 325/381 (85%), Gaps = 9/381 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSP+AIAR+RNEKARRYLSSMRKKKP+PFS KF NADPLAL LLERMLAF+ KDR
Sbjct  245   DFLGTPSPDAIARVRNEKARRYLSSMRKKKPVPFSQKFSNADPLALRLLERMLAFEAKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ A SLPR  VLYSDN+
Sbjct  365   KEFLEGAEPTGFMYPSAVDLFKKQFAYLEEHYGKGGTVAPPERQHA-SLPRACVLYSDNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             +Q  AEVA+DLSKC IKE ++  +DR+S +P TRLPLQ P   QG AARPG++V SVMRY
Sbjct  424   MQTTAEVADDLSKCCIKEVEKPAVDRSSAVPMTRLPLQAPQNIQGVAARPGKVVGSVMRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE-DGNEGSNTV-PK  610
             N+     A+E  EQRR++RNP+   QYA S+ SY RR+P+ K+ER E DG E SN + PK
Sbjct  484   NNCGVAVATET-EQRRVVRNPSVSAQYATSSCSYPRRNPNYKSERAEDDGIESSNELQPK  542

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P   M RKVAAA GG+G QWY
Sbjct  543   PQYNMTRKVAAAQGGAGGQWY  563


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KHN03429.1| Mitogen-activated protein kinase 16 [Glycine soja]
Length=454

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/381 (75%), Positives = 316/381 (83%), Gaps = 10/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIAR+RNEKARRYLSSMRKKKP+PFS KFPN DPLAL +L+RMLAF+PKDR
Sbjct  137   DFLGTPSPEAIARVRNEKARRYLSSMRKKKPVPFSQKFPNVDPLALRVLQRMLAFEPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFER RITKEDVRELIYREILEYHPKML
Sbjct  197   PTAEEALADSYFKGLAKVEREPSAQPVTKIEFEFERHRITKEDVRELIYREILEYHPKML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPT FMYPSAVD FKKQFAYLEEHYGKGG V PPERQ A SLPR  VLYSDNS
Sbjct  257   KEHLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVTPPERQHA-SLPRSCVLYSDNS  315

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
               N AEVA+D+S+CSIKE ++  +DR  GIP  RLPLQ P   QG AA P + V SV+ Y
Sbjct  316   RPNMAEVADDISRCSIKEVEKPAMDRTGGIPMARLPLQAPQNIQGVAAWPRKGVGSVLHY  375

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKP  607
             N+ G AVTA    EQR+M RNP+   QYA  + SY RR+PSCK+E+ E+G EG+N +   
Sbjct  376   NNCGVAVTA--VAEQRKMGRNPSVSAQYAAPSSSYPRRNPSCKSEKVEEGIEGANGLQTK  433

Query  606   DQYMARK-VAAAPGGSGNQWY  547
              QY+ARK VAAA GG G  WY
Sbjct  434   PQYIARKVVAAAQGGPGGNWY  454


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIH  1664
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIH
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIH  35



>ref|XP_009352134.1| PREDICTED: mitogen-activated protein kinase 15-like [Pyrus x 
bretschneideri]
Length=561

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/382 (75%), Positives = 323/382 (85%), Gaps = 13/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTG+PLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS +AIAR+RNEKARRYLSSMRKKK IPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSADAIARVRNEKARRYLSSMRKKKQIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQF YLEEHYG G     PER  A SLPR  V YSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHA-SLPRACVSYSDNQ  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQ+  +V +DLS+C I E ++  +DR+SG+PTTRLP+QVP   QG AARPG++V SV+R+
Sbjct  424   VQHSTDVTDDLSRCCINEAEKPQMDRSSGVPTTRLPIQVPHTIQG-AARPGKVVGSVLRF  482

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-P  613
             N+     A+EA+EQRR++RNP +  QY A S  SY RR+  CKNERGE +G EGSN + P
Sbjct  483   NN---CGAAEALEQRRVVRNPGSPAQYPAASAASYPRRNLPCKNERGECEGVEGSNGLQP  539

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QY+ RKVAAA GG+G+QWY
Sbjct  540   KPPQYIPRKVAAAQGGTGSQWY  561


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_010255857.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Nelumbo nucifera]
Length=561

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/381 (76%), Positives = 323/381 (85%), Gaps = 11/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIF+E+LTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFSEILTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFR LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAV++FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYS+N+
Sbjct  365   KEFLEGTESTGFMYPSAVEQFKKQFAYLEEHYGNGAAVAPPERQHA-SLPRPCVLYSNNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
               + +EV +DLSKC IKE ++   DR  GIPTT++PLQVP   QG  A+PG++V SV+ Y
Sbjct  424   AHSSSEVTDDLSKCCIKEIEKPQPDRGFGIPTTKVPLQVPQRLQGTTAKPGKVVGSVLHY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKN-ERGEDGNEGSNTV-PK  610
             N+     A+EA+EQRR++RNP    QYA    SY RR+PSCKN     +G EGSN+V PK
Sbjct  484   NN-CGTAATEALEQRRIVRNPAVSSQYA-PGCSYPRRNPSCKNESGEGEGLEGSNSVQPK  541

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P Q++ARKVAAA GG G  WY
Sbjct  542   P-QFIARKVAAAQGGPGGHWY  561


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010695309.1| PREDICTED: mitogen-activated protein kinase 16 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=559

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/380 (75%), Positives = 322/380 (85%), Gaps = 11/380 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPSP+AIARIRNEKARRYLSSMRKKKPIPF++KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSPDAIARIRNEKARRYLSSMRKKKPIPFTHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRMTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPTSFMYPSAVD FKKQFAYLEEHY  G   AP +RQ A SLPR  V YSDNS
Sbjct  365   KEFLDGSEPTSFMYPSAVDHFKKQFAYLEEHYKNGSTGAPIDRQHA-SLPRACVSYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             V +  EV +DLSKC IKE ++  +DRN  IP TRLPLQVP   QG AARPG++VS+++RY
Sbjct  424   VHSSVEVTDDLSKCRIKEVEKPHVDRNGAIPMTRLPLQVPQNVQGAAARPGKVVSNLLRY  483

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-PKP  607
             N+  A   +E ++ RR +RNP+   Q+  S  SY +R+P CKNER ++  EGSN+V PKP
Sbjct  484   NNCGAAATAEVMD-RRAVRNPSVPSQFPTS--SYPKRNPGCKNEREDEPMEGSNSVQPKP  540

Query  606   DQYMARKVAAAPGGSGNQWY  547
               Y+ARKVAAA G  G+ WY
Sbjct  541   -PYLARKVAAAQGVPGSHWY  559


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008353245.1| PREDICTED: mitogen-activated protein kinase 16-like [Malus domestica]
Length=564

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/382 (76%), Positives = 323/382 (85%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS +AIAR+RNEKARRYLSSMR+KK IPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSADAIARVRNEKARRYLSSMRRKKQIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQF YLEEHYG G     PER  A SLPR  V YSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHA-SLPRACVSYSDNP  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQ+  +V +DLS+C IKE ++   DR+SGIPTTRLP+QVP   QG AARPG++V SV+R+
Sbjct  424   VQHSTDVTDDLSRCCIKEXEKPQTDRSSGIPTTRLPIQVPHTIQG-AARPGKVVGSVLRF  482

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-P  613
             N+  A  A+EA+EQRR++RNP    QY A S  SY RR+  CKNERG+ +G EGSN + P
Sbjct  483   NNCGAAAAAEALEQRRVMRNPAAPTQYPAASAASYPRRNMPCKNERGDCEGVEGSNRLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QY+ RKVAAA GGSG+QWY
Sbjct  543   KPPQYIPRKVAAAQGGSGSQWY  564


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_010695308.1| PREDICTED: mitogen-activated protein kinase 16 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=560

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/381 (75%), Positives = 322/381 (85%), Gaps = 12/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPSP+AIARIRNEKARRYLSSMRKKKPIPF++KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSPDAIARIRNEKARRYLSSMRKKKPIPFTHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRMTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++G+EPTSFMYPSAVD FKKQFAYLEEHY  G   AP +RQ A SLPR  V YSDNS
Sbjct  365   KEFLDGSEPTSFMYPSAVDHFKKQFAYLEEHYKNGSTGAPIDRQHA-SLPRACVSYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSVMR  787
             V +  EV +DLSKC IKE ++  +DRN  IP TRLPLQVPQ    G AARPG++VS+++R
Sbjct  424   VHSSVEVTDDLSKCRIKEVEKPHVDRNGAIPMTRLPLQVPQNVQAGAAARPGKVVSNLLR  483

Query  786   YNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-PK  610
             YN+  A   +E ++ RR +RNP+   Q+  S  SY +R+P CKNER ++  EGSN+V PK
Sbjct  484   YNNCGAAATAEVMD-RRAVRNPSVPSQFPTS--SYPKRNPGCKNEREDEPMEGSNSVQPK  540

Query  609   PDQYMARKVAAAPGGSGNQWY  547
             P  Y+ARKVAAA G  G+ WY
Sbjct  541   P-PYLARKVAAAQGVPGSHWY  560


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_009365785.1| PREDICTED: mitogen-activated protein kinase 16 [Pyrus x bretschneideri]
Length=564

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/382 (75%), Positives = 324/382 (85%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS +AIAR+RNEKARRYLSSMRKKK IPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSADAIARVRNEKARRYLSSMRKKKQIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQF YLEEHYG G     PER  A SLPR  V YSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHA-SLPRACVSYSDNQ  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQ+  +V +DLS+C IK+ ++   DR+SG+PTTRLP+QVP   QG AARPG++V SV+R+
Sbjct  424   VQHSTDVTDDLSRCCIKKAEKPQTDRSSGVPTTRLPIQVPHTIQG-AARPGKVVGSVLRF  482

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-P  613
             N+  A  A+EA+EQRR++RNP +  QY A S  SY RR+  CKNERGE +G EGSN + P
Sbjct  483   NNCGAAAAAEALEQRRVVRNPGSPAQYPAASAASYPRRNLPCKNERGECEGVEGSNGLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QY+ RKVAAA GG+G+QWY
Sbjct  543   KPPQYIPRKVAAAQGGTGSQWY  564


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_009339928.1| PREDICTED: mitogen-activated protein kinase 16-like [Pyrus x 
bretschneideri]
Length=564

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/382 (76%), Positives = 322/382 (84%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS +AIAR+RNEKARRYLSSMRKKK IPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSADAIARVRNEKARRYLSSMRKKKQIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQF YLEEHYG G     PER  A SLPR  V YSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHA-SLPRACVSYSDNP  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQ+  +V +DLS+C IKE ++   DR+SGIPTTR P+QVP   QG AARPG++V SV+R+
Sbjct  424   VQHSTDVTDDLSRCCIKEVEKPQTDRSSGIPTTRHPIQVPHTIQG-AARPGKVVGSVLRF  482

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-P  613
             N+  A  A+EA+EQRR++RNP    QY A S  SY RR+  CKNERG+ +G EGSN + P
Sbjct  483   NNCGAAAAAEALEQRRVMRNPAAPTQYPAASAASYPRRNMPCKNERGDCEGVEGSNRLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QY+ RKVAAA GGSG+QWY
Sbjct  543   KPPQYIPRKVAAAQGGSGSQWY  564


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_006584059.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X3 
[Glycine max]
Length=562

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/368 (76%), Positives = 310/368 (84%), Gaps = 9/368 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIAR+RNEKARRYL  MRKKKP+PFS KFPN DPLAL +LERMLAF+PKDR
Sbjct  245   DFLGTPSPEAIARVRNEKARRYLCCMRKKKPVPFSQKFPNVDPLALRVLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALA PYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALAYPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPT FMYPSAVD FKKQFAYLEEHYGK G V PPERQ A SLPRP VLYSDNS
Sbjct  365   KEHLEGEEPTGFMYPSAVDHFKKQFAYLEEHYGKAGTVTPPERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
              QN AEVA+D+SKC IKE ++  +DR  GIP TRLPLQ P   QG AARPG++V S++ Y
Sbjct  424   RQNMAEVADDISKCIIKEVEKPAMDRTGGIPMTRLPLQAPQNIQGVAARPGKVVGSILHY  483

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKP  607
             N+ G+AVTA    EQRRM RNP+   QYA  + SY RR+PSCK+ER E+  EG+N +   
Sbjct  484   NNCGAAVTADA--EQRRMGRNPSVSAQYAAPSSSYPRRNPSCKSERAEEVIEGANGLQTK  541

Query  606   DQYMARKV  583
              Q++ +KV
Sbjct  542   PQHITQKV  549


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006584058.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Glycine max]
Length=565

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/371 (76%), Positives = 310/371 (84%), Gaps = 12/371 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIAR+RNEKARRYL  MRKKKP+PFS KFPN DPLAL +LERMLAF+PKDR
Sbjct  245   DFLGTPSPEAIARVRNEKARRYLCCMRKKKPVPFSQKFPNVDPLALRVLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALA PYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALAYPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPT FMYPSAVD FKKQFAYLEEHYGK G V PPERQ A SLPRP VLYSDNS
Sbjct  365   KEHLEGEEPTGFMYPSAVDHFKKQFAYLEEHYGKAGTVTPPERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ------GDAARPGRIVSSV  793
              QN AEVA+D+SKC IKE ++  +DR  GIP TRLPLQ PQ      G AARPG++V S+
Sbjct  424   RQNMAEVADDISKCIIKEVEKPAMDRTGGIPMTRLPLQAPQNIQVASGVAARPGKVVGSI  483

Query  792   MRYNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV  616
             + YN+ G+AVTA    EQRRM RNP+   QYA  + SY RR+PSCK+ER E+  EG+N +
Sbjct  484   LHYNNCGAAVTADA--EQRRMGRNPSVSAQYAAPSSSYPRRNPSCKSERAEEVIEGANGL  541

Query  615   PKPDQYMARKV  583
                 Q++ +KV
Sbjct  542   QTKPQHITQKV  552


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010931939.1| PREDICTED: mitogen-activated protein kinase 15 [Elaeis guineensis]
 ref|XP_010931940.1| PREDICTED: mitogen-activated protein kinase 15 [Elaeis guineensis]
Length=555

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/377 (75%), Positives = 311/377 (82%), Gaps = 10/377 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMR+KKP+PFS KFPNADPLAL LLERMLAF+ KDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRRKKPMPFSQKFPNADPLALRLLERMLAFEHKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFRN+A+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK+ 
Sbjct  305   PTAEEALADPYFRNIAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKLK  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD FKKQFAYLEE+YG G  VAPPERQ A SLPRP V YSDN 
Sbjct  365   KEFLEGTESTGFMYPSAVDHFKKQFAYLEENYGNGATVAPPERQHA-SLPRPCVFYSDNK  423

Query  948   VQNPAEVANDLSKCSIKEGDRLD-RNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRYN  781
             +QN  ++  D SKC IKE ++    N  +P TR PLQVP   QG AARPG++V S++ YN
Sbjct  424   MQNSMDITQDFSKCLIKEAEKPKLENCMVPMTRPPLQVPQRAQGAAARPGKVVGSLLHYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             + +  + SE  EQRR  RNP    QYA    SY RR+PSCK+ERG++G EG+N V +P  
Sbjct  484   NCT-TSGSELYEQRRAARNPAIPAQYA---SSYPRRNPSCKSERGDEGIEGTNIV-RPKP  538

Query  600   YMARKVAAAPGGSGNQW  550
             Y+A KVAAA GG    W
Sbjct  539   YVASKVAAAHGGPSGHW  555


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_003529601.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Glycine max]
Length=571

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/377 (75%), Positives = 310/377 (82%), Gaps = 18/377 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIAR+RNEKARRYL  MRKKKP+PFS KFPN DPLAL +LERMLAF+PKDR
Sbjct  245   DFLGTPSPEAIARVRNEKARRYLCCMRKKKPVPFSQKFPNVDPLALRVLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALA PYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALAYPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPT FMYPSAVD FKKQFAYLEEHYGK G V PPERQ A SLPRP VLYSDNS
Sbjct  365   KEHLEGEEPTGFMYPSAVDHFKKQFAYLEEHYGKAGTVTPPERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ------------GDAARPG  811
              QN AEVA+D+SKC IKE ++  +DR  GIP TRLPLQ PQ            G AARPG
Sbjct  424   RQNMAEVADDISKCIIKEVEKPAMDRTGGIPMTRLPLQAPQNIQGVMTDRIASGVAARPG  483

Query  810   RIVSSVMRYNS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN  634
             ++V S++ YN+ G+AVTA    EQRRM RNP+   QYA  + SY RR+PSCK+ER E+  
Sbjct  484   KVVGSILHYNNCGAAVTADA--EQRRMGRNPSVSAQYAAPSSSYPRRNPSCKSERAEEVI  541

Query  633   EGSNTVPKPDQYMARKV  583
             EG+N +    Q++ +KV
Sbjct  542   EGANGLQTKPQHITQKV  558


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KEH32220.1| MAP kinase-like protein [Medicago truncatula]
Length=563

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/385 (72%), Positives = 311/385 (81%), Gaps = 18/385 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIARIRNEKARRYLS+MRKKKP+P   KFPNADPLAL +LERMLAFDPKDR
Sbjct  245   DFLGTPSPEAIARIRNEKARRYLSTMRKKKPVPLYQKFPNADPLALRVLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  LA+ EREP AQ V+KMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFNGLAKFEREPCAQSVSKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG EPT FMYPSAVD FKKQFAYLEEHYGKGG V+P +RQ A SLPR  VLYSD+S
Sbjct  365   KEYLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVSPLDRQHA-SLPRQCVLYSDDS  423

Query  948   VQNPAEV-ANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGD---------AARPGRI  805
              QN AEV A+DLSKC IKE ++  +DR+ G+P  RLPLQ PQ           A RP ++
Sbjct  424   RQNMAEVAADDLSKCCIKEVEKPVIDRSGGVPMNRLPLQAPQNIQGVMTNRSVAPRPRKV  483

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGS  625
               S++ YN G A       +QR+  RNP+   QYA S+ SY +R+PSCKNER EDG EGS
Sbjct  484   AGSLLHYNGGVA-----GADQRKTTRNPSVPAQYAASSYSYPKRNPSCKNERAEDGIEGS  538

Query  624   NTVPKPDQYMARKVAAAPGGSGNQW  550
             N +    QY+ARKVAAAPGG+G+ W
Sbjct  539   NGLQSKPQYIARKVAAAPGGAGSNW  563


 Score = 75.1 bits (183),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008793663.1| PREDICTED: mitogen-activated protein kinase 15 [Phoenix dactylifera]
 ref|XP_008793664.1| PREDICTED: mitogen-activated protein kinase 15 [Phoenix dactylifera]
Length=555

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/377 (74%), Positives = 309/377 (82%), Gaps = 10/377 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMR+KKP+PFS KFPN DPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRRKKPVPFSQKFPNTDPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFRN+A+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK+ 
Sbjct  305   PTAEEALADPYFRNIAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKLK  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD FKKQFAYLEE+YG G  VAPPERQ A SLPRP V YSDN 
Sbjct  365   KEFLEGTESTGFMYPSAVDHFKKQFAYLEENYGNGATVAPPERQHA-SLPRPCVFYSDNK  423

Query  948   VQNPAEVANDLSKCSIKEGDRLD-RNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRYN  781
             +QN  ++  D SKC IKE ++    N  +P TR PLQVP   QG AARPG++V S++ YN
Sbjct  424   MQNSRDITEDFSKCLIKETEKPKPENCMVPMTRAPLQVPQRFQGAAARPGKVVGSLLHYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             + +  + SE  EQRR  RNP    QYA    SY RR+PSCK ERG++G EG N V +P  
Sbjct  484   NCT-TSGSELYEQRRAARNPAIPAQYA---SSYPRRNPSCKIERGDEGIEGPNIV-QPKP  538

Query  600   YMARKVAAAPGGSGNQW  550
             Y+  KVAAA GG  + W
Sbjct  539   YVGSKVAAAHGGPSSHW  555


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008390809.1| PREDICTED: mitogen-activated protein kinase 15 [Malus domestica]
Length=564

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/382 (75%), Positives = 320/382 (84%), Gaps = 10/382 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS +AIAR+RNEKARRYLSSMR+KK IPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSTDAIARVRNEKARRYLSSMRRKKQIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFAYLEEHYG G     PER  A SLPR  V YSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAYLEEHYGNGTTAVAPERTHA-SLPRACVSYSDNQ  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
             VQ+  +V +DLS+C IKE ++   DR+SGI TTRLP+QVP   QG AARPG++V SV+R+
Sbjct  424   VQHSTDVTDDLSRCCIKEVEKPQXDRSSGIATTRLPIQVPHTIQG-AARPGKVVGSVLRF  482

Query  783   NSGSAVTASEAIEQRRMLRN-PTTMPQYAISNPSYSRRHPSCKNERGE-DGNEGSNTV-P  613
             N+  A  A+EA+EQRR++RN        A S  SY RR+  CKNERGE +G EGSN + P
Sbjct  483   NNCGAAAAAEALEQRRVVRNPAAPAQYPAASAASYPRRNLPCKNERGECEGVEGSNGLQP  542

Query  612   KPDQYMARKVAAAPGGSGNQWY  547
             KP QY+ RKVAAA GGSG+QWY
Sbjct  543   KPPQYIPRKVAAAQGGSGSQWY  564


 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_006600319.1| PREDICTED: mitogen-activated protein kinase 16-like [Glycine 
max]
Length=559

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/378 (74%), Positives = 307/378 (81%), Gaps = 7/378 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIAR+RNEKARRYLSSMRKKKP+PFS KFPN DPLAL +L+RMLAF+PKDR
Sbjct  245   DFLGTPSPEAIARVRNEKARRYLSSMRKKKPVPFSQKFPNVDPLALRVLQRMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFER RITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADSYFKGLAKVEREPSAQPVTKIEFEFERHRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPT FMYPSAVD FKKQFAYLEEHYGKGG V PPERQ A SLPR  VLYSDNS
Sbjct  365   KEHLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVTPPERQHA-SLPRSCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG-DAARPGRIVSSVMRYNS  778
               N AEVA+D+S+CSIKE ++  +DR  GIP  RLPLQ PQ        R  S +   +S
Sbjct  424   RPNMAEVADDISRCSIKEVEKPAMDRTGGIPMARLPLQAPQNIQGVMTDR--SIIGNQSS  481

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQY  598
               AV  +   EQR+M RNP+   QYA  + SY RR+PSCK+E+ E+G EG+N +    QY
Sbjct  482   WFAVAVTAVAEQRKMGRNPSVSAQYAAPSSSYPRRNPSCKSEKVEEGIEGANGLQTKPQY  541

Query  597   MARK-VAAAPGGSGNQWY  547
             +ARK VAAA GG G  WY
Sbjct  542   IARKVVAAAQGGPGGNWY  559


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIH  1664
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIH
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIH  143



>ref|XP_011090812.1| PREDICTED: mitogen-activated protein kinase 16 [Sesamum indicum]
Length=533

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/349 (77%), Positives = 300/349 (86%), Gaps = 7/349 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE IARIRNEKARRYLSSMRKK+PIP +YKFPNADPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPPPETIARIRNEKARRYLSSMRKKRPIPLTYKFPNADPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PSAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EG EPT FMYPSAVDKFKKQFAYLEEHY + G   PPERQ +SSLPRP VLYS++S
Sbjct  365   KEFLEGAEPTGFMYPSAVDKFKKQFAYLEEHY-RNGAAGPPERQHSSSLPRPCVLYSESS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRY  784
               +  +VANDLSKCSI+E ++  + R+S  P TR P+QVP   QG AARPG+++ SV+RY
Sbjct  424   NPSMIDVANDLSKCSIEEVEKPQVGRSSVQPMTRFPVQVPQNVQGGAARPGKVIGSVLRY  483

Query  783   NS-GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             N+ G+A  + EA +QR M RN     QY + + SY R+HPSCKN +GE+
Sbjct  484   NNCGAAAASIEATDQRNMARNLGIPAQYIVPSSSYPRKHPSCKNLKGEE  532


 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  145



>ref|XP_010921949.1| PREDICTED: mitogen-activated protein kinase 15-like [Elaeis guineensis]
Length=555

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/377 (73%), Positives = 307/377 (81%), Gaps = 10/377 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMR+KKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRRKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+N+A+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK+ 
Sbjct  305   PTAEEALADPYFKNIAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKLK  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD FKKQFAYLEE+YG G  VAPPERQ A SLPRPSV +SDN 
Sbjct  365   KEFLEGTESTGFMYPSAVDHFKKQFAYLEENYGSGATVAPPERQHA-SLPRPSVFHSDNK  423

Query  948   VQNPAEVANDLSKCSIKEGDRLD-RNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRYN  781
             + N   +  D SK  IKE ++    N  +P TR+PLQVP   QG  ARPG++V S++ YN
Sbjct  424   MLNSTNITEDSSKRLIKESEKPKLENCMVPITRVPLQVPQRVQGAGARPGKVVGSLLHYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             + +  +  E  EQRR  RNP    QYA    SY RR+PSCK+ER ++G EG+  V +P  
Sbjct  484   NCT-TSGPELYEQRRATRNPAIPTQYA---SSYPRRNPSCKSEREDEGIEGAKAV-QPKP  538

Query  600   YMARKVAAAPGGSGNQW  550
             Y+A KVAAA  G  + W
Sbjct  539   YVASKVAAAHAGPSSHW  555


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008790997.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Phoenix dactylifera]
Length=555

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/377 (72%), Positives = 307/377 (81%), Gaps = 10/377 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMR+KKP+PFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRRKKPVPFSRKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+N+A+VEREPSAQPVTKMEF+FERRRITKEDVRELIY+EILEYHPK+ 
Sbjct  305   PTAEEALADPYFKNIAKVEREPSAQPVTKMEFDFERRRITKEDVRELIYKEILEYHPKLK  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD FKKQFAYLEE+Y  G  VAPPERQ A SLPRPSV YSDN 
Sbjct  365   KEFLEGTESTGFMYPSAVDHFKKQFAYLEENYESGATVAPPERQHA-SLPRPSVFYSDNK  423

Query  948   VQNPAEVANDLSKCSIKEGDRLD-RNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRYN  781
             + N  ++  D SKC IKE ++    N  +P TR+PLQVP   QG  ARPG++V S++ YN
Sbjct  424   LLNSRDITEDSSKCLIKESEKPKPENCMVPMTRVPLQVPQRVQGAGARPGKVVGSLLHYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             +    +  E  EQRR  RNP    QYA    SY RR+PSCK+ER ++G EG+  V +P  
Sbjct  484   N-CITSGPELYEQRRATRNPAIPTQYA---SSYPRRNPSCKSEREDEGIEGAKVV-QPKP  538

Query  600   YMARKVAAAPGGSGNQW  550
             Y+A KVAAA  G  + W
Sbjct  539   YVASKVAAAHAGPSSHW  555


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010524786.1| PREDICTED: mitogen-activated protein kinase 16 isoform X2 [Tarenaya 
hassleriana]
Length=554

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/386 (74%), Positives = 316/386 (82%), Gaps = 28/386 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI R+RNEKARRYLSSMRKKK +PFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIGRVRNEKARRYLSSMRKKKSVPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVREL+YREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELVYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHY  G   APPERQ  +SLPR  VLYSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYKNGTSGAPPERQH-TSLPRACVLYSDNN  423

Query  951   -SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGD--AARPGRIVSSVMR  787
              +VQN AEV + LSKC I+E +R  +DR       R+P+ VPQ +  AARPG++V SV+R
Sbjct  424   HAVQNSAEVTDSLSKCRIREIERPHVDR-------RVPIHVPQANQGAARPGKVVGSVLR  476

Query  786   YNS-GSAVTASEAIEQR--RMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSNT  619
             YN+ G A   +EAIEQ+  RM+RNP        SN SY +R   CKN+RGED   EGSN 
Sbjct  477   YNNCGIAAAGTEAIEQQRSRMVRNPA-------SNCSYPKRTQPCKNDRGEDECPEGSNR  529

Query  618   V-PKPDQYMARKVAAAP-GGSGNQWY  547
             + PKP QY+ARKVAAA  GG  N WY
Sbjct  530   LQPKP-QYVARKVAAAAQGGPVNNWY  554


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010524784.1| PREDICTED: mitogen-activated protein kinase 16 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010524785.1| PREDICTED: mitogen-activated protein kinase 16 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/387 (73%), Positives = 316/387 (82%), Gaps = 29/387 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI R+RNEKARRYLSSMRKKK +PFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIGRVRNEKARRYLSSMRKKKSVPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVREL+YREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELVYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHY  G   APPERQ  +SLPR  VLYSDN 
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYKNGTSGAPPERQH-TSLPRACVLYSDNN  423

Query  951   -SVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGD---AARPGRIVSSVM  790
              +VQN AEV + LSKC I+E +R  +DR       R+P+ VPQ +   AARPG++V SV+
Sbjct  424   HAVQNSAEVTDSLSKCRIREIERPHVDR-------RVPIHVPQANQAGAARPGKVVGSVL  476

Query  789   RYNS-GSAVTASEAIEQR--RMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGN-EGSN  622
             RYN+ G A   +EAIEQ+  RM+RNP        SN SY +R   CKN+RGED   EGSN
Sbjct  477   RYNNCGIAAAGTEAIEQQRSRMVRNPA-------SNCSYPKRTQPCKNDRGEDECPEGSN  529

Query  621   TV-PKPDQYMARKVAAAP-GGSGNQWY  547
              + PKP QY+ARKVAAA  GG  N WY
Sbjct  530   RLQPKP-QYVARKVAAAAQGGPVNNWY  555


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008790998.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X2 
[Phoenix dactylifera]
Length=554

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/372 (73%), Positives = 305/372 (82%), Gaps = 10/372 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAIAR+RNEKARRYLSSMR+KKP+PFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAIARVRNEKARRYLSSMRRKKPVPFSRKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+N+A+VEREPSAQPVTKMEF+FERRRITKEDVRELIY+EILEYHPK+ 
Sbjct  305   PTAEEALADPYFKNIAKVEREPSAQPVTKMEFDFERRRITKEDVRELIYKEILEYHPKLK  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAVD FKKQFAYLEE+Y  G  VAPPERQ A SLPRPSV YSDN 
Sbjct  365   KEFLEGTESTGFMYPSAVDHFKKQFAYLEENYESGATVAPPERQHA-SLPRPSVFYSDNK  423

Query  948   VQNPAEVANDLSKCSIKEGDRLD-RNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRYN  781
             + N  ++  D SKC IKE ++    N  +P TR+PLQVP   QG  ARPG++V S++ YN
Sbjct  424   LLNSRDITEDSSKCLIKESEKPKPENCMVPMTRVPLQVPQRVQGAGARPGKVVGSLLHYN  483

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             +    +  E  EQRR  RNP    QYA    SY RR+PSCK+ER ++G EG+  V +P  
Sbjct  484   N-CITSGPELYEQRRATRNPAIPTQYA---SSYPRRNPSCKSEREDEGIEGAKVV-QPKP  538

Query  600   YMARKVAAAPGG  565
             Y+A KVAAA  G
Sbjct  539   YVASKVAAAHAG  550


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_004508354.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Cicer arietinum]
Length=565

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/374 (72%), Positives = 302/374 (81%), Gaps = 18/374 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPS EAIARIRNEKARRYLSSMRKKKP+PFS KFPNADPLAL +LERMLAF+PKDR
Sbjct  245   DFLGTPSLEAIARIRNEKARRYLSSMRKKKPVPFSQKFPNADPLALRVLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+ EREP AQPV+KMEFEFERRR+TKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKFEREPCAQPVSKMEFEFERRRVTKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPT FMYPSAVD FKKQFAYLEEHYGKGG ++P +RQ A SLPR  VLYSD+S
Sbjct  365   KEHLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTISPLDRQHA-SLPRQCVLYSDDS  423

Query  948   VQNPAEV-ANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGD---------AARPGRI  805
              QN AEV A+DLSKC IKE ++  +DR   +P  RLPL  PQ           AARP ++
Sbjct  424   RQNMAEVAADDLSKCCIKEVEKPTIDRTGVVPMNRLPLLAPQNIQGVMTDICVAARPRKV  483

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGS  625
               S + Y+ G A +     EQRR +RNP+   QYA S+ SY +R+PSCKNER EDG E S
Sbjct  484   AGSALHYSRGVAGS-----EQRRTIRNPSVAVQYAASSCSYPKRNPSCKNERAEDGIESS  538

Query  624   NTVPKPDQYMARKV  583
             N +    QY+A+KV
Sbjct  539   NGLQSKPQYIAQKV  552


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006400455.1| hypothetical protein EUTSA_v10013120mg [Eutrema salsugineum]
 gb|ESQ41908.1| hypothetical protein EUTSA_v10013120mg [Eutrema salsugineum]
Length=567

 Score =   528 bits (1361),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 265/390 (68%), Positives = 311/390 (80%), Gaps = 23/390 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ----GDAARPGRIV  802
                + QN  EV + LSKCSI++ +R    DRN+ +P +R+P+ VPQ       ARPG++V
Sbjct  425   HAAAQQNSVEVTDGLSKCSIRDTERQRGADRNAQMPMSRIPINVPQTIQGAAVARPGKVV  484

Query  801   SSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED---G  637
              SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ RG++    
Sbjct  485   GSVLRYNNCGAATGVEALEQQQRRMVRNPAGAAQ-------YPKRTQPCKSNRGDEDCVA  537

Query  636   NEGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
              EGS+ + +  QY+ +KVAAA   + ++WY
Sbjct  538   AEGSSRLKQNPQYIPQKVAAAQDTAMSRWY  567


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_004960458.1| PREDICTED: mitogen-activated protein kinase 14-like isoform X2 
[Setaria italica]
Length=545

