BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23499_g1_i2 len=538 path=[2374:0-18 962:19-66 1009:67-133
422:134-165 1107:166-198 1140:199-253 1194:254-379 139:380-439
1376:440-477 656:478-537]

Length=538
                                                                      Score     E

gb|ADV02771.1|  cysteine protease inhibitor                             101   1e-23   
ref|XP_009588279.1|  PREDICTED: cysteine proteinase inhibitor B-like  93.2    2e-20   
ref|XP_009589279.1|  PREDICTED: cysteine proteinase inhibitor B-like  92.0    4e-20   
gb|EYU28504.1|  hypothetical protein MIMGU_mgv1a016168mg              90.5    1e-19   
ref|XP_009763807.1|  PREDICTED: cysteine proteinase inhibitor B-like  90.9    1e-19   
gb|EYU24293.1|  hypothetical protein MIMGU_mgv1a016063mg              90.1    2e-19   
ref|XP_009762060.1|  PREDICTED: cysteine proteinase inhibitor B-like  89.4    5e-19   
ref|XP_010314744.1|  PREDICTED: cysteine proteinase inhibitor B-like  89.0    6e-19   
gb|AEQ54766.1|  cysteine proteinase inhibitor CPI-1                   87.8    2e-18   
ref|XP_006349967.1|  PREDICTED: cysteine proteinase inhibitor B-like  85.5    1e-17   
ref|XP_011084146.1|  PREDICTED: cysteine proteinase inhibitor B       85.1    1e-17   
ref|XP_002265736.1|  PREDICTED: cysteine proteinase inhibitor 4       85.1    2e-17   Vitis vinifera
ref|XP_007163791.1|  hypothetical protein PHAVU_001G264400g           84.3    3e-17   
ref|XP_006358790.1|  PREDICTED: cysteine proteinase inhibitor B-like  83.2    7e-17   
ref|XP_007034159.1|  Cystatin                                         82.8    1e-16   
gb|KHN44464.1|  Cysteine proteinase inhibitor 2                       83.2    1e-16   
ref|XP_010326957.1|  PREDICTED: cysteine proteinase inhibitor B       82.4    1e-16   
ref|XP_003538534.1|  PREDICTED: cysteine proteinase inhibitor 4       82.0    2e-16   
gb|ACU17144.1|  unknown                                               80.9    4e-16   Glycine max [soybeans]
ref|XP_002516375.1|  Cysteine proteinase inhibitor B, putative        80.5    9e-16   Ricinus communis
gb|ACK87021.1|  cysteine protease inhibitor                           79.7    1e-15   Gossypium hirsutum [American cotton]
gb|ABS52572.1|  cysteine proteinase inhibitor                         79.3    2e-15   Gossypium hirsutum [American cotton]
sp|Q10993.1|CYTB_HELAN  RecName: Full=Cysteine proteinase inhibit...  78.2    2e-15   Helianthus annuus
gb|ACD85810.1|  cystcine proteinase inhibitor                         78.2    4e-15   Gossypium hirsutum [American cotton]
pir||JE0308  cysteine proteinase inhibitor - common sunflower         78.2    4e-15
ref|XP_002320446.1|  cystatin family protein                          78.2    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010101112.1|  Cysteine proteinase inhibitor 10                 78.2    6e-15   
ref|XP_006492987.1|  PREDICTED: cysteine proteinase inhibitor 2-like  77.4    9e-15   
ref|XP_002301749.1|  cystatin family protein                          77.4    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_007223412.1|  hypothetical protein PRUPE_ppa013391mg           76.6    2e-14   
ref|XP_004297057.1|  PREDICTED: cysteine proteinase inhibitor B-like  76.3    3e-14   
dbj|BAA20464.1|  extracellular insoluble cystatin                     75.9    3e-14   Daucus carota [carrots]
ref|XP_010243158.1|  PREDICTED: cysteine proteinase inhibitor 4-like  75.5    5e-14   
ref|NP_180758.1|  cysteine proteinase inhibitor 2                     75.1    9e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64985.1|  putative cysteine proteinase inhibitor B (cystati...  74.7    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009402733.1|  PREDICTED: cysteine proteinase inhibitor 4-like  74.7    1e-13   
ref|XP_003552894.1|  PREDICTED: cysteine proteinase inhibitor 4-like  74.3    2e-13   
gb|KHN24041.1|  Cysteine proteinase inhibitor 2                       74.3    2e-13   
ref|XP_006410333.1|  hypothetical protein EUTSA_v10017392mg           73.2    4e-13   
ref|XP_011024794.1|  PREDICTED: cysteine proteinase inhibitor B-like  73.2    4e-13   
ref|XP_003524913.1|  PREDICTED: cysteine proteinase inhibitor 4-l...  72.8    5e-13   
ref|XP_008792948.1|  PREDICTED: cysteine proteinase inhibitor 4       72.4    5e-13   
ref|XP_010469645.1|  PREDICTED: cysteine proteinase inhibitor 2-like  72.8    6e-13   
gb|KDP32576.1|  hypothetical protein JCGZ_13126                       73.6    7e-13   
ref|XP_002862941.1|  hypothetical protein ARALYDRAFT_497243           72.4    7e-13   
ref|XP_006421050.1|  hypothetical protein CICLE_v10006584mg           72.0    8e-13   
ref|XP_006296241.1|  hypothetical protein CARUB_v10025408mg           72.0    1e-12   
emb|CDY68279.1|  BnaC04g54180D                                        71.6    1e-12   
ref|XP_008365221.1|  PREDICTED: cysteine proteinase inhibitor B-like  70.9    2e-12   
emb|CAN70300.1|  hypothetical protein VITISV_001398                   72.0    2e-12   Vitis vinifera
ref|XP_009378164.1|  PREDICTED: cysteine proteinase inhibitor B-like  70.9    2e-12   
ref|XP_002456830.1|  hypothetical protein SORBIDRAFT_03g043680        71.2    2e-12   Sorghum bicolor [broomcorn]
ref|XP_010926673.1|  PREDICTED: cysteine proteinase inhibitor 5       70.5    3e-12   
ref|XP_007153801.1|  hypothetical protein PHAVU_003G065700g           70.5    3e-12   
ref|XP_006840905.1|  hypothetical protein AMTR_s00087p00085650        70.1    4e-12   
ref|XP_010243160.1|  PREDICTED: cysteine proteinase inhibitor 2-like  70.1    6e-12   
emb|CDY42085.1|  BnaA05g11010D                                        69.7    6e-12   
ref|XP_009144029.1|  PREDICTED: cysteine proteinase inhibitor 2-like  69.7    6e-12   
ref|XP_006645220.1|  PREDICTED: cysteine proteinase inhibitor 5-like  69.7    7e-12   
gb|AFK48234.1|  unknown                                               69.3    7e-12   
ref|XP_009371093.1|  PREDICTED: cysteine proteinase inhibitor B       68.9    9e-12   
ref|XP_009387215.1|  PREDICTED: cysteine proteinase inhibitor 4-like  69.3    1e-11   
ref|XP_006840903.1|  hypothetical protein AMTR_s00087p00084520        68.9    1e-11   
ref|XP_008799565.1|  PREDICTED: cysteine proteinase inhibitor 10-...  69.7    1e-11   
ref|XP_010557035.1|  PREDICTED: cysteine proteinase inhibitor 2-like  68.6    2e-11   
ref|XP_010414055.1|  PREDICTED: cysteine proteinase inhibitor 2-like  68.6    2e-11   
ref|XP_010510121.1|  PREDICTED: cysteine proteinase inhibitor 2-like  68.2    2e-11   
ref|XP_008337489.1|  PREDICTED: cysteine proteinase inhibitor B       67.8    3e-11   
ref|XP_010542782.1|  PREDICTED: cysteine proteinase inhibitor 2-like  67.8    3e-11   
ref|XP_009373605.1|  PREDICTED: cysteine proteinase inhibitor B-like  67.4    3e-11   
ref|XP_010673372.1|  PREDICTED: cysteine proteinase inhibitor B       67.4    5e-11   
ref|NP_001172709.1|  Os01g0915401                                     67.4    5e-11   
ref|XP_009132828.1|  PREDICTED: cysteine proteinase inhibitor 2-like  67.0    7e-11   
ref|XP_004160226.1|  PREDICTED: cysteine proteinase inhibitor B-like  66.6    8e-11   
ref|XP_004502264.1|  PREDICTED: cysteine proteinase inhibitor 2-like  66.6    8e-11   
ref|XP_004138536.1|  PREDICTED: cysteine proteinase inhibitor B-like  66.2    9e-11   
ref|XP_009141203.1|  PREDICTED: cysteine proteinase inhibitor 2-like  65.9    1e-10   
ref|NP_001052530.1|  Os04g0350100                                     65.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045185.1|  Os01g0915200                                     65.5    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76949.1|  hypothetical protein OsI_04907                        65.5    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010039949.1|  PREDICTED: cysteine proteinase inhibitor B       65.1    3e-10   
emb|CDY62192.1|  BnaCnng39540D                                        64.7    3e-10   
emb|CDX84749.1|  BnaA03g14810D                                        68.6    4e-10   
ref|XP_008465470.1|  PREDICTED: cysteine proteinase inhibitor B       64.3    4e-10   
gb|AES71980.2|  phloem filament protein PP1                           64.3    5e-10   
ref|XP_003601729.1|  Cysteine proteinase inhibitor                    64.3    5e-10   
gb|KFK31166.1|  hypothetical protein AALP_AA6G077400                  63.9    6e-10   
gb|AHV85520.1|  cysteine proteinase inhibitor TrcC-6                  64.3    6e-10   
ref|XP_010244063.1|  PREDICTED: cysteine proteinase inhibitor B-like  63.9    7e-10   
emb|CDX79450.1|  BnaC03g17860D                                        67.4    8e-10   
emb|CAG38125.1|  cystatin Hv-CPI9                                     63.5    1e-09   Hordeum vulgare [barley]
emb|CAJ20032.1|  putative cystatin                                    63.2    1e-09   Zea mays [maize]
gb|KEH20629.1|  cysteine protease inhibitor cystatin                  63.2    1e-09   
emb|CAG38126.1|  cystatin Hv-CPI5                                     63.5    1e-09   Hordeum vulgare [barley]
gb|ABK21379.1|  unknown                                               63.2    1e-09   Picea sitchensis
gb|EAY93675.1|  hypothetical protein OsI_15462                        63.2    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010522274.1|  PREDICTED: cysteine proteinase inhibitor 2-like  61.6    4e-09   
gb|EMT28873.1|  Cysteine proteinase inhibitor 4                       61.6    5e-09   
ref|XP_004971036.1|  PREDICTED: cysteine proteinase inhibitor 4-like  61.2    7e-09   
emb|CDM85644.1|  unnamed protein product                              60.5    1e-08   
emb|CDY14750.1|  BnaC04g47470D                                        59.7    2e-08   
emb|CDY06956.1|  BnaA04g23590D                                        59.3    3e-08   
ref|XP_004504436.1|  PREDICTED: cysteine proteinase inhibitor 4-like  58.9    3e-08   
ref|XP_006646602.1|  PREDICTED: cysteine proteinase inhibitor 4-like  58.9    4e-08   
emb|CDY14748.1|  BnaC04g47450D                                        57.8    4e-08   
gb|KDO52834.1|  hypothetical protein CISIN_1g035532mg                 58.2    5e-08   
gb|ABK23108.1|  unknown                                               58.2    6e-08   Picea sitchensis
ref|XP_006411355.1|  hypothetical protein EUTSA_v10017418mg           57.8    7e-08   
pdb|4N6T|A  Chain A, Adhiron: A Stable And Versatile Peptide Disp...  57.0    8e-08   
gb|ABS11040.1|  cysteine proteinase inhibitor                         55.8    2e-07   Brassica oleracea var. gemmifera
ref|XP_009141947.1|  PREDICTED: cysteine proteinase inhibitor 3-like  56.6    2e-07   
ref|XP_002465058.1|  hypothetical protein SORBIDRAFT_01g031440        56.6    2e-07   Sorghum bicolor [broomcorn]
emb|CDY04170.1|  BnaA09g19480D                                        57.8    2e-07   
ref|NP_001146946.1|  cysteine proteinase inhibitor B precursor        56.2    3e-07   Zea mays [maize]
gb|AFW84200.1|  putative cystatin                                     55.8    5e-07   
tpe|CAG29029.1|  TPA: putative cystatin                               55.8    6e-07   
ref|XP_007153806.1|  hypothetical protein PHAVU_003G066200g           55.8    6e-07   
ref|NP_001105948.1|  cystatin6 precursor                              54.7    9e-07   Zea mays [maize]
sp|Q10992.1|CYTA_HELAN  RecName: Full=Cysteine proteinase inhibit...  53.9    9e-07   Helianthus annuus
gb|EMT28874.1|  Cysteine proteinase inhibitor 4                       54.7    1e-06   
ref|XP_003564913.1|  PREDICTED: cysteine proteinase inhibitor 4-like  55.1    1e-06   
gb|KFK41155.1|  hypothetical protein AALP_AA2G092800                  54.3    1e-06   
ref|XP_010522275.1|  PREDICTED: cysteine proteinase inhibitor 2-like  54.3    1e-06   
sp|Q10Q47.1|CYT7_ORYSJ  RecName: Full=Putative cysteine proteinas...  53.9    2e-06   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA45942.1|  TPA: hypothetical protein ZEAMMB73_294169            54.3    2e-06   