 Score =   522 bits (1345),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 254/375 (68%), Positives = 296/375 (79%), Gaps = 4/375 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKARRYLS+MR+KK IPF+ KFPNADPLAL LLERMLAF+PKDR
Sbjct  233   DLLGTPSPEAISRIRNEKARRYLSTMRRKKAIPFTQKFPNADPLALSLLERMLAFEPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQ VTK+EFEFERRR+TK+D+RELIYREILEYHPKML
Sbjct  293   PSAEEALADPYFKNIANVDREPSAQAVTKLEFEFERRRVTKDDIRELIYREILEYHPKML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE + FMYPSAVD FKKQFAYLEEHY KG    PPERQ  +SLPRPSV+YSDN 
Sbjct  353   REFLEGTESSGFMYPSAVDHFKKQFAYLEEHYCKGSTGTPPERQH-NSLPRPSVVYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
              Q+ A +  DLSKC I+E  +     ++ +   + PL VP G AARPG+ V SV++YN G
Sbjct  412   QQSTANITEDLSKCLIRENTQKTQQHSASVAANKFPLHVPHGAAARPGKAVGSVLQYNPG  471

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYM  595
              A +A+E  EQRR+ R+P   P    S  SY RR+ +CK+E G+      N   +P  Y 
Sbjct  472   PA-SAAEQYEQRRIARHPAIAPNNIPSGSSYPRRNQTCKSETGDAERMDVNQAGQPKPYA  530

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A   G G  W
Sbjct  531   ANKLPATVDGRGGHW  545


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>ref|XP_004960457.1| PREDICTED: mitogen-activated protein kinase 14-like isoform X1 
[Setaria italica]
Length=557

 Score =   523 bits (1346),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 254/375 (68%), Positives = 296/375 (79%), Gaps = 4/375 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKARRYLS+MR+KK IPF+ KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAISRIRNEKARRYLSTMRRKKAIPFTQKFPNADPLALSLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQ VTK+EFEFERRR+TK+D+RELIYREILEYHPKML
Sbjct  305   PSAEEALADPYFKNIANVDREPSAQAVTKLEFEFERRRVTKDDIRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE + FMYPSAVD FKKQFAYLEEHY KG    PPERQ  +SLPRPSV+YSDN 
Sbjct  365   REFLEGTESSGFMYPSAVDHFKKQFAYLEEHYCKGSTGTPPERQH-NSLPRPSVVYSDNR  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
              Q+ A +  DLSKC I+E  +     ++ +   + PL VP G AARPG+ V SV++YN G
Sbjct  424   QQSTANITEDLSKCLIRENTQKTQQHSASVAANKFPLHVPHGAAARPGKAVGSVLQYNPG  483

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYM  595
              A +A+E  EQRR+ R+P   P    S  SY RR+ +CK+E G+      N   +P  Y 
Sbjct  484   PA-SAAEQYEQRRIARHPAIAPNNIPSGSSYPRRNQTCKSETGDAERMDVNQAGQPKPYA  542

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A   G G  W
Sbjct  543   ANKLPATVDGRGGHW  557


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|AGT16879.1| mitogen activated protein kinase [Saccharum hybrid cultivar R570]
Length=556

 Score =   523 bits (1346),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 256/374 (68%), Positives = 294/374 (79%), Gaps = 3/374 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKARRYLSSMR+KKPIPF+ KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAISRIRNEKARRYLSSMRRKKPIPFTQKFPNADPLALSLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQ VTK+EFEFERRR+TKED+RELIYREILEYHP+ML
Sbjct  305   PSAEEALADPYFKNIANVDREPSAQAVTKLEFEFERRRVTKEDIRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE + FMYPSAVD FKKQFAYLEEHY KG    PPERQ  +SLPRPSV+YSDN 
Sbjct  365   REFLEGTESSGFMYPSAVDHFKKQFAYLEEHYAKGSTGTPPERQH-NSLPRPSVVYSDNR  423

Query  948   VQNPAEVANDLSKCSIKEGDRLDR-NSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
                 A +  DLSKC I+E  +  R +S    ++ P  VPQGD ARPG+ V S+M+YN   
Sbjct  424   SHATANITEDLSKCIIRENTQKTRQHSAYVASKFPPHVPQGDVARPGKAVGSMMQYNPYP  483

Query  771   AVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMA  592
             A +A+E  EQRR+ R+P   P    S  SY RR  +CK+E G+      N   +P  Y A
Sbjct  484   A-SAAEQYEQRRIARHPAVAPNNIPSGSSYPRRSQTCKSETGDAERMDVNQAGQPKPYAA  542

Query  591   RKVAAAPGGSGNQW  550
              K+ A   G G  W
Sbjct  543   NKLPATVDGRGGHW  556


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008670546.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
14-like [Zea mays]
Length=556

 Score =   522 bits (1344),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 254/374 (68%), Positives = 294/374 (79%), Gaps = 3/374 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DL+GTPSPEAI+RIRNEKARRYLS+MR+KKPIPF+ KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLMGTPSPEAISRIRNEKARRYLSNMRRKKPIPFTQKFPNADPLALGLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALA PYF+N+A V+REPSAQ VTK+EFEFERRR+TK+D+RELIYREILEYHPKML
Sbjct  305   PSAEEALAHPYFKNIANVDREPSAQAVTKLEFEFERRRVTKDDIRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEFIEGTE + FMYPSAVD FKKQFAYLEEHY KG    PPERQ  +SLPRPSV+YSDN 
Sbjct  365   KEFIEGTESSGFMYPSAVDNFKKQFAYLEEHYAKGSTGTPPERQH-NSLPRPSVVYSDNQ  423

Query  948   VQNPAEVANDLSKCSIKE-GDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
              Q+ A +  DLSKC I+E   +  + +     + P  VPQG AARPG+ V SV++YN   
Sbjct  424   SQSTANITEDLSKCIIRENAQKSQQYNASVANKFPSHVPQGAAARPGKAVGSVLQYNLSQ  483

Query  771   AVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMA  592
             A +A+E  EQRR+ R+P   P    S  SY RR+ +CK+E G+      N   +P  Y A
Sbjct  484   A-SAAEQYEQRRVARHPAVAPNNIPSGSSYPRRNQTCKSETGDTERMDVNQAGQPKSYAA  542

Query  591   RKVAAAPGGSGNQW  550
              K+ A   G G  W
Sbjct  543   NKLPATVDGRGGHW  556


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KFK26139.1| hypothetical protein AALP_AA8G208500 [Arabis alpina]
Length=565

 Score =   522 bits (1345),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 263/388 (68%), Positives = 309/388 (80%), Gaps = 21/388 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+MLAF+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPV+K+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVSKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHTPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDRLD--RNSGIPTTRLPLQVP---QGDAARPGRIVSS  796
                + Q+  EV + LSKCSI++ +RL    ++ +P +R+P+ VP   QG  ARPG++V S
Sbjct  425   HAAAQQSSVEVTDGLSKCSIRDTERLHGADSAQMPMSRIPINVPQTTQGTVARPGKVVGS  484

Query  795   VMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED---GNE  631
             V+RYN+  A T  EA+E  QRRM+RNPT   QY        +R   CK+ RG++     E
Sbjct  485   VLRYNNCGAATGVEALEQQQRRMVRNPTGASQYP-------KRTQPCKSNRGDEDCAATE  537

Query  630   GSNTVPKPDQYMARKVAAAPGGSGNQWY  547
             G + +    QY+ +KVAAA     ++WY
Sbjct  538   GPSRMKPNPQYIPQKVAAAQDTGMSRWY  565


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KFK26138.1| hypothetical protein AALP_AA8G208500 [Arabis alpina]
Length=566

 Score =   522 bits (1344),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 263/389 (68%), Positives = 309/389 (79%), Gaps = 22/389 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+MLAF+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPV+K+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVSKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHTPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDRLD--RNSGIPTTRLPLQVPQ----GDAARPGRIVS  799
                + Q+  EV + LSKCSI++ +RL    ++ +P +R+P+ VPQ    G  ARPG++V 
Sbjct  425   HAAAQQSSVEVTDGLSKCSIRDTERLHGADSAQMPMSRIPINVPQTTQAGTVARPGKVVG  484

Query  798   SVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED---GN  634
             SV+RYN+  A T  EA+E  QRRM+RNPT   Q       Y +R   CK+ RG++     
Sbjct  485   SVLRYNNCGAATGVEALEQQQRRMVRNPTGASQ-------YPKRTQPCKSNRGDEDCAAT  537

Query  633   EGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
             EG + +    QY+ +KVAAA     ++WY
Sbjct  538   EGPSRMKPNPQYIPQKVAAAQDTGMSRWY  566


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006289614.1| hypothetical protein CARUB_v10003167mg, partial [Capsella rubella]
 gb|EOA22512.1| hypothetical protein CARUB_v10003167mg, partial [Capsella rubella]
Length=557

 Score =   521 bits (1341),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 266/387 (69%), Positives = 304/387 (79%), Gaps = 19/387 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  177   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  236

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLERMLAF+PKDR
Sbjct  237   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLERMLAFEPKDR  296

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  297   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  356

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  357   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTTHNPPERQQHASLPRACVLYSDNN  416

Query  951   ---SVQNPAEVANDLSKCSIKEG--DRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVS  799
                + QN AEV + LSKCSI++      DRN+ +P +R+P+ VPQ       ARPG++V 
Sbjct  417   HPMAQQNSAEVTDGLSKCSIRDERPRGADRNAQMPMSRIPINVPQTIQGAAVARPGKVVG  476

Query  798   SVMRYNSGSAVTASEAIE-QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED--GNEG  628
             SV+RYN+  A T  EA+E QRRM+RNP    QY        R  PS  N   ED    EG
Sbjct  477   SVLRYNNCGAATGVEALEQQRRMVRNPAAASQYP------KRTQPSKSNRADEDCAAAEG  530

Query  627   SNTVPKPDQYMARKVAAAPGGSGNQWY  547
              + +    QY+ +KVAAA   + ++WY
Sbjct  531   PSRLKPNTQYIPQKVAAAQDTAMSRWY  557


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  101   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  137



>ref|NP_001105238.1| LOC542143 [Zea mays]
 gb|AAQ94319.1| mitogen activated protein kinase 6 [Zea mays]
 gb|ACN25657.1| unknown [Zea mays]
 gb|AFW57581.1| putative MAP kinase family protein [Zea mays]
Length=557

 Score =   520 bits (1338),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 256/375 (68%), Positives = 295/375 (79%), Gaps = 4/375 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKARRYLSSMR+KKPIPF+ KFPNADPLALCLLERMLAF+PKDR
Sbjct  245   DLLGTPSPEAISRIRNEKARRYLSSMRRKKPIPFTQKFPNADPLALCLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQ VTK+EFEFERRR+TKED+RELIYREILEYHPKML
Sbjct  305   PSAEEALADPYFKNIASVDREPSAQAVTKLEFEFERRRVTKEDIRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE + FMYPSAVD FKKQFAYLEEHY KG    PPERQ  +SLPRPSV+YSDN 
Sbjct  365   REFLEGTESSGFMYPSAVDHFKKQFAYLEEHYAKGSTGTPPERQH-NSLPRPSVVYSDNR  423

Query  948   VQNPAEVANDLSKCSIKEG-DRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
              Q  A +  DLSKC ++E   +    S    ++ P  VPQGD ARPG+ V SVM+Y+   
Sbjct  424   SQTTANITEDLSKCMLRENTQKTHPYSASVASKFPPHVPQGDVARPGKAVGSVMQYSPCP  483

Query  771   AVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE-DGNEGSNTVPKPDQYM  595
             A  A+E  EQRR+ R+P   P    S  SY RR  +CK+E G+ + +  +N   +P  Y 
Sbjct  484   A-PAAERYEQRRIARHPAVAPNNIPSGSSYPRRSQTCKSETGDAESHMDANQARQPKPYA  542

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A     G  W
Sbjct  543   ANKLPATVDSRGGHW  557


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010420681.1| PREDICTED: mitogen-activated protein kinase 16 [Camelina sativa]
Length=566

 Score =   517 bits (1332),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 263/389 (68%), Positives = 305/389 (78%), Gaps = 22/389 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEG--DRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVS  799
                + QN  EV + LSKCSI++      DRN+ +P +R+P+ VPQ       ARPG++V 
Sbjct  425   HPMAQQNSVEVTDGLSKCSIRDERPRGADRNAQMPMSRVPINVPQTVQGAAVARPGKVVG  484

Query  798   SVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED---GN  634
             SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ R ++     
Sbjct  485   SVLRYNNCGAATGVEALEQQQRRMVRNPAAASQ-------YPKRTQPCKSNRADEDCAAA  537

Query  633   EGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
             EG + +    QY+ +KVAAA   + ++WY
Sbjct  538   EGPSRLKPNAQYIPQKVAAAQDTAMSRWY  566


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>sp|Q75KK8.1|MPK14_ORYSJ RecName: Full=Mitogen-activated protein kinase 14; Short=MAP 
kinase 14 [Oryza sativa Japonica Group]
 gb|AAS98446.1| putative Mitogen-activated protein kinase [Oryza sativa Japonica 
Group]
 gb|AAU90196.1| putative mitogen-activated protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAG88926.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACT67689.1| mitogen-activated protein kinase 14 [Oryza sativa Japonica Group]
Length=542

 Score =   516 bits (1329),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 297/375 (79%), Gaps = 7/375 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE I+RIRNEKARRYL+SMR+KKPIPF+ KFPNADPLA+ LLERMLAFDPKDR
Sbjct  233   DLLGTPSPETISRIRNEKARRYLNSMRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQP+TK+EFEFERRRITKED+RELIYREILEYHPKML
Sbjct  293   PSAEEALADPYFKNIANVDREPSAQPITKLEFEFERRRITKEDIRELIYREILEYHPKML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRP V+YSDN 
Sbjct  353   REFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPCVVYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSG-IPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
              Q+ A V  DLS+C I++ +   ++S  +  +R    +PQG AARPG+ V SV+RY + S
Sbjct  412   PQSTASVTEDLSRCLIRDNNLKSQDSASVGASR----IPQGAAARPGKAVGSVLRYGNCS  467

Query  771   AVTASEAIEQRRMLRNPTTMPQYAI-SNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYM  595
                A +  EQRR++RNP   P  ++    SY RR+ +CK+E G+     S+    P  Y+
Sbjct  468   TSAAEQQYEQRRVVRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKPYV  527

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A   G    W
Sbjct  528   ANKLPATVDGRSGHW  542


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|EEC78500.1| hypothetical protein OsI_18423 [Oryza sativa Indica Group]
 gb|EEE62295.1| hypothetical protein OsJ_17083 [Oryza sativa Japonica Group]
Length=547

 Score =   516 bits (1330),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 297/375 (79%), Gaps = 7/375 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  178   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  237

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE I+RIRNEKARRYL+SMR+KKPIPF+ KFPNADPLA+ LLERMLAFDPKDR
Sbjct  238   DLLGTPSPETISRIRNEKARRYLNSMRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDR  297

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQP+TK+EFEFERRRITKED+RELIYREILEYHPKML
Sbjct  298   PSAEEALADPYFKNIANVDREPSAQPITKLEFEFERRRITKEDIRELIYREILEYHPKML  357

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRP V+YSDN 
Sbjct  358   REFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPCVVYSDNR  416

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSG-IPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
              Q+ A V  DLS+C I++ +   ++S  +  +R    +PQG AARPG+ V SV+RY + S
Sbjct  417   PQSTASVTEDLSRCLIRDNNLKSQDSASVGASR----IPQGAAARPGKAVGSVLRYGNCS  472

Query  771   AVTASEAIEQRRMLRNPTTMPQYAIS-NPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYM  595
                A +  EQRR++RNP   P  ++    SY RR+ +CK+E G+     S+    P  Y+
Sbjct  473   TSAAEQQYEQRRVVRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKPYV  532

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A   G    W
Sbjct  533   ANKLPATVDGRSGHW  547


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  102   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  138



>ref|XP_010454159.1| PREDICTED: mitogen-activated protein kinase 16-like [Camelina 
sativa]
Length=566

 Score =   517 bits (1331),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 263/389 (68%), Positives = 305/389 (78%), Gaps = 22/389 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLERMLAF+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEDFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEG--DRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVS  799
                + QN  EV + LSKCSI++      DRN+ +P +R+P+ VPQ       ARPG++V 
Sbjct  425   HPMAQQNSVEVTDGLSKCSIRDERPRGADRNAQMPMSRVPINVPQTVQGAAVARPGKVVG  484

Query  798   SVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED---GN  634
             SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ R ++     
Sbjct  485   SVLRYNNCGAATGVEALEQQQRRMVRNPAAASQ-------YPKRTQPCKSNRADEDCAAA  537

Query  633   EGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
             EG + +    QY+ +KVAAA   + ++WY
Sbjct  538   EGPSRLKPNAQYIPQKVAAAQDTAMSRWY  566


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|EYU45605.1| hypothetical protein MIMGU_mgv1a003935mg [Erythranthe guttata]
Length=553

 Score =   516 bits (1330),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/382 (71%), Positives = 299/382 (78%), Gaps = 20/382 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTG+PLFPGKNVVHQLDLMT
Sbjct  184   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGRPLFPGKNVVHQLDLMT  243

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP  E IARIRNEKARRYLSSMRKKK +P S+KFPNADP AL LLERMLAFDPKDR
Sbjct  244   DLLGTPPSETIARIRNEKARRYLSSMRKKKAVPLSHKFPNADPFALRLLERMLAFDPKDR  303

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITK+DVRELIYREILEYHPKML
Sbjct  304   PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKDDVRELIYREILEYHPKML  363

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG EPTSFMYPSAVDKFKKQFA+LEEH+ K G  APPERQ +SSLPR  VLYSDNS
Sbjct  364   KEQLEGAEPTSFMYPSAVDKFKKQFAFLEEHW-KNGSAAPPERQHSSSLPRTCVLYSDNS  422

Query  948   VQNP-AEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYN---  781
               +   +VAN+ SKCS+KE +++     I          +  AARPG+IV  V+RYN   
Sbjct  423   NHSSVGDVANEFSKCSVKEDEKIQAPQNIQA--------RASAARPGKIVGPVLRYNNCG  474

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQ  601
             + +A T+ +A EQR+ +RNP+   QY   N SY R+        G DG  G    PKPD 
Sbjct  475   AAAATTSVDANEQRKTIRNPSIPAQYIGPNSSYPRKQSGLPEGSG-DGPNGLQ--PKPDA  531

Query  600   YMARKVAAAP----GGSGNQWY  547
             Y+ARKVAAA     GG G+ WY
Sbjct  532   YLARKVAAAAAAAQGGPGSHWY  553


 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRG+KYIHT 
Sbjct  108   MESDLHQVIKANDDLTPEHYQFFLYQLLRGMKYIHTA  144



>gb|AGA37181.1| mitogen-activated protein kinase 16.1 [Brassica napus]
Length=558

 Score =   516 bits (1328),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 260/387 (67%), Positives = 304/387 (79%), Gaps = 26/387 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PT+EEALADPYF+NLA+VEREPS QPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTSEEALADPYFKNLAKVEREPSCQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ----GDAARPGRIV  802
                + Q+  EV + LSKCSI++ +R    DR       R+P+ VPQ       ARPG++V
Sbjct  425   HAAAQQSSVEVTDGLSKCSIRDTERPRGADR-------RVPINVPQTIQGAAVARPGKVV  477

Query  801   SSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEG  628
              SV+RYN+  A T  EAIE  QRRM+RNP    QY    P        CK+ RG++ +EG
Sbjct  478   GSVLRYNNCGAATGVEAIEQQQRRMVRNPAGAAQYPKRTPQ------PCKSNRGDEDSEG  531

Query  627   SNTVPKPDQYMARKVAAAPGGSGNQWY  547
             S+ + +  QY+ +KV  A   + ++WY
Sbjct  532   SSRLKQNPQYIPQKVGGAQDTATSRWY  558


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|ACF06191.1| mitogen activated protein kinase 16-1 [Oryza sativa Indica Group]
Length=542

 Score =   515 bits (1326),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 251/375 (67%), Positives = 297/375 (79%), Gaps = 7/375 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE I+RIRNEKARRYL+SMR+KKPIPF+ KFPNADPLA+ LLERMLAFDPKDR
Sbjct  233   DLLGTPSPETISRIRNEKARRYLNSMRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQP+TK+EFEFERRRITKED+RELIYREILEYHPKML
Sbjct  293   PSAEEALADPYFKNIANVDREPSAQPITKLEFEFERRRITKEDIRELIYREILEYHPKML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRP V+YSDN 
Sbjct  353   REFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPCVVYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSG-IPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
              Q+ A V  DLS+C I++ +   ++S  +  +R    +PQG AARPG+ V S++RY + S
Sbjct  412   PQSTASVTEDLSRCLIRDNNLKSQDSASVGASR----IPQGAAARPGKAVGSMLRYGNCS  467

Query  771   AVTASEAIEQRRMLRNPTTMPQYAI-SNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYM  595
                A +  EQRR++RNP   P  ++    SY RR+ +CK+E G+     S+    P  Y+
Sbjct  468   TSAAEQQYEQRRVVRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKPYV  527

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A   G    W
Sbjct  528   ANKLPATVDGRSGHW  542


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>emb|CDY13942.1| BnaC09g38840D [Brassica napus]
Length=560

 Score =   515 bits (1327),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 306/387 (79%), Gaps = 24/387 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPF++KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFTHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTK+EFEFERRR+TKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKLEFEFERRRVTKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHTPPERQQHASLPRACVLYSDNK  424

Query  951   ----SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVSS  796
                   Q+  EV + LSKCSI++ +R  RN+     R+P+ VPQ       ARPG++V S
Sbjct  425   NGAGGQQSSVEVTDGLSKCSIRD-ERPHRNA----QRIPVNVPQTIQGAAVARPGKVVGS  479

Query  795   VMRYNSGSAVTASEAIE-QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE---DGNEG  628
             V+RYN+  A T  EA+E QRRM+RNP  + QY        R    CK+ RG+   D  EG
Sbjct  480   VLRYNNCGAATGVEALEQQRRMVRNPVGVAQYP------KRSSQPCKSSRGDEDCDTTEG  533

Query  627   SNTVPKPDQYMARKVAAAPGGSGNQWY  547
             S+ + +  QY+ +KVAAA   + ++WY
Sbjct  534   SSRLKQNPQYIPQKVAAAQDTAMSRWY  560


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006654030.1| PREDICTED: mitogen-activated protein kinase 14-like [Oryza brachyantha]
Length=543

 Score =   514 bits (1324),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 295/374 (79%), Gaps = 4/374 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE I+RIRNEKARRYL+ MR+K+PIPF+ KFPNADPLA+ LLERMLAFDPKDR
Sbjct  233   DLLGTPSPETISRIRNEKARRYLNGMRRKRPIPFTQKFPNADPLAMRLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQP+TK+EFEFERRRITKED+RELIYREILEYHPKML
Sbjct  293   PSAEEALADPYFKNIANVDREPSAQPITKLEFEFERRRITKEDIRELIYREILEYHPKML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EFIEGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRP V+YSDN 
Sbjct  353   REFIEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPCVVYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              Q+ + V  DLS+C I+  D   ++     +    +VPQG AARPG++V SV+RY + S 
Sbjct  412   PQSTSNVTEDLSRCLIR--DNTIKSQQDSASVGASRVPQGAAARPGKVVGSVLRYGNCST  469

Query  768   VTASEAIEQRRMLRNPTTMPQYAIS-NPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMA  592
               A +  EQRR++RNP   P  ++S   SY RR+ +CK+E G+     ++    P  Y+A
Sbjct  470   SAAEQQYEQRRVVRNPAIAPNSSVSLGSSYPRRNQTCKSETGDAERIDTSQAGPPKPYVA  529

Query  591   RKVAAAPGGSGNQW  550
              K+ A   G    W
Sbjct  530   NKLPATVDGRSGHW  543


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>emb|CDY66706.1| BnaAnng22780D [Brassica napus]
Length=559

 Score =   514 bits (1325),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 302/388 (78%), Gaps = 27/388 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DTLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PT+EEALADPYF+NLA+VEREPS QPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTSEEALADPYFKNLAKVEREPSCQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ-----GDAARPGRI  805
                + Q   EV + LSKCSI++ +R    DR       R+P+ VPQ        ARPG++
Sbjct  425   HAAAQQTSVEVTDGLSKCSIRDTERPRGADR-------RVPINVPQTIQAGAAVARPGKV  477

Query  804   VSSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNE  631
             V SV+RYN+  A T  EAIE  QRRM+RNP    QY    P        CK+ RG++ +E
Sbjct  478   VGSVLRYNNCGAATGVEAIEQQQRRMVRNPAGAAQYPKRTPQ------PCKSNRGDEDSE  531

Query  630   GSNTVPKPDQYMARKVAAAPGGSGNQWY  547
             GS+ + +  QY+ +KV  A   + ++WY
Sbjct  532   GSSRLKQNPQYIPQKVGGAQDTATSRWY  559


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_002873923.1| mitogen-activated protein kinase 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50182.1| mitogen-activated protein kinase 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=566

 Score =   514 bits (1325),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 265/391 (68%), Positives = 309/391 (79%), Gaps = 26/391 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF  LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADVYFMGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ----GDAARPGRIV  802
                + Q+ AEV + LSKCSI++ +R    DRN+ +P +R+P+  PQ       ARPG++V
Sbjct  425   HPVAQQSSAEVTDGLSKCSIRD-ERPRGADRNAQMPMSRIPINAPQTIQGAAVARPGKVV  483

Query  801   SSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED----  640
              SV+RYN G+A T  EA+E  QRRM+RNP    QY        R HP CK+ RG++    
Sbjct  484   GSVLRYNCGAA-TGVEALEQQQRRMVRNPAAASQYP------KRTHP-CKSNRGDEDCAT  535

Query  639   GNEGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
               EG + +    QY+ +KVAAA   + ++WY
Sbjct  536   AAEGPSRLKPNTQYIPQKVAAAQDTAMSRWY  566


 Score = 75.5 bits (184),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRGLKYIHTA  145



>ref|XP_009120928.1| PREDICTED: mitogen-activated protein kinase 16 [Brassica rapa]
 emb|CDX92566.1| BnaA10g16050D [Brassica napus]
Length=561

 Score =   514 bits (1324),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 261/388 (67%), Positives = 306/388 (79%), Gaps = 25/388 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPF++KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFTHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTK+EFEFERRR+TKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKLEFEFERRRVTKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHTPPERQQHASLPRACVLYSDNK  424

Query  951   ----SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVSS  796
                   Q+  EV + LSKCSI++ +R  RN+     R+P+ VPQ       ARPG++V S
Sbjct  425   NGAGGQQSSVEVTDGLSKCSIRD-ERPHRNA----QRIPVNVPQTIQGAAVARPGKVVGS  479

Query  795   VMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE---DGNE  631
             V+RYN+  A T  EA+E  QRRM+RNP  + QY        R    CK+ RG+   D  E
Sbjct  480   VLRYNNCGAATGVEALEQQQRRMVRNPVGVAQYP------KRSSQPCKSSRGDEDCDSAE  533

Query  630   GSNTVPKPDQYMARKVAAAPGGSGNQWY  547
             GS+ + +  QY+ +KVAAA   + ++WY
Sbjct  534   GSSRLKQNPQYIPQKVAAAQDTAMSRWY  561


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|NP_197402.1| mitogen-activated protein kinase 16 [Arabidopsis thaliana]
 sp|Q8W4J2.2|MPK16_ARATH RecName: Full=Mitogen-activated protein kinase 16; Short=AtMPK16; 
Short=MAP kinase 16 [Arabidopsis thaliana]
 gb|AED92639.1| mitogen-activated protein kinase 16 [Arabidopsis thaliana]
Length=567

 Score =   514 bits (1323),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 261/391 (67%), Positives = 308/391 (79%), Gaps = 25/391 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ DPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHTDPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ----GDAARPGRIV  802
                + Q+ AEV + LSKCSI++ +R    DRN+ +P +R+P+ VPQ       ARPG++V
Sbjct  425   HPVAQQSSAEVTDGLSKCSIRD-ERPRGADRNAQMPMSRIPINVPQTIQGAAVARPGKVV  483

Query  801   SSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED----  640
              SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ RG++    
Sbjct  484   GSVLRYNNCGAATGVEALEQQQRRMVRNPAAASQ-------YPKRTQPCKSNRGDEDCAT  536

Query  639   GNEGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
               EG + +    QY+ +KV+AA   + ++WY
Sbjct  537   AAEGPSRLKPNTQYIPQKVSAAQDTAMSRWY  567


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_009131716.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Brassica rapa]
Length=558

 Score =   513 bits (1322),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 258/384 (67%), Positives = 303/384 (79%), Gaps = 20/384 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PT+EEALADPYF+NLA+VEREPS QPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTSEEALADPYFKNLAKVEREPSCQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVSSV  793
                + Q+  EV + LSKCSI++ +R  R S     R+P+ VPQ       ARPG++V SV
Sbjct  425   HAAAQQSSVEVTDGLSKCSIRDTER-PRGSD---RRVPINVPQTIQGAAVARPGKVVGSV  480

Query  792   MRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNT  619
             +RYN+    T  EA+E  QRRM+RNP    QY    P        CK+ RG++ +EGS+ 
Sbjct  481   LRYNNCGEATGVEALEQQQRRMVRNPAGAAQYPKRTPQ------PCKSNRGDEDSEGSSR  534

Query  618   VPKPDQYMARKVAAAPGGSGNQWY  547
             + +  QY+ +KV  A   + ++WY
Sbjct  535   LKQNPQYIPQKVGGAQDTATSRWY  558


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|AAL32607.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15447.1| Unknown protein [Arabidopsis thaliana]
Length=567

 Score =   513 bits (1322),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/391 (67%), Positives = 308/391 (79%), Gaps = 25/391 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ DPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHTDPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYRNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ----GDAARPGRIV  802
                + Q+ AEV + LSKCSI++ +R    DRN+ +P +R+P+ VPQ       ARPG++V
Sbjct  425   HPVAQQSSAEVTDGLSKCSIRD-ERPRGADRNAQMPMSRIPINVPQTIQGAAVARPGKVV  483

Query  801   SSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED----  640
              SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ RG++    
Sbjct  484   GSVLRYNNCGAATGVEALEQQQRRMVRNPAAASQ-------YPKRTQPCKSNRGDEDCAT  536

Query  639   GNEGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
               EG + +    QY+ +KV+AA   + ++WY
Sbjct  537   AAEGPSRLKPNTQYIPQKVSAAQDTAMSRWY  567


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_009131715.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Brassica rapa]
Length=559

 Score =   513 bits (1321),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 303/385 (79%), Gaps = 21/385 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PT+EEALADPYF+NLA+VEREPS QPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTSEEALADPYFKNLAKVEREPSCQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQ-----GDAARPGRIVSS  796
                + Q+  EV + LSKCSI++ +R  R S     R+P+ VPQ        ARPG++V S
Sbjct  425   HAAAQQSSVEVTDGLSKCSIRDTER-PRGSD---RRVPINVPQTIQAGAAVARPGKVVGS  480

Query  795   VMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSN  622
             V+RYN+    T  EA+E  QRRM+RNP    QY    P        CK+ RG++ +EGS+
Sbjct  481   VLRYNNCGEATGVEALEQQQRRMVRNPAGAAQYPKRTPQ------PCKSNRGDEDSEGSS  534

Query  621   TVPKPDQYMARKVAAAPGGSGNQWY  547
              + +  QY+ +KV  A   + ++WY
Sbjct  535   RLKQNPQYIPQKVGGAQDTATSRWY  559


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010496745.1| PREDICTED: mitogen-activated protein kinase 16-like [Camelina 
sativa]
Length=650

 Score =   516 bits (1328),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 263/390 (67%), Positives = 307/390 (79%), Gaps = 24/390 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  269   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLMT  328

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLERMLAF+PKDR
Sbjct  329   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLERMLAFEPKDR  388

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  389   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  448

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  449   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  508

Query  951   ---SVQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQ----GDAARPGRIV  802
                + QN  EV + LSKCSI++ +R    DRN+ +P +R+P+ VPQ       ARPG++V
Sbjct  509   HPMAQQNSVEVTDGLSKCSIRD-ERPRGADRNAQMPMSRVPINVPQTVQGAAVARPGKVV  567

Query  801   SSVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED---G  637
              SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ R ++    
Sbjct  568   GSVLRYNNCGAATGVEALEQQQRRMVRNPAAASQ-------YPKRTQPCKSNRADEDCAA  620

Query  636   NEGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
              EG + +    QY+ +KVAAA   + ++WY
Sbjct  621   AEGPSRLKPNAQYIPQKVAAAQDTAMSRWY  650


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -2

Query  1759  DLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
              ++QVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  196   SIYQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  229



>gb|ABG54343.1| double HA-tagged mitogen activated protein kinase 16 [synthetic 
construct]
Length=588

 Score =   512 bits (1319),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 260/390 (67%), Positives = 306/390 (78%), Gaps = 23/390 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ DPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHTDPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALAD YF+ LA+VEREPSAQPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADVYFKGLAKVEREPSAQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+++G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYLDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEG--DRLDRNSGIPTTRLPLQVPQ----GDAARPGRIVS  799
                + Q+ AEV + LSKCSI++      DRN+ +P +R+P+ VPQ       ARPG++V 
Sbjct  425   HPVAQQSSAEVTDGLSKCSIRDERPRGADRNAQMPMSRIPINVPQTIQGAAVARPGKVVG  484

Query  798   SVMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED----G  637
             SV+RYN+  A T  EA+E  QRRM+RNP    Q       Y +R   CK+ RG++     
Sbjct  485   SVLRYNNCGAATGVEALEQQQRRMVRNPAAASQ-------YPKRTQPCKSNRGDEDCATA  537

Query  636   NEGSNTVPKPDQYMARKVAAAPGGSGNQWY  547
              EG + +    QY+ +KV+AA   + ++WY
Sbjct  538   AEGPSRLKPNTQYIPQKVSAAQDTAMSRWY  567


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>emb|CDX70861.1| BnaC03g09450D [Brassica napus]
Length=559