gb|KFK36955.1|  hypothetical protein AALP_AA4G194100                  52.8    3e-06   
emb|CDY35433.1|  BnaA03g19270D                                        52.8    3e-06   
dbj|BAB17683.1|  cysteine proteinase inhibitor homolog                52.4    4e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADK13078.1|  phytocystatin 5-3                                     52.4    6e-06   
ref|XP_007153809.1|  hypothetical protein PHAVU_003G066500g           52.4    6e-06   
ref|NP_001049339.1|  Os03g0210200                                     52.0    6e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788566.1|  PREDICTED: cysteine proteinase inhibitor A-like  52.0    6e-06   
ref|XP_010906414.1|  PREDICTED: cysteine proteinase inhibitor 12-...  53.5    7e-06   
ref|XP_008786873.1|  PREDICTED: cysteine proteinase inhibitor 12-...  53.5    7e-06   
gb|AAL86314.1|  putative cysteine proteinase inhibitor cystatin B     52.0    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181620.1|  cysteine proteinase inhibitor 3                     52.0    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AHA85335.1|  cysteine protease inhibitor                           53.9    7e-06   
pdb|3IMA|B  Chain B, Complex Strcuture Of Tarocystatin And Papain     51.2    9e-06   
gb|AGF33489.1|  cysteine proteinase inhibitor                         52.0    9e-06   
emb|CAG38129.1|  cystatin Hv-CPI8                                     51.6    9e-06   Hordeum vulgare [barley]
emb|CDY33126.1|  BnaC09g22220D                                        52.0    9e-06   
ref|XP_009792732.1|  PREDICTED: cysteine proteinase inhibitor 1-like  51.6    1e-05   
ref|XP_009629445.1|  PREDICTED: cysteine proteinase inhibitor 1 {...  51.2    2e-05   
gb|EPS68642.1|  cysteine proteinase inhibitor                         50.4    2e-05   
ref|XP_006295236.1|  hypothetical protein CARUB_v10024323mg           51.2    2e-05   
gb|ACY06329.1|  cystatin precursor                                    50.8    2e-05   Dactylis glomerata [cocksfoot]
gb|AHX83554.1|  cysteine proteinase inhibitor                         50.8    2e-05   
gb|ABW03251.1|  cysteine proteinase inhibitor                         50.1    2e-05   Sonneratia caseolaris
ref|XP_009114123.1|  PREDICTED: cysteine proteinase inhibitor 5-like  50.8    2e-05   
gb|AAA32672.1|  cystatin proteinase inhibitor                         50.4    2e-05   Ambrosia artemisiifolia [annual ragweed]
dbj|BAA95416.1|  multicystatin                                        52.8    2e-05   Helianthus annuus
ref|XP_006649608.1|  PREDICTED: cysteine proteinase inhibitor 6-like  50.4    2e-05   
ref|XP_010931548.1|  PREDICTED: cysteine proteinase inhibitor 12-...  52.0    2e-05   
ref|XP_006836222.1|  hypothetical protein AMTR_s00101p00100170        52.0    3e-05   
ref|XP_002879896.1|  FL3-27                                           50.1    4e-05   
gb|EMT18217.1|  Cysteine proteinase inhibitor 10                      50.4    4e-05   
ref|XP_004975327.1|  PREDICTED: cysteine proteinase inhibitor 10-...  50.1    5e-05   
emb|CBI32827.3|  unnamed protein product                              50.8    6e-05   
gb|ABK23526.1|  unknown                                               50.1    6e-05   Picea sitchensis
gb|AAM88397.1|AF525880_1  cysteine proteinase inhibitor               50.8    6e-05   Colocasia esculenta [cocoyam]
ref|XP_010494993.1|  PREDICTED: cysteine proteinase inhibitor 5-like  49.3    8e-05   
ref|XP_004308672.1|  PREDICTED: cysteine proteinase inhibitor 6-like  50.1    8e-05   
ref|XP_006346810.1|  PREDICTED: cysteine proteinase inhibitor 5-like  49.3    9e-05   
ref|XP_002465060.1|  hypothetical protein SORBIDRAFT_01g031460        49.3    9e-05   Sorghum bicolor [broomcorn]
ref|XP_007153810.1|  hypothetical protein PHAVU_003G066600g           49.3    9e-05   
gb|AGX28142.1|  cysteine protease inhibitor                           48.9    9e-05   
emb|CAH57551.1|  cysteine protease inhibitor                          49.3    9e-05   Populus tremula [European aspen]
ref|XP_003532730.1|  PREDICTED: cysteine proteinase inhibitor 4-like  48.5    9e-05   
ref|XP_002283400.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.8    1e-04   Vitis vinifera
ref|XP_010910533.1|  PREDICTED: cysteine proteinase inhibitor 1-like  48.9    1e-04   
ref|XP_002531171.1|  Cysteine proteinase inhibitor, putative          48.9    1e-04   Ricinus communis
ref|XP_007216188.1|  hypothetical protein PRUPE_ppa015901mg           49.3    1e-04   
emb|CAN78115.1|  hypothetical protein VITISV_031522                   48.1    1e-04   Vitis vinifera
ref|XP_002277752.1|  PREDICTED: cysteine proteinase inhibitor 5-like  48.5    1e-04   Vitis vinifera
ref|XP_004493324.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.4    1e-04   
ref|XP_009361915.1|  PREDICTED: cysteine proteinase inhibitor A-like  48.1    1e-04   
ref|XP_007153804.1|  hypothetical protein PHAVU_003G066000g           48.1    1e-04   
ref|XP_010031030.1|  PREDICTED: cysteine proteinase inhibitor 12      50.4    2e-04   
gb|KCW50301.1|  hypothetical protein EUGRSUZ_J00085                   50.1    2e-04   
prf||2203261A  Cys protease inhibitor                                 48.1    2e-04
ref|XP_002268378.1|  PREDICTED: cysteine proteinase inhibitor A       48.5    2e-04   Vitis vinifera
gb|ABK22339.1|  unknown                                               50.1    2e-04   Picea sitchensis
emb|CAH57571.1|  cysteine protease inhibitor                          48.5    2e-04   Populus tremula [European aspen]
gb|AAB71505.1|  cysteine protease inhibitor                           47.8    2e-04   Pyrus communis
gb|ABK22677.1|  unknown                                               48.5    2e-04   Picea sitchensis
ref|NP_001106013.1|  cystatin2 precursor                              48.5    2e-04   Zea mays [maize]
ref|XP_010245150.1|  PREDICTED: cysteine proteinase inhibitor 12-...  49.7    2e-04   
gb|ABK26812.1|  unknown                                               50.1    2e-04   Picea sitchensis
ref|XP_009383251.1|  PREDICTED: cysteine proteinase inhibitor A-like  48.5    2e-04   
emb|CDY66113.1|  BnaCnng49600D                                        48.1    2e-04   
ref|XP_009384360.1|  PREDICTED: cysteine proteinase inhibitor A-like  47.8    2e-04   
ref|XP_010481310.1|  PREDICTED: cysteine proteinase inhibitor 5-like  48.1    2e-04   
gb|AGX28141.1|  cysteine protease inhibitor                           47.8    2e-04   
dbj|BAB21558.1|  cystatin                                             48.1    2e-04   Coix lacryma-jobi
pdb|2W9P|A  Chain A, Crystal Structure Of Potato Multicystatin        47.4    2e-04   
gb|AAY41807.1|  cysteine proteinase inhibitor                         48.1    2e-04   Populus tomentosa [Chinese white poplar]
gb|ACO39793.1|  cysteine inhibitor 1                                  48.1    2e-04   Populus balsamifera [balsam poplar]
ref|XP_010441439.1|  PREDICTED: cysteine proteinase inhibitor 5-like  47.8    2e-04   
ref|XP_001771745.1|  predicted protein                                48.1    3e-04   
dbj|BAA09666.1|  cysteine proteinase inhibitor                        47.8    3e-04   Zea mays [maize]
ref|XP_011070080.1|  PREDICTED: cysteine proteinase inhibitor iso...  48.5    3e-04   
ref|XP_009114124.1|  PREDICTED: cysteine proteinase inhibitor 5-like  47.8    3e-04   
gb|KCW50299.1|  hypothetical protein EUGRSUZ_J00085                   49.3    3e-04   
gb|ACO39782.1|  cysteine inhibitor 1                                  47.8    3e-04   Populus balsamifera [balsam poplar]
emb|CAA60610.1|  cysteine proteinase inhibitor                        47.8    3e-04   Zea mays [maize]
ref|XP_011070083.1|  PREDICTED: cysteine proteinase inhibitor iso...  48.1    3e-04   
emb|CAH57539.1|  cysteine protease inhibitor                          48.1    3e-04   Populus tremula [European aspen]
gb|ACO39758.1|  cysteine inhibitor 1                                  47.8    3e-04   Populus balsamifera [balsam poplar]
ref|XP_011070084.1|  PREDICTED: cysteine proteinase inhibitor iso...  48.1    3e-04   
ref|XP_011070081.1|  PREDICTED: cysteine proteinase inhibitor iso...  48.1    4e-04   
gb|AEQ54767.1|  cysteine proteinase inhibitor CPI-2                   47.0    4e-04   
ref|XP_010465015.1|  PREDICTED: cysteine proteinase inhibitor 6       48.9    4e-04   
ref|XP_008455746.1|  PREDICTED: cysteine proteinase inhibitor A       47.4    4e-04   
gb|AAY57859.1|  cysteine proteinase inhibitor                         47.4    4e-04   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002267841.1|  PREDICTED: cysteine proteinase inhibitor 12      48.5    4e-04   Vitis vinifera
ref|XP_009394087.1|  PREDICTED: cysteine proteinase inhibitor-like    47.8    4e-04   
ref|XP_010499025.1|  PREDICTED: cysteine proteinase inhibitor 6-like  48.9    4e-04   
ref|XP_010505846.1|  PREDICTED: cysteine proteinase inhibitor 3-like  47.4    4e-04   
gb|AAF72202.1|AF265551_1  cysteine protease inhibitor                 47.0    4e-04   Manihot esculenta [manioc]
ref|XP_004239826.1|  PREDICTED: cysteine proteinase inhibitor 5-like  47.4    4e-04   
emb|CDP06249.1|  unnamed protein product                              47.8    5e-04   
ref|XP_010031687.1|  PREDICTED: cysteine proteinase inhibitor A-like  46.6    5e-04   
emb|CAH57573.1|  cysteine protease inhibitor                          47.4    5e-04   Populus tremula [European aspen]
emb|CAH57557.1|  cysteine protease inhibitor                          47.4    5e-04   Populus tremula [European aspen]
emb|CAH57534.1|  cysteine protease inhibitor                          47.4    5e-04   Populus tremula [European aspen]
ref|XP_011090213.1|  PREDICTED: cysteine proteinase inhibitor A-like  46.6    5e-04   
gb|AAL79831.1|AF469485_1  cystatin                                    47.0    5e-04   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ABK20186.1|  cysteine protease inhibitor                           47.4    5e-04   Populus tomentosa [Chinese white poplar]
ref|XP_010486966.1|  PREDICTED: cysteine proteinase inhibitor 6-like  48.5    6e-04   
ref|XP_002303955.1|  cysteine proteinase inhibitor                    48.5    6e-04   Populus trichocarpa [western balsam poplar]
emb|CAH57538.1|  cysteine protease inhibitor                          47.4    6e-04   Populus tremula [European aspen]
emb|CAH57560.1|  cysteine protease inhibitor                          47.4    6e-04   Populus tremula [European aspen]
emb|CAH57541.1|  cysteine protease inhibitor                          47.4    6e-04   Populus tremula [European aspen]
ref|XP_006449877.1|  hypothetical protein CICLE_v10017209mg           46.6    6e-04   
gb|ADD69946.1|  cysteine protease inhibitor                           46.6    7e-04   Knorringia sibirica
ref|XP_010909027.1|  PREDICTED: cysteine proteinase inhibitor 6-like  48.5    7e-04   
gb|ABB89766.1|  At3g12490-like protein                                48.1    7e-04   Boechera stricta
emb|CDY42150.1|  BnaC05g40690D                                        48.1    7e-04   
ref|XP_010096012.1|  Cysteine proteinase inhibitor 12                 48.1    8e-04   
ref|XP_006482025.1|  PREDICTED: cysteine proteinase inhibitor 6-like  48.1    9e-04   
gb|ABG89856.1|  cystatin                                              48.1    0.001   Amaranthus hypochondriacus [prince's feather]
ref|XP_009759630.1|  PREDICTED: cysteine proteinase inhibitor A-like  45.8    0.001   
gb|AAG38521.1|AF283536_1  cystatin-like protein                       46.2    0.001   Citrus x paradisi [grapefruit]
ref|XP_010689648.1|  PREDICTED: cysteine proteinase inhibitor 6-like  47.8    0.001   
gb|AGX28139.1|  cysteine protease inhibitor                           46.2    0.001   
emb|CAH57549.1|  cysteine protease inhibitor                          46.6    0.001   Populus tremula [European aspen]