 Score =   511 bits (1315),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 303/385 (79%), Gaps = 21/385 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS EAI R+RNEKARRYLSSMRKKKPIPFS+KFP+ADPLAL LLE+ML+F+PKDR
Sbjct  245   DMLGTPSAEAIGRVRNEKARRYLSSMRKKKPIPFSHKFPHADPLALRLLEKMLSFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PT+EEALADPYF+NLA+VEREPS QPVTK+EFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTSEEALADPYFKNLAKVEREPSCQPVTKLEFEFERRRITKEDVRELIYRESLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             KE+ +G+EPT+FMYPSAV+ FKKQFAYLEEHY  G    PPERQQ +SLPR  VLYSDN 
Sbjct  365   KEYSDGSEPTNFMYPSAVEHFKKQFAYLEEHYKNGTSHNPPERQQHASLPRACVLYSDNN  424

Query  951   ---SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQ-----GDAARPGRIVSS  796
                + Q+  EV + LSKCSI++ +R  R S     R+P+ VPQ        ARPG++V S
Sbjct  425   HAAAQQSSVEVTDGLSKCSIRDTER-PRGSD---RRVPINVPQTIQAGAAVARPGKVVGS  480

Query  795   VMRYNSGSAVTASEAIE--QRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSN  622
             V+RY++  A T  EA+E  QRRM+RNP    QY    P        CK+ RG++ +EGS+
Sbjct  481   VLRYSNCGAATGVEALEQQQRRMVRNPAGAAQYPKRTPQ------PCKSNRGDEDSEGSS  534

Query  621   TVPKPDQYMARKVAAAPGGSGNQWY  547
              + +  QY+ +KV  A   + ++WY
Sbjct  535   RLKQNPQYIPQKVGGAQDTAVSRWY  559


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_006850807.1| hypothetical protein AMTR_s00025p00113840 [Amborella trichopoda]
 gb|ERN12388.1| hypothetical protein AMTR_s00025p00113840 [Amborella trichopoda]
Length=557

 Score =   509 bits (1312),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 259/377 (69%), Positives = 305/377 (81%), Gaps = 15/377 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYL SMRKKKP+PF+ KFPN DP AL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLGSMRKKKPVPFTQKFPNVDPFALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAE+ALADPYFR LARV+RE S QP+TKMEFEFERRR+TKED+RELIYREILEYHPKML
Sbjct  305   PTAEKALADPYFRGLARVDREHSTQPLTKMEFEFERRRLTKEDIRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF++GT+ T FMYPSAVD+FKKQFAYLEEH+G G  VAP ERQ A SLPRP VLYS+ +
Sbjct  365   KEFLDGTDSTGFMYPSAVDQFKKQFAYLEEHFGNGVTVAPLERQHA-SLPRPCVLYSEEA  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP----QGDAARPGRIVSSVMR  787
              QN +EV  D S+C   E ++   D+ +GI  +++PLQV     QG AA+PG+++ SV+ 
Sbjct  424   TQN-SEVLADSSRCGNSESNKPPSDKIAGIAMSKVPLQVHQKALQGSAAKPGKVIGSVL-  481

Query  786   YNSGSAVTASEAIEQRRMLR-NPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTV-P  613
              ++G+ V  +EA EQRR++R +P  + QY  SN SY RR+ + K E  E+  E SN V P
Sbjct  482   -HNGNGVALTEAYEQRRVIRHHPAIVTQYNASNCSYPRRNSAIKGEIREE--EASNVVQP  538

Query  612   KPDQYMARKVAAAPGGS  562
             KP QY+ARKVA+  G  
Sbjct  539   KP-QYVARKVASQAGAG  554


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLK+IH+ 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKFIHSA  145



>ref|XP_010231730.1| PREDICTED: mitogen-activated protein kinase 14 [Brachypodium 
distachyon]
Length=544

 Score =   504 bits (1298),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 247/375 (66%), Positives = 294/375 (78%), Gaps = 5/375 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E IARIRNEKARRYLSSMR+KK +PF+ KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPSAETIARIRNEKARRYLSSMRRKKTVPFTQKFPNADPLALNLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  293   PSAEEALADPYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EG EPT FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV+YSDN 
Sbjct  353   REFLEGAEPTGFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDR--NSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
              QN A + +DLS+C+I++  +  +  ++ +   R+P       AARPG++V SV+RY + 
Sbjct  412   PQNAANITDDLSRCAIRDNTQKAQKDSASVGANRIP-HGAAAAAARPGKVVGSVLRYGNC  470

Query  774   SAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYM  595
             S  + +E  EQRR++R+P   P    S  SY RR+ +CK+E GE     +N    P  Y+
Sbjct  471   S-TSGTEQYEQRRVVRSPGIAPNGVTSGSSYPRRNNTCKSETGEAERIDTNQGGPPKPYV  529

Query  594   ARKVAAAPGGSGNQW  550
             A K+ A   G    W
Sbjct  530   ANKLPATVDGRNGHW  544


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>ref|XP_007034573.1| Mitogen-activated protein kinase 16 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05499.1| Mitogen-activated protein kinase 16 isoform 2, partial [Theobroma 
cacao]
Length=475

 Score =   500 bits (1287),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/292 (84%), Positives = 263/292 (90%), Gaps = 6/292 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYG G   AP ERQ A SLPRP VLYSDNS
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHA-SLPRPCVLYSDNS  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGR  808
             VQN  +V ++LSKCSIKE ++   +R+ GIP +RLPLQVP   Q  AARPG+
Sbjct  424   VQNSTDVTDNLSKCSIKETEKPHTERSCGIPMSRLPLQVPQSIQAGAARPGK  475


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010255858.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Nelumbo nucifera]
Length=488

 Score =   490 bits (1261),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/281 (85%), Positives = 256/281 (91%), Gaps = 3/281 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIF+E+LTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFSEILTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSQKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFR LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFRGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KEF+EGTE T FMYPSAV++FKKQFAYLEEHYG G  VAPPERQ A SLPRP VLYS+N+
Sbjct  365   KEFLEGTESTGFMYPSAVEQFKKQFAYLEEHYGNGAAVAPPERQHA-SLPRPCVLYSNNT  423

Query  948   VQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQ  832
               + +EV +DLSKC IKE ++   DR  GIPTT++PLQVPQ
Sbjct  424   AHSSSEVTDDLSKCCIKEIEKPQPDRGFGIPTTKVPLQVPQ  464


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>dbj|BAK06412.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   486 bits (1251),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 245/383 (64%), Positives = 287/383 (75%), Gaps = 16/383 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  49    FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  108

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE IARIRNEKARRYLSSMR+KKP+PF+ KFPNADPLAL LLERMLAFDPKDR
Sbjct  109   DLLGTPSPETIARIRNEKARRYLSSMRRKKPVPFTQKFPNADPLALNLLERMLAFDPKDR  168

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  169   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  228

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV++SDN 
Sbjct  229   REFLEGAEPTGFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIFSDNR  287

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDR--NSGIPTTRLPLQVPQGDA-ARPGRIVS  799
                     Q  A + +DLS+C I++  +  R   + +   R    VPQG A ARPG++V 
Sbjct  288   PQGSDSRPQGAANITDDLSRCIIRDNTQKPRRDTASVGANR----VPQGAAVARPGKVVG  343

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNT  619
             S +RY + S  + +E  EQRR+      +P    S  SY RR+ +CK+E GE      + 
Sbjct  344   SALRYGNCS-TSGTEQYEQRRVTTGQGIVPNGVPSGSSYPRRNNTCKSETGEAERIDVSQ  402

Query  618   VPKPDQYMARKVAAAPGGSGNQW  550
                P  Y   K+ A   G    W
Sbjct  403   AGPPKPYTGNKLPATVDGRNGHW  425



>gb|EMS68017.1| Mitogen-activated protein kinase 14 [Triticum urartu]
Length=583

 Score =   491 bits (1265),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/394 (63%), Positives = 296/394 (75%), Gaps = 14/394 (4%)
 Frame = -3

Query  1701  FFISFSED*NTYTQ--DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLF  1528
             +FI  S    ++    DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLF
Sbjct  194   YFIEISNQRISWLMLIDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLF  253

Query  1527  PGKNVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALC  1348
             PGKNVVHQLD++TDLLGTP+PE IARIRNEKARRYLSSMR+KKP+PF++KFPNADPLAL 
Sbjct  254   PGKNVVHQLDIITDLLGTPAPETIARIRNEKARRYLSSMRRKKPVPFTHKFPNADPLALN  313

Query  1347  LLERMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVREL  1168
             LLERMLAFDPKDRP+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+REL
Sbjct  314   LLERMLAFDPKDRPSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIREL  373

Query  1167  IYREILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQAS  988
             IYREILEYHP ML+EF+EG EPT+FMYPSAVD FKKQF +LEEHY KG   APPERQ  +
Sbjct  374   IYREILEYHPNMLREFLEGAEPTNFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-N  432

Query  987   SLPRPSVLYSDN-------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQG  829
             SLPRPSV+YSDN         Q  A + +DLS+C I++  +  R    P +    +VPQG
Sbjct  433   SLPRPSVIYSDNRPQCSDSRPQGAANITDDLSRCIIRDNAQKPRRD--PASVGANRVPQG  490

Query  828   DA-ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
              A ARPG++V S +RY + S  + +E  EQRR++ +   +P    S  SY RR+ +CK+E
Sbjct  491   AAVARPGKVVGSALRYGNCST-SGTEQYEQRRVVTSQGIVPNGVPSGSSYPRRNNTCKSE  549

Query  651   RGEDGNEGSNTVPKPDQYMARKVAAAPGGSGNQW  550
              GE      +    P  Y   K+ A   G    W
Sbjct  550   TGEAERIDVSQAGPPKPYTGNKLPATVDGRNGHW  583


 Score = 85.5 bits (210),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTGLCCNKMVQGS*IVWILFL  1604
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG       Q +  + ILF+
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTGHTVRYSAQRTLEIQILFV  151



>ref|XP_004979153.1| PREDICTED: mitogen-activated protein kinase 14-like isoform X3 
[Setaria italica]
Length=534

 Score =   489 bits (1260),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 250/376 (66%), Positives = 283/376 (75%), Gaps = 17/376 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKA+RYLSSMR+KKPIPF++KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPSPEAISRIRNEKAKRYLSSMRRKKPIPFTHKFPNADPLALRLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REP+AQPV K+EFEFERRRITKED+RELIYREILEYHP ML
Sbjct  293   PSAEEALADPYFKNIANVDREPAAQPVMKLEFEFERRRITKEDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSDN 
Sbjct  353   REFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNS  778
              Q+   V  DLSKC I++  R   LD +S +   R    VPQG A RP R V S  RY +
Sbjct  412   TQSTTNVTEDLSKCVIRDDARRAQLD-SSSVGANR----VPQGGATRPARGVGSAERYGN  466

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQY  598
               A  A++  EQRR+    +          SY +R P+CK E  E          +P  Y
Sbjct  467   -YASPAADQYEQRRIANGVS-------PRSSYPKRIPTCKGETSEADRIDVRQTGQPKPY  518

Query  597   MARKVAAAPGGSGNQW  550
             +  K+     G    W
Sbjct  519   IPNKLPTTVDGRNGHW  534


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|ABC54585.1| mitogen-activated protein kinase 2 [Triticum aestivum]
Length=549

 Score =   489 bits (1259),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/381 (64%), Positives = 289/381 (76%), Gaps = 12/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PE IARIRNEKARRYLSSMR+KKP+PF+ KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPAPETIARIRNEKARRYLSSMRRKKPVPFTQKFPNADPLALNLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  293   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT+FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV+YSDN 
Sbjct  353   REFLEGAEPTNFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIYSDNR  411

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDA-ARPGRIVSSV  793
                     Q  A + +DLS+C I++  +  R    P +    +VPQG A ARPG++V S 
Sbjct  412   PQGSDSRPQGAANITDDLSRCIIRDNTQKPRRD--PASVGANRVPQGAAVARPGKVVGSA  469

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVP  613
             +RY + S    +E  EQRR++ +   +P    S  SY RR+ +CK+E GE      +   
Sbjct  470   LRYGNCS-TPGTEQYEQRRVITSQGVVPNGVPSGSSYPRRNNTCKSETGEAERIDVSQAG  528

Query  612   KPDQYMARKVAAAPGGSGNQW  550
              P  Y   K+ A   G    W
Sbjct  529   PPKPYTGNKLPATVDGRNGHW  549


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|ABG22446.1| Extracellular signal-regulated kinase 1, putative, expressed 
[Oryza sativa Japonica Group]
Length=402

 Score =   484 bits (1245),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 264/316 (84%), Gaps = 4/316 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  77    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  136

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI+RIRNEKARRYLSSMR+KKPIPF+ KFPNADPLAL LLERML+F+PKDR
Sbjct  137   DLLGTPSTEAISRIRNEKARRYLSSMRRKKPIPFTQKFPNADPLALRLLERMLSFEPKDR  196

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRN+A V+REPSAQPVTK+EFEFERRRITKED+RELIYR+ILEYHP ML
Sbjct  197   PNAEEALADPYFRNIANVDREPSAQPVTKLEFEFERRRITKEDIRELIYRDILEYHPNML  256

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++EGTE   FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSD+ 
Sbjct  257   REYLEGTESAGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDDR  315

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              QN A +A DLSKC +  GD   +      +    +VPQG AARPG++V S +RY + S 
Sbjct  316   PQNTANIAEDLSKCVL--GDNTQKMHQGSASVCANRVPQGGAARPGKVVGSALRYGNCST  373

Query  768   VTASEAIEQRRMLRNP  721
              TA E  E RR  RNP
Sbjct  374   STA-EQYEHRRTDRNP  388


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  37



>ref|XP_004979154.1| PREDICTED: mitogen-activated protein kinase 14-like isoform X4 
[Setaria italica]
Length=415

 Score =   484 bits (1246),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/376 (66%), Positives = 282/376 (75%), Gaps = 16/376 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  53    FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  112

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKA+RYLSSMR+KKPIPF++KFPNADPLAL LLERMLAFDPKDR
Sbjct  113   DLLGTPSPEAISRIRNEKAKRYLSSMRRKKPIPFTHKFPNADPLALRLLERMLAFDPKDR  172

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REP+AQPV K+EFEFERRRITKED+RELIYREILEYHP ML
Sbjct  173   PSAEEALADPYFKNIANVDREPAAQPVMKLEFEFERRRITKEDIRELIYREILEYHPNML  232

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSDN 
Sbjct  233   REFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDNR  291

Query  948   VQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNS  778
              Q+   V  DLSKC I++  R   LD +S +   R+P     G A RP R V S  RY +
Sbjct  292   TQSTTNVTEDLSKCVIRDDARRAQLD-SSSVGANRVPQ---AGGATRPARGVGSAERYGN  347

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQY  598
               A  A++  EQRR+    +          SY +R P+CK E  E          +P  Y
Sbjct  348   -YASPAADQYEQRRIANGVS-------PRSSYPKRIPTCKGETSEADRIDVRQTGQPKPY  399

Query  597   MARKVAAAPGGSGNQW  550
             +  K+     G    W
Sbjct  400   IPNKLPTTVDGRNGHW  415



>dbj|BAJ88123.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   488 bits (1256),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/383 (64%), Positives = 288/383 (75%), Gaps = 16/383 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE IARIRNEKARRYLSSMR+KKP+PF+ KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPSPETIARIRNEKARRYLSSMRRKKPVPFTQKFPNADPLALNLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  293   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV++SDN 
Sbjct  353   REFLEGAEPTGFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIFSDNR  411

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDR--NSGIPTTRLPLQVPQGDA-ARPGRIVS  799
                     Q  A + +DLS+C I++  +  R   + +   R    VPQG A ARPG++V 
Sbjct  412   PQGSDSRPQGAANITDDLSRCIIRDNTQKPRRDTASVGANR----VPQGAAVARPGKVVG  467

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNT  619
             S +RY + S  + +E  EQRR++     +P    S  SY RR+ +CK+E GE      + 
Sbjct  468   SALRYGNCS-TSGTEQYEQRRVITGQGIVPNGVPSGSSYPRRNNTCKSETGEAERIDVSQ  526

Query  618   VPKPDQYMARKVAAAPGGSGNQW  550
                P  Y   K+ A   G    W
Sbjct  527   AGPPKPYTGNKLPATVDGRNGHW  549


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>dbj|BAJ85440.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   488 bits (1255),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 245/383 (64%), Positives = 287/383 (75%), Gaps = 16/383 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE IARIRNEKARRYLSSMR+KKP+PF+ KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPSPETIARIRNEKARRYLSSMRRKKPVPFTQKFPNADPLALNLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  293   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV++SDN 
Sbjct  353   REFLEGAEPTGFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIFSDNR  411

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDR--NSGIPTTRLPLQVPQGDA-ARPGRIVS  799
                     Q  A + +DLS+C I++  +  R   + +   R    VPQG A ARPG++V 
Sbjct  412   PQGSDSRPQGAANITDDLSRCIIRDNTQKPRRDTASVGANR----VPQGAAVARPGKVVG  467

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNT  619
             S +RY + S  + +E  EQRR++      P    S  SY RR+ +CK+E GE      + 
Sbjct  468   SALRYGNCS-TSGTEQYEQRRVITGQGIFPNGVPSGSSYPRRNNTCKSETGEAERIDVSQ  526

Query  618   VPKPDQYMARKVAAAPGGSGNQW  550
                P  Y   K+ A   G    W
Sbjct  527   AGPPKPYTGNKLPATVDGRNGHW  549


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>ref|XP_010546824.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Tarenaya hassleriana]
Length=503

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 272/314 (87%), Gaps = 15/314 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSVEAIARVRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG+EPT FMYPSAVD FKKQFA+LEEHY  G   APPERQ A SLPR SVLYSD S
Sbjct  365   KEHLEGSEPTGFMYPSAVDHFKKQFAFLEEHYKNGTCGAPPERQHA-SLPRASVLYSDKS  423

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSS--VMRYN-S  778
              QN  +V + +SKCSI+E   ++RN+    TR+P+Q     AA+PG+ V S  ++RYN  
Sbjct  424   -QNSTQVTDSISKCSIRE---IERNN--TATRIPIQ-----AAKPGKAVGSSVLLRYNKC  472

Query  777   GSAVTASEAIEQRR  736
             G+A T SEA+EQ+R
Sbjct  473   GAAATGSEAMEQQR  486


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010546821.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010546823.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X1 
[Tarenaya hassleriana]
Length=504

 Score =   486 bits (1250),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 245/314 (78%), Positives = 272/314 (87%), Gaps = 14/314 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSVEAIARVRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG+EPT FMYPSAVD FKKQFA+LEEHY  G   APPERQ A SLPR SVLYSD S
Sbjct  365   KEHLEGSEPTGFMYPSAVDHFKKQFAFLEEHYKNGTCGAPPERQHA-SLPRASVLYSDKS  423

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSS--VMRYN-S  778
              QN  +V + +SKCSI+E   ++RN+    TR+P+Q     AA+PG+ V S  ++RYN  
Sbjct  424   -QNSTQVTDSISKCSIRE---IERNN--TATRIPIQ----GAAKPGKAVGSSVLLRYNKC  473

Query  777   GSAVTASEAIEQRR  736
             G+A T SEA+EQ+R
Sbjct  474   GAAATGSEAMEQQR  487


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|KHN03034.1| Mitogen-activated protein kinase 16 [Glycine soja]
Length=385

 Score =   481 bits (1238),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 247/342 (72%), Positives = 275/342 (80%), Gaps = 18/342 (5%)
 Frame = -3

Query  1563  IFAELLTGKPLFPGKNVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFS  1384
             I  ELLTGKPLFPGKNVVHQLDLMTD LGTPSPEAIAR+RNEKARRYL  MRKKKP+PFS
Sbjct  34    IHTELLTGKPLFPGKNVVHQLDLMTDFLGTPSPEAIARVRNEKARRYLCCMRKKKPVPFS  93

Query  1383  YKFPNADPLALCLLERMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFE  1204
              KFPN DPLAL +LERMLAF+PKDRPTAEEALA PYF+ LA+VEREPSAQPVTKMEFEFE
Sbjct  94    QKFPNVDPLALRVLERMLAFEPKDRPTAEEALAYPYFKGLAKVEREPSAQPVTKMEFEFE  153

Query  1203  RRRITKEDVRELIYREILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKG  1024
             RRRITKEDVRELIYREILEYHPKMLKE +EG EPT FMYPSAVD FKKQFAYLEEHYGK 
Sbjct  154   RRRITKEDVRELIYREILEYHPKMLKEHLEGEEPTGFMYPSAVDHFKKQFAYLEEHYGKA  213

Query  1023  GVVAPPERQQASSLPRPSVLYSDNSVQNPAEVANDLSKCSIKEGDR--LDRNSGIPTTRL  850
             G V PPERQ A SLPRP VLYSDNS QN AEVA+D+SKC IKE ++  +DR  GIP TRL
Sbjct  214   GTVTPPERQHA-SLPRPCVLYSDNSRQNMAEVADDISKCIIKEVEKPAMDRTGGIPMTRL  272

Query  849   PLQVPQ------------GDAARPGRIVSSVMRYNS-GSAVTASEAIEQRRMLRNPTTMP  709
             PLQ PQ            G AARPG++V S++ YN+ G+AVTA    EQRRM RNP+   
Sbjct  273   PLQAPQNIQGVMTDRIASGVAARPGKVVGSILHYNNCGAAVTAD--AEQRRMGRNPSVSA  330

Query  708   QYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMARKV  583
             QYA  + SY RR+PSCK+ER E+  EG+N +    Q++ +KV
Sbjct  331   QYAAPSSSYPRRNPSCKSERAEEVIEGANGLQTKPQHITQKV  372


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTGLCCNK  1643
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT L   K
Sbjct  1     MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTELLTGK  42



>ref|NP_001067677.2| Os11g0271100 [Oryza sativa Japonica Group]
 dbj|BAF28040.2| Os11g0271100, partial [Oryza sativa Japonica Group]
Length=501

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 264/316 (84%), Gaps = 4/316 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  176   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  235

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI+RIRNEKARRYLSSMR+KKPIPF+ KFPNADPLAL LLERML+F+PKDR
Sbjct  236   DLLGTPSTEAISRIRNEKARRYLSSMRRKKPIPFTQKFPNADPLALRLLERMLSFEPKDR  295

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRN+A V+REPSAQPVTK+EFEFERRRITKED+RELIYR+ILEYHP ML
Sbjct  296   PNAEEALADPYFRNIANVDREPSAQPVTKLEFEFERRRITKEDIRELIYRDILEYHPNML  355

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++EGTE   FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSD+ 
Sbjct  356   REYLEGTESAGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDDR  414

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              QN A +A DLSKC +  GD   +      +    +VPQG AARPG++V S +RY + S 
Sbjct  415   PQNTANIAEDLSKCVL--GDNTQKMHQGSASVCANRVPQGGAARPGKVVGSALRYGNCST  472

Query  768   VTASEAIEQRRMLRNP  721
              TA E  E RR  RNP
Sbjct  473   STA-EQYEHRRTDRNP  487


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  100   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  136



>sp|Q53N72.1|MPK15_ORYSJ RecName: Full=Mitogen-activated protein kinase 15; Short=MAP 
kinase 15 [Oryza sativa Japonica Group]
 gb|AAX94956.1| Protein kinase domain, putative [Oryza sativa Japonica Group]
 gb|ABA92667.1| Extracellular signal-regulated kinase 1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG91195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=498

 Score =   484 bits (1246),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 264/316 (84%), Gaps = 4/316 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI+RIRNEKARRYLSSMR+KKPIPF+ KFPNADPLAL LLERML+F+PKDR
Sbjct  233   DLLGTPSTEAISRIRNEKARRYLSSMRRKKPIPFTQKFPNADPLALRLLERMLSFEPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRN+A V+REPSAQPVTK+EFEFERRRITKED+RELIYR+ILEYHP ML
Sbjct  293   PNAEEALADPYFRNIANVDREPSAQPVTKLEFEFERRRITKEDIRELIYRDILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++EGTE   FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSD+ 
Sbjct  353   REYLEGTESAGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDDR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              QN A +A DLSKC +  GD   +      +    +VPQG AARPG++V S +RY + S 
Sbjct  412   PQNTANIAEDLSKCVL--GDNTQKMHQGSASVCANRVPQGGAARPGKVVGSALRYGNCST  469

Query  768   VTASEAIEQRRMLRNP  721
              TA E  E RR  RNP
Sbjct  470   STA-EQYEHRRTDRNP  484


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>ref|XP_004979151.1| PREDICTED: mitogen-activated protein kinase 14-like isoform X1 
[Setaria italica]
 ref|XP_004979152.1| PREDICTED: mitogen-activated protein kinase 14-like isoform X2 
[Setaria italica]
Length=535

 Score =   485 bits (1249),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 248/376 (66%), Positives = 282/376 (75%), Gaps = 16/376 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPEAI+RIRNEKA+RYLSSMR+KKPIPF++KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPSPEAISRIRNEKAKRYLSSMRRKKPIPFTHKFPNADPLALRLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF+N+A V+REP+AQPV K+EFEFERRRITKED+RELIYREILEYHP ML
Sbjct  293   PSAEEALADPYFKNIANVDREPAAQPVMKLEFEFERRRITKEDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +EF+EGTE T FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSDN 
Sbjct  353   REFLEGTESTGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDR---LDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNS  778
              Q+   V  DLSKC I++  R   LD +S +   R+P     G A RP R V S  RY +
Sbjct  412   TQSTTNVTEDLSKCVIRDDARRAQLD-SSSVGANRVP---QAGGATRPARGVGSAERYGN  467

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQY  598
               A  A++  EQRR+    +          SY +R P+CK E  E          +P  Y
Sbjct  468   -YASPAADQYEQRRIANGVS-------PRSSYPKRIPTCKGETSEADRIDVRQTGQPKPY  519

Query  597   MARKVAAAPGGSGNQW  550
             +  K+     G    W
Sbjct  520   IPNKLPTTVDGRNGHW  535


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|ABC54584.1| mitogen-activated protein kinase 2 [Triticum aestivum]
Length=549

 Score =   485 bits (1248),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/382 (64%), Positives = 293/382 (77%), Gaps = 14/382 (4%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PE IARIRNEKARRYLSSMR+KKP+PF+ KFPNADPLAL LLERMLAFDPK R
Sbjct  233   DLLGTPAPETIARIRNEKARRYLSSMRRKKPVPFTQKFPNADPLALNLLERMLAFDPKYR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  293   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT+FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV+YSDN 
Sbjct  353   REFLEGAEPTNFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIYSDNR  411

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDA-ARPGRIVSSV  793
                     Q  A + +DLS+C I++  +  R    P +    +VP+G A ARPG++V S 
Sbjct  412   PQGSDSRPQGAANITDDLSRCIIRDNAQKPRRD--PASVGANRVPKGAAVARPGKVVGSA  469

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE-DGNEGSNTV  616
             +RY + S  + +E  EQRR++ +   +P    S  SY RR+ +CK+E GE +  + S  V
Sbjct  470   LRYGNCS-TSGTEQYEQRRVITSQGIVPNGVPSGSSYPRRNNTCKSETGEAERIDVSQAV  528

Query  615   PKPDQYMARKVAAAPGGSGNQW  550
             P P  Y   K+ A   G    W
Sbjct  529   P-PKPYTGNKLPATVDGRNGHW  549


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|EEC67992.1| hypothetical protein OsI_35774 [Oryza sativa Indica Group]
Length=578

 Score =   486 bits (1250),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 238/314 (76%), Positives = 263/314 (84%), Gaps = 4/314 (1%)
 Frame = -3

Query  1662  QDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMTDL  1483
             +DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++TDL
Sbjct  255   EDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIITDL  314

Query  1482  LGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDRPT  1303
             LGTPS EAI+RIRNEKARRYLSSMR KKPIPF+ KFPNADPLAL LLERML+F+PKDRP 
Sbjct  315   LGTPSTEAISRIRNEKARRYLSSMRCKKPIPFTQKFPNADPLALRLLERMLSFEPKDRPN  374

Query  1302  AEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKMLKE  1123
             AEEALADPYFRN+A V+REPSAQPVTK+EFEFERRRITKED+RELIYREILEYHP ML+E
Sbjct  375   AEEALADPYFRNIANVDREPSAQPVTKLEFEFERRRITKEDIRELIYREILEYHPNMLRE  434

Query  1122  FIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNSVQ  943
             ++EGTE   FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSD+  Q
Sbjct  435   YLEGTESAGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDDRPQ  493

Query  942   NPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSAVT  763
             N A +A DLSKC +  GD   +      +    +VPQG AARPG++V S +RY + S  T
Sbjct  494   NTANIAEDLSKCVL--GDNTQKMHQGSASVCANRVPQGGAARPGKVVGSALRYGNCSTST  551

Query  762   ASEAIEQRRMLRNP  721
             A E  E RR  RNP
Sbjct  552   A-ERYEHRRTDRNP  564


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTGLCC  1649
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT L C
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTDLLC  136



>gb|EMT19997.1| Mitogen-activated protein kinase 14 [Aegilops tauschii]
Length=731

 Score =   489 bits (1259),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 245/381 (64%), Positives = 289/381 (76%), Gaps = 12/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  355   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  414

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PE IARIRNEKARRYLSSMR+KKP+PF+ KFPNADPLAL LLERMLAFDPKDR
Sbjct  415   DLLGTPAPETIARIRNEKARRYLSSMRRKKPVPFTQKFPNADPLALNLLERMLAFDPKDR  474

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  475   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  534

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT+FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV+YSDN 
Sbjct  535   REFLEGAEPTNFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIYSDNR  593

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDA-ARPGRIVSSV  793
                     Q  A + +DLS+C I++  +  R    P +    +VPQG A ARPG++V S 
Sbjct  594   PQGSDSRPQGAANITDDLSRCIIRDNTQKPRRD--PASVGANRVPQGAAVARPGKVVGSA  651

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVP  613
             +RY + S    +E  EQRR++ +   +P    S  SY RR+ +CK+E GE      +   
Sbjct  652   LRYGNCS-TPGTEQYEQRRVITSQGVVPNGVPSGSSYPRRNNTCKSETGEAERIDVSQAG  710

Query  612   KPDQYMARKVAAAPGGSGNQW  550
              P  Y   K+ A   G    W
Sbjct  711   PPKPYTGNKLPATVDGRNGHW  731


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT  1661
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT
Sbjct  240   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT  275



>ref|XP_004508355.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X2 
[Cicer arietinum]
Length=543

 Score =   482 bits (1240),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 283/374 (76%), Gaps = 40/374 (11%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPS EAIARIRNEKARRYLSSMRKKKP+PFS KFPNADPLAL +LERMLAF+PKDR
Sbjct  245   DFLGTPSLEAIARIRNEKARRYLSSMRKKKPVPFSQKFPNADPLALRVLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+ EREP AQPV+KMEFEFERRR+TKEDVRELIYREIL+      
Sbjct  305   PTAEEALADPYFKGLAKFEREPCAQPVSKMEFEFERRRVTKEDVRELIYREILD------  358

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
                             AVD FKKQFAYLEEHYGKGG ++P +RQ A SLPR  VLYSD+S
Sbjct  359   ----------------AVDHFKKQFAYLEEHYGKGGTISPLDRQHA-SLPRQCVLYSDDS  401

Query  948   VQNPAEV-ANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQGD---------AARPGRI  805
              QN AEV A+DLSKC IKE ++  +DR   +P  RLPL  PQ           AARP ++
Sbjct  402   RQNMAEVAADDLSKCCIKEVEKPTIDRTGVVPMNRLPLLAPQNIQGVMTDICVAARPRKV  461

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGS  625
               S + Y+ G A +     EQRR +RNP+   QYA S+ SY +R+PSCKNER EDG E S
Sbjct  462   AGSALHYSRGVAGS-----EQRRTIRNPSVAVQYAASSCSYPKRNPSCKNERAEDGIESS  516

Query  624   NTVPKPDQYMARKV  583
             N +    QY+A+KV
Sbjct  517   NGLQSKPQYIAQKV  530


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>gb|ACD76441.1| mitogen activated protein kinase 16-2 [Oryza sativa Indica Group]
Length=498

 Score =   479 bits (1233),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 262/316 (83%), Gaps = 4/316 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI+RIRNEKARRYLSSMR KKPIPF+ KFPNADPLAL LLERML+F+PKDR
Sbjct  233   DLLGTPSTEAISRIRNEKARRYLSSMRCKKPIPFTQKFPNADPLALRLLERMLSFEPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRN+A V+REPSAQPVTK+EFEFERRRITKED+RELIYREI EYHP ML
Sbjct  293   PNAEEALADPYFRNIANVDREPSAQPVTKLEFEFERRRITKEDIRELIYREIPEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++EGTE   FMYPSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSD+ 
Sbjct  353   REYLEGTESAGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDDR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              QN A +A DLSKC +  GD   +      +    +VPQG AARPG++V S +RY + S 
Sbjct  412   PQNTANIAEDLSKCVL--GDNTQKMHQGSASVCANRVPQGGAARPGKVVGSALRYGNCST  469

Query  768   VTASEAIEQRRMLRNP  721
              TA E  E RR  RNP
Sbjct  470   STA-ERYEHRRTDRNP  484


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>ref|XP_006662904.1| PREDICTED: mitogen-activated protein kinase 15-like isoform X1 
[Oryza brachyantha]
Length=508

 Score =   479 bits (1234),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 239/340 (70%), Positives = 275/340 (81%), Gaps = 6/340 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++T
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAI+RIRNEKARRYLSSMR KKPIPF+ KFPNADPLAL LLERML+F+PKDR
Sbjct  233   DLLGTPSTEAISRIRNEKARRYLSSMRWKKPIPFTQKFPNADPLALRLLERMLSFEPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P AEEALADPYFRN+A V+REPSAQPVTK+EF+FERRRITKED+RELIYREILEYHP ML
Sbjct  293   PNAEEALADPYFRNIANVDREPSAQPVTKLEFDFERRRITKEDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++EGTE   FMYPSAV+ FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSDN 
Sbjct  353   REYLEGTESAGFMYPSAVEHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDNR  411

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              Q+ A +  DLSKC +K+  +  + +    +     VPQG  ARPG++V SV+RY + S 
Sbjct  412   PQSTANITEDLSKCVLKDNTQEMQQASASVS--ANGVPQGGVARPGKVVGSVLRYGNCST  469

Query  768   VTASEAIEQRRMLRNPT-TMPQYAIS-NPSYSRRHPSCKN  655
              TA E  E R+ +RNP   +   ++S   SY RR P  ++
Sbjct  470   STA-EQYEHRQAVRNPNPALATNSVSPRGSYPRRSPILQD  508


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|ABC54586.1| mitogen-activated protein kinase 2 [Triticum aestivum]
Length=549

 Score =   479 bits (1233),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/381 (63%), Positives = 287/381 (75%), Gaps = 12/381 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVV QLD++T
Sbjct  173   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVRQLDIIT  232

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP+PE IA I NEKARRYLSSM +KKP+PF++KFPNADPLAL LLERMLAFDPKDR
Sbjct  233   DLLGTPAPETIATIPNEKARRYLSSMMRKKPVPFTHKFPNADPLALNLLERMLAFDPKDR  292

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALAD YF+N+A V+REPSAQP+TK+EFEFERRRITK+D+RELIYREILEYHP ML
Sbjct  293   PSAEEALADLYFKNIASVDREPSAQPITKLEFEFERRRITKDDIRELIYREILEYHPNML  352

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN-  952
             +EF+EG EPT+FMYPSAVD FKKQF +LEEHY KG   APPERQ  +SLPRPSV+YSDN 
Sbjct  353   REFLEGAEPTNFMYPSAVDHFKKQFTFLEEHYAKGSTAAPPERQH-NSLPRPSVIYSDNR  411

Query  951   ------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDA-ARPGRIVSSV  793
                     Q  A + +DLS+C I++  +  R    P +    +VPQG A ARPG++V S 
Sbjct  412   PQCSDSRPQGAANITDDLSRCIIRDNAQKPRRD--PASVGANRVPQGAAVARPGKVVGSA  469

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVP  613
             +RY + S  + +E  EQRR++ +   +P    S  SY RR+ +CK+E GE      +   
Sbjct  470   LRYGNCS-TSGTEQYEQRRVVTSQGIVPNGVPSGSSYPRRNNTCKSETGEAERIDVSQAG  528

Query  612   KPDQYMARKVAAAPGGSGNQW  550
              P  Y   K+ A   G    W
Sbjct  529   PPKPYTGNKLPATVDGRNGHW  549


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|KEH32219.1| MAP kinase-like protein [Medicago truncatula]
Length=504

 Score =   474 bits (1220),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 231/283 (82%), Positives = 249/283 (88%), Gaps = 4/283 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DY+ATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYIATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSPEAIARIRNEKARRYLS+MRKKKP+P   KFPNADPLAL +LERMLAFDPKDR
Sbjct  245   DFLGTPSPEAIARIRNEKARRYLSTMRKKKPVPLYQKFPNADPLALRVLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  LA+ EREP AQ V+KMEFEFERRRITKEDVRELIYRE LEYHPKML
Sbjct  305   PTAEEALADPYFNGLAKFEREPCAQSVSKMEFEFERRRITKEDVRELIYRETLEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++EG EPT FMYPSAVD FKKQFAYLEEHYGKGG V+P +RQ A SLPR  VLYSD+S
Sbjct  365   KEYLEGAEPTGFMYPSAVDHFKKQFAYLEEHYGKGGTVSPLDRQHA-SLPRQCVLYSDDS  423

Query  948   VQNPAEV-ANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVPQG  829
              QN AEV A+DLSKC IKE ++  +DR+ G+P  RLPLQ PQ 
Sbjct  424   RQNMAEVAADDLSKCCIKEVEKPVIDRSGGVPMNRLPLQAPQN  466


 Score = 75.1 bits (183),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRGLKYIHTA  145



>gb|EEE51955.1| hypothetical protein OsJ_33603 [Oryza sativa Japonica Group]
Length=544

 Score =   464 bits (1195),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 237/362 (65%), Positives = 264/362 (73%), Gaps = 50/362 (14%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSK-------------------------------------  1600
             +  DYVATRWYRAPELCGSFFSK                                     
Sbjct  173   FWTDYVATRWYRAPELCGSFFSKAHVPFENHKRKRKIKVWPTALQMDCSFHVHFVGYGVA  232

Query  1599  ---------YTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMTDLLGTPSPEAIARI  1447
                      YTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD++TDLLGTPS EAI+RI
Sbjct  233   RAEAEVKQPYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIITDLLGTPSTEAISRI  292

Query  1446  RNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDRPTAEEALADPYFRN  1267
             RNEKARRYLSSMR+KKPIPF+ KFPNADPLAL LLERML+F+PKDRP AEEALADPYFRN
Sbjct  293   RNEKARRYLSSMRRKKPIPFTQKFPNADPLALRLLERMLSFEPKDRPNAEEALADPYFRN  352

Query  1266  LARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKMLKEFIEGTEPTSFMY  1087
             +A V+REPSAQPVTK+EFEFERRRITKED+RELIYR+ILEYHP ML+E++EGTE   FMY
Sbjct  353   IANVDREPSAQPVTKLEFEFERRRITKEDIRELIYRDILEYHPNMLREYLEGTESAGFMY  412

Query  1086  PSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNSVQNPAEVANDLSKC  907
             PSAVD FKKQFAYLEEHY KG   APPERQ  +SLPRPSVLYSD+  QN A +A DLSKC
Sbjct  413   PSAVDHFKKQFAYLEEHYAKGSTAAPPERQH-NSLPRPSVLYSDDRPQNTANIAEDLSKC  471

Query  906   SIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLR  727
              +  GD   +      +    +VPQG AARPG++V S +RY + S  TA E  E RR  R
Sbjct  472   VL--GDNTQKMHQGSASVCANRVPQGGAARPGKVVGSALRYGNCSTSTA-EQYEHRRTDR  528

Query  726   NP  721
             NP
Sbjct  529   NP  530


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  97    MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  133



>gb|KEH36745.1| MAP kinase-like protein [Medicago truncatula]
Length=421

 Score =   445 bits (1145),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 210/234 (90%), Positives = 221/234 (94%), Gaps = 0/234 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D LGTPSP+AIAR+RNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAF+ KDR
Sbjct  245   DFLGTPSPDAIARVRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFEAKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             KEF+EG EPT FMYPSAVD FKKQFAYLEEHYGKGG VAPPERQ ASSLPR  +
Sbjct  365   KEFLEGAEPTGFMYPSAVDLFKKQFAYLEEHYGKGGTVAPPERQHASSLPRRHI  418


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010546826.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X4 
[Tarenaya hassleriana]
Length=480

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 255/314 (81%), Gaps = 38/314 (12%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSVEAIARVRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG+EPT FMYPSAVD FKKQFA+LEEHY  G   APPERQ A SLP          
Sbjct  365   KEHLEGSEPTGFMYPSAVDHFKKQFAFLEEHYKNGTCGAPPERQHA-SLP----------  413

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSS--VMRYN-S  778
                           SI+E   ++RN+    TR+P+Q     AA+PG+ V S  ++RYN  
Sbjct  414   --------------SIRE---IERNNT--ATRIPIQ-----AAKPGKAVGSSVLLRYNKC  449

Query  777   GSAVTASEAIEQRR  736
             G+A T SEA+EQ+R
Sbjct  450   GAAATGSEAMEQQR  463


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_010546825.1| PREDICTED: mitogen-activated protein kinase 16-like isoform X3 
[Tarenaya hassleriana]
Length=481

 Score =   446 bits (1148),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 255/314 (81%), Gaps = 37/314 (12%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             +LLGTPS EAIAR+RNEKARRYLSSMRKKKP+PFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   ELLGTPSVEAIARVRNEKARRYLSSMRKKKPVPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE +EG+EPT FMYPSAVD FKKQFA+LEEHY  G   APPERQ A SLP          
Sbjct  365   KEHLEGSEPTGFMYPSAVDHFKKQFAFLEEHYKNGTCGAPPERQHA-SLP----------  413

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSS--VMRYN-S  778
                           SI+E   ++RN+    TR+P+Q     AA+PG+ V S  ++RYN  
Sbjct  414   --------------SIRE---IERNN--TATRIPIQ----GAAKPGKAVGSSVLLRYNKC  450

Query  777   GSAVTASEAIEQRR  736
             G+A T SEA+EQ+R
Sbjct  451   GAAATGSEAMEQQR  464


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_007034574.1| Mitogen-activated protein kinase 16 isoform 3 [Theobroma cacao]
 gb|EOY05500.1| Mitogen-activated protein kinase 16 isoform 3 [Theobroma cacao]
Length=417

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 207/231 (90%), Positives = 217/231 (94%), Gaps = 1/231 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS EAIAR+RNEKARRYLSSMRKKKPIPFS+KFPNADPLAL LLERMLAF+PKDR
Sbjct  245   DLLGTPSAEAIARVRNEKARRYLSSMRKKKPIPFSHKFPNADPLALRLLERMLAFEPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML
Sbjct  305   PTAEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPR  976
             KE++EG+EPT FMYPSAVD FKKQFA+LEEHYG G   AP ERQ A SLPR
Sbjct  365   KEYLEGSEPTGFMYPSAVDHFKKQFAFLEEHYGNGTTAAPLERQHA-SLPR  414


 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  145



>ref|XP_008340961.1| PREDICTED: mitogen-activated protein kinase 16-like [Malus domestica]
Length=343

 Score =   426 bits (1096),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 260/317 (82%), Gaps = 10/317 (3%)
 Frame = -3

Query  1482  LGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDRPT  1303
             LGTPS +AIAR+RNEKARRYLSSMR+KK IPFS KFPNADPLAL LLERMLAF+PKDRPT
Sbjct  14    LGTPSADAIARVRNEKARRYLSSMRRKKQIPFSQKFPNADPLALRLLERMLAFEPKDRPT  73

Query  1302  AEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKMLKE  1123
             AEEALADPYF+ LA+VEREPSAQPVTKMEFEFERRRITKEDVRELIYRE LEYHPKMLKE
Sbjct  74    AEEALADPYFKGLAKVEREPSAQPVTKMEFEFERRRITKEDVRELIYRETLEYHPKMLKE  133

Query  1122  FIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNSVQ  943
             ++EG+EPT FMYPSAVD FKKQF YLEEHYG G     PER  A SLPR  V YSDN VQ
Sbjct  134   YLEGSEPTGFMYPSAVDHFKKQFTYLEEHYGNGTTAVAPERTHA-SLPRACVSYSDNPVQ  192

Query  942   NPAEVANDLSKCSIKEGDR--LDRNSGIPTTRLPLQVP---QGDAARPGRIVSSVMRYNS  778
             +  +V +DLS+C IKE ++   DR+SGIPTTRLP+QVP   QG AARPG++V SV+R+N+
Sbjct  193   HSTDVTDDLSRCCIKEXEKPQTDRSSGIPTTRLPIQVPHTIQG-AARPGKVVGSVLRFNN  251

Query  777   GSAVTASEAIEQRRMLRNPTTMPQY-AISNPSYSRRHPSCKNERGE-DGNEGSNTV-PKP  607
               A  A+EA+EQRR++RNP    QY A S  SY RR+  CKNERG+ +G EGSN + PKP
Sbjct  252   CGAAAAAEALEQRRVMRNPAAPTQYPAASAASYPRRNMPCKNERGDCEGVEGSNRLQPKP  311

Query  606   DQYMARKVAAAPGGSGN  556
              QY+ RKVAAA GGSG+
Sbjct  312   PQYIPRKVAAAQGGSGS  328



>gb|ABK24488.1| unknown [Picea sitchensis]
Length=571

 Score =   432 bits (1111),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 241/393 (61%), Positives = 290/393 (74%), Gaps = 26/393 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E IAR+RNEKARRYL+SMRKK+P+PF+ KF   D LAL LLER+LAFDPKDR
Sbjct  245   DLLGTPSQETIARVRNEKARRYLNSMRKKQPVPFTQKFVGTDNLALKLLERLLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFR LARV REP AQP+TKMEFEFERRR+TK+DVRELIYREILEYHP++L
Sbjct  305   PTAEEALADPYFRGLARVSREPVAQPITKMEFEFERRRVTKDDVRELIYREILEYHPQIL  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             KE++ GT+ T+FMYPSAVD+FK+QFA+LEEHYGKGG V P ERQ A SLPRP V+YS++ 
Sbjct  365   KEYLNGTDRTNFMYPSAVDQFKRQFAHLEEHYGKGGSVPPLERQHA-SLPRPCVVYSNSG  423

Query  948   VQNPAEVANDLSKCS------IKEGDR--LDRNSGIPTTRLPL----QVPQGDAARPGRI  805
               +  + ++  S+        I+E ++   DR+SG    ++PL    +V QG  A+PG++
Sbjct  424   GPSSEQASSGTSRDREEAPRYIRETEKQHQDRSSG--NVKVPLHATQKVLQGSTAKPGKV  481

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPTTMP-QYAISNPSYSRRHPSCKNE---RGEDG  637
             +  V+ Y +GS     EA   RR++RN    P Q      SY RR+ + K E   + EDG
Sbjct  482   IGPVLPYENGS---IKEAYNPRRLIRNAGVAPSQCPAPIYSYPRRNSTAKTEMDDKREDG  538

Query  636   NEGSNTVPKPDQYM----ARKVAAAPGGSGNQW  550
                 N      QY+    ARKVAA    S + +
Sbjct  539   INQFNLSQPKTQYVGIGAARKVAAVESRSSHLY  571


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LK+IHT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKFIHTA  145



>gb|KDP33076.1| hypothetical protein JCGZ_13613 [Jatropha curcas]
Length=620

 Score =   424 bits (1089),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 214/356 (60%), Positives = 279/356 (78%), Gaps = 15/356 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             +SFS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VSFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+P+PF+ KFPNADP AL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKQPVPFAQKFPNADPFALHLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F++QFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYVNGTERTNFLYPSAVDQFRRQFAHLEENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEG-DRLDRNS-----GIPTTRLPLQVPQGDAAR  817
             R ++++S++       +A+   + +++E  ++  R+S      I T +   ++P    A+
Sbjct  414   RSTIVHSNSIPPREQNIASLTERQTVEESYNKNYRDSDGTYVNISTLQAQQRIPM---AK  470

Query  816   PGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER  649
             PG++V SV  Y++GS +   +A + R ++R  + +P  A+  P+Y  R  S K E+
Sbjct  471   PGKVVGSVAPYDNGSIM--KDAYDPRTLVRG-SVLPTQALP-PAYGCRKSSTKQEK  522


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_002961155.1| mitogen activated protein kinase 16 [Selaginella moellendorffii]
 gb|EFJ38694.1| mitogen activated protein kinase 16 [Selaginella moellendorffii]
Length=573

 Score =   421 bits (1083),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 224/365 (61%), Positives = 271/365 (74%), Gaps = 25/365 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  187   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLMT  246

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LGTPS E++AR+RNEKARRYLS MRKK  IPF+ KFPNADPLAL LLER+LAFDPKDR
Sbjct  247   DMLGTPSAESVARVRNEKARRYLSGMRKKTAIPFTQKFPNADPLALRLLERLLAFDPKDR  306

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYFR LA+VEREPSAQP+TKMEFEFERRRI+K+DVRELIYREILEYHP+ML
Sbjct  307   PTAEEALADPYFRGLAKVEREPSAQPITKMEFEFERRRISKDDVRELIYREILEYHPQML  366

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++ GT+  +FMYPSAVD+FK+QFA LEEHYGKGG       +  +SLPRP+ +YS   
Sbjct  367   EEYLNGTDHANFMYPSAVDQFKRQFAQLEEHYGKGGHNNAAVERHHASLPRPATVYS---  423

Query  948   VQNPAEVANDLSKCSIKEGDRLD--RNSGIPTTRLPLQVPQ------GDAARPGRIVSSV  793
               + A  A+D   CS KE +  D  + S  P      + PQ      G AA+PG++V   
Sbjct  424   --STAAAASD---CSSKEREYHDSGKFSEKPQQEKSTRAPQKGGYQGGLAAKPGKVV---  475

Query  792   MRYNSGSAVTASEAIEQRRMLRNP---TTMPQYAISNPSYSRRHPSCKNERGEDGNEGSN  622
                NSG +V   + ++ RR++++    +++ QY  S  SY RR  +  +   +  N G  
Sbjct  476   ---NSGVSVVTRDTVDARRLVKSASISSSLQQYTASVYSYGRRTFAKSDRDDKKDNTGEF  532

Query  621   TVPKP  607
                +P
Sbjct  533   VAVQP  537


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  111   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  147



>ref|XP_010272645.1| PREDICTED: mitogen-activated protein kinase 8-like [Nelumbo nucifera]
Length=614

 Score =   416 bits (1069),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 221/380 (58%), Positives = 276/380 (73%), Gaps = 29/380 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+++RNEKARRYL+SMRKK+P+PF+ KFPNADP AL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSMDTISQVRNEKARRYLTSMRKKQPVPFAQKFPNADPSALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+L+FDPKDRPTAEEALADPYF+ LA+VEREPS QP+TK+EFEFERRR+TKED+RELI+R
Sbjct  295   RLLSFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKLEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+L+E+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLDENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDN------------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVP  835
             R +V++S+               Q P E +N  S+ +      + R    P  R+PL   
Sbjct  414   RSTVVHSNTIPPKDTNLGSLKDRQIPDEASNKNSRETDGTSGSISRTLYAP-HRIPL---  469

Query  834   QGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKN  655
                 A+PG++V  VM + +   VT  +     R++RN    PQ A S   Y  R  S K 
Sbjct  470   ----AKPGKVVGPVMPFEN---VTGIKDAYDPRIIRNAVLPPQAAPS--PYCYRRTSMKQ  520

Query  654   ERG--EDGNEGSNTVPKPDQ  601
             ER   E   + S T P+P Q
Sbjct  521   ERSGVEAVRDSSQTKPQPSQ  540


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>gb|AHY20717.1| mitogen-activated protein kinase [Dendrobium catenatum]
Length=597

 Score =   410 bits (1053),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 223/373 (60%), Positives = 268/373 (72%), Gaps = 18/373 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIW IGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWGIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NV HQLDLMTDLLGTPS + I+R+RNEKARRYLSSMRKK PIPFS KFPNADP AL LLE
Sbjct  235   NVAHQLDLMTDLLGTPSLDTISRVRNEKARRYLSSMRKKLPIPFSQKFPNADPSALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L++VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLSKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+FK+QFA+LEE+ GK   V P ER    SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFKRQFAHLEENGGKSAPVIPLERNHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R SV++S  +   PAE  N+        G  + R S  P  R+P+       A+PG++V 
Sbjct  414   RSSVVHS--TTIPPAEQGNNPRGAERIPG-HIGRVSPAP-QRIPV-------AKPGKVVG  462

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNT  619
              VM   +GS     +  + RR++RN    P      P+Y   H +      + G E  + 
Sbjct  463   PVMPLENGS---IKDPYDPRRLIRN-AVPPLQPCLPPAYC-FHRTASKSASKMGAEVEDN  517

Query  618   VPKPDQYMARKVA  580
                P   M  KVA
Sbjct  518   ARHPQPCMPSKVA  530


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLY+LLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYRLLRALKYIHTA  145



>ref|XP_008797488.1| PREDICTED: mitogen-activated protein kinase 10-like [Phoenix 
dactylifera]
Length=615

 Score =   410 bits (1054),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 227/364 (62%), Positives = 282/364 (77%), Gaps = 20/364 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYLS+MRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLSTMRKKQPVPFSQKFPNADPLALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEAL+DPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALSDPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+ A SLP
Sbjct  355   EILEYHPQLLKDYVSGTERTTFLYPSAVDQFRKQFAHLEENGGKSGPVIPIDRKHA-SLP  413

Query  978   RPSVLYSDNSVQNPAEVAN-DL--SKCSIKEGDR----LDRNSG--IPTTRLPLQVPQGD  826
             R +V++S  +   P E AN DL  ++ +  EG +     +R SG    T++ P ++P   
Sbjct  414   RSTVVHS--TPIPPKEQANMDLYRNRQTSDEGCKNPRDTERWSGNMSKTSQAPQRIP---  468

Query  825   AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG  646
               RPG++V  VM Y +GS     +A + RR++RNP   P  AI  P+Y     + K E  
Sbjct  469   TCRPGKVVGPVMPYENGS---LKDAYDPRRLIRNPVLPPHPAIP-PAYCFHRTTDKFENS  524

Query  645   EDGN  634
             + G 
Sbjct  525   DTGT  528


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_007210883.1| hypothetical protein PRUPE_ppa002837mg [Prunus persica]
 gb|EMJ12082.1| hypothetical protein PRUPE_ppa002837mg [Prunus persica]
Length=628

 Score =   409 bits (1052),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 190/245 (78%), Positives = 219/245 (89%), Gaps = 2/245 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  294   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLMT  353

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E+IARIRNEKARRYLSSMRKK+P+PF++KFPNADPLAL L+E++LAFDPKDR
Sbjct  354   DLLGTPSTESIARIRNEKARRYLSSMRKKQPVPFTHKFPNADPLALRLVEQLLAFDPKDR  413

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  LA V+REPS QP++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  414   PTAEEALADPYFHGLANVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  473

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLY--SD  955
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG    PP ++Q +SLPR  V     +
Sbjct  474   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERGTPPLQRQHASLPRERVCAPKDE  533

Query  954   NSVQN  940
             NS QN
Sbjct  534   NSGQN  538


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  218   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  254



>ref|XP_001765894.1| predicted protein [Physcomitrella patens]
 gb|EDQ69215.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   402 bits (1034),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 188/232 (81%), Positives = 212/232 (91%), Gaps = 1/232 (0%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLM
Sbjct  178   IFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLM  237

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TD+LG+PSPE + R+RNEKARRYLS+MRKK P+PF  KFPNADPLA+ LLERMLAFDP+D
Sbjct  238   TDMLGSPSPETVQRVRNEKARRYLSTMRKKPPMPFVQKFPNADPLAIRLLERMLAFDPRD  297

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPTAEEALADPYF+ LA+V+REPSAQP+TKMEFEFERRRI KEDVRELIYREILEYHP+M
Sbjct  298   RPTAEEALADPYFKGLAKVDREPSAQPITKMEFEFERRRINKEDVRELIYREILEYHPQM  357

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPR  976
             LKE++ G++  +F+YPSAVD+FK+QFA+LEEHYGKGG   P ERQ A SLPR
Sbjct  358   LKEYLNGSDNATFLYPSAVDQFKRQFAHLEEHYGKGGNNPPLERQHA-SLPR  408


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  103   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  139



>ref|XP_008240170.1| PREDICTED: mitogen-activated protein kinase 9-like [Prunus mume]
Length=626

 Score =   408 bits (1048),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 245/317 (77%), Gaps = 19/317 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  292   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLMT  351

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E+IARIRNEKARRYLSSMRKK+P+PF++KFP+ADPLAL L+E++LAFDPKDR
Sbjct  352   DLLGTPSTESIARIRNEKARRYLSSMRKKQPVPFTHKFPHADPLALRLVEQLLAFDPKDR  411

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  LA V+REPS QP++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  412   PTAEEALADPYFHGLANVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  471

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLY--SD  955
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG    PP ++Q +SLPR  V     +
Sbjct  472   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERGTPPLQRQHASLPRERVCAPKDE  531

Query  954   NSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSG  775
             NS QN     ND+ + +      L+   G        Q P G     G+   S   +N+ 
Sbjct  532   NSGQN-----NDVERTAASVASTLESPPGS-------QQPDGSVNADGQNGPSKTNHNAR  579

Query  774   S-----AVTASEAIEQR  739
             S     +++AS+ I  R
Sbjct  580   SLLKSASISASKCIGVR  596


 Score = 79.3 bits (194),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  216   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  252



>ref|NP_001146342.1| uncharacterized protein LOC100279919 [Zea mays]
 gb|ACL53728.1| unknown [Zea mays]
Length=421

 Score =   400 bits (1029),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/353 (58%), Positives = 260/353 (74%), Gaps = 39/353 (11%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  16    VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  75

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+P+PF+ KFP ADP AL LL+
Sbjct  76    NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQPVPFTEKFPKADPAALKLLQ  135

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFER++ TKEDV+ELI+R
Sbjct  136   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERKKATKEDVKELIFR  195

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK G  A    ++  SLP
Sbjct  196   EILEYHPQLLKDYMNGTEKTNFLYPSAVDHFRRQFANLEENGGKSGAHAASSDRKHVSLP  255

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGR  808
             R + ++S     NP                       IP   T+++P ++P G   RPGR
Sbjct  256   RTTTVHS-----NP-----------------------IPPNGTSQVPQKIPTG---RPGR  284

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNE  652
             +V  V+ + + +AV   +   QRR+ RNP   P  + +S  +Y R+  +   E
Sbjct  285   VVGPVIPFENAAAV---DPYSQRRVSRNPVLPPTTSNMSAYAYHRKSDNSDRE  334



>ref|XP_006477803.1| PREDICTED: mitogen-activated protein kinase 19-like [Citrus sinensis]
Length=607

 Score =   406 bits (1043),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 271/374 (72%), Gaps = 16/374 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPMTVFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPSPE IA +RNEKAR+YL+ MRKK P+P   KFPN DPLAL LL+
Sbjct  235   SVVHQLDLITDLLGTPSPETIAVVRNEKARKYLTEMRKKPPVPLFQKFPNVDPLALRLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R++AFDPKDRPTAEEALADPYF+ LA++EREPS QP++K+EFEFERRR+TK+D+RELIYR
Sbjct  295   RLIAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPISKLEFEFERRRVTKDDIRELIYR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSA+ +F+KQFAYLEE+ G+ G V PPER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTEGTNFLYPSAIGQFRKQFAYLEENGGRSGPVIPPERKHV-SLP  413

Query  978   RPSV-------LYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAA  820
             R +V       +   N+  + ++   + +  + +  D +  N     ++ P   P+  AA
Sbjct  414   RSTVHSGTTPPIVQHNAASSESQQMTEDTSRNFRVTDEISGNH----SKFPRPPPRVPAA  469

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +PGR+V SVM Y +G  +   + I   RM      +P   +S   + R +   + + G +
Sbjct  470   KPGRVVGSVMPYENGRNI---KDIYDARMFYRNAVLPPQNVSPHCFFRTNTINQEKSGLE  526

Query  639   GNEGSNTVPKPDQY  598
                 S+  P+P Q+
Sbjct  527   SGRSSHVKPEPTQH  540


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  145



>ref|XP_010926676.1| PREDICTED: mitogen-activated protein kinase 10-like [Elaeis guineensis]
Length=622

 Score =   406 bits (1044),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 223/367 (61%), Positives = 273/367 (74%), Gaps = 30/367 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYLSSMRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLSSMRKKQPVPFSQKFPNADPLALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++  GTE T+F+YPSAVD+F+KQFA+LE+  GK G V P +R+ A SLP
Sbjct  355   EILEYHPQLLKDYASGTERTTFLYPSAVDQFRKQFAHLEDSGGKSGPVIPIDRKHA-SLP  413

Query  978   RPSV---------------LYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPL  844
             R ++               LY D   Q   EV  +      ++ +RL   S    ++ P 
Sbjct  414   RSTMVHSTPIPPKEQPNMALYRDRQWQTSDEVCKN-----SRDTERL-LGSMSKASQAPQ  467

Query  843   QVPQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPS  664
             ++P    ARPG++V  VM Y +GS     +A + RR++RNP   P  AI  P+Y     +
Sbjct  468   RIP---TARPGKVVGPVMPYENGS---LKDAYDPRRLMRNPVLPPHPAIP-PAYCFHRTA  520

Query  663   CKNERGE  643
              K+E  +
Sbjct  521   DKSENSD  527


 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_006442323.1| hypothetical protein CICLE_v10019362mg [Citrus clementina]
 gb|ESR55563.1| hypothetical protein CICLE_v10019362mg [Citrus clementina]
Length=608

 Score =   406 bits (1043),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 210/375 (56%), Positives = 274/375 (73%), Gaps = 17/375 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPMTVFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPSPE IA +RNEKAR+YL+ MRKK P+P   KFPN DPLAL LL+
Sbjct  235   SVVHQLDLITDLLGTPSPETIAVVRNEKARKYLTEMRKKPPVPLFQKFPNVDPLALRLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R++AFDPKDRPTAEEALADPYF+ LA++EREPS QP++K+EFEFERRR+TK+D+RELIYR
Sbjct  295   RLIAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPISKLEFEFERRRVTKDDIRELIYR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSA+ +F+KQFAYLEE+ G+ G V PPER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTEGTNFLYPSAIGQFRKQFAYLEENGGRSGPVIPPERKHV-SLP  413

Query  978   RPSV-------LYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAA  820
             R +V       +   N+  + ++   + +  + +  D +  N     ++ P   P+  AA
Sbjct  414   RSTVHSGTTPPIVQHNAASSESQQMTEDTSRNFRVTDEISGNH----SKFPRPPPRVPAA  469

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +PGR+V SVM Y +G  +   +  + R   RN    PQ  +S   + R +   + + G +
Sbjct  470   KPGRVVGSVMPYENGRNI--KDTYDARMFYRNAVLPPQ-NVSPQCFFRTNTINQEKSGLE  526

Query  639   GNEGSNTV-PKPDQY  598
                GS+ V P+P Q+
Sbjct  527   SGRGSSHVKPEPTQH  541


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  145



>tpg|DAA41368.1| TPA: putative MAP kinase family protein [Zea mays]
Length=310

 Score =   394 bits (1012),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 236/313 (75%), Gaps = 5/313 (2%)
 Frame = -3

Query  1482  LGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDRPT  1303
             +GTPSPEAI+RIRNEKARRYLS+MR+KKPIPF+ KFPNADPLAL LLERMLAF+PKDRP+
Sbjct  1     MGTPSPEAISRIRNEKARRYLSNMRRKKPIPFTQKFPNADPLALGLLERMLAFEPKDRPS  60

Query  1302  AEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKMLKE  1123
             AEEALA PYF+N+A V+REPSAQ VTK+EFEFERRR+TK+D+RELIYREILEYHPKMLKE
Sbjct  61    AEEALAHPYFKNIANVDREPSAQAVTKLEFEFERRRVTKDDIRELIYREILEYHPKMLKE  120

Query  1122  FIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNSVQ  943
             FIEGTE + FMYPSAVD FKKQFAYLEEHY KG    PPERQ  +SLPRPSV+YSDN  Q
Sbjct  121   FIEGTESSGFMYPSAVDNFKKQFAYLEEHYAKGSTGTPPERQH-NSLPRPSVVYSDNQSQ  179

Query  942   NPAEVANDLSKCSIKEGDRLDR--NSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
             + A +  DLSKC I+E  +  +  N+ +   + P  VPQG AARPG+ V SV++YN   A
Sbjct  180   STANITEDLSKCIIRENAQKSQQYNASV-ANKFPSHVPQGAAARPGKAVGSVLQYNLSQA  238

Query  768   VTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMAR  589
              +A+E  EQRR+ R+P   P    S  SY RR+ +CK+E G+      N   +P  Y A 
Sbjct  239   -SAAEQYEQRRVARHPAVAPNNIPSGSSYPRRNQTCKSETGDTERMDVNQAGQPKSYAAN  297

Query  588   KVAAAPGGSGNQW  550
             K+ A   G G  W
Sbjct  298   KLPATVDGRGGHW  310



>gb|ACJ85654.1| unknown [Medicago truncatula]
Length=390

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 208/329 (63%), Positives = 268/329 (81%), Gaps = 8/329 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  67    VAFSDTPTTVFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  126

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KF NADPLAL LLE
Sbjct  127   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFSNADPLALRLLE  186

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  187   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  246

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F++QFA+LEE+ GK G VAP +R+   SLP
Sbjct  247   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRRQFAHLEEN-GKNGPVAPLDRKHV-SLP  304

Query  978   RPSVLYSDNSVQN-PAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQG-DAARPGRI  805
             R ++++S+   Q     +A+  ++ + +E ++L R++ IP  R P+Q PQ    A+PG++
Sbjct  305   RSTIVHSNTVPQKEQTSIASSKNRQTSEEYNKLSRDNEIPVPR-PIQGPQRIPLAKPGKV  363

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPT  718
             V  V+ +  G+ V   ++ + R  +R P 
Sbjct  364   VGPVVPFEYGNVV--KDSYDPRAFIRGPV  390


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  1     MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  37



>ref|XP_004303866.1| PREDICTED: mitogen-activated protein kinase 10-like [Fragaria 
vesca subsp. vesca]
Length=618

 Score =   404 bits (1038),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 280/358 (78%), Gaps = 20/358 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+P+ F+ KFPNADPLAL LL+
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKQPVSFAQKFPNADPLALRLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L+++EREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLSKIEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK   V P ER+ A SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENSGKSAPVIPLERKHA-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNS----GIP-----TTRLPLQVPQGD  826
             R ++++S N+V  P E  N       K+ D + +NS    GI      T + P ++P   
Sbjct  414   RSTIVHS-NTVP-PKEQQNYAYVKDPKQADEVYKNSRDTEGIHVNLSRTMQAPQRIP---  468

Query  825   AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
              A+PGR+V  V+ Y++G+ V   +A ++R ++RN T +P  A+  PSY  R P   ++
Sbjct  469   LAKPGRVVGPVVPYDNGNIV--KDAYDRRTLVRN-TVLPPQAVP-PSYCYRKPGSGSQ  522


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_011098082.1| PREDICTED: mitogen-activated protein kinase 20-like [Sesamum 
indicum]
Length=615

 Score =   403 bits (1036),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 226/385 (59%), Positives = 285/385 (74%), Gaps = 25/385 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLD++TDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PFS+KFPNADPLAL LLE
Sbjct  235   NVVHQLDMITDLLGTPSMDTISRVRNEKARRYLTSMRKKQPVPFSHKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP++KMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPISKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I G E T+F+YPSAVD+FKKQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYINGIERTNFLYPSAVDQFKKQFAHLEENTGKSGPVIPLERKHV-SLP  413

Query  978   RP-SVLYSD-------NSVQNPAEVANDLSKCSIKEGDRLD-RNSGIPTTRLPLQVPQGD  826
             R  +++YS+        ++ N  +  N    CS    D +   NS   T + P ++PQ  
Sbjct  414   RSTTIVYSNPVPQKDQTAISNAKDRQNLEQSCSRNSRDFIGLHNSLARTLQPPHRIPQ--  471