>gb|ADV02771.1| cysteine protease inhibitor [Ipomoea batatas]
Length=134

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  + DVKTNAE+Q LGR  + E+N  L  K NP   AK L F+EVIKAEKQVVAG  Y+
Sbjct  35   KTEVSDVKTNAEVQNLGRKAVMEFNKRLNVKVNPENNAKRLVFTEVIKAEKQVVAGEKYF  94

Query  127  LRIKAANSGGEVRTFNAEMYVGPG-ESSKELVTLAPSS  17
            L IKA +  G+ +T+ +EM+V PG E+  E++  AP++
Sbjct  95   LTIKATSEDGQTKTYESEMWVKPGDETVHEMLNFAPAA  132



>ref|XP_009588279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76382.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=142

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNN--PAITAKMLTFSEVIKAEKQVVAGVN  134
            R PI DVKTN +IQ LG+ C+ EYN  L+K          + L+F+EV++AE QVV+G+ 
Sbjct  35   RTPIKDVKTNKKIQDLGKYCVEEYNRSLRKYKQILQEDNIEFLSFAEVLEAETQVVSGIK  94

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            YYL+I A  S G  +TF+AE+ + P E  KEL+   P
Sbjct  95   YYLKISAIVSSGIPKTFDAELVIKPWEEKKELIHFLP  131



>ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76376.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=136

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKK-----NNPAITAKMLTFSEVIKAEKQVVA  143
            R  I DVKTN EIQ LG+ C+ EYN  L+K+     NN      +L+FSEV++AEKQVV+
Sbjct  36   RTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNG----LLSFSEVVEAEKQVVS  91

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            G+ YYL+I A  S G  + F+A + V   E  KEL+  +PS  ++
Sbjct  92   GIKYYLKISATTSSGAPKMFDAVLVVKAWEKKKELLNFSPSPATK  136



>gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata]
Length=132

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + +VK N ++Q LGR C+ EYN  L++K N     K+L FS+V+ AE QVV+G+ YY
Sbjct  31   RTEVKNVKANKDVQDLGRYCVQEYNRQLQQKAN---GTKLLVFSQVVAAETQVVSGIKYY  87

Query  127  LRIKAAN-SGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRR  5
            L+I AA   GG  ++F A + V P   SKELV  APS+   R
Sbjct  88   LKISAATRGGGAAKSFEAVIVVKPWIHSKELVNFAPSTPPSR  129



>ref|XP_009763807.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=142

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNN--PAITAKMLTFSEVIKAEKQVVAGVN  134
            R PI DVKTN +IQ LG+ C+ EYN  L+K          + L+F+EV++AE QVV+G+ 
Sbjct  35   RTPIKDVKTNKKIQDLGKYCVEEYNRSLRKYKQILQEDNIEFLSFAEVVEAETQVVSGIK  94

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            YYL+I A  S    + F+AE+ + P E  KEL+  +P
Sbjct  95   YYLKISATVSSETPKMFDAELVIKPWEKKKELIHFSP  131



>gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata]
Length=135

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + +VK N ++Q LGR C+ EYN  L++K N     K+L FS+V+ AE QVV+G+ YY
Sbjct  35   RTEVKNVKANKDVQDLGRYCVQEYNRQLQQKAN---GTKLLVFSQVVAAETQVVSGIKYY  91