Query  825   AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER-  649
              A+PG++V  V+   +G+A       + R ++RN  T+P   I +     R  + K ER 
Sbjct  472   -AKPGKVVGPVLPSENGNAY------DSRTLVRN--TLPPQIIPSAYCYHRSSTGKQERS  522

Query  648   -GEDGNE-GSNTVPKPDQYMARKVA  580
              G+   E  S+T   P+  MA K+A
Sbjct  523   VGDAPREFTSHTKQIPNCSMAAKLA  547


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_001766825.1| predicted protein [Physcomitrella patens]
 gb|EDQ68456.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   398 bits (1022),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 186/231 (81%), Positives = 210/231 (91%), Gaps = 1/231 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  176   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMT  235

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             D+LG+PS E + R+RNEKARRYLS+MRKK P+PF  KFPNADPLA+ LLERMLAFDP+DR
Sbjct  236   DMLGSPSSETVQRVRNEKARRYLSTMRKKLPMPFGQKFPNADPLAIRLLERMLAFDPRDR  295

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LA+V+REPSAQP+TKMEFEFERRRI KEDVRELIYREILEYHP+ML
Sbjct  296   PTAEEALADPYFKGLAKVDREPSAQPITKMEFEFERRRINKEDVRELIYREILEYHPQML  355

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPR  976
             KE++ G++  +F+YPSAVD+FK+QFA+LEEHYGK G   P ERQ A SLPR
Sbjct  356   KEYLNGSDNATFLYPSAVDQFKRQFAHLEEHYGKVGNNPPLERQHA-SLPR  405


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  100   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  136



>ref|XP_003532097.1| PREDICTED: mitogen-activated protein kinase 10-like [Glycine 
max]
Length=615

 Score =   403 bits (1036),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 217/365 (59%), Positives = 283/365 (78%), Gaps = 13/365 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  295   KLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVMPLDRKHV-SLP  412

Query  978   RPSVLYSDNSVQNPAEVANDLSKC--SIKEGDRLDRNSGIPTTRLPLQVPQG-DAARPGR  808
             R ++++S N+V +  +  N  SK   +++E ++  R++ IP  R  +Q PQ    A+PG+
Sbjct  413   RSTIVHS-NTVHSKEQTNNAASKNRPTVEEYNKNPRDTEIPVPR-SMQGPQRIPLAKPGK  470

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEG  628
             +V  V+ Y  G+ V   ++ + R  +R  + +P  A+    Y +R  +   ER     E 
Sbjct  471   VVGPVVPYEHGNIV--KDSYDPRSFIRG-SVLPTQAVPPAYYYQRSSTGNQER--PATEA  525

Query  627   SNTVP  613
             + +VP
Sbjct  526   NKSVP  530


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>gb|EYU29585.1| hypothetical protein MIMGU_mgv1a003728mg [Erythranthe guttata]
Length=568

 Score =   402 bits (1032),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 204/343 (59%), Positives = 263/343 (77%), Gaps = 19/343 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDL+T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS + I+R+RNEKARRYL+SMRKK+PIPF+ KFPNADP AL LLE++LAFDPKDR
Sbjct  245   DLLGTPSMDTISRVRNEKARRYLTSMRKKQPIPFAQKFPNADPPALRLLEKLLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTA+EAL DPYF+ LA+VEREPS+QP++KMEFEFERRR+TKED+RELI+REILEYHP++ 
Sbjct  305   PTAQEALGDPYFKGLAKVEREPSSQPISKMEFEFERRRVTKEDIRELIFREILEYHPQLR  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
              ++I G E T+F+YPSAVD+FK QFA+LEE+ GK G V P ER+   SLPR +V++S N+
Sbjct  365   NDYINGIERTNFLYPSAVDQFKNQFAHLEENGGKSGPVIPLERKHV-SLPRSTVVHS-NT  422

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
             V  P +    ++K           NS   T + P +  Q   A+PG++V  V+ Y +G+ 
Sbjct  423   V--PPKEQTTIAKA---------HNSSSRTLQPPQRFSQ---AKPGKVVGPVLPYENGNP  468

Query  768   VTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +   ++ + R ++++ T +  + I + ++  R+   K ER  D
Sbjct  469   I--KDSYDPRTVVKS-TVLSSHIIPSSNWYNRNGQGKTERSVD  508


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_008672728.1| PREDICTED: uncharacterized protein LOC100279919 isoform X3 [Zea 
mays]
 tpg|DAA58227.1| TPA: putative MAP kinase family protein [Zea mays]
Length=568

 Score =   402 bits (1032),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 269/378 (71%), Gaps = 39/378 (10%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+P+PF+ KFP ADP AL LL+
Sbjct  223   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQPVPFTEKFPKADPAALKLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFER++ TKEDV+ELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERKKATKEDVKELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK G  A    ++  SLP
Sbjct  343   EILEYHPQLLKDYMNGTEKTNFLYPSAVDHFRRQFANLEENGGKSGAHAASSDRKHVSLP  402

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGR  808
             R + ++S     NP                       IP   T+++P ++P G   RPGR
Sbjct  403   RTTTVHS-----NP-----------------------IPPNGTSQVPQKIPTG---RPGR  431

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNERGEDGNE  631
             +V  V+ + + +AV   +   QRR+ RNP   P  + +S  +Y R+  +   E  ++  +
Sbjct  432   VVGPVIPFENAAAV---DPYSQRRVSRNPVLPPTTSNMSAYAYHRKSDNSDRELQQELEK  488

Query  630   GSNTVPKPDQYMARKVAA  577
                      ++M  KV +
Sbjct  489   DRMQYQPAQRFMDAKVVS  506


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  133



>ref|XP_010924325.1| PREDICTED: mitogen-activated protein kinase 10-like [Elaeis guineensis]
Length=619

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 224/387 (58%), Positives = 288/387 (74%), Gaps = 27/387 (7%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEILTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDL+TDLLGTPS + I+R+RNEKARRYLSSMRKK+P+PF+  FPNADPLAL LLE
Sbjct  235   NVVHQLDLITDLLGTPSLDTISRVRNEKARRYLSSMRKKQPVPFAQNFPNADPLALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+T+ED+RELI+ 
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTEEDIRELIFC  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSA+D+FKKQFA+LEE+ GK GV+ P +R+   SLP
Sbjct  355   EILEYHPQLLKDYVNGTERTTFLYPSAIDQFKKQFAHLEENGGKSGVI-PLDRKHV-SLP  412

Query  978   RPSVLYS---------DNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGD  826
             R +V+YS         + ++    + +++  K S ++ +RL  N     ++ P ++P   
Sbjct  413   RSTVIYSTPFPHKEQPNMALYRDRQTSDEACKNS-RDTERLSGNMS-RASQAPQRIP---  467

Query  825   AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER-  649
             AA+PG++V  VM Y +GS     +A + RR++RNP   PQ  I  P Y     + K+E  
Sbjct  468   AAKPGKMVGPVMPYENGS---LKDAYDPRRLIRNPVLPPQPVIP-PVYCFHRTTGKSESS  523

Query  648   ----GEDGNEGSNTVPKPDQYMARKVA  580
                  E G E      +P Q++  K+A
Sbjct  524   DRVIAEVGREYVQH-KQPQQFIPSKMA  549


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>gb|KDO52122.1| hypothetical protein CISIN_1g008729mg [Citrus sinensis]
Length=556

 Score =   400 bits (1029),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/384 (55%), Positives = 272/384 (71%), Gaps = 24/384 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPMTVFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPSPE IA +RNEKAR+YL+ MRKK P+P   KFPN DPLAL LL+
Sbjct  235   SVVHQLDLITDLLGTPSPETIAVVRNEKARKYLTEMRKKPPVPLFQKFPNVDPLALRLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R++AFDPKDRPTAEEALADPYF+ LA++EREPS QP++K+EFEFERRR+TK+D+RELIYR
Sbjct  295   RLIAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPISKLEFEFERRRVTKDDIRELIYR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSA+ +F+KQFAYLEE+ G+ G V PPER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTEGTNFLYPSAIGQFRKQFAYLEENGGRSGPVIPPERKHV-SLP  413

Query  978   RPSV-------LYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAA  820
             R +V       +   N+  + ++   + +  + +  D +  N     ++ P   P+  AA
Sbjct  414   RSTVHSGTTPPIVQHNAASSESQQMTEDTSRNFRVTDEISGNH----SKFPRPPPRVPAA  469

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +PGR+V SVM Y +G  +   +  + R   RN    PQ  +S   + R +   + + G +
Sbjct  470   KPGRVVGSVMPYENGRNI--KDTYDARMFYRNAVLPPQ-NVSPHCFFRTNTINQEKSGLE  526

Query  639   GNEG--------SNTVPKPDQYMA  592
                G         NT    +Q MA
Sbjct  527   SGRGLLMLNQSPHNTTLLQNQLMA  550


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  145



>ref|XP_008672727.1| PREDICTED: uncharacterized protein LOC100279919 isoform X2 [Zea 
mays]
Length=577

 Score =   401 bits (1031),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 269/378 (71%), Gaps = 39/378 (10%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  172   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  231

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+P+PF+ KFP ADP AL LL+
Sbjct  232   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQPVPFTEKFPKADPAALKLLQ  291

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFER++ TKEDV+ELI+R
Sbjct  292   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERKKATKEDVKELIFR  351

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK G  A    ++  SLP
Sbjct  352   EILEYHPQLLKDYMNGTEKTNFLYPSAVDHFRRQFANLEENGGKSGAHAASSDRKHVSLP  411

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGR  808
             R + ++S     NP                       IP   T+++P ++P G   RPGR
Sbjct  412   RTTTVHS-----NP-----------------------IPPNGTSQVPQKIPTG---RPGR  440

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNERGEDGNE  631
             +V  V+ + + +AV   +   QRR+ RNP   P  + +S  +Y R+  +   E  ++  +
Sbjct  441   VVGPVIPFENAAAV---DPYSQRRVSRNPVLPPTTSNMSAYAYHRKSDNSDRELQQELEK  497

Query  630   GSNTVPKPDQYMARKVAA  577
                      ++M  KV +
Sbjct  498   DRMQYQPAQRFMDAKVVS  515


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  106   MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  142



>ref|XP_008672726.1| PREDICTED: uncharacterized protein LOC100279919 isoform X1 [Zea 
mays]
 tpg|DAA58228.1| TPA: putative MAP kinase family protein isoform 1 [Zea mays]
 tpg|DAA58229.1| TPA: putative MAP kinase family protein isoform 2 [Zea mays]
Length=588

 Score =   401 bits (1031),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 269/378 (71%), Gaps = 39/378 (10%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  183   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  242

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+P+PF+ KFP ADP AL LL+
Sbjct  243   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQPVPFTEKFPKADPAALKLLQ  302

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFER++ TKEDV+ELI+R
Sbjct  303   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERKKATKEDVKELIFR  362

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK G  A    ++  SLP
Sbjct  363   EILEYHPQLLKDYMNGTEKTNFLYPSAVDHFRRQFANLEENGGKSGAHAASSDRKHVSLP  422

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGR  808
             R + ++S     NP                       IP   T+++P ++P G   RPGR
Sbjct  423   RTTTVHS-----NP-----------------------IPPNGTSQVPQKIPTG---RPGR  451

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNERGEDGNE  631
             +V  V+ + + +AV   +   QRR+ RNP   P  + +S  +Y R+  +   E  ++  +
Sbjct  452   VVGPVIPFENAAAV---DPYSQRRVSRNPVLPPTTSNMSAYAYHRKSDNSDRELQQELEK  508

Query  630   GSNTVPKPDQYMARKVAA  577
                      ++M  KV +
Sbjct  509   DRMQYQPAQRFMDAKVVS  526


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  117   MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  153



>ref|XP_010663665.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X2 
[Vitis vinifera]
Length=507

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  176   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  235

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E+IARIRNEKARRYLS+MRKK  IPFS KFP+ADPLAL L+ER+LAFDPKDR
Sbjct  236   DLLGTPSAESIARIRNEKARRYLSTMRKKPSIPFSQKFPDADPLALHLVERLLAFDPKDR  295

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  LA V+REPS QP++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  296   PTAEEALADPYFDGLANVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  355

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG    P +RQ A SLPR  V
Sbjct  356   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERSTPLQRQHA-SLPRERV  408


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  100   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  136



>gb|AIU98489.1| mitogen-activated protein kinase [Musa acuminata AAA Group]
Length=607

 Score =   401 bits (1030),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 219/354 (62%), Positives = 267/354 (75%), Gaps = 17/354 (5%)
 Frame = -3

Query  1692  SFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKN  1516
             +FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKN
Sbjct  176   AFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKN  235

Query  1515  VVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLER  1336
             VVHQLDLMTDLLGTPS + I+R+RNEKARRYL SMRKK+P+PF+ KFPNADPLAL LLER
Sbjct  236   VVHQLDLMTDLLGTPSLDTISRVRNEKARRYLGSMRKKQPVPFAQKFPNADPLALKLLER  295

Query  1335  MLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYRE  1156
             +LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+RE
Sbjct  296   LLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRLTKEDIRELIFRE  355

Query  1155  ILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPR  976
             ILEYHP++L+++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLPR
Sbjct  356   ILEYHPQLLQDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKNGPVIPLDRKHV-SLPR  414

Query  975   PSVLYSDNSVQNPAEVANDLSKCSIKEG------DRLDRNSGIPTTRLPLQVPQG-DAAR  817
              +V++S  +   P     ++S    ++G      +  D      +     QV Q    AR
Sbjct  415   STVVHSTTT---PPTDQPNMSSSRDRQGTDEACKNTRDIEKSYGSIARASQVAQRISTAR  471

Query  816   PGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKN  655
             PG++V  VM Y SGS     +A + RR +RN   +PQ  +  P+Y   H S  N
Sbjct  472   PGKVVGPVMPYESGS---VKDAYDPRRYIRN-AVLPQQPVIPPAYC-HHGSAGN  520


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>gb|KHM99625.1| Mitogen-activated protein kinase 10 [Glycine soja]
Length=610

 Score =   401 bits (1030),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 277/353 (78%), Gaps = 11/353 (3%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  170   VAFSDTPTTIFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  229

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KFPNADPLAL LLE
Sbjct  230   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFPNADPLALRLLE  289

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  290   KLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  349

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLP
Sbjct  350   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVMPLDRKHV-SLP  407

Query  978   RPSVLYSDNSVQNPAEVANDLSKC--SIKEGDRLDRNSGIPTTRLPLQVPQGD-AARPGR  808
             R ++++S N+V +  +  N  SK   + +E ++  R++ IP  R  +Q PQ    A+PG+
Sbjct  408   RSTIVHS-NTVHSKEQTNNAASKNRPTAEEYNKNPRDTEIPVPR-SMQGPQRIPLAKPGK  465

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER  649
             +V  V+ Y  G+ V   ++ + R  +R  + +P  A+    Y +R  +   ER
Sbjct  466   VVGPVVPYEHGNIV--KDSYDPRSFIRG-SVLPTQAVPPAYYYQRSSTGNQER  515


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  104   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  140



>gb|ABR17985.1| unknown [Picea sitchensis]
Length=612

 Score =   400 bits (1029),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 214/378 (57%), Positives = 263/378 (70%), Gaps = 25/378 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFF+KYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLD+MT
Sbjct  252   FWTDYVATRWYRAPELCGSFFTKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDIMT  311

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E +ARIRNEKARRYLS+MRKK+P PFS KFPN DP A+ LLERMLAFDPKDR
Sbjct  312   DLLGTPSAETLARIRNEKARRYLSNMRKKQPTPFSQKFPNVDPFAIRLLERMLAFDPKDR  371

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYF  LA+VEREPS QP++K+EFEFERRR+TKEDVRELIYREILEYHP+ML
Sbjct  372   PSAEEALADPYFNGLAKVEREPSTQPISKLEFEFERRRVTKEDVRELIYREILEYHPQML  431

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++ G    +FMYPSAVD FK+QFA+LEEHY KG    P  RQ A SLPR  V+     
Sbjct  432   QEYLCGANNANFMYPSAVDMFKRQFAHLEEHYSKGENSTPLGRQHA-SLPRERVI---EF  487

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGSA  769
              +NP + + D    S K+ +R    S    T+  LQ P       G +  S +   +G++
Sbjct  488   RENPTKHSKD----SEKQQER----STASVTKATLQSP---PRTQGTVNDSAVSLTNGAS  536

Query  768   VTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSC---KNERGED-GNEGSNTVPKPDQ  601
              T  +    R ++++ +      I   +  +R  S    ++E+ ED  +E S      D 
Sbjct  537   KTVPDP---RNLVKSASISASKCIVVANAGQRRNSTMKPEDEKKEDLSSESSAVTYNTDS  593

Query  600   YMA---RKVAAAPGGSGN  556
              +A    K+AA   G+ +
Sbjct  594   MVAGLTSKIAAMSSGAAH  611


 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  176   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  212



>ref|XP_009406270.1| PREDICTED: mitogen-activated protein kinase 10-like [Musa acuminata 
subsp. malaccensis]
Length=609

 Score =   400 bits (1028),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 219/354 (62%), Positives = 266/354 (75%), Gaps = 17/354 (5%)
 Frame = -3

Query  1692  SFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKN  1516
             +FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKN
Sbjct  176   AFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKN  235

Query  1515  VVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLER  1336
             VVHQLDLMTDLLGTPS + I+R+RNEKARRYL SMRKK+P+PF  KFPNADPLAL LLER
Sbjct  236   VVHQLDLMTDLLGTPSLDTISRVRNEKARRYLGSMRKKQPVPFGQKFPNADPLALKLLER  295

Query  1335  MLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYRE  1156
             +LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+RE
Sbjct  296   LLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRLTKEDIRELIFRE  355

Query  1155  ILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPR  976
             ILEYHP++L+++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLPR
Sbjct  356   ILEYHPQLLQDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKNGPVIPLDRKHV-SLPR  414

Query  975   PSVLYSDNSVQNPAEVANDLSKCSIKEG-DRLDRN------SGIPTTRLPLQVPQGDAAR  817
              +V++S  +   P     ++S    ++G D   +N      S     R      +   AR
Sbjct  415   STVVHSTTT---PPTDQPNMSSSRDRQGTDEACKNPRDIEKSYGSIARASQAAQRISTAR  471

Query  816   PGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKN  655
             PG++V  VM Y SGS     +A + RR +RN   +PQ  +  P+Y   H S  N
Sbjct  472   PGKVVGPVMPYESGS---VKDAYDPRRYIRN-AVLPQQPVIPPAYC-HHGSAGN  520


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_007149430.1| hypothetical protein PHAVU_005G069800g [Phaseolus vulgaris]
 gb|ESW21424.1| hypothetical protein PHAVU_005G069800g [Phaseolus vulgaris]
Length=606

 Score =   400 bits (1028),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 215/362 (59%), Positives = 274/362 (76%), Gaps = 18/362 (5%)
 Frame = -3

Query  1674  NTYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL  1495
              T+  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK+VVHQLDL
Sbjct  183   TTFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQLDL  242

Query  1494  MTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPK  1315
             +TDLLGTPSPE IA +RN+KAR+YL  MRKK P+PF  KFPNADPLAL LL+R+LAFDPK
Sbjct  243   ITDLLGTPSPETIAGVRNDKARKYLMEMRKKSPVPFEQKFPNADPLALRLLQRLLAFDPK  302

Query  1314  DRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK  1135
             DRPTA+EAL+D +F+ LA+VEREPS QP++++EFEFERRR+TK++VRELIYREILEYHP+
Sbjct  303   DRPTAQEALSDTFFKGLAKVEREPSCQPISRLEFEFERRRVTKDEVRELIYREILEYHPQ  362

Query  1134  MLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD  955
             +LK+++ GTE T F+YPSA+D+F+KQFAYLEE++GK G V PPER+   SLPR +V    
Sbjct  363   LLKDYMNGTEGTHFLYPSAIDQFRKQFAYLEENHGKSGPVIPPERKHV-SLPRSTVHSCT  421

Query  954   NSVQNPAEVANDLSKCSIKEGDRLDR----NSG--IPTTRLPLQVPQGDAARPGRIVSSV  793
                      A+  SK  + E  ++ R    NSG  + ++R P +VP   AA+PGRIV  V
Sbjct  422   IPPSTQPSFASYESKQMVAEASKISRSVESNSGSQLRSSRPPPRVP---AAKPGRIVGPV  478

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPS---CKNERGEDGNEGSN  622
             + Y++G   T  +A +QR   RN  T+PQ A+S   + R  P+     +E  +D ++G +
Sbjct  479   LHYDNGR--TIKDAYDQRIFYRN--TLPQ-AVSPHCFHRVQPTNTKATSETYKDMSQGKH  533

Query  621   TV  616
              +
Sbjct  534   QL  535


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  145



>ref|XP_004969449.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X1 
[Setaria italica]
Length=589

 Score =   400 bits (1027),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 252/334 (75%), Gaps = 39/334 (12%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  181   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  240

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYL+SMRKK+P+PFS +FP ADP AL LL+
Sbjct  241   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLTSMRKKQPVPFSERFPKADPSALKLLQ  300

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFER+++TKEDV+ELI+R
Sbjct  301   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERKKVTKEDVKELIFR  360

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPER-QQASSL  982
             EILEYHP++LK+++ GTE TSF+YPSAVD F++QFA LEE+ GK G   PP   ++  SL
Sbjct  361   EILEYHPQLLKDYMNGTEKTSFLYPSAVDNFRRQFANLEENGGKSGAHIPPSSDRKHVSL  420

Query  981   PRPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPG  811
             PR + ++S     NP                       IP   T+++P ++P    ARPG
Sbjct  421   PRTTTVHS-----NP-----------------------IPPNGTSQIPQRIP---TARPG  449

Query  810   RIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMP  709
             R+V  V+ Y + + V   +   QRR+ RNP   P
Sbjct  450   RVVGPVIPYENLAVV---DPYSQRRVARNPVLPP  480


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  115   MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  151



>ref|XP_004969450.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X2 
[Setaria italica]
Length=571

 Score =   399 bits (1024),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/334 (61%), Positives = 252/334 (75%), Gaps = 39/334 (12%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYL+SMRKK+P+PFS +FP ADP AL LL+
Sbjct  223   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLTSMRKKQPVPFSERFPKADPSALKLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFER+++TKEDV+ELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERKKVTKEDVKELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPER-QQASSL  982
             EILEYHP++LK+++ GTE TSF+YPSAVD F++QFA LEE+ GK G   PP   ++  SL
Sbjct  343   EILEYHPQLLKDYMNGTEKTSFLYPSAVDNFRRQFANLEENGGKSGAHIPPSSDRKHVSL  402

Query  981   PRPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPG  811
             PR + ++S     NP                       IP   T+++P ++P    ARPG
Sbjct  403   PRTTTVHS-----NP-----------------------IPPNGTSQIPQRIP---TARPG  431

Query  810   RIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMP  709
             R+V  V+ Y + + V   +   QRR+ RNP   P
Sbjct  432   RVVGPVIPYENLAVV---DPYSQRRVARNPVLPP  462


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  133



>emb|CBI31754.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   396 bits (1018),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 216/361 (60%), Positives = 274/361 (76%), Gaps = 23/361 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  85    VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  144

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  145   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVIFAQKFPNADPLALRLLE  204

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  205   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  264

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  265   EILEYHPQLLKDYVNGTERTNFLYPSAVDQFRKQFAHLEENSGKTGPVIPLERKHV-SLP  323

Query  978   RPSVLYSDNS-VQNPAEVANDLSKCSIKEGDRLDRNS-GIP---------TTRLPLQVPQ  832
             R +V++S+    + P  +A    + + +   R  R++ GIP         + R+P+    
Sbjct  324   RSTVVHSNTIPAKEPHIIAFKDRQIAEESCSRSSRDTDGIPGNLSRSLQASQRIPM----  379

Query  831   GDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
                A+PG++V  +    +GSA+   +A + R ++RN   +P  A+      RR  + K E
Sbjct  380   ---AKPGKVVGPLAPPENGSAI--KDAYDHRTLIRN-AVLPSQALPPAYCYRRTSAGKQE  433

Query  651   R  649
             R
Sbjct  434   R  434


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  19    MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  55



>ref|XP_009377530.1| PREDICTED: mitogen-activated protein kinase 20 [Pyrus x bretschneideri]
Length=618

 Score =   399 bits (1025),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 217/357 (61%), Positives = 276/357 (77%), Gaps = 18/357 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAID+WSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDVWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVCFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTA+EALADPYF+ L+RVEREPS QP+TKMEFEFERRR+TKEDVRELI+R
Sbjct  295   RLLAFDPKDRPTAQEALADPYFKALSRVEREPSCQPITKMEFEFERRRVTKEDVRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSV-----QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLP--LQVPQG-DA  823
             R ++++S N+V     QN A + +   + + +E  R  R+S      L   +Q+P     
Sbjct  414   RSTIVHS-NTVPPKEQQNYAFLKD---QKNAEEAYRNSRDSEAVHVNLSRTMQMPHRISL  469

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
             A+PGR+V  V +Y++G+ +   +A ++R ++R     PQ     P+Y    PS  N+
Sbjct  470   AKPGRVVGPVAQYDNGNMM--KDAYDRRTLVRGSVLPPQ--AGPPAYCYHKPSAGNQ  522


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_007216974.1| hypothetical protein PRUPE_ppa002953mg [Prunus persica]
 gb|EMJ18173.1| hypothetical protein PRUPE_ppa002953mg [Prunus persica]
Length=618

 Score =   399 bits (1025),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 214/355 (60%), Positives = 271/355 (76%), Gaps = 14/355 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+  + KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVSLAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L+R+EREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLSRIEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSV-----QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQG-DAAR  817
             R ++++S N+V     QN A + +  +     +  R +    +  +R  +Q PQ    A+
Sbjct  414   RSTIVHS-NTVPPKEQQNYAFLKDQKNAEEAYKNSRDNEGIHVNLSR-TMQTPQRISLAK  471

Query  816   PGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
             PGR+V  V +Y +G+ +  +     RR L   + +P  A+  P+Y  R P   N+
Sbjct  472   PGRVVGPVAQYENGNMMKDT---YDRRTLVRSSVLPPQAVP-PAYCYRKPGAGNQ  522


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_004294176.1| PREDICTED: mitogen-activated protein kinase 19-like [Fragaria 
vesca subsp. vesca]
Length=609

 Score =   399 bits (1024),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 262/351 (75%), Gaps = 19/351 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTP+ E I+ +RNEKAR+YL+ MRKK P+PF+ KFP ADPLA+ LL+
Sbjct  235   SVVHQLDLITDLLGTPTLETISGVRNEKARKYLTEMRKKHPVPFTQKFPKADPLAVRLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDR TAEEALADPYF+ LARVERE S QP++K+EFEFERRR+ KED+R+LIYR
Sbjct  295   RLLAFDPKDRLTAEEALADPYFKGLARVERELSCQPISKLEFEFERRRVMKEDIRDLIYR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE TSFMYPSA+ +F+KQFAYLEE+ GK G V PPER+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTEGTSFMYPSAIGQFRKQFAYLEENGGKSGPVIPPERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLS-----KCSIKEGDRL-DRNSGIPT--TRLPLQVPQGDA  823
             R +V    +S   P    N LS           G R+ D  +G P+  +R P +VP    
Sbjct  414   RSTV---HSSTVIPIAQPNLLSYENRQTEEASNGLRVTDTVNGNPSKASRPPPRVP---T  467

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRH  670
             A+PGR++  V+ Y +G    A E  + R + RN   +PQ +IS   + R H
Sbjct  468   AKPGRVIGPVLPYENGR--NAKETYDPRTLYRN-AVLPQQSISPHCFFRTH  515


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  145



>ref|XP_010924832.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X2 
[Elaeis guineensis]
Length=518

 Score =   395 bits (1016),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 231/296 (78%), Gaps = 15/296 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  183   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  242

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLS+MRKK P+ FS KFP+ DP AL LLER+LAFDPKDR
Sbjct  243   DLLGTPSPESIARIRNEKARRYLSNMRKKPPVSFSQKFPSVDPFALHLLERLLAFDPKDR  302

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  L+ VEREPS QP++K+EFEFERR+++K+DVRELIYREILEYHP+ML
Sbjct  303   PTAEEALADPYFNGLSNVEREPSTQPISKLEFEFERRKLSKDDVRELIYREILEYHPQML  362

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++ G + T+FMYPS VD+FK+QFA+LEEH+GKG    P  RQ A SLPR  V  + + 
Sbjct  363   QEYLRGADQTNFMYPSGVDRFKRQFAHLEEHFGKGERSTPLGRQHA-SLPRERVGANKDE  421

Query  948   V--QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMR  787
             +  QN     ND  K   +  D + R+    T   P +  QG+ +    +   + R
Sbjct  422   IPDQN-----NDFEK---RSADSVARS----TLESPTRSQQGERSDHASVTDGINR  465


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLR +KYIH+ 
Sbjct  107   MESDLHQVIKANDDLTPEHHQFFLYQLLRAMKYIHSA  143



>ref|XP_003634202.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X1 
[Vitis vinifera]
 emb|CBI15552.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   398 bits (1023),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  270   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  329

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E+IARIRNEKARRYLS+MRKK  IPFS KFP+ADPLAL L+ER+LAFDPKDR
Sbjct  330   DLLGTPSAESIARIRNEKARRYLSTMRKKPSIPFSQKFPDADPLALHLVERLLAFDPKDR  389

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  LA V+REPS QP++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  390   PTAEEALADPYFDGLANVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  449

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG    P +RQ A SLPR  V
Sbjct  450   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERSTPLQRQHA-SLPRERV  502


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHT 
Sbjct  194   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTA  230



>ref|XP_003602111.1| Mitogen activated protein kinase 20-4 [Medicago truncatula]
 gb|AES72362.1| MAP kinase-like protein [Medicago truncatula]
Length=614

 Score =   399 bits (1024),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 262/316 (83%), Gaps = 6/316 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTVFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KF NADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFSNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G VAP +R+   SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVAPLDRKHV-SLP  412

Query  978   RPSVLYSDNSVQN-PAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGD-AARPGRI  805
             R ++++S+   Q     +A+  ++ + +E ++L R++ IP  R P+Q PQ    A+PG++
Sbjct  413   RSTIVHSNTVPQKEQTSIASSKNRQTSEEYNKLSRDNEIPVPR-PIQGPQRIPLAKPGKV  471

Query  804   VSSVMRYNSGSAVTAS  757
             V  V+ +  G+ V  S
Sbjct  472   VGPVVPFEYGNVVKDS  487


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_011082915.1| PREDICTED: mitogen-activated protein kinase 20-like [Sesamum 
indicum]
Length=620

 Score =   399 bits (1024),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 285/391 (73%), Gaps = 27/391 (7%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDL+T
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLIT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS   I+R+RNEKARRYL+SMRKK+P+PF+ KFPNADPLAL LLER+LAFDPKDR
Sbjct  245   DLLGTPSMNTISRVRNEKARRYLTSMRKKQPVPFALKFPNADPLALRLLERLLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
              TAEEALADPYF+ LA+VEREPS QP++KMEFEFERRR+TKED+RELI+REILEYHP++L
Sbjct  305   LTAEEALADPYFKGLAKVEREPSCQPISKMEFEFERRRVTKEDIRELIFREILEYHPQLL  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD--  955
             K++I GTE T+F+YPSA+D+FKK FA+LEE+ GK GV+  P  ++ +SLPR ++++++  
Sbjct  365   KDYINGTERTNFLYPSAIDQFKKLFAHLEENGGKDGVI--PLARKHASLPRSTIVHANAV  422

Query  954   -----NSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRL--PLQVPQG-DAARPGRIVS  799
                   +  N  +  N    CS     R  R+   P   L   LQ PQ    A+PG++V 
Sbjct  423   PSTEQTTFANARDRHNYEESCS-----RNSRDFDGPHNNLSRTLQQPQRIQQAKPGKVVG  477

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER--GED-GNEG  628
              V+ Y +G AV   ++ + R + RN  T+PQ   S  SY  R+ + K +R  GE   +  
Sbjct  478   PVLAYENGHAV--KDSYDPRTLFRN--TVPQVIPSLYSY-HRNGTGKMDRSAGETRRDSS  532

Query  627   SNTVPKPDQYMARKVA--AAPGGSGNQWY*T  541
             SNT   P+  MA K+A   A     NQ+Y T
Sbjct  533   SNTKQIPNCGMAAKLAPDIAINIDSNQFYMT  563


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_008656722.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X2 
[Zea mays]
Length=585

 Score =   397 bits (1021),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 204/346 (59%), Positives = 251/346 (73%), Gaps = 39/346 (11%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLM
Sbjct  188   VFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLM  247

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS + ++RIRNEKARRYL+SMRKK+P+ F  +FP ADP AL LL+R+LAFDPKD
Sbjct  248   TDLLGTPSLDTVSRIRNEKARRYLNSMRKKQPVSFPGRFPKADPAALKLLQRLLAFDPKD  307

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPT EEALADPYF+ LA+VEREPS QP+TKMEFEFERR++TKEDV+ELI+REILEYHP++
Sbjct  308   RPTPEEALADPYFKGLAKVEREPSCQPITKMEFEFERRKVTKEDVKELIFREILEYHPQL  367

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK         ++  SLPR + ++S  
Sbjct  368   LKDYMNGTEKTNFIYPSAVDNFRRQFANLEENGGKSVAHTASSDRKHVSLPRTTTVHS--  425

Query  951   SVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGRIVSSVMRYN  781
                NP                       IP   T+++P ++P G   RPGR+V SV+ + 
Sbjct  426   ---NP-----------------------IPPNGTSQVPRKIPTG---RPGRVVGSVIPFE  456

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE  643
             + +AV   +   QRR++RNP   P  A SN S    H    N  GE
Sbjct  457   NATAV---DPYSQRRVVRNPVLPP--ATSNLSAYTYHRKSDNSDGE  497


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  113   MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  149



>gb|KEH33588.1| MAP kinase-like protein [Medicago truncatula]
Length=602

 Score =   398 bits (1022),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 262/316 (83%), Gaps = 6/316 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFSDTPTTVFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KF NADPLAL LLE
Sbjct  223   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFSNADPLALRLLE  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G VAP +R+   SLP
Sbjct  343   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVAPLDRKHV-SLP  400

Query  978   RPSVLYSDNSVQN-PAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGD-AARPGRI  805
             R ++++S+   Q     +A+  ++ + +E ++L R++ IP  R P+Q PQ    A+PG++
Sbjct  401   RSTIVHSNTVPQKEQTSIASSKNRQTSEEYNKLSRDNEIPVPR-PIQGPQRIPLAKPGKV  459

Query  804   VSSVMRYNSGSAVTAS  757
             V  V+ +  G+ V  S
Sbjct  460   VGPVVPFEYGNVVKDS  475


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  97    MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  133



>ref|XP_008229412.1| PREDICTED: mitogen-activated protein kinase 20 [Prunus mume]
Length=618

 Score =   398 bits (1023),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 213/355 (60%), Positives = 272/355 (77%), Gaps = 14/355 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+  + KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVSLAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L+R+EREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLSRIEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSV-----QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQG-DAAR  817
             R ++++S N+V     QN A + +  +     +  R +    +  +R  +Q PQ    A+
Sbjct  414   RSTIVHS-NTVPPKEQQNYAFLKDQKNAEEAYKNSRDNEGIHVNLSR-TMQTPQRISLAK  471

Query  816   PGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
             PGR+V  V +Y +G+ +   +  ++R ++R+    PQ     P+Y  R P   N+
Sbjct  472   PGRVVGPVAQYENGNMM--KDTYDRRTLVRSSVLPPQ--AGPPAYCYRKPGAGNQ  522


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_008656723.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X3 
[Zea mays]
Length=569

 Score =   397 bits (1019),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/346 (59%), Positives = 251/346 (73%), Gaps = 39/346 (11%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLM
Sbjct  172   VFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLM  231

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS + ++RIRNEKARRYL+SMRKK+P+ F  +FP ADP AL LL+R+LAFDPKD
Sbjct  232   TDLLGTPSLDTVSRIRNEKARRYLNSMRKKQPVSFPGRFPKADPAALKLLQRLLAFDPKD  291

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPT EEALADPYF+ LA+VEREPS QP+TKMEFEFERR++TKEDV+ELI+REILEYHP++
Sbjct  292   RPTPEEALADPYFKGLAKVEREPSCQPITKMEFEFERRKVTKEDVKELIFREILEYHPQL  351

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK         ++  SLPR + ++S  
Sbjct  352   LKDYMNGTEKTNFIYPSAVDNFRRQFANLEENGGKSVAHTASSDRKHVSLPRTTTVHS--  409

Query  951   SVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGRIVSSVMRYN  781
                NP                       IP   T+++P ++P G   RPGR+V SV+ + 
Sbjct  410   ---NP-----------------------IPPNGTSQVPRKIPTG---RPGRVVGSVIPFE  440

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE  643
             + +AV   +   QRR++RNP   P  A SN S    H    N  GE
Sbjct  441   NATAV---DPYSQRRVVRNPVLPP--ATSNLSAYTYHRKSDNSDGE  481


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  133



>ref|XP_002283794.2| PREDICTED: mitogen-activated protein kinase 20 isoform X2 [Vitis 
vinifera]
 ref|XP_010656934.1| PREDICTED: mitogen-activated protein kinase 20 isoform X2 [Vitis 
vinifera]
Length=610

 Score =   398 bits (1022),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 220/380 (58%), Positives = 281/380 (74%), Gaps = 30/380 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  223   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVIFAQKFPNADPLALRLLE  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  343   EILEYHPQLLKDYVNGTERTNFLYPSAVDQFRKQFAHLEENSGKTGPVIPLERKHV-SLP  401

Query  978   RPSVLYSDNS-VQNPAEVANDLSKCSIKEGDRLDRNS-GIP---------TTRLPLQVPQ  832
             R +V++S+    + P  +A    + + +   R  R++ GIP         + R+P+    
Sbjct  402   RSTVVHSNTIPAKEPHIIAFKDRQIAEESCSRSSRDTDGIPGNLSRSLQASQRIPM----  457

Query  831   GDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPS----  664
                A+PG++V  +    +GSA+   +A + R ++RN   +P  A+  P+Y  R  S    
Sbjct  458   ---AKPGKVVGPLAPPENGSAI--KDAYDHRTLIRN-AVLPSQALP-PAYCYRRTSAGKQ  510

Query  663   --CKNERGEDGNEGSNTVPK  610
               C  E   D +  +  VP+
Sbjct  511   ERCVGEAERDLSSQAKQVPQ  530


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  97    MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  133



>ref|XP_008348358.1| PREDICTED: mitogen-activated protein kinase 10-like [Malus domestica]
Length=613

 Score =   398 bits (1022),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 216/357 (61%), Positives = 277/357 (78%), Gaps = 18/357 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  170   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  229

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  230   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVCFAQKFPNADPLALRLLE  289

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAE+ALADPYF+ L+R+EREP  QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  290   RLLAFDPKDRPTAEQALADPYFKGLSRIEREPLCQPITKMEFEFERRRVTKEDIRELIFR  349

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+  +SLP
Sbjct  350   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKH-TSLP  408

Query  978   RPSVLYSDNSV-----QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLP--LQVPQG-DA  823
             R ++++S N+V     QN A + +   + + +E  R  R+S      L   +Q PQ    
Sbjct  409   RSTIVHS-NTVPPKEQQNYAFLKD---QKNAEEAYRNSRDSEAIHVNLSRTMQTPQRISL  464

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
             A+PGR+V  V +Y++ + +   +A ++R ++     +PQ A   P+Y  R PS  N+
Sbjct  465   AKPGRVVGPVAQYDNRNMM--KDAYDRRTLVGGSVLLPQAA--PPAYCYRKPSAGNQ  517


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  104   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  140



>ref|XP_010656933.1| PREDICTED: mitogen-activated protein kinase 20 isoform X1 [Vitis 
vinifera]
Length=622

 Score =   398 bits (1023),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 220/380 (58%), Positives = 281/380 (74%), Gaps = 30/380 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVIFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYVNGTERTNFLYPSAVDQFRKQFAHLEENSGKTGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNS-VQNPAEVANDLSKCSIKEGDRLDRNS-GIP---------TTRLPLQVPQ  832
             R +V++S+    + P  +A    + + +   R  R++ GIP         + R+P+    
Sbjct  414   RSTVVHSNTIPAKEPHIIAFKDRQIAEESCSRSSRDTDGIPGNLSRSLQASQRIPM----  469

Query  831   GDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPS----  664
                A+PG++V  +    +GSA+   +A + R ++RN   +P  A+  P+Y  R  S    
Sbjct  470   ---AKPGKVVGPLAPPENGSAI--KDAYDHRTLIRN-AVLPSQALP-PAYCYRRTSAGKQ  522

Query  663   --CKNERGEDGNEGSNTVPK  610
               C  E   D +  +  VP+
Sbjct  523   ERCVGEAERDLSSQAKQVPQ  542


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_010924825.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X1 
[Elaeis guineensis]
Length=530

 Score =   395 bits (1014),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 231/296 (78%), Gaps = 15/296 (5%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  195   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  254

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPSPE+IARIRNEKARRYLS+MRKK P+ FS KFP+ DP AL LLER+LAFDPKDR
Sbjct  255   DLLGTPSPESIARIRNEKARRYLSNMRKKPPVSFSQKFPSVDPFALHLLERLLAFDPKDR  314

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF  L+ VEREPS QP++K+EFEFERR+++K+DVRELIYREILEYHP+ML
Sbjct  315   PTAEEALADPYFNGLSNVEREPSTQPISKLEFEFERRKLSKDDVRELIYREILEYHPQML  374

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++ G + T+FMYPS VD+FK+QFA+LEEH+GKG    P  RQ A SLPR  V  + + 
Sbjct  375   QEYLRGADQTNFMYPSGVDRFKRQFAHLEEHFGKGERSTPLGRQHA-SLPRERVGANKDE  433

Query  948   V--QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMR  787
             +  QN     ND  K   +  D + R+    T   P +  QG+ +    +   + R
Sbjct  434   IPDQN-----NDFEK---RSADSVARS----TLESPTRSQQGERSDHASVTDGINR  477


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLR +KYIH+ 
Sbjct  119   MESDLHQVIKANDDLTPEHHQFFLYQLLRAMKYIHSA  155



>ref|NP_001288504.1| uncharacterized protein LOC103636141 [Zea mays]
 gb|ACN34142.1| unknown [Zea mays]
 gb|AFW83485.1| putative MAP kinase family protein [Zea mays]
Length=589

 Score =   397 bits (1019),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/346 (59%), Positives = 251/346 (73%), Gaps = 39/346 (11%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLM
Sbjct  192   VFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLM  251

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS + ++RIRNEKARRYL+SMRKK+P+ F  +FP ADP AL LL+R+LAFDPKD
Sbjct  252   TDLLGTPSLDTVSRIRNEKARRYLNSMRKKQPVSFPGRFPKADPAALKLLQRLLAFDPKD  311

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPT EEALADPYF+ LA+VEREPS QP+TKMEFEFERR++TKEDV+ELI+REILEYHP++
Sbjct  312   RPTPEEALADPYFKGLAKVEREPSCQPITKMEFEFERRKVTKEDVKELIFREILEYHPQL  371

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LK+++ GTE T+F+YPSAVD F++QFA LEE+ GK         ++  SLPR + ++S  
Sbjct  372   LKDYMNGTEKTNFIYPSAVDNFRRQFANLEENGGKSVAHTASSDRKHVSLPRTTTVHS--  429

Query  951   SVQNPAEVANDLSKCSIKEGDRLDRNSGIP---TTRLPLQVPQGDAARPGRIVSSVMRYN  781
                NP                       IP   T+++P ++P G   RPGR+V SV+ + 
Sbjct  430   ---NP-----------------------IPPNGTSQVPRKIPTG---RPGRVVGSVIPFE  460

Query  780   SGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE  643
             + +AV   +   QRR++RNP   P  A SN S    H    N  GE
Sbjct  461   NATAV---DPYSQRRVVRNPVLPP--ATSNLSAYTYHRKSDNSDGE  501


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  117   MDTDLHQVIKANDDLTREHHQFFLYQMLRALKYIHTA  153



>ref|XP_006644481.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X3 
[Oryza brachyantha]
Length=561

 Score =   395 bits (1016),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 259/365 (71%), Gaps = 36/365 (10%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLM
Sbjct  172   VFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLM  231

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS + + RIRNEKARRYLSSMRKK+P+ FS +FP ADP AL LL+R+LAFDPKD
Sbjct  232   TDLLGTPSMDTVTRIRNEKARRYLSSMRKKQPVSFSGRFPKADPAALKLLQRLLAFDPKD  291

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPTAEEALADPYF+ LA+ EREPS QP+TKMEFEFERR++TKEDV+ELI+REILEYHP++
Sbjct  292   RPTAEEALADPYFKGLAKAEREPSCQPITKMEFEFERRKVTKEDVKELIFREILEYHPQL  351

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LK+++ GTE T+F+YPSA+D F++QFA LEE+ GK G   P +R+   SLPR + ++S  
Sbjct  352   LKDYMNGTEKTNFLYPSAIDNFRRQFANLEENGGKNGDAVPSDRKHV-SLPRTTTVHS--  408

Query  951   SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
             +   P +  N                    T+++P ++P G   RPGR+V  V+   + S
Sbjct  409   TPIPPKDHHN-------------------VTSQVPQRIPTG---RPGRVVGPVIPLENSS  446

Query  771   AVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMA  592
             A+       QRR++RN   M  YA     Y R+  S + E  ++  +        + +M 
Sbjct  447   AMG---PYNQRRVVRN---MSAYA-----YHRKSDSSERELQQELEKDRMRYQPSEHFMD  495

Query  591   RKVAA  577
              KV +
Sbjct  496   AKVVS  500


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  133



>ref|XP_006644480.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X2 
[Oryza brachyantha]
Length=569

 Score =   396 bits (1017),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 265/374 (71%), Gaps = 37/374 (10%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  171   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGK  230

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + + RIRNEKARRYLSSMRKK+P+ FS +FP ADP AL LL+
Sbjct  231   NVVHQLDLMTDLLGTPSMDTVTRIRNEKARRYLSSMRKKQPVSFSGRFPKADPAALKLLQ  290

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+ EREPS QP+TKMEFEFERR++TKEDV+ELI+R
Sbjct  291   RLLAFDPKDRPTAEEALADPYFKGLAKAEREPSCQPITKMEFEFERRKVTKEDVKELIFR  350

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSA+D F++QFA LEE+ GK G   P +R+   SLP
Sbjct  351   EILEYHPQLLKDYMNGTEKTNFLYPSAIDNFRRQFANLEENGGKNGDAVPSDRKHV-SLP  409

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S  +   P +  N                    T+++P ++P G   RPGR+V 
Sbjct  410   RTTTVHS--TPIPPKDHHN-------------------VTSQVPQRIPTG---RPGRVVG  445

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNT  619
              V+   + SA+       QRR++RN   M  YA     Y R+  S + E  ++  +    
Sbjct  446   PVIPLENSSAMG---PYNQRRVVRN---MSAYA-----YHRKSDSSERELQQELEKDRMR  494

Query  618   VPKPDQYMARKVAA  577
                 + +M  KV +
Sbjct  495   YQPSEHFMDAKVVS  508


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  105   MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  141



>ref|XP_006644479.1| PREDICTED: mitogen-activated protein kinase 8-like isoform X1 
[Oryza brachyantha]
Length=576

 Score =   396 bits (1017),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/365 (56%), Positives = 259/365 (71%), Gaps = 36/365 (10%)
 Frame = -3

Query  1671  TYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLM  1492
              +  DYVATRWYRAPELCGSFFSKY+PAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLM
Sbjct  187   VFWTDYVATRWYRAPELCGSFFSKYSPAIDIWSIGCIFAEILTGKPLFPGKNVVHQLDLM  246

Query  1491  TDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKD  1312
             TDLLGTPS + + RIRNEKARRYLSSMRKK+P+ FS +FP ADP AL LL+R+LAFDPKD
Sbjct  247   TDLLGTPSMDTVTRIRNEKARRYLSSMRKKQPVSFSGRFPKADPAALKLLQRLLAFDPKD  306

Query  1311  RPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKM  1132
             RPTAEEALADPYF+ LA+ EREPS QP+TKMEFEFERR++TKEDV+ELI+REILEYHP++
Sbjct  307   RPTAEEALADPYFKGLAKAEREPSCQPITKMEFEFERRKVTKEDVKELIFREILEYHPQL  366

Query  1131  LKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDN  952
             LK+++ GTE T+F+YPSA+D F++QFA LEE+ GK G   P +R+   SLPR + ++S  
Sbjct  367   LKDYMNGTEKTNFLYPSAIDNFRRQFANLEENGGKNGDAVPSDRKHV-SLPRTTTVHS--  423

Query  951   SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNSGS  772
             +   P +  N                    T+++P ++P G   RPGR+V  V+   + S
Sbjct  424   TPIPPKDHHN-------------------VTSQVPQRIPTG---RPGRVVGPVIPLENSS  461

Query  771   AVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPDQYMA  592
             A+       QRR++RN   M  YA     Y R+  S + E  ++  +        + +M 
Sbjct  462   AMG---PYNQRRVVRN---MSAYA-----YHRKSDSSERELQQELEKDRMRYQPSEHFMD  510

Query  591   RKVAA  577
              KV +
Sbjct  511   AKVVS  515


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  112   MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  148



>ref|XP_008456351.1| PREDICTED: mitogen-activated protein kinase 20-like isoform X1 
[Cucumis melo]
Length=620

 Score =   397 bits (1020),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 211/343 (62%), Positives = 263/343 (77%), Gaps = 20/343 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+L GKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLMGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL++MRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTTMRKKQPVPFSQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA++EREPS QP+TKMEFEFERRR+TKED++ELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPITKMEFEFERRRVTKEDIQELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK   V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENGGKSAPVIPLDRKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEG----DRLDRNSGIPTTRL-----PLQVPQGD  826
             R +V++S     NP    + +S   +++G    D   +NS     RL      +Q PQ +
Sbjct  414   RSTVVHS-----NPVYSKDQVSNVPLQDGKISEDAYSKNSRDSEGRLTNISRTMQAPQKN  468

Query  825   --AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQY  703
               AA+PGR+V  V+   SG  V   E  + R ++R     P Y
Sbjct  469   PFAAKPGRVVGPVIADESGRLV--KEPYDPRTLIRGAILPPAY  509


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_010247564.1| PREDICTED: mitogen-activated protein kinase 7-like [Nelumbo nucifera]
Length=617

 Score =   397 bits (1020),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 227/387 (59%), Positives = 280/387 (72%), Gaps = 26/387 (7%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDAPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF  KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSMDTISRVRNEKARRYLTSMRKKQPVPFVQKFPNADPLALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+ K+EFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPIAKLEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYH ++LK+++ GTE TSF+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHQQLLKDYMNGTERTSFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKE--GDRLDRN-----SGIP-TTRLPLQVPQGDA  823
             R +V++S+            L +  I+E   ++  RN       IP T + P ++P    
Sbjct  414   RSTVVHSNTIPPKDQTSLASLRERQIQEEACNKSSRNMEGVSGSIPRTLQAPHKIP---L  470

Query  822   ARPGRIVSSVMRYNSGSAVT-ASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERG  646
             A+PG++V  VM Y   S++    +A+    M+RN    PQ     P YS R    K ER 
Sbjct  471   AKPGKVVGPVMPYEGASSMKDGYDAM----MIRNAVLPPQAV--PPPYSFRRTGTKQERS  524

Query  645   EDGNEGSNTV----PKPDQY-MARKVA  580
               G E    +    P+P Q  MA K+A
Sbjct  525   S-GTEAERDLLQGKPQPAQCSMAVKMA  550


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_008368560.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
20-like [Malus domestica]
Length=616

 Score =   396 bits (1018),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 217/356 (61%), Positives = 271/356 (76%), Gaps = 16/356 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAID+WSIGCIFAE+LTGKPLFPGK
Sbjct  173   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDVWSIGCIFAEVLTGKPLFPGK  232

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL  MRKK+P+ F+ KFPNADPLAL LLE
Sbjct  233   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLXRMRKKQPVCFAQKFPNADPLALRLLE  292

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTA+EALADPYF+ L+RVEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  293   RLLAFDPKDRPTAQEALADPYFKGLSRVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  352

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  353   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  411

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNS------GIPTTRLPLQVPQG-DAA  820
             R ++++S N+V  P E  N       K  +   RNS       +  +R  +Q PQ    A
Sbjct  412   RSTIVHS-NTVP-PKEQQNYAFLKDQKNAEXAYRNSRDSEAVHVNISR-TMQTPQRISLA  468

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
             +PGR+V  V + ++GS +   +A ++R ++R     PQ     P+Y  R PS  N+
Sbjct  469   KPGRVVGPVAQCDNGSMM--KDAYDRRTLVRGSVLPPQAV--PPAYCYRKPSAGNQ  520


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  107   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  143



>ref|XP_009356626.1| PREDICTED: mitogen-activated protein kinase 20-like [Pyrus x 
bretschneideri]
Length=618

 Score =   396 bits (1018),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 215/357 (60%), Positives = 276/357 (77%), Gaps = 18/357 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKAR+YL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARKYLTSMRKKQPVCFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAE+ALADPYF+ L+R+EREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEQALADPYFKGLSRIEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSV-----QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLP--LQVPQG-DA  823
             R ++++S N+V     QN A + +   + + +E  R  R+S      L   +Q PQ    
Sbjct  414   RSTIVHS-NTVPPKEQQNYAFLKD---QKNAEEAYRNSRDSEAIHVNLSRTMQTPQRISL  469

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE  652
             A+PGR+V  V +Y++ + +   +  ++R ++     +PQ A   P+Y  R PS  N+
Sbjct  470   AKPGRVVGPVAQYDNRNKM--KDDYDRRTLVGGSVLLPQAA--PPAYCYRKPSAGNQ  522


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>gb|KDO60938.1| hypothetical protein CISIN_1g0070502mg, partial [Citrus sinensis]
Length=611

 Score =   396 bits (1017),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 281/381 (74%), Gaps = 17/381 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  167   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  226

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+P+ FS KFPNADP AL LLE
Sbjct  227   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKQPVQFSQKFPNADPSALRLLE  286

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L++VEREPS QP++KMEFEFERRR+TKED+RELI+R
Sbjct  287   RLLAFDPKDRPTAEEALADPYFKGLSKVEREPSCQPISKMEFEFERRRVTKEDIRELIFR  346

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V PPER+   SLP
Sbjct  347   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENVGKSGPVIPPERKHV-SLP  405

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNS----GIPTT---RLPLQVPQGDAA  820
             R ++++S N+V  P +   +LS+      +  ++NS    GIP      LP Q  +   A
Sbjct  406   RSTIVHS-NTV--PPKEQQNLSRDRQAAEEVFNKNSKESEGIPANLSRTLPAQ-QRFPLA  461

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +PG++V  V+ Y + S     +A + R  +R+ T +PQ AI      R+  + K E   +
Sbjct  462   KPGKVVGPVVPYENASV--RRDAYDPRTFIRS-TVLPQ-AIPAAYCYRKSSTGKQEMDSE  517

Query  639   GNEGSNTVPKPDQYMARKVAA  577
                 S     P   MA K A 
Sbjct  518   REMPSQVKHVPQCGMAAKFAT  538


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  101   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  137



>ref|XP_004969240.1| PREDICTED: mitogen-activated protein kinase 10-like [Setaria 
italica]
Length=611

 Score =   396 bits (1017),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 215/339 (63%), Positives = 262/339 (77%), Gaps = 14/339 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYLSSMRKK+PIPFS KFPNADPLAL LL+
Sbjct  235   NVVHQLDLMTDLLGTPSMDTISRVRNEKARRYLSSMRKKEPIPFSQKFPNADPLALDLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAE+ALA PYF++LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEQALAHPYFKSLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+F+KQFA+LEE+ G G V+ P ER+  +SLP
Sbjct  355   EILEYHPQLLKDYINGTERTTFLYPSAVDQFRKQFAHLEENSGNGPVI-PMERKH-TSLP  412

Query  978   RPSVLYSD-NSVQNPAEVANDLSKCSIKEGDRLDRN----SGIPTTRLPLQVPQGDAARP  814
             R ++++S    V+    +     K S  E  +  R     SG  +   P +VP    ARP
Sbjct  413   RSTIVHSAPIPVKEQPRIGPSREKPSSDESYKNSRETEKYSGNVSRTAPQRVP---TARP  469

Query  813   GRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAI  697
             GR+V  VM Y +G+     +  + RR+  N    PQ  I
Sbjct  470   GRVVGPVMPYENGN---TKDHYDARRLAMNSGYPPQQQI  505


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>gb|KDO60937.1| hypothetical protein CISIN_1g0070502mg [Citrus sinensis]
Length=614

 Score =   396 bits (1017),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 222/381 (58%), Positives = 281/381 (74%), Gaps = 17/381 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  170   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  229

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+P+ FS KFPNADP AL LLE
Sbjct  230   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKQPVQFSQKFPNADPSALRLLE  289

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L++VEREPS QP++KMEFEFERRR+TKED+RELI+R
Sbjct  290   RLLAFDPKDRPTAEEALADPYFKGLSKVEREPSCQPISKMEFEFERRRVTKEDIRELIFR  349

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V PPER+   SLP
Sbjct  350   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENVGKSGPVIPPERKHV-SLP  408

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNS----GIPTT---RLPLQVPQGDAA  820
             R ++++S N+V  P +   +LS+      +  ++NS    GIP      LP Q  +   A
Sbjct  409   RSTIVHS-NTV--PPKEQQNLSRDRQAAEEVFNKNSKESEGIPANLSRTLPAQ-QRFPLA  464

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +PG++V  V+ Y + S     +A + R  +R+ T +PQ AI      R+  + K E   +
Sbjct  465   KPGKVVGPVVPYENASV--RRDAYDPRTFIRS-TVLPQ-AIPAAYCYRKSSTGKQEMDSE  520

Query  639   GNEGSNTVPKPDQYMARKVAA  577
                 S     P   MA K A 
Sbjct  521   REMPSQVKHVPQCGMAAKFAT  541


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  104   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  140



>ref|XP_010261263.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
9-like [Nelumbo nucifera]
Length=609

 Score =   395 bits (1016),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 188/253 (74%), Positives = 213/253 (84%), Gaps = 4/253 (2%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  271   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  330

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS E IARIRNEKARRYLSSMRKK  IPFS KFP  DPLAL L+E +L+FDPKDR
Sbjct  331   DLLGTPSAETIARIRNEKARRYLSSMRKKPAIPFSQKFPGIDPLALRLVEHLLSFDPKDR  390

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+A+EALADPYF  LA V+REPS QP++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  391   PSAQEALADPYFHGLANVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  450

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG    P +RQ A SLPR  V    + 
Sbjct  451   QEYLRGADQTSFMYPSGVDRFKRQFAHLEEHYGKGERSTPLQRQHA-SLPRERVCVPKD-  508

Query  948   VQNPAEVANDLSK  910
               N A+  ND  K
Sbjct  509   --NSADQNNDFEK  519



>gb|ABH01192.1| mitogen activated protein kinase 20-4 [Oryza sativa Indica Group]
Length=569

 Score =   394 bits (1012),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 206/375 (55%), Positives = 261/375 (70%), Gaps = 31/375 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGCIFAEILTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + + RIRNEKARRYLSSMRKK+P+PFS +FP ADP AL LL+
Sbjct  223   NVVHQLDLMTDLLGTPSMDTVTRIRNEKARRYLSSMRKKQPVPFSERFPKADPAALKLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+ EREPS QP+TKMEFEFERR++TKEDV+ELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKAEREPSCQPITKMEFEFERRKVTKEDVKELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSA+D F++QFA LEE+ GK G   P +R+   SLP
Sbjct  343   EILEYHPQLLKDYMNGTEKTNFLYPSALDNFRRQFANLEENGGKNGDAVPSDRKHV-SLP  401

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S                  I   D  +  S         QVPQ    R GR   
Sbjct  402   RTTTVHS----------------APIPPKDHQNITS---------QVPQRIPGRTGRGAC  436

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNERGEDGNEGSN  622
              V+ + + SA+       QRR++RNP   P    +S  +Y R+  S + E  ++  +   
Sbjct  437   PVIPFENLSAMG---PYNQRRVVRNPVLPPATTNLSAHAYHRKSDSSERELQQELEKDRM  493

Query  621   TVPKPDQYMARKVAA  577
                  + +M  KV +
Sbjct  494   RYQPSEHFMDAKVVS  508


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  133



>ref|XP_002300882.2| mitogen-activated protein kinase [Populus trichocarpa]
 gb|EEE80155.2| mitogen-activated protein kinase [Populus trichocarpa]
Length=621

 Score =   395 bits (1016),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 219/363 (60%), Positives = 270/363 (74%), Gaps = 26/363 (7%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++  +T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPSTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+ +RN+KARRYL+SMRKK+P+P + KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISLVRNDKARRYLTSMRKKQPVPLAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LARVEREPS QP+TKMEFEFERRR+TKEDVRELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLARVEREPSCQPITKMEFEFERRRVTKEDVRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+ A SLP
Sbjct  355   EILEYHPQLLKDYLNGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHA-SLP  413

Query  978   RPSVLYSDN----SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTT---------RLPLQV  838
             R ++++S +      QN A   +  +       +  D   GIP           R+PL  
Sbjct  414   RSTIVHSSSIPTKEQQNLASFKDRHTAEEAYNKNPRD-TEGIPVNISRTLQAQQRVPL--  470

Query  837   PQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCK  658
                  A+PG++V  V+ Y +GS V   +A + R  +R+    P  A S   Y R+  S K
Sbjct  471   -----AKPGKVVGQVVSYENGSIV--KDARDPRTYIRSAVLPPHAAPSAYCY-RKSNSGK  522

Query  657   NER  649
              ER
Sbjct  523   QER  525


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>emb|CDM83592.1| unnamed protein product [Triticum aestivum]
Length=586

 Score =   394 bits (1013),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 259/350 (74%), Gaps = 32/350 (9%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  182   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGCIFAEILTGKPLFPGK  241

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+P+ FS +FP ADP A  L++
Sbjct  242   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQPVCFSERFPKADPAAFKLMQ  301

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L +VEREPS QP++K EFEFER+++TKEDV+ELI+R
Sbjct  302   RLLAFDPKDRPTAEEALADPYFKGLGKVEREPSCQPISKFEFEFERKKVTKEDVKELIFR  361

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GKGG + P +R+   SLP
Sbjct  362   EILEYHPQLLKDYMNGTEKTNFLYPSAVDNFRRQFANLEENGGKGGAIVPSDRKHV-SLP  420

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S                  I   D+        ++++P ++P G   RPGR+V 
Sbjct  421   RTTTVHS----------------TPIPPKDQ-------KSSQVPQRIPTG---RPGRVVG  454

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER  649
              V+ + +  A+   +   QRR+ RNP  +P  A +  +Y+    S  +ER
Sbjct  455   PVIPFENSCAM---DPYSQRRVARNP-VLPAAATNVSAYAYHRKSDSSER  500


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  116   MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  152



>ref|XP_006598124.1| PREDICTED: mitogen-activated protein kinase 19-like isoform X2 
[Glycine max]
Length=598

 Score =   395 bits (1014),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 261/339 (77%), Gaps = 15/339 (4%)
 Frame = -3

Query  1674  NTYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL  1495
              T+  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK+VVHQLDL
Sbjct  174   TTFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQLDL  233

Query  1494  MTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPK  1315
             +TDLLGTP PE IA +RN+KAR+YL  MRKK P+PF  KFPNADPLAL LL+R+LAFDPK
Sbjct  234   ITDLLGTPPPETIAGVRNDKARKYLMEMRKKSPVPFEQKFPNADPLALRLLQRLLAFDPK  293

Query  1314  DRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK  1135
             DRPTA+EALADP+F+ LA+VEREPS QP++++EFEFERRR+TK+DVRELIYREILEYHP+
Sbjct  294   DRPTAQEALADPFFKGLAKVEREPSCQPISRLEFEFERRRVTKDDVRELIYREILEYHPQ  353

Query  1134  MLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD  955
             +LK+++ GTE T F+YPSA+D+F+K FAYLEE++GK G V PPER+   SLPR +V  S 
Sbjct  354   LLKDYMNGTEGTHFLYPSAIDQFRKHFAYLEENHGKSGPVIPPERKHV-SLPRSTVHSST  412

Query  954   NSVQNPAEVANDLSKCSIKEGDRLDR----NSG--IPTTRLPLQVPQGDAARPGRIVSSV  793
                       +  +K   +E  ++ R    NSG  + ++R P +VP   AA+PGRIV  V
Sbjct  413   IPPSTQPSFTSYENKHMAEEASKVTRSVESNSGSQLRSSRPPPRVP---AAKPGRIVGPV  469

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSR  676
             + Y++G   T  +  +QR   RN  T+PQ A+S   + R
Sbjct  470   LHYDNGR--TLKDTYDQRIFYRN--TLPQ-AVSPHCFHR  503


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR +KY+HT 
Sbjct  100   MESDLHQVIKANDDLTREHHQFFLYQMLRAMKYMHTA  136



>ref|XP_006437188.1| hypothetical protein CICLE_v10030977mg [Citrus clementina]
 ref|XP_006484845.1| PREDICTED: mitogen-activated protein kinase 20-like [Citrus sinensis]
 gb|ESR50428.1| hypothetical protein CICLE_v10030977mg [Citrus clementina]
Length=619

 Score =   395 bits (1015),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 221/381 (58%), Positives = 281/381 (74%), Gaps = 17/381 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+P+ FS KFPNADP AL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKQPVQFSQKFPNADPSALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L++VEREPS QP++KMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLSKVEREPSCQPISKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V PPER+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENVGKSGPVIPPERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNS----GIPTT---RLPLQVPQGDAA  820
             R ++++S N+V  P +   +LS+      +  ++NS    GIP      LP Q  +   A
Sbjct  414   RSTIVHS-NTV--PPKEQQNLSRDRQAAEEVFNKNSKESEGIPANLSRTLPAQ-QRFPLA  469

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGED  640
             +PG++V  V+ Y + S     +A + R  +R+ T +PQ A+      R+  + K E   +
Sbjct  470   KPGKVVGPVVPYENASV--RRDAYDPRTFIRS-TVLPQ-AVPAAYCYRKSSTGKQEMDSE  525

Query  639   GNEGSNTVPKPDQYMARKVAA  577
                 S     P   MA K A 
Sbjct  526   REMPSQVKHVPQCGMAAKFAT  546


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_003546736.1| PREDICTED: mitogen-activated protein kinase 19-like isoform X1 
[Glycine max]
Length=607

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 261/339 (77%), Gaps = 15/339 (4%)
 Frame = -3

Query  1674  NTYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL  1495
              T+  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK+VVHQLDL
Sbjct  183   TTFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQLDL  242

Query  1494  MTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPK  1315
             +TDLLGTP PE IA +RN+KAR+YL  MRKK P+PF  KFPNADPLAL LL+R+LAFDPK
Sbjct  243   ITDLLGTPPPETIAGVRNDKARKYLMEMRKKSPVPFEQKFPNADPLALRLLQRLLAFDPK  302

Query  1314  DRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK  1135
             DRPTA+EALADP+F+ LA+VEREPS QP++++EFEFERRR+TK+DVRELIYREILEYHP+
Sbjct  303   DRPTAQEALADPFFKGLAKVEREPSCQPISRLEFEFERRRVTKDDVRELIYREILEYHPQ  362

Query  1134  MLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD  955
             +LK+++ GTE T F+YPSA+D+F+K FAYLEE++GK G V PPER+   SLPR +V  S 
Sbjct  363   LLKDYMNGTEGTHFLYPSAIDQFRKHFAYLEENHGKSGPVIPPERKHV-SLPRSTVHSST  421