Query  127  LRIKAAN-SGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            L+I AA   GG  + F A + V P   SKELV  APS+  R
Sbjct  92   LKISAATRGGGPAKNFEAVIVVKPWIHSKELVNFAPSTPPR  132



>ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=138

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAK---MLTFSEVIKAEKQVVAGV  137
            R  I DVKTN EIQ LG+ C+ EYN  L+K+           +L+FSEV++AEKQVV+G+
Sbjct  36   RTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNNNGLLSFSEVVEAEKQVVSGI  95

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
             YYL+I A  S G  + F+A + V   E  KEL+  +PS  ++
Sbjct  96   KYYLKISATTSSGSPKMFDAVLVVKAWEKKKELLNFSPSPATK  138



>ref|XP_010314744.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum lycopersicum]
Length=136

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNN--PAITAKMLTFSEVIKAEKQVVAGVN  134
            R PI DVKTN +IQ+LG+ C+ EYN+ LKK N+       + L F EV++AE Q+V+G+ 
Sbjct  35   RTPIKDVKTNKKIQELGKYCVEEYNHSLKKYNHIMQKDNIEFLNFVEVLEAETQIVSGIK  94

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            YYL+I +  + G V+ F+AE+ +   E  KEL+  +P
Sbjct  95   YYLKI-STFTLGMVKIFDAELVIKSWEKKKELIHFSP  130



>gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora]
Length=139

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I+DVK+N E+Q+LG  C++EYN  L+KKNN   +   + F+ V++AEKQVVAG+ YYL+I
Sbjct  43   IEDVKSNKEVQELGEYCVSEYNKSLRKKNNE--SGAPIIFTSVVEAEKQVVAGIKYYLKI  100

Query  118  KAANSGGEVRTFNAEMYVGPGESSK--ELVTLAPSSLSR  8
            KA  S G  + ++A + V P   +K  +L+  +PS  ++
Sbjct  101  KATTSSGVPKVYDAIVVVRPWVHTKPRQLLNFSPSPATK  139



>ref|XP_006349967.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=136

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNN--PAITAKMLTFSEVIKAEKQVVAGVN  134
            R PI DVKTN +IQ+LG+ C+ EYN+ L+K N        ++L F EV++AE QVV+G+ 
Sbjct  35   RTPIKDVKTNKKIQELGKYCVEEYNHSLRKYNQIMQKDNIELLNFVEVLEAETQVVSGIK  94

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            YYL+I +  + G V+ ++AE+ +   E  KEL+  +P
Sbjct  95   YYLKI-STFTLGIVKVYDAELVIKSWEKKKELIHFSP  130



>ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum]
Length=131

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 4/97 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + +VK N EIQ+LGR C+ EYN+ L+ K N    +  L FS+V+ AE QV++G+ YY
Sbjct  31   RTQVKNVKQNQEIQELGRYCVGEYNHQLQLKAN---GSTALVFSQVVAAETQVISGIKYY  87

Query  127  LRIKAAN-SGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            L+I A    G   RTF+A + V P   SKEL+  APS
Sbjct  88   LKISAVTRDGAPARTFDAVVVVKPWLHSKELLNFAPS  124



>ref|XP_002265736.1| PREDICTED: cysteine proteinase inhibitor 4 [Vitis vinifera]
Length=140

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAI------TAKMLTFSEVIKAEKQVV  146
            R  I DVKTN E+QQLGR  + EYN    ++   AI        + LTFSEV++A+KQVV
Sbjct  37   RTEIKDVKTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVEAQKQVV  96

Query  145  AGVNYYLRIKAANSGGEVR-TFNAEMYVGPGESSKELVTLAPSSL  14
            +G  YYL+I A  +G  VR TF+A + V P   SK+L+  +PSS+
Sbjct  97   SGFKYYLKIAATQNG--VRNTFDAVVVVKPWLPSKQLLHFSPSSI  139



>ref|XP_007163791.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
 gb|ESW35785.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
Length=130

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I DV+TN E+Q+LGR  + EYNNGLK  N+     + LTFSEV++A++QVV+GV YY
Sbjct  27   KTEIPDVRTNREVQELGRFSVEEYNNGLKLYNDS--DNEKLTFSEVVEAQQQVVSGVKYY  84

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L+I A + G   + F++ + V P   SK+L+  +P+S
Sbjct  85   LKISATHRGIH-KMFSSVVVVKPWIHSKKLLHFSPAS  120



>ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=135

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I DVKTN EIQ LG+ C+ E+N  L+K+N  A+++ +L+FS+V++AEKQVV+GV YY
Sbjct  34   RTQIKDVKTNQEIQDLGKYCVEEHNRNLRKQNG-ALSS-LLSFSQVVEAEKQVVSGVKYY  91

Query  127  LRIKA-ANSGGEVRTFNAEMYVGPGESSK-ELVTLAPS  20
            L+I A   S    + F+A + V   E  K EL+T  PS
Sbjct  92   LKISAIVKSSSSPKLFDAVVVVKSWEKKKEELLTFFPS  129



>ref|XP_007034159.1| Cystatin [Theobroma cacao]
 gb|EOY05085.1| Cystatin [Theobroma cacao]
Length=127

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 9/101 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYN---NGLKKKNNPAITAKMLTFSEVIKAEKQVVAGV  137
            +  I+DVKTN E+Q+LGR  + E+N    GL+           L FS+V++A+KQVV+G+
Sbjct  33   KTEINDVKTNKEVQELGRFSVEEFNRSRGGLRSNGGTE-----LVFSQVVEAQKQVVSGI  87

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSL  14
             YYL+I+A  S G  RTF + + V P E SKEL+  +PS L
Sbjct  88   KYYLKIEAMQS-GLTRTFESVVVVKPWEDSKELLNFSPSPL  127



>gb|KHN44464.1| Cysteine proteinase inhibitor 2 [Glycine soja]
Length=169

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKK-KNNPAITAKMLTFSEVIKAEKQVVAGVNY  131
            +  + DV+TN E+Q+LGR  + EYN GLK+ KNN    ++ L FSEV++A++QVV+G+ Y
Sbjct  27   KTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNN---GSEQLNFSEVVEAQQQVVSGMKY  83

Query  130  YLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            YL+I A + G   + F + + V P   SK+L+  AP++ SR
Sbjct  84   YLKISATHKGVH-KMFTSVVVVKPWLHSKQLLHFAPAAPSR  123



>ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [Solanum lycopersicum]
Length=134

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I +VKTN EIQ LG+ C+ E+N  L+  N  A+++ +L+FS+V++AEKQVV+GV YY
Sbjct  34   RTQIKNVKTNQEIQDLGKYCVEEHNRDLRHING-ALSS-LLSFSQVVEAEKQVVSGVKYY  91

Query  127  LRIKA-ANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            L+I A   S    + F+A + V   E  KEL+T +PS
Sbjct  92   LKISAIVKSSSSPKLFDAVVVVKAWEKKKELLTFSPS  128



>ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 4 [Glycine max]
Length=126

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 68/102 (67%), Gaps = 5/102 (5%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKK-KNNPAITAKMLTFSEVIKAEKQVVAGVNY  131
            +  + DV+TN E+Q+LGR  + EYN GLK+ KNN    ++ L FSEV++A++QVV+G+ Y
Sbjct  27   KTEVPDVRTNREVQELGRFAVEEYNRGLKQWKNN---GSEQLNFSEVVEAQQQVVSGMKY  83

Query  130  YLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRR  5
            YL+I A + G   + F + + V P   SK+L+  AP++ S +
Sbjct  84   YLKISATHKGVH-KMFTSVVVVKPWLHSKQLLHFAPAAPSSK  124



>gb|ACU17144.1| unknown [Glycine max]
Length=122

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 66/97 (68%), Gaps = 5/97 (5%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKK-KNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            + DV+TN E+Q+LGR  + EYN GLK+ KNN    ++ L FSEV++A++QVV+G+ YYL+
Sbjct  30   VPDVRTNREVQELGRFAVEEYNRGLKQWKNN---GSEQLNFSEVVEAQQQVVSGMMYYLK  86

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLS  11
            I A + G   + F + + V P   SK+L+  AP++ S
Sbjct  87   ISATHKGVH-KMFTSVVVVKPWLHSKQLLHFAPAAPS  122



>ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
 gb|EEF45992.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
Length=138

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITA---KMLTFSEVIKAEKQVVAGV  137
            R  + DVK+N  +Q+LGR C+ E+N    ++ +        ++L FSEV+ AE QVV+G+
Sbjct  30   RTQVRDVKSNEAVQELGRFCVKEFNKQQLRQQHGGSNGGGGELLMFSEVVAAETQVVSGI  89

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRRR  2
             YYL+I A+N  GE + F++ + V      K+L+T  P++ +  R
Sbjct  90   KYYLKIAASNGKGEAKVFDSVVVVKAWIDDKQLITFEPAAANELR  134



>gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum]
Length=119

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 64/101 (63%), Gaps = 5/101 (5%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAIT----AKMLTFSEVIKAEKQVVAG  140
            R+ I+DVK N E+Q+LGR  + EYN   + +   ++     +  L FS+V+ AEKQVVAG
Sbjct  19   RMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAG  78

Query  139  VNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            + YYL+IKA   GG  +TF + + V P   SK+L+  +PS+
Sbjct  79   IKYYLKIKAMQ-GGVTKTFESVVLVKPWVQSKDLLNFSPST  118



>gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 9/103 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKK------NNPAITAKMLTFSEVIKAEKQVV  146
            R+ I+DVK N E+Q+LGR  + EYN   + +      N    TA  L FS+V+ AEKQVV
Sbjct  25   RMRINDVKNNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTA--LVFSQVVGAEKQVV  82

Query  145  AGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            AG+ YYL+IKA   GG  +TF + + V P   SK+L+  +PS+
Sbjct  83   AGIKYYLKIKAMQ-GGVTKTFESVVLVKPWVQSKDLLNFSPST  124



>sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibitor B; AltName: Full=Cystatin-B; 
AltName: Full=SCB [Helianthus annuus]
Length=101

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + +VKT+ EIQQLG   + EYN   + K   A     L FS+VI AE QVVAG  YY
Sbjct  5    RTKVKNVKTDTEIQQLGSYSVDEYNRLQRTKKTGAGD---LKFSQVIAAETQVVAGTKYY  61

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            L+I+A   GG+++ F+AE+ V   + SK+L+   P+ + +
Sbjct  62   LKIEAITKGGKMKVFDAEVVVQSWKHSKKLLGFKPAPVDK  101



>gb|ACD85810.1| cystcine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 9/103 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKK------NNPAITAKMLTFSEVIKAEKQVV  146
            R+ I+DVK N E+Q+LGR  + EYN   + +      N    TA  L FS+V+ AEKQVV
Sbjct  25   RMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTA--LVFSQVVGAEKQVV  82

Query  145  AGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            AG+ YYL IKA   GG  +TF + + V P   SK+L+  +PS+
Sbjct  83   AGIKYYLEIKAMQ-GGVTKTFESVVLVKPWVQSKDLLKFSPST  124



>pir||JE0308 cysteine proteinase inhibitor - common sunflower
Length=123

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + +VKT+ EIQQLG   + EYN   + K      A  L FS+VI AE QVVAG  YY
Sbjct  27   RTKVKNVKTDTEIQQLGSYSVDEYNRLQRTKKT---GAGDLKFSQVIAAETQVVAGTKYY  83

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            L+I+A   GG+++ F+AE+ V   + SK+L+   P+ + +
Sbjct  84   LKIEAIYKGGKMKVFDAEVVVQSWKHSKKLLGFKPAPVDK  123



>ref|XP_002320446.1| cystatin family protein [Populus trichocarpa]
 gb|EEE98761.1| cystatin family protein [Populus trichocarpa]
Length=138

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DVKTN ++Q+LGR  + E+N+            K++ FSEV++A KQVV+G+ YY
Sbjct  37   RSEVSDVKTNKQVQELGRFSVKEFNSHRSLYWKGGGVGKLM-FSEVVEAHKQVVSGLKYY  95

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L I A    GE R F++ + V PG  + EL+T  PS+
Sbjct  96   LNIVATTQNGEKRMFDSVVVVQPGLRTTELLTFEPSA  132



>ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|EXB87085.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|AJD79057.1| CPI-6 [Morus alba var. atropurpurea]
Length=143

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 8/105 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNG----LKKKNNPAITA---KMLTFSEVIKAEKQV  149
            R  I DVKTN E+Q+LGR  + EYN      +++ N  A        L+FS+V++AEKQV
Sbjct  33   RTAISDVKTNEEVQELGRFSVEEYNRRSQKLIRRGNGGARDGYGDGELSFSQVVEAEKQV  92

Query  148  VAGVNYYLRIKA-ANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            V+G+ YYL++ A A   GE R F++ + V P   S++L+  APS+
Sbjct  93   VSGIKYYLKVSATATETGESRIFDSVVVVKPWLRSRQLLNFAPST  137



>ref|XP_006492987.1| PREDICTED: cysteine proteinase inhibitor 2-like [Citrus sinensis]
Length=130

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPA--ITAKMLTFSEVIKAEKQVVAGVN  134
            R  + DVK N E+Q+LG+ C+ E+N   +++      +    L FS+V++A+KQVV+G+ 
Sbjct  31   RSEVKDVKKNKEVQELGKFCVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIK  90

Query  133  YYLRIKAAN-SGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            YYL I+A     GE++ FN+ + V P   SKEL+  APS
Sbjct  91   YYLIIEATTGENGEIQMFNSIVVVKPWLHSKELLKFAPS  129



>ref|XP_002301749.1| cystatin family protein [Populus trichocarpa]
 gb|EEE81022.1| cystatin family protein [Populus trichocarpa]
Length=135

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DVKTN EIQ+LGR  + E+NN            +++ FSEV++A+ QVV+GV YY
Sbjct  36   RAKVSDVKTNKEIQELGRFSVKEFNNHRSTYGKGGEVGELM-FSEVVEAQTQVVSGVKYY  94

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            L+I+A     E   F++ + V P   SKEL+   PS
Sbjct  95   LKIEATTQSEEKLMFDSVLVVKPWLRSKELLAFEPS  130



>ref|XP_007223412.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
 ref|XP_008222787.1| PREDICTED: cysteine proteinase inhibitor B [Prunus mume]
 gb|EMJ24611.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
Length=125

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 2/96 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I+DVKTN E+Q+LGR  + EYN   ++K++ +     L F EV++A+ QVV+G+ YY
Sbjct  29   RQQIEDVKTNKEVQKLGRFSVAEYNR-TQRKSHQSNGGGELQFLEVVEAQSQVVSGIKYY  87

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            L++ A  +G  +  F++E+ V P   SK+L+  AP 
Sbjct  88   LKVSAVRNGAHM-LFDSEVVVKPWLHSKQLLNFAPH  122



>ref|XP_004297057.1| PREDICTED: cysteine proteinase inhibitor B-like [Fragaria vesca 
subsp. vesca]
Length=138

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R P++DVKTN E+Q+LGR  + EYN  +++++  +     L F EV++AE QVV+G+ YY
Sbjct  35   RRPVEDVKTNKEVQELGRFSVAEYNR-MQRQSLRSNGGGELQFREVVEAETQVVSGIKYY  93

Query  127  LRIKAAN---SGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L+I       +GG    F++++ V P   SK L+  AP S
Sbjct  94   LKISTVRNGLNGGTPLLFDSQVVVKPWLRSKRLLNFAPHS  133



>dbj|BAA20464.1| extracellular insoluble cystatin [Daucus carota]
Length=133

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKN--NPAITAKMLTFSEVIKAEKQVVAGVN  134
            R  I DV++N EIQQLG   + +YN      +  +   +A  L F +V+ AEKQVVAG+ 
Sbjct  35   RTEIPDVESNEEIQQLGEYSVEQYNQQHHNGDGGDSTDSAGDLKFVKVVAAEKQVVAGIK  94

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            YYL+I AA  GG  + F+AE+ V   + +K+L++ APS
Sbjct  95   YYLKIVAAK-GGHKKKFDAEIVVQAWKKTKQLMSFAPS  131



>ref|XP_010243158.1| PREDICTED: cysteine proteinase inhibitor 4-like [Nelumbo nucifera]
Length=133

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I+DVK N E+Q+LGR  + E+N   +++         L FSEV++AE+QVV+G+ YY
Sbjct  38   RTEIEDVKDNEEVQELGRFSVEEFNRSQREEERSRGNV-YLVFSEVVRAERQVVSGIKYY  96

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++A    GE + F+A + V P   SK+L+T  P +
Sbjct  97   LNVEALEE-GEAKKFDAVVVVKPWLESKQLLTFIPCT  132



>ref|NP_180758.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
 sp|Q8L5T9.2|CYT2_ARATH RecName: Full=Cysteine proteinase inhibitor 2; Short=AtCYS-2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD15406.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 dbj|BAF01107.1| putative cysteine proteinase inhibitor B [Arabidopsis thaliana]
 gb|AEC08615.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
Length=147

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 10/101 (10%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNN---------GLKKKNNPAITAKMLTFSEVIKAEKQVV  146
            + +++TN EIQQLGR C+ ++N          G   K + AI+   L FS V+ A+KQVV
Sbjct  42   VPNIRTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNP-LQFSRVVSAQKQVV  100

Query  145  AGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            AG+ YYLRI+     G  R F++ + + P   SK+L+   P
Sbjct  101  AGLKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  141



>gb|AAM64985.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
Length=144

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 10/101 (10%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNN---------GLKKKNNPAITAKMLTFSEVIKAEKQVV  146
            + +++TN EIQQLGR C+ ++N          G   K + AI+   L FS V+ A+KQVV
Sbjct  39   VPNIRTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNP-LQFSRVVSAQKQVV  97

Query  145  AGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            AG+ YYLRI+     G  R F++ + + P   SK+L+   P
Sbjct  98   AGLKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  138



>ref|XP_009402733.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 10/100 (10%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+TN E+Q LG   + EYN  L  +      A +LTFS V  A++QVV+G+ YY
Sbjct  34   RTEVQDVETNKEVQDLGLFSVDEYNRRLALRG-----AGLLTFSRVAAAQRQVVSGIKYY  88

Query  127  LRIKAA-----NSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            L++ AA       G + RTF+A + V P  SS+ LV+ AP
Sbjct  89   LQVVAAVEGTGEEGQQHRTFDAVVIVKPWLSSRSLVSFAP  128



>ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=142

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLK--KKNNPAITAKMLTFSEVIKAEKQVVAGVNYYL  125
            I +V+ N ++Q+LGR  + EYN GLK  K NN     + L FS V++A++QVV+G+ YYL
Sbjct  30   IPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYL  89

Query  124  RIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            +I A ++G     FN+ + V P   SK+L+  AP+
Sbjct  90   KISATHNGVH-EMFNSVVVVKPWLHSKQLLHFAPA  123



>gb|KHN24041.1| Cysteine proteinase inhibitor 2, partial [Glycine soja]
Length=151

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLK--KKNNPAITAKMLTFSEVIKAEKQVVAGVNYYL  125
            I +V+ N ++Q+LGR  + EYN GLK  K NN     + L FS V++A++QVV+G+ YYL
Sbjct  39   IPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYL  98

Query  124  RIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            +I A ++G     FN+ + V P   SK+L+  AP+
Sbjct  99   KISATHNGVH-EMFNSVVVVKPWLHSKQLLHFAPA  132



>ref|XP_006410333.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
 gb|ESQ51786.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
Length=142