Query  954   NSVQNPAEVANDLSKCSIKEGDRLDR----NSG--IPTTRLPLQVPQGDAARPGRIVSSV  793
                       +  +K   +E  ++ R    NSG  + ++R P +VP   AA+PGRIV  V
Sbjct  422   IPPSTQPSFTSYENKHMAEEASKVTRSVESNSGSQLRSSRPPPRVP---AAKPGRIVGPV  478

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSR  676
             + Y++G   T  +  +QR   RN  T+PQ A+S   + R
Sbjct  479   LHYDNGR--TLKDTYDQRIFYRN--TLPQ-AVSPHCFHR  512


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR +KY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRAMKYMHTA  145



>sp|Q5SN53.2|MPK8_ORYSJ RecName: Full=Mitogen-activated protein kinase 8; Short=MAP kinase 
8; AltName: Full=OsWJUMK1; AltName: Full=Wound- and JA-uninducible 
MAP kinase 1 [Oryza sativa Japonica Group]
 emb|CAD54742.1| putative mitogen-activated protein kinase wjumk1 [Oryza sativa 
Japonica Group]
 dbj|BAD72351.1| mitogen-activated protein kinase ERK1-like [Oryza sativa Japonica 
Group]
Length=569

 Score =   393 bits (1010),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/375 (55%), Positives = 261/375 (70%), Gaps = 31/375 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGCIFAEILTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + + RIRNEKARRYLSSMRKK+P+PFS +FP ADP AL LL+
Sbjct  223   NVVHQLDLMTDLLGTPSMDTVTRIRNEKARRYLSSMRKKQPVPFSERFPKADPAALKLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+ EREPS QP+TKMEFEFERR++TKEDV+ELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKAEREPSCQPITKMEFEFERRKVTKEDVKELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSA+D F++QFA LEE+ GK G   P +R+   SLP
Sbjct  343   EILEYHPQLLKDYMNGTEKTNFLYPSALDNFRRQFANLEENGGKNGDAVPSDRKHV-SLP  401

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S                  I   D  +  S         QVPQ    R GR   
Sbjct  402   RTTTVHS----------------APIPPKDHQNITS---------QVPQRIPGRTGRGAC  436

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNERGEDGNEGSN  622
              V+ + + SA+       QRR++RNP   P    +S  +Y R+  S + E  ++  +   
Sbjct  437   PVIPFENLSAMG---PYNQRRVVRNPVLPPATTNLSAYAYHRKSDSSERELQQELEKDRM  493

Query  621   TVPKPDQYMARKVAA  577
                  + +M  KV +
Sbjct  494   RYQPSEHFMDAKVVS  508


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  133



>ref|XP_009383467.1| PREDICTED: mitogen-activated protein kinase 10-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 284/397 (72%), Gaps = 29/397 (7%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAELL GKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAELLIGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKAR+YLSSMRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARKYLSSMRKKQPVPFSQKFPNADPLALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRP+A EALADPYF+ L+++EREPS QP++KMEFEFER R++KED+RELI+R
Sbjct  295   RLLAFDPKDRPSAAEALADPYFKGLSKLEREPSCQPISKMEFEFERHRVSKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LKE+I GTE  +F+YPSAVD+F+KQFAYLEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKEYINGTERPNFLYPSAVDQFRKQFAYLEENRGKSGPVVPLERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRN---SGIP-----TTRLPLQVPQGDA  823
             R +V++S  SV  P E  N  S    +  D    N   SG P     T++LP ++P    
Sbjct  414   RSTVVHS-TSVP-PREQPNLASSRGSQVMDDTSNNPGDSGAPRNVARTSQLPQRIP---T  468

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRN----------PTTMPQYAISNPSYSRR  673
             A+PGR+V SV+ Y  G      ++ + RR++RN          PT     A++NP+ S R
Sbjct  469   AKPGRVVGSVLPYEHGG---PKDSYDPRRLIRNHGFPPPPVIPPTFCFNRAMANPTCSER  525

Query  672   HPSCKNERGEDGNEGSNTVPKPDQYMARKVAAAPGGS  562
             + S + ER     +   +VP     M       P G+
Sbjct  526   N-SVEAERLVMDRKPHRSVPDLVMDMGVHAFCQPRGA  561


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_011009093.1| PREDICTED: mitogen-activated protein kinase 19 isoform X2 [Populus 
euphratica]
Length=597

 Score =   394 bits (1013),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 209/389 (54%), Positives = 265/389 (68%), Gaps = 18/389 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYT AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFSDTPTTVFWTDYVATRWYRAPELCGSFFSKYTRAIDIWSIGCIFAEVLTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPS E I+R+RN+KAR+YL+ MRKK+P+PF+ KFPNADPLA  LL+
Sbjct  223   SVVHQLDLITDLLGTPSLETISRVRNDKARKYLTEMRKKQPVPFANKFPNADPLAHRLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+ K+EFEFERRR+TKEDVREL+YR
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPIMKLEFEFERRRVTKEDVRELLYR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ G E T+F+YPSA+  F+KQFAYLEE+ G+   V P ER+   SLP
Sbjct  343   EILEYHPQLLKDYMNGNESTNFLYPSAIGHFRKQFAYLEENSGRSAPVIPLERKHV-SLP  401

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQV----PQGDAARPG  811
             R S ++S+   +N    +       + E D  +      +   P +V    P+  +A+PG
Sbjct  402   R-STVHSNTIPRNMQSNSTSFDNRRVTEDDSKNLRVQDTSFENPAKVARPPPRMPSAKPG  460

Query  810   RIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQ----YAISNPSYSRRHPSCKNERGE  643
             R+V SV+ Y +G  V   +    R   RN    PQ    +     + +       +E G+
Sbjct  461   RVVGSVVPYENGRNV--KDLYGTRMFCRNAVLPPQTSSPHCFLRTNNTLIQAKSISETGK  518

Query  642   DGNEGS-----NTVPKPDQYMARKVAAAP  571
             D          N   KP   MA  V   P
Sbjct  519   DSQTKQQPPKCNVAAKPSSGMAMDVNTNP  547


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  97    MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  133



>ref|XP_004503296.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X3 
[Cicer arietinum]
Length=513

 Score =   391 bits (1005),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTP IDIWSIGCIFAE+LTG+PLFPGKNVVHQLD+MT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGRPLFPGKNVVHQLDIMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE+IARIRNEKARRYL+SMRKK+P+PFS KFPN DPLAL +LER+LAFDPK+R
Sbjct  245   DLLGTPPPESIARIRNEKARRYLNSMRKKQPVPFSQKFPNIDPLALRILERLLAFDPKNR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEAL+DPYF  L+ ++REPS  P++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  305   PSAEEALSDPYFHGLSNIDREPSTHPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG   +P +RQ A SLPR  V
Sbjct  365   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERSSPLQRQHA-SLPRERV  417


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLRGLK+IHT 
Sbjct  109   MESDLHQVIKANDDLTPEHHQFFLYQLLRGLKFIHTA  145



>ref|XP_008456353.1| PREDICTED: mitogen-activated protein kinase 20-like isoform X2 
[Cucumis melo]
Length=619

 Score =   395 bits (1014),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/342 (61%), Positives = 262/342 (77%), Gaps = 19/342 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+L GKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLMGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL++MRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTTMRKKQPVPFSQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA++EREPS QP+TKMEFEFERRR+TKED++ELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPITKMEFEFERRRVTKEDIQELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK   V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENGGKSAPVIPLDRKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEG----DRLDRNSGIPTTRL-----PLQVPQGD  826
             R +V++S     NP    + +S   +++G    D   +NS     RL      +Q PQ +
Sbjct  414   RSTVVHS-----NPVYSKDQVSNVPLQDGKISEDAYSKNSRDSEGRLTNISRTMQAPQKN  468

Query  825   -AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQY  703
               A+PGR+V  V+   SG  V   E  + R ++R     P Y
Sbjct  469   PFAKPGRVVGPVIADESGRLV--KEPYDPRTLIRGAILPPAY  508


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_007141393.1| hypothetical protein PHAVU_008G191500g [Phaseolus vulgaris]
 gb|ESW13387.1| hypothetical protein PHAVU_008G191500g [Phaseolus vulgaris]
Length=613

 Score =   395 bits (1014),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 209/362 (58%), Positives = 268/362 (74%), Gaps = 6/362 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+S+YTPAIDIWSIGCIFAE+L GKPLFPGK
Sbjct  175   VAFSDTPTTVFWTDYVATRWYRAPELCGSFYSRYTPAIDIWSIGCIFAEVLIGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+PIPF+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKQPIPFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++ ELI+R
Sbjct  295   KLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIGELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSAVD+FKKQFA+LEE  GK   V  PER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTERTNFLYPSAVDQFKKQFAHLEETGGKSSPVMLPERKHV-SLP  413

Query  978   RPSVLYSD-NSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIV  802
             R ++++S+  S +  + + +  ++ + +E +   R++  P  R    + +   A+PG++V
Sbjct  414   RSTIIHSNIVSTKEQSNITSSKNRQTTEEYNNNSRDTDNPAPRSIQGLQKFSLAKPGKVV  473

Query  801   SSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSN  622
               V+ Y   S V  S   E R  +R  + +P       S+ +R    K ER     E   
Sbjct  474   GPVIPYEYASVVKGS--YEPRTFMRG-SVLPSQPTPPTSHYQRLTPGKQERSATATEADK  530

Query  621   TV  616
              V
Sbjct  531   CV  532


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_004516460.1| PREDICTED: mitogen-activated protein kinase 10-like [Cicer arietinum]
Length=615

 Score =   394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 214/363 (59%), Positives = 277/363 (76%), Gaps = 9/363 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+ F+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVSFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVMPLDRKHV-SLP  412

Query  978   RPSVLYSDNSVQN-PAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGD-AARPGRI  805
             R ++++S+   Q     +A+  ++ + +E ++  R++ IP  R P+Q PQ    A+PG++
Sbjct  413   RSTIVHSNTIPQKEQTSIASSKNRQTPEEYNKNSRDTEIPMLR-PMQGPQRIPLAKPGKV  471

Query  804   VSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGS  625
             V  V  Y  G+ V   ++ + R  +R  T +P   +    Y +R  S  N+  +   E  
Sbjct  472   VGPVAPYEYGNVV--KDSYDARAYIRG-TVLPPQPVPPAYYYQRPSSTANQERQATIEAD  528

Query  624   NTV  616
               V
Sbjct  529   KGV  531


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>gb|KHN47491.1| Mitogen-activated protein kinase 19 [Glycine soja]
Length=625

 Score =   395 bits (1014),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 261/339 (77%), Gaps = 15/339 (4%)
 Frame = -3

Query  1674  NTYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL  1495
              T+  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK+VVHQLDL
Sbjct  201   TTFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQLDL  260

Query  1494  MTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPK  1315
             +TDLLGTP PE IA +RN+KAR+YL  MRKK P+PF  KFPNADPLAL LL+R+LAFDPK
Sbjct  261   ITDLLGTPPPETIAGVRNDKARKYLMEMRKKSPVPFEQKFPNADPLALRLLQRLLAFDPK  320

Query  1314  DRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK  1135
             DRPTA+EALADP+F+ LA+VEREPS QP++++EFEFERRR+TK+DVRELIYREILEYHP+
Sbjct  321   DRPTAQEALADPFFKGLAKVEREPSCQPISRLEFEFERRRVTKDDVRELIYREILEYHPQ  380

Query  1134  MLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD  955
             +LK+++ GTE T F+YPSA+D+F+K FAYLEE++GK G V PPER+   SLPR +V  S 
Sbjct  381   LLKDYMNGTEGTHFLYPSAIDQFRKHFAYLEENHGKSGPVIPPERKHV-SLPRSTVHSST  439

Query  954   NSVQNPAEVANDLSKCSIKEGDRLDR----NSG--IPTTRLPLQVPQGDAARPGRIVSSV  793
                       +  +K   +E  ++ R    NSG  + ++R P +VP   AA+PGRIV  V
Sbjct  440   IPPSTQPSFTSYENKHMAEEASKVTRSVESNSGSQLRSSRPPPRVP---AAKPGRIVGPV  496

Query  792   MRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSR  676
             + Y++G   T  +  +QR   RN  T+PQ A+S   + R
Sbjct  497   LHYDNGR--TLKDTYDQRIFYRN--TLPQ-AVSPHCFHR  530


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR +KY+HT 
Sbjct  127   MESDLHQVIKANDDLTREHHQFFLYQMLRAMKYMHTA  163



>ref|NP_001043794.1| Os01g0665200 [Oryza sativa Japonica Group]
 dbj|BAF05708.1| Os01g0665200 [Oryza sativa Japonica Group]
 gb|EEC71229.1| hypothetical protein OsI_03169 [Oryza sativa Indica Group]
 gb|EEE55137.1| hypothetical protein OsJ_02925 [Oryza sativa Japonica Group]
Length=590

 Score =   393 bits (1010),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 206/375 (55%), Positives = 261/375 (70%), Gaps = 31/375 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  184   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGCIFAEILTGKPLFPGK  243

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + + RIRNEKARRYLSSMRKK+P+PFS +FP ADP AL LL+
Sbjct  244   NVVHQLDLMTDLLGTPSMDTVTRIRNEKARRYLSSMRKKQPVPFSERFPKADPAALKLLQ  303

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+ EREPS QP+TKMEFEFERR++TKEDV+ELI+R
Sbjct  304   RLLAFDPKDRPTAEEALADPYFKGLAKAEREPSCQPITKMEFEFERRKVTKEDVKELIFR  363

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSA+D F++QFA LEE+ GK G   P +R+   SLP
Sbjct  364   EILEYHPQLLKDYMNGTEKTNFLYPSALDNFRRQFANLEENGGKNGDAVPSDRKHV-SLP  422

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S                  I   D  +  S         QVPQ    R GR   
Sbjct  423   RTTTVHS----------------APIPPKDHQNITS---------QVPQRIPGRTGRGAC  457

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYA-ISNPSYSRRHPSCKNERGEDGNEGSN  622
              V+ + + SA+       QRR++RNP   P    +S  +Y R+  S + E  ++  +   
Sbjct  458   PVIPFENLSAMG---PYNQRRVVRNPVLPPATTNLSAYAYHRKSDSSERELQQELEKDRM  514

Query  621   TVPKPDQYMARKVAA  577
                  + +M  KV +
Sbjct  515   RYQPSEHFMDAKVVS  529


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  118   MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  154



>gb|ABF69963.1| mitogen-activated protein kinase (MAPK), putative [Musa acuminata]
Length=581

 Score =   393 bits (1009),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 225/398 (57%), Positives = 277/398 (70%), Gaps = 49/398 (12%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYT AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  169   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTTAIDIWSIGCIFAEVLTGKPLFPGK  228

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKAR+YLS+MRKK  +PFS KFPNADPLAL LLE
Sbjct  229   NVVHQLDLMTDLLGTPSLDTISRVRNEKARKYLSNMRKKLSVPFSQKFPNADPLALKLLE  288

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  289   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRLTKEDIRELIFR  348

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GT+  +F+YPSAVD+F+KQFAYLEE+ GK G V P +R+   SLP
Sbjct  349   EILEYHPQLLKDYMNGTQSANFLYPSAVDQFRKQFAYLEENGGKSGPVIPLDRKHV-SLP  407

Query  978   RPSVLYSDN--------------------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPT  859
             R +V++S                      + +NP +  N+ S  SI +  +  R   IPT
Sbjct  408   RSTVVHSATIPPMEQPNMGPSRDKQGTVEACKNPRD--NERSSGSIAKASQAQR---IPT  462

Query  858   TRLPLQVPQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYS  679
                         ARPG++V  V+ Y+SGS     +A + RR +RNP    Q AI  P + 
Sbjct  463   ------------ARPGKVVGPVVPYDSGS---MKDAYDPRRFIRNPVLPLQSAI--PPFC  505

Query  678   RRHPSCK-----NERGEDGNEGSNTVPKPDQYMARKVA  580
                P+ K      + GE   E     P P   +  K+A
Sbjct  506   FHGPAGKLGSSNRDPGEAEGESVQHKPPPHPCIPSKMA  543


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  103   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  139



>ref|XP_003551917.1| PREDICTED: mitogen-activated protein kinase 10-like [Glycine 
max]
Length=614

 Score =   394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 215/366 (59%), Positives = 283/366 (77%), Gaps = 15/366 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPK+RPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  295   KLLAFDPKNRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVMPLDRKHV-SLP  412

Query  978   RPSVLYSDNSVQNPAE---VANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQG-DAARPG  811
             R ++++S N+V +P E   +A+  ++ + +E ++  R++ IP  R  +Q PQ    A+PG
Sbjct  413   RSTIVHS-NTV-HPKEQTNIASSKNRPTAEEYNKHPRDTEIPVPR-SMQGPQRIPLAKPG  469

Query  810   RIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNE  631
             ++V  V+ Y  G+ V   ++ + R  +R  + +P   +    Y +R  +   ER     E
Sbjct  470   KVVGPVVPYEYGNIV--KDSYDPRSFIRG-SVLPTQPVPPAYYYQRSSTGNQER--PSTE  524

Query  630   GSNTVP  613
                +VP
Sbjct  525   ADKSVP  530


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>gb|KEH21420.1| MAP kinase-like protein [Medicago truncatula]
Length=600

 Score =   394 bits (1011),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 216/244 (89%), Gaps = 1/244 (0%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             +SF++  +T +  DYVATRWYRAPELCGSFFSKYTP IDIWSIGCIFAE+LTG+PLFPGK
Sbjct  268   VSFNDAPSTIFWTDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGRPLFPGK  327

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLD+MTDLLGTP PE+IARIRNEKARRYL+SMRKK+P+PFS KFPN DPLAL +LE
Sbjct  328   NVVHQLDIMTDLLGTPPPESIARIRNEKARRYLNSMRKKQPVPFSQKFPNIDPLALRILE  387

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPK+RP+AEEAL+DPYF  L+ ++REPS  P++K+EFEFERR++TK+DVRELIYR
Sbjct  388   RLLAFDPKNRPSAEEALSDPYFHGLSNIDREPSTHPISKLEFEFERRKVTKDDVRELIYR  447

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP+ML+E+I G + TSFMYPS VD+FK+QFA+LEEHYGK G    P ++Q +SLP
Sbjct  448   EILEYHPQMLEEYIRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKKGERISPLQRQHASLP  507

Query  978   RPSV  967
             R  V
Sbjct  508   RERV  511


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKAN DLTP+H+QFFLYQLLRGLK+IHT 
Sbjct  202   MESDLHQVIKANHDLTPQHHQFFLYQLLRGLKFIHTA  238



>ref|XP_003569512.1| PREDICTED: mitogen-activated protein kinase 8 isoform X1 [Brachypodium 
distachyon]
Length=580

 Score =   393 bits (1009),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 201/348 (58%), Positives = 253/348 (73%), Gaps = 37/348 (11%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+ AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  177   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSRAIDIWSIGCIFAEILTGKPLFPGK  236

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+ + FS +FP ADP AL LL+
Sbjct  237   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQSVSFSERFPKADPAALKLLQ  296

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L +VEREPS QP+TKMEFEFER+ +TK DV+ELI+R
Sbjct  297   RLLAFDPKDRPTAEEALADPYFKGLGKVEREPSCQPITKMEFEFERKNVTKADVKELIFR  356

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GKGG V PP+R+   SLP
Sbjct  357   EILEYHPQLLKDYMNGTEKTNFLYPSAVDNFRRQFANLEENGGKGGAVVPPDRKHV-SLP  415

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S                  I   D+         +++P ++P G   RPGR+V 
Sbjct  416   RNTTVHS----------------TPIPPKDQ-------KYSQVPQRIPTG---RPGRVVG  449

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNP------TTMPQYAISNPSYSRR  673
              V+ + + S +   +   QRR+ RNP      T +  YA  N   S R
Sbjct  450   PVIPFENSSTM---DPYSQRRVARNPVLPAAATNLSAYAYRNSDNSER  494


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  111   MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  147



>dbj|BAJ96852.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97013.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=584

 Score =   393 bits (1009),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/353 (57%), Positives = 256/353 (73%), Gaps = 38/353 (11%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+PAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  180   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSPAIDIWSIGCIFAEILTGKPLFPGK  239

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+ + FS +FP ADP AL L++
Sbjct  240   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQTVCFSERFPKADPAALKLMQ  299

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L +VEREPS QP++K EFEFER+++TKEDV+ELI+R
Sbjct  300   RLLAFDPKDRPTAEEALADPYFKGLGKVEREPSCQPISKFEFEFERKKVTKEDVKELIFR  359

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GKGG V P +R+   SLP
Sbjct  360   EILEYHPQLLKDYMNGTEKTNFLYPSAVDNFRRQFANLEENGGKGGAVVPSDRKHV-SLP  418

Query  978   RPSVLYSD---NSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGR  808
             R + ++S       Q P++V                          P ++P G   RPGR
Sbjct  419   RTTTVHSTPIPPKDQKPSQV--------------------------PQRIPTG---RPGR  449

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER  649
             +V  V+ + +  A+   +   QRR+ RNP  +P  A +  +Y+    S   ER
Sbjct  450   VVGPVIPFENSCAM---DPYSQRRVARNP-VLPAAATNLSAYAYHRKSDNTER  498


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  114   MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  150



>gb|EYU31578.1| hypothetical protein MIMGU_mgv1a003659mg [Erythranthe guttata]
Length=571

 Score =   392 bits (1007),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 216/366 (59%), Positives = 266/366 (73%), Gaps = 36/366 (10%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWS+GCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDL+TDLLGTPS + I+R+RN+KARRYL+SMRKK+P+PFS+KFPNADPL+L LLE
Sbjct  235   NVVHQLDLITDLLGTPSMDTISRVRNDKARRYLTSMRKKQPVPFSHKFPNADPLSLRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPKDRPTAEEAL DPYF+ L RV+REPSAQP++KMEFEFERR++TKED+RELI+R
Sbjct  295   KLLAFDPKDRPTAEEALGDPYFKGLTRVDREPSAQPISKMEFEFERRKVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I G E T+F+YPSAVD+FKKQFA+LEEH GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYINGIEGTTFLYPSAVDQFKKQFAHLEEHSGKSGPVIPLERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R +VL+S     N A   N  +   I        NS   T + P ++PQ   A+PG++V 
Sbjct  414   RSTVLHS-----NTAPPKNQTTVDGI-------HNSLSRTLQPPQRIPQ--LAKPGKVVG  459

Query  798   SVM-----RYN-SGSAVTASEAIEQRRMLRNPTTM-----------PQYAI---SNPSYS  679
              V+      YN S +        E RR L  PT             P  AI   +NP Y+
Sbjct  460   PVIPSASYSYNRSSTGKPERSTAEIRRELPPPTKQIPSCAMAAKLAPDIAINIDTNPFYT  519

Query  678   RRHPSC  661
                P+ 
Sbjct  520   MTRPAV  525


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_010232110.1| PREDICTED: mitogen-activated protein kinase 8 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010232111.1| PREDICTED: mitogen-activated protein kinase 8 isoform X2 [Brachypodium 
distachyon]
Length=566

 Score =   392 bits (1006),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/348 (58%), Positives = 253/348 (73%), Gaps = 37/348 (11%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFF+KY+ AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFTKYSRAIDIWSIGCIFAEILTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + ++RIRNEKARRYLSSMRKK+ + FS +FP ADP AL LL+
Sbjct  223   NVVHQLDLMTDLLGTPSLDTVSRIRNEKARRYLSSMRKKQSVSFSERFPKADPAALKLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ L +VEREPS QP+TKMEFEFER+ +TK DV+ELI+R
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLGKVEREPSCQPITKMEFEFERKNVTKADVKELIFR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD F++QFA LEE+ GKGG V PP+R+   SLP
Sbjct  343   EILEYHPQLLKDYMNGTEKTNFLYPSAVDNFRRQFANLEENGGKGGAVVPPDRKHV-SLP  401

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVS  799
             R + ++S                  I   D+         +++P ++P G   RPGR+V 
Sbjct  402   RNTTVHS----------------TPIPPKDQ-------KYSQVPQRIPTG---RPGRVVG  435

Query  798   SVMRYNSGSAVTASEAIEQRRMLRNP------TTMPQYAISNPSYSRR  673
              V+ + + S +   +   QRR+ RNP      T +  YA  N   S R
Sbjct  436   PVIPFENSSTM---DPYSQRRVARNPVLPAAATNLSAYAYRNSDNSER  480


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             M++DLHQVIKANDDLT EH+QFFLYQ+LR LKYIHT 
Sbjct  97    MDTDLHQVIKANDDLTKEHHQFFLYQMLRALKYIHTA  133



>ref|XP_010657062.1| PREDICTED: mitogen-activated protein kinase 9 isoform X3 [Vitis 
vinifera]
Length=515

 Score =   390 bits (1002),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 219/263 (83%), Gaps = 5/263 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             +SF++  +T +  DYVATRWYRAPELCG FFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  166   VSFNDTPSTIFWTDYVATRWYRAPELCGCFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGK  225

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVV QLDLMTDLLGTPS E+IARIRNEKA+RYL++MRKK PIPFS KFPNADPLA+ LLE
Sbjct  226   NVVQQLDLMTDLLGTPSYESIARIRNEKAKRYLNNMRKKSPIPFSQKFPNADPLAVRLLE  285

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPK+RP+AEEALADPYF  LA  + EP  QP++K  FEFERRR+TKEDVRELIYR
Sbjct  286   RLLAFDPKNRPSAEEALADPYFHGLANADYEPCTQPISKFLFEFERRRMTKEDVRELIYR  345

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP+ML+E+++GT+ TSFMYPS VD+FK+QFA+LEEH+GKG   AP  RQ A SLP
Sbjct  346   EILEYHPQMLQEYLQGTDLTSFMYPSGVDRFKQQFAHLEEHHGKGERTAPRLRQHA-SLP  404

Query  978   RPSVLYSDNSVQNPAEVANDLSK  910
             R  V      + +P    ND  K
Sbjct  405   RERVC---APIDDPVSQTNDFEK  424


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  100   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  136



>ref|XP_011009092.1| PREDICTED: mitogen-activated protein kinase 19 isoform X1 [Populus 
euphratica]
Length=598

 Score =   393 bits (1009),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 212/394 (54%), Positives = 267/394 (68%), Gaps = 27/394 (7%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYT AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFSDTPTTVFWTDYVATRWYRAPELCGSFFSKYTRAIDIWSIGCIFAEVLTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPS E I+R+RN+KAR+YL+ MRKK+P+PF+ KFPNADPLA  LL+
Sbjct  223   SVVHQLDLITDLLGTPSLETISRVRNDKARKYLTEMRKKQPVPFANKFPNADPLAHRLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+ K+EFEFERRR+TKEDVREL+YR
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPIMKLEFEFERRRVTKEDVRELLYR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ G E T+F+YPSA+  F+KQFAYLEE+ G+   V P ER+   SLP
Sbjct  343   EILEYHPQLLKDYMNGNESTNFLYPSAIGHFRKQFAYLEENSGRSAPVIPLERKHV-SLP  401

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTT---------RLPLQVPQGD  826
             R S ++S+   +N    +       + E D   +N  +  T         R P ++P   
Sbjct  402   R-STVHSNTIPRNMQSNSTSFDNRRVTEDD--SKNLRVQDTSFENPAKVARPPPRMPS--  456

Query  825   AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQ----YAISNPSYSRRHPSCK  658
             AA+PGR+V SV+ Y +G  V   +    R   RN    PQ    +     + +       
Sbjct  457   AAKPGRVVGSVVPYENGRNV--KDLYGTRMFCRNAVLPPQTSSPHCFLRTNNTLIQAKSI  514

Query  657   NERGEDGNEGS-----NTVPKPDQYMARKVAAAP  571
             +E G+D          N   KP   MA  V   P
Sbjct  515   SETGKDSQTKQQPPKCNVAAKPSSGMAMDVNTNP  548


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  97    MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  133



>ref|XP_004503294.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X1 
[Cicer arietinum]
Length=591

 Score =   392 bits (1008),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTP IDIWSIGCIFAE+LTG+PLFPGKNVVHQLD+MT
Sbjct  263   FWTDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGRPLFPGKNVVHQLDIMT  322

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE+IARIRNEKARRYL+SMRKK+P+PFS KFPN DPLAL +LER+LAFDPK+R
Sbjct  323   DLLGTPPPESIARIRNEKARRYLNSMRKKQPVPFSQKFPNIDPLALRILERLLAFDPKNR  382

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEAL+DPYF  L+ ++REPS  P++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  383   PSAEEALSDPYFHGLSNIDREPSTHPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  442

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG   +P +RQ A SLPR  V
Sbjct  443   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERSSPLQRQHA-SLPRERV  495


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLRGLK+IHT 
Sbjct  187   MESDLHQVIKANDDLTPEHHQFFLYQLLRGLKFIHTA  223



>gb|ABE80150.1| Serine/threonine protein kinase, active site [Medicago truncatula]
 gb|AET05561.2| MAP kinase-like protein [Medicago truncatula]
Length=606

 Score =   393 bits (1009),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 180/244 (74%), Positives = 216/244 (89%), Gaps = 1/244 (0%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             +SF++  +T +  DYVATRWYRAPELCGSFFSKYTP IDIWSIGCIFAE+LTG+PLFPGK
Sbjct  268   VSFNDAPSTIFWTDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGRPLFPGK  327

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLD+MTDLLGTP PE+IARIRNEKARRYL+SMRKK+P+PFS KFPN DPLAL +LE
Sbjct  328   NVVHQLDIMTDLLGTPPPESIARIRNEKARRYLNSMRKKQPVPFSQKFPNIDPLALRILE  387

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPK+RP+AEEAL+DPYF  L+ ++REPS  P++K+EFEFERR++TK+DVRELIYR
Sbjct  388   RLLAFDPKNRPSAEEALSDPYFHGLSNIDREPSTHPISKLEFEFERRKVTKDDVRELIYR  447

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP+ML+E+I G + TSFMYPS VD+FK+QFA+LEEHYGK G    P ++Q +SLP
Sbjct  448   EILEYHPQMLEEYIRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKKGERISPLQRQHASLP  507

Query  978   RPSV  967
             R  V
Sbjct  508   RERV  511


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKAN DLTP+H+QFFLYQLLRGLK+IHT 
Sbjct  202   MESDLHQVIKANHDLTPQHHQFFLYQLLRGLKFIHTA  238



>ref|XP_004503295.1| PREDICTED: mitogen-activated protein kinase 9-like isoform X2 
[Cicer arietinum]
Length=590

 Score =   392 bits (1007),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/234 (76%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTP IDIWSIGCIFAE+LTG+PLFPGKNVVHQLD+MT
Sbjct  263   FWTDYVATRWYRAPELCGSFFSKYTPGIDIWSIGCIFAEMLTGRPLFPGKNVVHQLDIMT  322

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE+IARIRNEKARRYL+SMRKK+P+PFS KFPN DPLAL +LER+LAFDPK+R
Sbjct  323   DLLGTPPPESIARIRNEKARRYLNSMRKKQPVPFSQKFPNIDPLALRILERLLAFDPKNR  382

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEAL+DPYF  L+ ++REPS  P++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  383   PSAEEALSDPYFHGLSNIDREPSTHPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  442

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TSFMYPS VD+FK+QFA+LEEHYGKG   +P +RQ A SLPR  V
Sbjct  443   QEYLRGGDQTSFMYPSGVDRFKRQFAHLEEHYGKGERSSPLQRQHA-SLPRERV  495


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEH+QFFLYQLLRGLK+IHT 
Sbjct  187   MESDLHQVIKANDDLTPEHHQFFLYQLLRGLKFIHTA  223



>ref|XP_006377705.1| mitogen-activated protein kinase homologue [Populus trichocarpa]
 gb|ERP55502.1| mitogen-activated protein kinase homologue [Populus trichocarpa]
Length=596

 Score =   392 bits (1008),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 216/395 (55%), Positives = 271/395 (69%), Gaps = 31/395 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYT AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  163   VAFSDTPTTVFWTDYVATRWYRAPELCGSFFSKYTRAIDIWSIGCIFAEVLTGKPLFPGK  222

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPS E I+R+RN+KAR+YL+ MRKK+P+PF+ KFPNADP A  LL+
Sbjct  223   SVVHQLDLITDLLGTPSLETISRVRNDKARKYLTEMRKKQPVPFAQKFPNADPSAHRLLQ  282

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TK+EFEFERRR+TKEDVREL+YR
Sbjct  283   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKLEFEFERRRVTKEDVRELLYR  342

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ G E T+F+YPSA+  F+KQFAYLEE+ G+   V P ER+   SLP
Sbjct  343   EILEYHPQLLKDYMNGNESTNFLYPSAIGHFRKQFAYLEENSGRSAPVIPLERKHV-SLP  401

Query  978   R---------PSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGD  826
             R         P++  +  S  N  +V  D SK +++  D    N      R P ++P   
Sbjct  402   RCTVHSNTMPPNMQLNSTSFDN-RQVTEDASK-NLRVQDTSFENPA-KVARPPPRMP---  455

Query  825   AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER-  649
             +A+PGR+V SV+ Y +G  V   +  + R   RN    PQ   S+P    R  +   E+ 
Sbjct  456   SAKPGRVVGSVVPYENGRNV--KDLYDTRMFCRNAVLPPQ--TSSPHCFLRTNTLIQEKS  511

Query  648   -GEDGNEG--------SNTVPKPDQYMARKVAAAP  571
               E G +          N   KP   MA  V   P
Sbjct  512   ISETGKDSQTKQQPPKCNVAAKPSSGMAMDVNTNP  546


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  97    MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  133



>ref|XP_004241638.1| PREDICTED: mitogen-activated protein kinase 9 isoform X2 [Solanum 
lycopersicum]
Length=518

 Score =   390 bits (1001),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 208/235 (89%), Gaps = 2/235 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE IA+IRNEKARRYL +MRKK P+PF+ KFP+ DPLAL LLERMLAFDPKDR
Sbjct  245   DLLGTPPPETIAKIRNEKARRYLGNMRKKTPVPFAQKFPHVDPLALRLLERMLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYFR+L+ V+REPS  P++K+EFEFERR++ KEDVRELIYREILEYHP+ML
Sbjct  305   PSAEEALADPYFRSLSNVDREPSTHPISKLEFEFERRKLAKEDVRELIYREILEYHPQML  364

Query  1128  KEFIEGTEPTS-FMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TS FMYPS VD+FK+QFA+LEEHYGKG    P +RQ A SLPR  V
Sbjct  365   QEYLRGGDQTSGFMYPSGVDRFKRQFAHLEEHYGKGERSTPLQRQHA-SLPRERV  418


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQL+RGLKY HT 
Sbjct  109   MESDLHQVIKANDDLTPEHYQFFLYQLMRGLKYTHTA  145



>gb|KHF98072.1| Mitogen-activated protein kinase 20 [Gossypium arboreum]
Length=606

 Score =   392 bits (1008),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 270/368 (73%), Gaps = 21/368 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS + I+R+RNEKARRYL+SMRKK+PIPF  KFPNADPLAL LL+R+LAFDPKDR
Sbjct  245   DLLGTPSLDTISRVRNEKARRYLTSMRKKQPIPFEQKFPNADPLALRLLQRLLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LARVEREPS QP+TKMEFEFERRR+TK+D++ELI+REILEYHP++L
Sbjct  305   PTAEEALADPYFKGLARVEREPSCQPITKMEFEFERRRVTKDDIQELIFREILEYHPQLL  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             K+ + GTE T+F+YPSAVD+FKKQFA+LEE+ GK   V P ER+   SLPR ++++S+  
Sbjct  365   KDHMNGTERTNFLYPSAVDQFKKQFAHLEENGGKSAPVIPLERKHV-SLPRSTIVHSNTI  423

Query  948   VQNPAEVANDLSKCSIKEGDRLDR-----NSGIPTTRLPLQVPQGDAARPGRIVSSVMRY  784
                P E    L   S+KE    +       S     R+PL       A+PG+IV  V+ Y
Sbjct  424   A--PKEQQPSLK--SLKERQNAEEAYQASKSLQAQQRIPL-------AKPGKIVGPVVLY  472

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPD  604
              +G+ +   +A + R  +R+ T +P  A+ +P+Y+    +  N+   +    S     P 
Sbjct  473   ENGTIM--KDAYDTRTFIRS-TGLPPQAV-HPAYTYSKSNTGNQERSERELPSQAKQGPQ  528

Query  603   QYMARKVA  580
               MA K +
Sbjct  529   CSMAAKFS  536


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_004143173.1| PREDICTED: mitogen-activated protein kinase 20-like [Cucumis 
sativus]
 gb|KGN47041.1| hypothetical protein Csa_6G179480 [Cucumis sativus]
Length=620

 Score =   393 bits (1009),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 209/343 (61%), Positives = 262/343 (76%), Gaps = 20/343 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+L GKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLMGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL++MRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTTMRKKQPVPFSQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA++EREPS QP+TKMEFEFERRR+TKED++ELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPITKMEFEFERRRVTKEDIQELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK   V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENGGKSAPVIPLDRKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEG----DRLDRNSGIPTTRL-----PLQVPQGD  826
             R +V++S     NP    + ++   +++G    D   +NS     RL      +Q PQ  
Sbjct  414   RSTVVHS-----NPVYSKDQVNNIPLQDGKISEDAYSKNSRDSEGRLTNISRTMQAPQKI  468

Query  825   --AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQY  703
               AA+PGR+V  V+   +G  V   E  + R ++R     P Y
Sbjct  469   PFAAKPGRVVGPVIADENGRLV--KEPYDPRTLIRGAILPPAY  509


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>gb|AET36534.1| mitogen-activated protein kinase [Gossypium hirsutum]
 gb|AFU83097.1| mitogen-activated protein kinase 20 [Gossypium hirsutum]
Length=606

 Score =   392 bits (1006),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 217/368 (59%), Positives = 269/368 (73%), Gaps = 21/368 (6%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  185   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNVVHQLDLMT  244

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTPS + I+R+RNEKARRYL+SMRKK+PIPF  KFPNADPLAL LL+R+LAFDPKDR
Sbjct  245   DLLGTPSLDTISRVRNEKARRYLTSMRKKQPIPFEQKFPNADPLALRLLQRLLAFDPKDR  304

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEALADPYF+ LARVEREPS QP+TKMEFEFERRR+TK+D++ELI+REILEYHP++L
Sbjct  305   PTAEEALADPYFKGLARVEREPSCQPITKMEFEFERRRVTKDDIQELIFREILEYHPQLL  364

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             K+ + GTE T+F+YPSAVD+FKKQFA+LEE+ GK   V P ER+   SLPR ++++S+  
Sbjct  365   KDHMNGTERTNFLYPSAVDQFKKQFAHLEENGGKSAPVIPLERKHV-SLPRSTIVHSNTI  423

Query  948   VQNPAEVANDLSKCSIKEGDRLDR-----NSGIPTTRLPLQVPQGDAARPGRIVSSVMRY  784
                P E    L   S+KE    +       S     R+PL       A+PG+IV  V  Y
Sbjct  424   A--PKEQQPSLK--SLKERQNAEEAYQASKSLQAQQRIPL-------AKPGKIVGPVALY  472

Query  783   NSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEGSNTVPKPD  604
              +G+ +   +A + R  +R+ T +P  A+ +P+Y+    +  N+   +    S     P 
Sbjct  473   ENGTIM--KDAYDTRTFIRS-TGLPPQAV-HPAYTYSKSNTGNQERSERELPSQAKQGPQ  528

Query  603   QYMARKVA  580
               MA K +
Sbjct  529   CSMAAKFS  536


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_010657027.1| PREDICTED: mitogen-activated protein kinase 9 isoform X2 [Vitis 
vinifera]
Length=574

 Score =   390 bits (1003),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 219/263 (83%), Gaps = 5/263 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             +SF++  +T +  DYVATRWYRAPELCG FFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  263   VSFNDTPSTIFWTDYVATRWYRAPELCGCFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGK  322

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVV QLDLMTDLLGTPS E+IARIRNEKA+RYL++MRKK PIPFS KFPNADPLA+ LLE
Sbjct  323   NVVQQLDLMTDLLGTPSYESIARIRNEKAKRYLNNMRKKSPIPFSQKFPNADPLAVRLLE  382

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPK+RP+AEEALADPYF  LA  + EP  QP++K  FEFERRR+TKEDVRELIYR
Sbjct  383   RLLAFDPKNRPSAEEALADPYFHGLANADYEPCTQPISKFLFEFERRRMTKEDVRELIYR  442

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP+ML+E+++GT+ TSFMYPS VD+FK+QFA+LEEH+GKG   AP  RQ A SLP
Sbjct  443   EILEYHPQMLQEYLQGTDLTSFMYPSGVDRFKQQFAHLEEHHGKGERTAPRLRQHA-SLP  501

Query  978   RPSVLYSDNSVQNPAEVANDLSK  910
             R  V      + +P    ND  K
Sbjct  502   RERVC---APIDDPVSQTNDFEK  521


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  197   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  233



>emb|CDP06180.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 266/340 (78%), Gaps = 19/340 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTVFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSMDTISRVRNDKARRYLTSMRKKQPVPFSQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPKDRPTAEEALADPYFR LA+VEREPS  P++KMEFEFERRR+TKEDVRELI+R
Sbjct  295   KLLAFDPKDRPTAEEALADPYFRGLAKVEREPSCLPISKMEFEFERRRVTKEDVRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ G E T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  355   EILEYHPQLLKDYMNGIERTNFLYPSAVDQFRKQFAHLEENGGKNGTVIPFERKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGD----RLDRNS-GIP-----TTRLPLQVPQG  829
             R ++++S N+V  P E     +    + G+    R  R+S G+P     T +   ++PQ 
Sbjct  414   RSTIVHS-NAVP-PKEQLRAPTLKDRQNGEEPCCRNPRDSDGLPGSLSRTLQTQQRIPQ-  470

Query  828   DAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMP  709
               A+PG+ V  V+ Y +G+     EA + R ++RNP   P
Sbjct  471   --AKPGKAVGPVLPYENGTV--NKEAYDPRTVVRNPVLQP  506


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>ref|XP_011082811.1| PREDICTED: mitogen-activated protein kinase 19 isoform X1 [Sesamum 
indicum]
Length=625

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 217/380 (57%), Positives = 280/380 (74%), Gaps = 21/380 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  176   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  235

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPS + IA +RNEKAR+YL+ MR+K+P+PF+ KFPNADPLAL LL+
Sbjct  236   SVVHQLDLITDLLGTPSADTIAGVRNEKARKYLTEMRRKRPVPFAEKFPNADPLALKLLQ  295

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRP+AEEALADPYF+ LA++EREPS QP++K+EFEFERRR+TKED+RELI+R
Sbjct  296   RLLAFDPKDRPSAEEALADPYFKGLAKIEREPSCQPISKLEFEFERRRVTKEDIRELIFR  355

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GT  TSF+YPSA+  FKKQFAYLEE+ GK G V PPER+   SLP
Sbjct  356   EILEYHPQLLKDYMAGTGGTSFLYPSAIGHFKKQFAYLEENVGKSGPVIPPERKHV-SLP  414

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNSGI------PTTRLPLQVPQGDAAR  817
             R ++    NS   P +   ++S    ++    + ++G+        +R P +VP G  A+
Sbjct  415   RSTI----NSCTIPPKTQPNVSAVDNRQITG-ETSAGVISGNISKVSRPPPRVPNGIEAK  469

Query  816   PGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNE---RG  646
             PGR+V  V+ Y +  ++  S   + R  ++N + +PQ +IS P    R  S KNE   R 
Sbjct  470   PGRVVGPVLPYENVRSLRDSH--DGRAYIQN-SLIPQ-SIS-PHCFYRTNSGKNEEKFRM  524

Query  645   EDGNEGSNTVPKPDQYMARK  586
             E G E S     P Q++  K
Sbjct  525   ESGIEASQVKQPPKQFIPVK  544


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH++FFLYQ+LR LKY+HT 
Sbjct  110   MESDLHQVIKANDDLTHEHHRFFLYQMLRALKYMHTA  146



>ref|XP_006644399.1| PREDICTED: mitogen-activated protein kinase 10-like [Oryza brachyantha]
Length=612

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 210/341 (62%), Positives = 261/341 (77%), Gaps = 16/341 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYLSSMRKK+PI FS KFP+ADPLAL LL+
Sbjct  235   NVVHQLDLMTDLLGTPSMDTISRVRNEKARRYLSSMRKKEPILFSQKFPSADPLALDLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPKDRPTAEEALA PYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   KLLAFDPKDRPTAEEALAHPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++  GTE T+F+YPSAVD+F+KQFA+LEE+ G G V+  P  ++ +SLP
Sbjct  355   EILEYHPQLLKDYTNGTERTTFLYPSAVDQFRKQFAHLEENSGNGPVI--PMDRKHTSLP  412

Query  978   RPSVLYS-----DNSVQNPAEVANDLSKCSIKEGDRLDRNSGIP--TTRLPLQVPQGDAA  820
             R +++++         +N       LS  +       DR SG    T++ P +VP    A
Sbjct  413   RSTIVHTTPIPAKEQPRNGLSRDKPLSDETYNNPREFDRFSGSAPRTSQAPQRVP---TA  469

Query  819   RPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAI  697
             RPGR+V  V+ Y +G+   A ++ E RR+  N    PQ  I
Sbjct  470   RPGRVVGPVLPYENGA---AKDSYEARRLAMNSGYPPQQQI  507


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_011044799.1| PREDICTED: mitogen-activated protein kinase 20-like [Populus 
euphratica]
Length=623

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 215/363 (59%), Positives = 271/363 (75%), Gaps = 26/363 (7%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++  +T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE++TGKPLFPGK
Sbjct  176   VAFNDTPSTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVITGKPLFPGK  235

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL+SMRKK P+PF+ KFPNADPLALCLLE
Sbjct  236   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTSMRKKAPVPFAQKFPNADPLALCLLE  295

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEAL DPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  296   RLLAFDPKDRPTAEEALGDPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEDIRELIFR  355

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++  GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P ER+   SLP
Sbjct  356   EILEYHPQLLKDYANGTERTNFLYPSAVDQFRKQFAHLEENGGKSGPVIPLERKHV-SLP  414

Query  978   RPSVLYSDN----SVQNPAEVANDLSKCSIKEGDRLDRNSGIPTT---------RLPLQV  838
             R +V++S +      QN A   +  S   +   +  D   GIP           R+PL  
Sbjct  415   RSTVVHSSSIPSKEQQNLASFKDRHSTEEVYNKNPRD-AEGIPVNISRTLQAQQRIPL--  471

Query  837   PQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCK  658
                  A+PG++V SV+ Y +GS     +A + R  +++ T +P   + +    R+  + K
Sbjct  472   -----AKPGKVVGSVVPYENGS--IRKDAYDPRTYMKS-TVLPLQPVPSAYCYRKSSTGK  523

Query  657   NER  649
              ER
Sbjct  524   LER  526


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  110   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  146



>ref|XP_008449538.1| PREDICTED: mitogen-activated protein kinase 15 isoform X1 [Cucumis 
melo]
Length=606

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 290/400 (73%), Gaps = 36/400 (9%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             N+VHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+PI FS KFPNADPLAL LL+
Sbjct  235   NIVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPISFSQKFPNADPLALQLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP++K+EFEFERR++TK+D+RELI+ 
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPISKVEFEFERRKVTKDDIRELIFL  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE ++F+YPSA+D+FKKQFA+LE++ GK G V P ER+ A SLP
Sbjct  355   EILEYHPQLLKDYLNGTERSNFLYPSALDQFKKQFAHLEDNGGKSGPVYPLERKHA-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKE--------GDRLDRNSGIPTTRLPLQVPQGDA  823
             R SV    N++  P +V +++   S K+        G +L ++S                
Sbjct  414   RSSV--QSNTI--PPKVTSNI--VSFKDRYAPSGPFGSQLYKDSAAQRI-------AAAQ  460

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKN-ERG  646
             A+PGRI   VM Y+SGS  T  +A + R ++R  + +P +AI +P+Y  +    +N ER 
Sbjct  461   AKPGRISGPVMPYDSGS--TIKDAYDPRMLIR--SALPSHAI-HPTYYYQQSCGQNEERS  515

Query  645   EDGNEGSNTV---PKPDQYMARKV----AAAPGGSGNQWY  547
               G E   ++     P   MA K+    AAA G   N ++
Sbjct  516   ATGAEQDTSMQCKQSPQCGMAAKLAGDTAAASGAFSNSFF  555


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_010657002.1| PREDICTED: mitogen-activated protein kinase 9 isoform X1 [Vitis 
vinifera]
Length=612

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 219/263 (83%), Gaps = 5/263 (2%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             +SF++  +T +  DYVATRWYRAPELCG FFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  263   VSFNDTPSTIFWTDYVATRWYRAPELCGCFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGK  322

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVV QLDLMTDLLGTPS E+IARIRNEKA+RYL++MRKK PIPFS KFPNADPLA+ LLE
Sbjct  323   NVVQQLDLMTDLLGTPSYESIARIRNEKAKRYLNNMRKKSPIPFSQKFPNADPLAVRLLE  382

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPK+RP+AEEALADPYF  LA  + EP  QP++K  FEFERRR+TKEDVRELIYR
Sbjct  383   RLLAFDPKNRPSAEEALADPYFHGLANADYEPCTQPISKFLFEFERRRMTKEDVRELIYR  442

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP+ML+E+++GT+ TSFMYPS VD+FK+QFA+LEEH+GKG   AP  RQ A SLP
Sbjct  443   EILEYHPQMLQEYLQGTDLTSFMYPSGVDRFKQQFAHLEEHHGKGERTAPRLRQHA-SLP  501

Query  978   RPSVLYSDNSVQNPAEVANDLSK  910
             R  V      + +P    ND  K
Sbjct  502   RERVC---APIDDPVSQTNDFEK  521


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLR LKYIHT 
Sbjct  197   MESDLHQVIKANDDLTPEHYQFFLYQLLRALKYIHTA  233



>ref|XP_009416542.1| PREDICTED: mitogen-activated protein kinase 10-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   391 bits (1004),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 217/367 (59%), Positives = 266/367 (72%), Gaps = 44/367 (12%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYT AIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTTAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKAR+YLS+MRKK  +PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNEKARKYLSNMRKKLSVPFSQKFPNADPLALKLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKED+RELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRLTKEDIRELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GT+  +F+YPSAVD+F+KQFAYLEE+ GK G V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTQSANFLYPSAVDQFRKQFAYLEENGGKSGPVIPLDRKHV-SLP  413

Query  978   RPSVLYSDN--------------------SVQNPAEVANDLSKCSIKEGDRLDRNSGIPT  859
             R +V++S                      + +NP +  N+ S  SI +  +  R   IPT
Sbjct  414   RSTVVHSATIPPMEQPNMGPSRDKQGTVEACKNPRD--NERSSGSIAKASQAQR---IPT  468

Query  858   TRLPLQVPQGDAARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYS  679
                         ARPG++V  V+ Y+ GS     +A + RR +RNP    Q AI  P + 
Sbjct  469   ------------ARPGKVVGPVVPYDIGS---MKDAYDPRRFIRNPVLPLQSAI--PPFC  511

Query  678   RRHPSCK  658
                P+ K
Sbjct  512   FHGPAGK  518


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



>gb|KDO52123.1| hypothetical protein CISIN_1g008729mg [Citrus sinensis]
Length=414

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/241 (74%), Positives = 214/241 (89%), Gaps = 2/241 (1%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPMTVFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             +VVHQLDL+TDLLGTPSPE IA +RNEKAR+YL+ MRKK P+P   KFPN DPLAL LL+
Sbjct  235   SVVHQLDLITDLLGTPSPETIAVVRNEKARKYLTEMRKKPPVPLFQKFPNVDPLALRLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R++AFDPKDRPTAEEALADPYF+ LA++EREPS QP++K+EFEFERRR+TK+D+RELIYR
Sbjct  295   RLIAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPISKLEFEFERRRVTKDDIRELIYR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK++I GTE T+F+YPSA+ +F+KQFAYLEE+ G+ G V PPER+   SLP
Sbjct  355   EILEYHPQLLKDYINGTEGTNFLYPSAIGQFRKQFAYLEENGGRSGPVIPPERKHV-SLP  413

Query  978   R  976
             R
Sbjct  414   R  414


 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EH+QFFLYQ+LR LKY+HT 
Sbjct  109   MESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTA  145



>gb|KDO60939.1| hypothetical protein CISIN_1g0070502mg, partial [Citrus sinensis]
Length=612

 Score =   391 bits (1005),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 281/382 (74%), Gaps = 18/382 (5%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++F++   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  167   VAFNDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  226

Query  1518  NVVHQLDLMTDLLGTPSPEAIARI-RNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLL  1342
             NVVHQLDLMTDLLGTPS + I+R+ RN+KARRYL+SMRKK+P+ FS KFPNADP AL LL
Sbjct  227   NVVHQLDLMTDLLGTPSLDTISRVVRNDKARRYLTSMRKKQPVQFSQKFPNADPSALRLL  286

Query  1341  ERMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIY  1162
             ER+LAFDPKDRPTAEEALADPYF+ L++VEREPS QP++KMEFEFERRR+TKED+RELI+
Sbjct  287   ERLLAFDPKDRPTAEEALADPYFKGLSKVEREPSCQPISKMEFEFERRRVTKEDIRELIF  346

Query  1161  REILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSL  982
             REILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V PPER+   SL
Sbjct  347   REILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENVGKSGPVIPPERKHV-SL  405

Query  981   PRPSVLYSDNSVQNPAEVANDLSKCSIKEGDRLDRNS----GIPTT---RLPLQVPQGDA  823
             PR ++++S N+V  P +   +LS+      +  ++NS    GIP      LP Q  +   
Sbjct  406   PRSTIVHS-NTV--PPKEQQNLSRDRQAAEEVFNKNSKESEGIPANLSRTLPAQ-QRFPL  461

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGE  643
             A+PG++V  V+ Y + S     +A + R  +R+ T +PQ AI      R+  + K E   
Sbjct  462   AKPGKVVGPVVPYENASV--RRDAYDPRTFIRS-TVLPQ-AIPAAYCYRKSSTGKQEMDS  517

Query  642   DGNEGSNTVPKPDQYMARKVAA  577
             +    S     P   MA K A 
Sbjct  518   EREMPSQVKHVPQCGMAAKFAT  539


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  101   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  137



>ref|XP_003519551.1| PREDICTED: mitogen-activated protein kinase 20-like isoform X1 
[Glycine max]
Length=575

 Score =   390 bits (1002),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 274/360 (76%), Gaps = 6/360 (2%)
 Frame = -3

Query  1674  NTYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL  1495
               +  DYVATRWYRAPELCGSF+S+YTPAIDIWSIGCIFAE+L GKPLFPGKNVVHQLDL
Sbjct  183   TVFWTDYVATRWYRAPELCGSFYSRYTPAIDIWSIGCIFAEVLIGKPLFPGKNVVHQLDL  242

Query  1494  MTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPK  1315
             MTDLLGTPS +AI+++RN+KARRYL+SMRKK+PIPF+ KFPNADPLAL LLER+LAFDPK
Sbjct  243   MTDLLGTPSLDAISKVRNDKARRYLTSMRKKQPIPFAQKFPNADPLALQLLERLLAFDPK  302

Query  1314  DRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK  1135
             DRPTAEEALADPYF+ L+++EREPS QP+TKMEFEFERRR+TKE++ ELI+REILEYHP+
Sbjct  303   DRPTAEEALADPYFKGLSKIEREPSCQPITKMEFEFERRRVTKEEIGELIFREILEYHPQ  362

Query  1134  MLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD  955
             +LK++I GTE T+F+YPSAVD+FK+QFA+LEE  GK   + P ER+   SLPR ++++S+
Sbjct  363   LLKDYINGTERTNFLYPSAVDQFKQQFAHLEEDSGKCCPIMPLERKHV-SLPRSTIVHSN  421

Query  954   NS-VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNS  778
                ++  + +A+ +++ + +E ++  R++  P       + +   A+PG++V  V+ Y  
Sbjct  422   MVPLKEQSNIASCINRQTAEEYNKNSRDTENPAPSYIQGLQKFPQAKPGKVVGPVIPYEY  481

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNER-GEDGNEGSNTVPKPDQ  601
              S V  +   + R  +R  + +P   I   ++ +R  S K ER   + ++G N + + D+
Sbjct  482   ASVVKGT--YDPRTFMRG-SVLPSQPIPPTNHYQRSTSGKQERSATEADKGINKIEQDDR  538


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_004512727.1| PREDICTED: mitogen-activated protein kinase 9-like [Cicer arietinum]
Length=566

 Score =   389 bits (1000),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 186/268 (69%), Positives = 219/268 (82%), Gaps = 8/268 (3%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+L+GKPLFPGKNVVHQLDLMT
Sbjct  242   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLSGKPLFPGKNVVHQLDLMT  301

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP  E+I+RIRNEKARRYLSSMRKK+P+PF+ KFPN DP AL LLER+LAFDPKDR
Sbjct  302   DLLGTPPAESISRIRNEKARRYLSSMRKKQPVPFTKKFPNVDPSALSLLERLLAFDPKDR  361

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             PTAEEAL+DPYF  L+ V+REPS QP++K+EFEFERR++TK+DVRELIYREILEYHP+ML
Sbjct  362   PTAEEALSDPYFHGLSNVDREPSTQPISKLEFEFERRKLTKDDVRELIYREILEYHPQML  421

Query  1128  KEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSDNS  949
             +E++ G + TSFMYPS VD+FK+QFA+LE++YGKG   +P  RQ A SLPR         
Sbjct  422   QEYLSGGDQTSFMYPSGVDRFKRQFAHLEDNYGKGERGSPLLRQHA-SLPR-------ER  473

Query  948   VQNPAEVANDLSKCSIKEGDRLDRNSGI  865
             V  P +  N  + C +  G  L    G+
Sbjct  474   VPAPKDENNQNNDCEMPTGSNLHSPPGV  501


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKY HT 
Sbjct  166   MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYTHTA  202



>ref|XP_008449539.1| PREDICTED: mitogen-activated protein kinase 20 isoform X2 [Cucumis 
melo]
Length=552

 Score =   389 bits (998),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 221/394 (56%), Positives = 286/394 (73%), Gaps = 32/394 (8%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             N+VHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+PI FS KFPNADPLAL LL+
Sbjct  235   NIVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPISFSQKFPNADPLALQLLQ  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA+VEREPS QP++K+EFEFERR++TK+D+RELI+ 
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPISKVEFEFERRKVTKDDIRELIFL  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE ++F+YPSA+D+FKKQFA+LE++ GK G V P ER+ A SLP
Sbjct  355   EILEYHPQLLKDYLNGTERSNFLYPSALDQFKKQFAHLEDNGGKSGPVYPLERKHA-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKE--------GDRLDRNSGIPTTRLPLQVPQGDA  823
             R SV    N++  P +V +++   S K+        G +L ++S                
Sbjct  414   RSSV--QSNTI--PPKVTSNI--VSFKDRYAPSGPFGSQLYKDSAAQRI-------AAAQ  460

Query  822   ARPGRIVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKN-ERG  646
             A+PGRI   VM Y+SGS  T  +A + R ++R  + +P +AI +P+Y  +    +N ER 
Sbjct  461   AKPGRISGPVMPYDSGS--TIKDAYDPRMLIR--SALPSHAI-HPTYYYQQSCGQNEERS  515

Query  645   EDGNEGSNTV---PKPDQYMARKVAAAPGGSGNQ  553
               G E   ++     P   MA K+A     +  +
Sbjct  516   ATGAEQDTSMQCKQSPQCGMAAKLAGDTAAASGK  549


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>ref|XP_010322620.1| PREDICTED: mitogen-activated protein kinase 9 isoform X1 [Solanum 
lycopersicum]
Length=601

 Score =   390 bits (1003),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/235 (78%), Positives = 208/235 (89%), Gaps = 2/235 (1%)
 Frame = -3

Query  1668  YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMT  1489
             +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+LTGKPLFPGKNVVHQLDLMT
Sbjct  268   FWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDLMT  327

Query  1488  DLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPKDR  1309
             DLLGTP PE IA+IRNEKARRYL +MRKK P+PF+ KFP+ DPLAL LLERMLAFDPKDR
Sbjct  328   DLLGTPPPETIAKIRNEKARRYLGNMRKKTPVPFAQKFPHVDPLALRLLERMLAFDPKDR  387

Query  1308  PTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPKML  1129
             P+AEEALADPYFR+L+ V+REPS  P++K+EFEFERR++ KEDVRELIYREILEYHP+ML
Sbjct  388   PSAEEALADPYFRSLSNVDREPSTHPISKLEFEFERRKLAKEDVRELIYREILEYHPQML  447

Query  1128  KEFIEGTEPTS-FMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSV  967
             +E++ G + TS FMYPS VD+FK+QFA+LEEHYGKG    P +RQ A SLPR  V
Sbjct  448   QEYLRGGDQTSGFMYPSGVDRFKRQFAHLEEHYGKGERSTPLQRQHA-SLPRERV  501


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLTPEHYQFFLYQL+RGLKY HT 
Sbjct  192   MESDLHQVIKANDDLTPEHYQFFLYQLMRGLKYTHTA  228



>ref|XP_006575663.1| PREDICTED: mitogen-activated protein kinase 20-like isoform X5 
[Glycine max]
Length=528

 Score =   387 bits (995),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 267/350 (76%), Gaps = 5/350 (1%)
 Frame = -3

Query  1674  NTYTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDL  1495
               +  DYVATRWYRAPELCGSF+S+YTPAIDIWSIGCIFAE+L GKPLFPGKNVVHQLDL
Sbjct  183   TVFWTDYVATRWYRAPELCGSFYSRYTPAIDIWSIGCIFAEVLIGKPLFPGKNVVHQLDL  242

Query  1494  MTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLERMLAFDPK  1315
             MTDLLGTPS +AI+++RN+KARRYL+SMRKK+PIPF+ KFPNADPLAL LLER+LAFDPK
Sbjct  243   MTDLLGTPSLDAISKVRNDKARRYLTSMRKKQPIPFAQKFPNADPLALQLLERLLAFDPK  302

Query  1314  DRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYREILEYHPK  1135
             DRPTAEEALADPYF+ L+++EREPS QP+TKMEFEFERRR+TKE++ ELI+REILEYHP+
Sbjct  303   DRPTAEEALADPYFKGLSKIEREPSCQPITKMEFEFERRRVTKEEIGELIFREILEYHPQ  362

Query  1134  MLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLPRPSVLYSD  955
             +LK++I GTE T+F+YPSAVD+FK+QFA+LEE  GK   + P ER+   SLPR ++++S+
Sbjct  363   LLKDYINGTERTNFLYPSAVDQFKQQFAHLEEDSGKCCPIMPLERKHV-SLPRSTIVHSN  421

Query  954   NS-VQNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGDAARPGRIVSSVMRYNS  778
                ++  + +A+ +++ + +E ++  R++  P       + +   A+PG++V  V+ Y  
Sbjct  422   MVPLKEQSNIASCINRQTAEEYNKNSRDTENPAPSYIQGLQKFPQAKPGKVVGPVIPYEY  481

Query  777   GSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEG  628
              S V  +   + R  +R  + +P   I   ++ +R  S K ER +    G
Sbjct  482   ASVVKGT--YDPRTFMRG-SVLPSQPIPPTNHYQRSTSGKQERNQQDRAG  528


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  145



>gb|KHN18099.1| Mitogen-activated protein kinase 10 [Glycine soja]
Length=672

 Score =   392 bits (1008),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 213/365 (58%), Positives = 281/365 (77%), Gaps = 13/365 (4%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSF+SKYTPAIDIWSIGCIFAE+LTGKPLFPGK
Sbjct  233   VAFSDTPTTIFWTDYVATRWYRAPELCGSFYSKYTPAIDIWSIGCIFAEVLTGKPLFPGK  292

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RNEKARRYL+SMRKK+P+PF+ KFPNADPLAL LLE
Sbjct  293   NVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPVPFAQKFPNADPLALRLLE  352

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             ++LAFDPK+RPTAEEALADPYF+ LA+VEREPS QP+TKMEFEFERRR+TKE++RELI+R
Sbjct  353   KLLAFDPKNRPTAEEALADPYFKGLAKVEREPSCQPITKMEFEFERRRVTKEEIRELIFR  412

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK G V P +R+   SLP
Sbjct  413   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEEN-GKNGPVMPLDRKHV-SLP  470

Query  978   RPSVLYSDNSV--QNPAEVANDLSKCSIKEGDRLDRNSGIPTTRLPLQVPQGD-AARPGR  808
             R ++++S N+V  +    +A+  ++ + +E ++  R++ IP  R  +Q PQ    A+PG+
Sbjct  471   RSTIVHS-NTVHPKEQTNIASSKNRPTAEEYNKHPRDTEIPVPR-SMQGPQRIPLAKPGK  528

Query  807   IVSSVMRYNSGSAVTASEAIEQRRMLRNPTTMPQYAISNPSYSRRHPSCKNERGEDGNEG  628
             +V  V+ Y  G+ V   ++ + R  +R  + +P   +    Y +R  +   ER     E 
Sbjct  529   VVGPVVPYEYGNIV--KDSYDPRSFIRG-SVLPTQPVPPAYYYQRSSTGNQER--PSTEA  583

Query  627   SNTVP  613
               +VP
Sbjct  584   DKSVP  588


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  167   MESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTA  203



>ref|XP_004162404.1| PREDICTED: mitogen-activated protein kinase 10-like [Cucumis 
sativus]
Length=550

 Score =   388 bits (997),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 260/335 (78%), Gaps = 20/335 (6%)
 Frame = -3

Query  1695  ISFSED*NT-YTQDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGK  1519
             ++FS+   T +  DYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAE+L GKPLFPGK
Sbjct  175   VAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLMGKPLFPGK  234

Query  1518  NVVHQLDLMTDLLGTPSPEAIARIRNEKARRYLSSMRKKKPIPFSYKFPNADPLALCLLE  1339
             NVVHQLDLMTDLLGTPS + I+R+RN+KARRYL++MRKK+P+PFS KFPNADPLAL LLE
Sbjct  235   NVVHQLDLMTDLLGTPSLDTISRVRNDKARRYLTTMRKKQPVPFSQKFPNADPLALRLLE  294

Query  1338  RMLAFDPKDRPTAEEALADPYFRNLARVEREPSAQPVTKMEFEFERRRITKEDVRELIYR  1159
             R+LAFDPKDRPTAEEALADPYF+ LA++EREPS QP+TKMEFEFERRR+TKED++ELI+R
Sbjct  295   RLLAFDPKDRPTAEEALADPYFKGLAKIEREPSCQPITKMEFEFERRRVTKEDIQELIFR  354

Query  1158  EILEYHPKMLKEFIEGTEPTSFMYPSAVDKFKKQFAYLEEHYGKGGVVAPPERQQASSLP  979
             EILEYHP++LK+++ GTE T+F+YPSAVD+F+KQFA+LEE+ GK   V P +R+   SLP
Sbjct  355   EILEYHPQLLKDYMNGTERTNFLYPSAVDQFRKQFAHLEENGGKSAPVIPLDRKHV-SLP  413

Query  978   RPSVLYSDNSVQNPAEVANDLSKCSIKEG----DRLDRNSGIPTTRL-----PLQVPQGD  826
             R +V++S     NP    + ++   +++G    D   +NS     RL      +Q PQ  
Sbjct  414   RSTVVHS-----NPVYSKDQVNNIPLQDGKISEDAYSKNSRDSEGRLTNISRTMQAPQKI  468

Query  825   --AARPGRIVSSVMRYNSGSAVTASEAIEQRRMLR  727
               AA+PGR+V  V+   +G  V   E  + R ++R
Sbjct  469   PFAAKPGRVVGPVIADENGRLV--KEPYDPRTLIR  501


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  1768  MESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTG  1658
             MESDLHQVIKANDDLT EHYQFFLYQLLR LKYIHT 
Sbjct  109   MESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTA  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5109523114556