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-------LTFSEVIKAEKQVVA  143
            I +V+TN EIQ+LGR C+ ++N     ++ N A  AK        L FS V+ A+KQVVA
Sbjct  37   ISNVQTNMEIQELGRYCVEQFNLQEQSEQGNVASIAKTDPAVLNPLKFSRVVSAQKQVVA  96

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI+ +   G  R F++ + + P   S++L+   P
Sbjct  97   GTKYYLRIEVSQPDGTTRMFDSVLVIQPWLHSRKLLGFTP  136



>ref|XP_011024794.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
 ref|XP_011011101.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
Length=137

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  ++DVK N EIQ+LGR  + E+NN            +++ FSEV++A+ QVV+G+ YY
Sbjct  36   RAKVNDVKNNKEIQELGRFSVKEFNNHRSTYGKGGEVGELM-FSEVVEAQTQVVSGLKYY  94

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            L+I+      E   F++ + V P   SKEL++  PS
Sbjct  95   LKIEVTTQSEEKLVFDSVLVVKPWLRSKELLSFEPS  130



>ref|XP_003524913.1| PREDICTED: cysteine proteinase inhibitor 4-like isoform 1 [Glycine 
max]
Length=130

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I DVK N ++Q LGR  + E+N  L++        + +TF EV++A++QVV+G+ YY
Sbjct  34   RSKIPDVKANKKVQDLGRFSVEEHNRMLRQAQK---EEEQVTFVEVVEAQQQVVSGIKYY  90

Query  127  LRIKAAN--SGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            ++I A     GG+ R F + + V P   SK+L+  APS+
Sbjct  91   MKISATQGGDGGDSRIFESVVVVKPWLRSKQLLNFAPST  129



>ref|XP_008792948.1| PREDICTED: cysteine proteinase inhibitor 4 [Phoenix dactylifera]
Length=125

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  +  V++N E+Q LG  C+ EYN  L          ++LTF  V+ AE+QVV+G+ YY
Sbjct  35   RTEVPHVESNKEVQDLGLFCVEEYNQHLHGGG------EVLTFLRVLAAERQVVSGIKYY  88

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L+I A +  G  R+F+A + V P   S+ L++ APS+
Sbjct  89   LKIAARD--GRERSFDAVVVVKPWLKSRSLLSFAPSA  123



>ref|XP_010469645.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNN-GLKKKNNPAITAKM-------LTFSEVIKAEKQVVA  143
            + +VK N EIQ+LGR C+ ++N  G  ++ N    AK        L FS V+ A+KQVVA
Sbjct  41   VANVKANREIQELGRYCVEQFNQRGQSEEGNVESIAKTDTDMSNPLRFSRVVSAQKQVVA  100

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI+     G  R F++ + + P   SK+L+   P
Sbjct  101  GTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  140



>gb|KDP32576.1| hypothetical protein JCGZ_13126 [Jatropha curcas]
Length=197

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 61/96 (64%), Gaps = 4/96 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+TN E+Q LG+  + E+N  + +  N     + L FSEV++A++QVV+G+ YY
Sbjct  31   RTEVKDVETNQEVQDLGKFSVEEFNEQIHRHGN---GGEELIFSEVVEAQRQVVSGIKYY  87

Query  127  LRIKAANS-GGEVRTFNAEMYVGPGESSKELVTLAP  23
            L+I+AA    GE++ F++ + V     SKEL++  P
Sbjct  88   LKIEAATKVNGEMKVFDSVVVVKAWLESKELISFEP  123



>ref|XP_002862941.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002881207.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39200.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57466.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 10/101 (10%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNN---------GLKKKNNPAITAKMLTFSEVIKAEKQVV  146
            + +++TN EIQ+LGR C+ ++N          G   K + A++   L FS V+ A+KQVV
Sbjct  42   VPNIRTNREIQELGRYCVEQFNQQEQTEQGNIGSIAKTDTAMSNP-LVFSRVVSAQKQVV  100

Query  145  AGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            AG  YYLRI+     G  R F++ + + P   SK+L+   P
Sbjct  101  AGTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  141



>ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
 gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
Length=130

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNN--PAITAKMLTFSEVIKAEKQVVAGVN  134
            R  + DVK N E+Q+LG+  + E+N   +++      +    L FS+V++A+KQVV+G+ 
Sbjct  31   RSEVKDVKKNKEVQELGKFSVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIK  90

Query  133  YYLRIKAAN-SGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            YYL I+A     GE++ F++ + + P   SKEL+  APS
Sbjct  91   YYLTIEATTGENGEIQMFDSIVVIKPWLHSKELLKFAPS  129



>ref|XP_006296241.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
 gb|EOA29139.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
Length=144

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLK-KKNNPAITAKM-------LTFSEVIKAEKQVVA  143
            + +VK N EIQQLGR C+ ++N   + ++ N    AK        L FS V+ A+KQVVA
Sbjct  39   VPNVKANREIQQLGRYCVEQFNQREQSEEGNVESIAKTDTDMSNPLMFSRVVSAQKQVVA  98

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI+     G  R F++ + + P   SK+L+   P
Sbjct  99   GTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  138



>emb|CDY68279.1| BnaC04g54180D [Brassica napus]
Length=140

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-------LTFSEVIKAEKQ  152
            R  + +V+TN EIQ+LGR C+ ++N     K+ N A  A+        L FS V  A+KQ
Sbjct  32   RSDVGNVRTNMEIQELGRYCVKQFNLQQQSKQGNDATNARTDTAVLSPLKFSRVESAQKQ  91

Query  151  VVAGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            VVAG  YYLRI      G  R F++ + + P   SK+L+   P
Sbjct  92   VVAGTKYYLRIAVTQPDGTSRMFDSVIVIQPWLFSKKLIEFTP  134



>ref|XP_008365221.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 ref|XP_008365234.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 gb|AAO18638.1| cystatin [Malus domestica]
 gb|AHZ92268.1| cystatin 2 [Malus prunifolia]
Length=123

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I++VKTN E+Q+LGR  + EYN   ++          L F EV++A+ QVV+G+ YY
Sbjct  28   RKEIENVKTNKEVQELGRFSVEEYNR--QRGTQKMDGGGELQFLEVVEAQSQVVSGIKYY  85

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L++ A  +G   R F++E+ V P   SK+L+  AP  
Sbjct  86   LKVSAVRNGVH-RLFDSEVVVKPWLRSKQLLNFAPHG  121



>emb|CAN70300.1| hypothetical protein VITISV_001398 [Vitis vinifera]
Length=199

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAI------TAKMLTFSEVIKAEKQVV  146
            R  I DVKTN E+QQLGR  + EYN    ++   AI        + LTFSEV++A+KQVV
Sbjct  37   RTEIKDVKTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVEAQKQVV  96

Query  145  AGVNYYLRIKAANSGGEVRTFNAEMYVG  62
            +G  YYL+I AA   G   TF+A + VG
Sbjct  97   SGFKYYLKI-AATQNGVRNTFDAVVVVG  123



>ref|XP_009378164.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=124

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I++VK+N E+Q+LGR  + EYN+  +K +        L F EV++A+ QVV+G+ YY
Sbjct  28   RRQIENVKSNKEVQELGRFSVAEYNS-RQKASRKMDGGGELQFLEVVEAQSQVVSGIKYY  86

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L++ A  +G  +  F++E+ V P   SK+L+  AP +
Sbjct  87   LKVSAVKNGAHM-LFDSEVVVKPWLRSKQLLNFAPHA  122



>ref|XP_002456830.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
 gb|EES01950.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
Length=155

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 11/102 (11%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+++ E+Q+LGR  + EYN  L+           L F  V+ A++QVV+G+ YY
Sbjct  58   RTEVRDVESDGEVQELGRFSVAEYNRQLRGDGG-----GRLEFGRVVAAQRQVVSGLKYY  112

Query  127  LRIKAA-----NSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ A      N+GGE R F+A + V P   S+ L+T AP++
Sbjct  113  LRVAAVEEGAQNAGGE-RAFDAVVVVKPWLESRTLLTFAPAA  153



>ref|XP_010926673.1| PREDICTED: cysteine proteinase inhibitor 5 [Elaeis guineensis]
Length=126

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 7/97 (7%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  +  V+++ E+Q LG  C+ EYN  L    + A     LTF  V+ AE+QVV+G+ YY
Sbjct  35   RTEVPHVESDKEVQDLGLFCVEEYNQRLHGGRSEA-----LTFLRVVAAERQVVSGIKYY  89

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L+I A +  G  RTF+A + V P   S+ L++  PS+
Sbjct  90   LKIAARD--GRERTFDAIVVVKPWLKSRSLLSFTPSA  124



>ref|XP_007153801.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
 gb|ESW25795.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
Length=130

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I DVK N E+Q LG   + E+N  L++       ++   F EV++A+KQ+V+G  YY
Sbjct  33   KTEITDVKRNKEVQDLGSFSVEEHNRMLRQALKG--MSEETKFVEVVEAQKQMVSGTKYY  90

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L+I A  SG  V  F++ + V PG +SK+L++ APSS
Sbjct  91   LKISATQSGNPV-MFDSVVVVQPGLASKDLLSFAPSS  126



>ref|XP_006840905.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
 gb|ERN02580.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
Length=120

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 62/97 (64%), Gaps = 10/97 (10%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I +VK++ E+Q LG+ C+  YN    + ++P      L F+EV+K E+QVV+G+ YY
Sbjct  33   RAEIPNVKSSTEVQDLGKFCVETYN----QDHHP-----QLDFNEVVKGERQVVSGIKYY  83

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L I+A + GG ++ F+A + V     SK++++ +PS+
Sbjct  84   LLIEAKD-GGVLKKFDAVVVVQAWRHSKQMLSFSPST  119



>ref|XP_010243160.1| PREDICTED: cysteine proteinase inhibitor 2-like [Nelumbo nucifera]
Length=145

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 9/105 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAK--------MLTFSEVIKAEKQ  152
            R  + +VK N EIQ+LGR  + E+N   +++    +  +         L FSEV+ AE+Q
Sbjct  38   RTDVKNVKCNHEIQKLGRFSVEEFNRRKQQEEVVLLHGQGTSNSDDGELVFSEVVMAERQ  97

Query  151  VVAGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            VV+G+NYYL I+A   G   R F+A + V P   SK+L+  +PS+
Sbjct  98   VVSGINYYLHIEALQHGMTKR-FDAVVAVKPWLPSKQLLAFSPST  141



>emb|CDY42085.1| BnaA05g11010D [Brassica napus]
Length=136

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-------LTFSEVIKAEKQVVA  143
            + +V+TN EIQ+LGR C+ ++N     K+ N A  A+        L FS V  A+KQVVA
Sbjct  35   VGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQVVA  94

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI      G  R F++ + + P   SK+L+   P
Sbjct  95   GTKYYLRIAVTQPDGTSRMFDSVIVIQPWLFSKKLLEFTP  134



>ref|XP_009144029.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ABB97037.1| cystatin-like protein [Brassica rapa]
Length=136

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-------LTFSEVIKAEKQVVA  143
            + +V+TN EIQ+LGR C+ ++N     K+ N A  A+        L FS V  A+KQVVA
Sbjct  35   VGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQVVA  94

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI      G  R F++ + + P   SK+L+   P
Sbjct  95   GTKYYLRIAVTQPDGTSRMFDSVIVIQPWLFSKKLLEFTP  134



>ref|XP_006645220.1| PREDICTED: cysteine proteinase inhibitor 5-like [Oryza brachyantha]
Length=143

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 9/99 (9%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            ++DV+ N E+Q+LG  C+ E+N    ++ +P      L FS V+ A+ QVVAG+ YYLRI
Sbjct  44   VEDVEGNREVQELGLFCVVEHN----RRGSPTARGHRLVFSRVVAAQTQVVAGIKYYLRI  99

Query  118  KAAN-----SGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
             A N        E + F+A + V     S+E+++ AP++
Sbjct  100  AARNGLREGDDDEEKVFDAVVVVKAWVPSREMLSFAPAA  138



>gb|AFK48234.1| unknown [Medicago truncatula]
Length=133

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 58/103 (56%), Gaps = 3/103 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I DV TN E+Q+LG+  + EYN   K+  N     + L F EV++AE+QVV+G+ YY
Sbjct  30   RTEISDVGTNKEVQELGKFAVKEYN--YKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYY  87

Query  127  LRIKAANSGGEVRTFNAEMYVGPG-ESSKELVTLAPSSLSRRR  2
            L I A +  G  R FN+ + V P     K+++   PSS   + 
Sbjct  88   LNISAVDHNGVQRMFNSVVVVKPWLHQYKKVIHFGPSSTFHQH  130



>ref|XP_009371093.1| PREDICTED: cysteine proteinase inhibitor B [Pyrus x bretschneideri]
Length=123

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I++VKTN E+Q+LGR  + EYN   ++          L F EV++A+ QVV+G+ YY
Sbjct  28   RKEIENVKTNKEVQELGRFSVEEYNR--QRGTQKMDGGGELQFLEVVEAQSQVVSGLKYY  85

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L++ A  +G  +  F++E+ V P   SK+L+  AP  
Sbjct  86   LKVSAVRNGVHM-LFDSEVVVKPWLRSKQLLNFAPHG  121



>ref|XP_009387215.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + DV++N E+Q LGR  + EYN    +   PA     LTF+ V+ A++QVV+G+ YYLR+
Sbjct  49   VRDVESNKEVQDLGRYSVEEYN----RHQGPA---HPLTFARVVGAQRQVVSGIKYYLRV  101

Query  118  KA----ANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             A      S G+ RT++A + V     S+EL++  P
Sbjct  102  LATEGDGGSAGQQRTYDAVVVVKAWLGSRELISFVP  137



>ref|XP_006840903.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
 gb|ERN02578.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
Length=120

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I +VK+N E+Q LG+ C+ +YN          +    L FSEV++ E+QVV+G+ YY
Sbjct  33   RSAIPNVKSNTEVQDLGKFCVEKYNQ---------VHDSRLVFSEVVQGERQVVSGMKYY  83

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L I+A + G  ++ F+A + V     SK++++ +PS+
Sbjct  84   LLIEAKD-GDVLKKFDAVVVVQAWRHSKQMLSFSPST  119



>ref|XP_008799565.1| PREDICTED: cysteine proteinase inhibitor 10-like [Phoenix dactylifera]
Length=219

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + +V+++ E+Q LG  C+ EYN+  +         ++LTF  V+ AE+QVV+G+ YYL+I
Sbjct  131  VPNVESDKEVQDLGLFCVEEYNHRRRVGGE-----ELLTFLRVVAAERQVVSGIKYYLKI  185

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
             AA  G EV TF+A + V P   S+ L++ APSS
Sbjct  186  -AARDGREV-TFDAVVVVRPWLDSRFLLSFAPSS  217



>ref|XP_010557035.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=149

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYN--------NGLKKKNNPAITAKMLTFSEVIKAEKQ  152
            R  + DV++N E+Q+LGR C+ E+N         G    +  A     L FS V++A++Q
Sbjct  36   RSEVQDVESNRELQELGRYCVQEFNLREEREHEKGRGSTSEEAAVFDPLMFSRVVEAQEQ  95

Query  151  VVAGVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            VV+G+ Y+L+I+   S    R F + + + P   S+EL+  +P
Sbjct  96   VVSGIKYFLKIEVTLSDRTTRMFTSVVVIKPWLQSRELLDFSP  138



>ref|XP_010414055.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNN-GLKKKNNPAITAKM-------LTFSEVIKAEKQVVA  143
            + +VK N EIQ+LGR C+ ++N     ++ N    AK        L FS V+ A+KQVVA
Sbjct  41   VANVKANREIQELGRYCVEQFNQRDQSEEGNVESIAKTDTDMSNPLRFSRVVSAQKQVVA  100

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI+     G  + F++ + + P   SK+L+   P
Sbjct  101  GTKYYLRIEVTQPNGSTKMFDSVVVIQPWLHSKQLLGFTP  140



>ref|XP_010510121.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAIT--------AKMLTFSEVIKAEKQVVA  143
            + +VK N EIQ+LGR C+ ++N   + +     +        +  L FS V+ A+KQVVA
Sbjct  41   VANVKANREIQELGRYCVEQFNQRDQSEEGKVESIAKSDTDMSNPLRFSRVVSAQKQVVA  100

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            G  YYLRI+     G  R F++ + + P   SK+L+   P
Sbjct  101  GTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  140



>ref|XP_008337489.1| PREDICTED: cysteine proteinase inhibitor B [Malus domestica]
Length=123

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I++VKTN E+Q+LGR  + EYN   ++          L F EV++A+ QVV+G+ YY
Sbjct  28   RKEIENVKTNKEVQELGRFSVEEYNR--QRGTQKMDGGGELQFLEVVEAQSQVVSGIKYY  85

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            +++ A  +G  +  F++E+ V P   SK+L+  AP  
Sbjct  86   VKVSAVRNGVHM-LFDSEVVVKPWLRSKQLLNFAPHG  121



>ref|XP_010542782.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=145

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 60/97 (62%), Gaps = 5/97 (5%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN--NGLKKKNNPAITAKML---TFSEVIKAEKQVVAGVN  134
            + DV++N E+Q+LGR C+ E+N   G ++K +     ++L    FS V++A++QVV+G+ 
Sbjct  40   VPDVESNKELQELGRYCVEEFNLKEGRREKGSGEEEEEVLGPLVFSRVVEAQRQVVSGIK  99

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            Y+L+I+        R F++ + V P   S+EL+  +P
Sbjct  100  YFLKIEVTLPDRTTRMFSSVVVVKPWLPSRELLDFSP  136



>ref|XP_009373605.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=123

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I++VKTN E+Q+LGR  + EYN   ++          L F EV++A+ QVV+G+ YY
Sbjct  28   RKEIENVKTNEEVQELGRFSVEEYNR--QRGTQKMDGGGELQFLEVVEAQSQVVSGLKYY  85

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            +++ A  +G  +  F++E+ V P   SK+L+  AP  
Sbjct  86   IKVSAVRNGVHM-LFDSEVVVKPWLRSKQLLNFAPHG  121



>ref|XP_010673372.1| PREDICTED: cysteine proteinase inhibitor B [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 58/108 (54%), Gaps = 21/108 (19%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNN-------------GLKKKNNPAITAKMLTFSEVIKAE  158
            I DV TN E+Q+LG+  + EYN              GL   N P      L F +V+KA+
Sbjct  35   ITDVNTNKEVQELGKFSVEEYNREILNMQQSPLRSVGLGDTNGP------LNFVKVVKAQ  88

Query  157  KQVVAGVNYYLRIKAANSGGEVRTFNAEMYVGPG-ESSKELVTLAPSS  17
            KQVVAG+ YYL+++A    G  R F+A + V P    SK+L+   PSS
Sbjct  89   KQVVAGLKYYLKVEATKD-GVTRIFDAVVVVKPWVHESKKLLNFGPSS  135



>ref|NP_001172709.1| Os01g0915401 [Oryza sativa Japonica Group]
 sp|Q0JGM8.2|CYT5_ORYSJ RecName: Full=Cysteine proteinase inhibitor 5; AltName: Full=Oryzacystatin 
V; Short=OC-V; AltName: Full=Oryzacystatin-5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|EAY76950.1| hypothetical protein OsI_04908 [Oryza sativa Indica Group]
 gb|EAZ14606.1| hypothetical protein OsJ_04531 [Oryza sativa Japonica Group]
 dbj|BAH91439.1| Os01g0915401 [Oryza sativa Japonica Group]
Length=148

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            ++DV+ N E+Q+LG  C+ E+N    ++   A   + L FS V+ A+ QVV+G+ YYLRI
Sbjct  55   VEDVEGNREVQELGLFCVVEHN----RRGGSATRGRGLVFSRVVAAQTQVVSGIKYYLRI  110

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
             A  +  E+  F+A + V     S+E+V+  P++
Sbjct  111  AAQEADDEL-VFDAVVVVKAWVPSREMVSFVPAA  143



>ref|XP_009132828.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10747.1| phytocystatin 2-2 [Brassica rapa subsp. pekinensis]
Length=141

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-----LTFSEVIKAEKQVVAGV  137
            + +V+TN E+Q+LGR C+ ++N +    K N A +        LTFS V+ A++QVVAG+
Sbjct  38   VPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVVAGL  97

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             YYLRI+        R F++ + V P   SK L+   P
Sbjct  98   KYYLRIEVTQPDRTSRMFDSVVVVQPWLHSKTLLGFTP  135



>ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
Length=128

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R+ + DV+ N E+Q+LGR  + EYN  +            + F+ V+ AE+QVV+G  YY
Sbjct  31   RMEVKDVRRNEEVQRLGRFSVEEYNRRMGGGGE-------VKFTAVVAAERQVVSGTKYY  83

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            LRI    + GE + F++ + V P   SK L+  +PS++ R
Sbjct  84   LRILGTQN-GERKVFDSVVIVKPWIGSKRLLDFSPSTVFR  122



>ref|XP_004502264.1| PREDICTED: cysteine proteinase inhibitor 2-like [Cicer arietinum]
Length=134

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 57/101 (56%), Gaps = 2/101 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I D +TN E+Q+LG+  + EYN   K+  N     + L F EV++A++QVV+G+ YY
Sbjct  29   KTEISDARTNREVQELGKFAVEEYN--YKQGLNNGGGGEALKFVEVVEAQQQVVSGMKYY  86

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRR  5
            L I A +  G  R F + + V P    K+L+   P S + +
Sbjct  87   LNISATDRSGIHRMFTSVVVVKPWLQYKKLLHFEPLSTTHQ  127



>ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
 gb|KGN45922.1| Cystatin [Cucumis sativus]
Length=128

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R+ + DV+ N E+Q+LGR  + EYN  +            + F+ V+ AE+QVV+G  YY
Sbjct  31   RMEVKDVRRNEEVQRLGRFSVEEYNRRMGGGGE-------VKFTAVVAAERQVVSGTKYY  83

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            LRI    + GE + F++ + V P   SK L+  +PS++ R
Sbjct  84   LRILGTQN-GERKVFDSVVIVKPWIGSKRLLDFSPSAVFR  122



>ref|XP_009141203.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10746.1| phytocystatin 2-1 [Brassica rapa subsp. pekinensis]
 emb|CDY60964.1| BnaA04g28930D [Brassica napus]
Length=142

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN--NGLKKKNNPAI--TAKM--LTFSEVIKAEKQVVAGV  137
            I +V+TN EIQ+LGR C+ ++N     ++ N  +I  TA +  L FS V+ A+KQVVAG+
Sbjct  39   IPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIADTAVLNPLNFSRVVSAQKQVVAGL  98

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             Y LRI+     G  R F++ + + P   SK+L+   P
Sbjct  99   KYDLRIEVIQPDGTSRMFDSVVIIQPWLHSKKLLGFTP  136



>ref|NP_001052530.1| Os04g0350100 [Oryza sativa Japonica Group]
 sp|A2XS65.2|CYT10_ORYSI RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Indica Group]
 sp|P0C579.1|CYT10_ORYSJ RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE05518.1| OSJNBa0038P21.11 [Oryza sativa Japonica Group]
 dbj|BAF14444.1| Os04g0350100 [Oryza sativa Japonica Group]
 emb|CAH66615.1| OSIGBa0144C23.1 [Oryza sativa Indica Group]
 dbj|BAG88896.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=151

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 63/111 (57%), Gaps = 12/111 (11%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKK--KNNPAITAKM-LTFSEVIKAEKQVVAGV  137
            R  I DV +N  +Q LGR  + E+N  L+      PA    + L F+ V++A+KQVV+GV
Sbjct  42   RTEIRDVGSNKAVQSLGRFAVAEHNRRLRHGGSGGPADPVPVKLAFARVVEAQKQVVSGV  101

Query  136  NYYLRIKA--------ANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
             YYL++ A        A +GG+ R F+A + V     SKELV+  P+S ++
Sbjct  102  AYYLKVAASARDPRGGAAAGGD-RVFDAVVVVKAWLKSKELVSFTPASSTK  151



>ref|NP_001045185.1| Os01g0915200 [Oryza sativa Japonica Group]
 sp|Q5N806.1|CYT4_ORYSJ RecName: Full=Cysteine proteinase inhibitor 4; AltName: Full=Oryzacystatin 
IV; Short=OC-IV; AltName: Full=Oryzacystatin-4; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD82395.1| putative cystatin [Oryza sativa Japonica Group]
 dbj|BAF07099.1| Os01g0915200 [Oryza sativa Japonica Group]
 gb|EAZ14605.1| hypothetical protein OsJ_04530 [Oryza sativa Japonica Group]
 dbj|BAH00694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 9/102 (9%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + DV+ + E+Q+LGR  + E+N   + ++   +    L F  V+ A++QVV+G+ YYLR+
Sbjct  56   VRDVEGDREVQELGRFSVEEHNRRRRSRDCGDVR---LEFGRVVAAQRQVVSGLKYYLRV  112

Query  118  ------KAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLS  11
                   A  +GGE R F+A + V P   S+ L+T AP++ S
Sbjct  113  AAAEEGAAGQNGGEPRVFDAVVVVKPWLESRTLLTFAPAADS  154



>gb|EAY76949.1| hypothetical protein OsI_04907 [Oryza sativa Indica Group]
Length=159

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 9/102 (9%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + DV+ + E+Q+LGR  + E+N   + ++   +    L F  V+ A++QVV+G+ YYLR+
Sbjct  57   VRDVEGDREVQELGRFSVEEHNRRRRSRDCGDVR---LEFGRVVAAQRQVVSGLKYYLRV  113

Query  118  ------KAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLS  11
                   A  +GGE R F+A + V P   S+ L+T AP++ S
Sbjct  114  AAAEEGAAGQNGGEPRVFDAVVVVKPWLESRTLLTFAPAADS  155



>ref|XP_010039949.1| PREDICTED: cysteine proteinase inhibitor B [Eucalyptus grandis]
 gb|KCW45610.1| hypothetical protein EUGRSUZ_L00642 [Eucalyptus grandis]
Length=146

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKM-----LTFSEVIKAEKQVVA  143
            R  + DV++N E+Q LGR  + EYN   + +              + F EV+ AE+QVVA
Sbjct  32   RTAVPDVRSNQEVQDLGRYSVEEYNRMQRWQRGGGGGRGGGDNGEIVFGEVVGAERQVVA  91

Query  142  GVNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTL  29
            G+ YYL+I+    G   + F + + V P   SKELVT 
Sbjct  92   GIKYYLKIEGMQRGAR-KVFESVVVVRPWVRSKELVTF  128



>emb|CDY62192.1| BnaCnng39540D [Brassica napus]
Length=142

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN--NGLKKKNNPAI--TAKM--LTFSEVIKAEKQVVAGV  137
            I +V+TN EIQ+LGR C+ ++N     ++ N  +I  TA +  L FS V+ A+KQVVAG+
Sbjct  39   IPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIANTAVLNPLNFSRVVSAQKQVVAGL  98

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             Y LRI+     G  R F++ + + P   SK+L+   P
Sbjct  99   KYDLRIEVIQPDGTNRMFDSVVIIQPWLHSKKLLGFTP  136



>emb|CDX84749.1| BnaA03g14810D [Brassica napus]
Length=757

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 6/98 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-----LTFSEVIKAEKQVVAGV  137
            + +V+TN E+Q+LGR C+ ++N +    K N A + +      LTFS V+ A++QVVAG+
Sbjct  654  VPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIERAVLNPLTFSRVVSAQQQVVAGL  713

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             YYLRI+     G  R F++ + V P   SK L+   P
Sbjct  714  KYYLRIEVTQPDGTNRMFDSVVVVQPWLHSKTLLGFTP  751



>ref|XP_008465470.1| PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]
Length=128

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R+ I DVK N E+Q+LGR  + EYN  +        TA       V+ A++QVV+G  YY
Sbjct  31   RMEIKDVKRNEEVQRLGRFSVEEYNRRMGGGGEVKFTA-------VVAADRQVVSGTKYY  83

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSL  14
            LRI    + GE + F++ + V P   SK L+  +PS++
Sbjct  84   LRILGIQN-GERKIFDSVVIVKPWIGSKRLLDFSPSTV  120



>gb|AES71980.2| phloem filament protein PP1 [Medicago truncatula]
Length=130

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I DV TN E+Q+LG+  + EYN   K+  N     + L F EV++AE+QVV+G+ YY
Sbjct  30   RTEISDVGTNKEVQELGKFAVKEYN--YKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYY  87

Query  127  LRIKAANSGGEVRTFNAEMYVGP  59
            L I A +  G  R FN+ + V P
Sbjct  88   LNISAVDHNGVQRMFNSVVVVKP  110



>ref|XP_003601729.1| Cysteine proteinase inhibitor [Medicago truncatula]
Length=129

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  I DV TN E+Q+LG+  + EYN   K+  N     + L F EV++AE+QVV+G+ YY
Sbjct  29   RTEISDVGTNKEVQELGKFAVKEYN--YKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYY  86

Query  127  LRIKAANSGGEVRTFNAEMYVGP  59
            L I A +  G  R FN+ + V P
Sbjct  87   LNISAVDHNGVQRMFNSVVVVKP  109



>gb|KFK31166.1| hypothetical protein AALP_AA6G077400 [Arabis alpina]
Length=139

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 56/97 (58%), Gaps = 5/97 (5%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKMLT----FSEVIKAEKQVVAGVN  134
            + +V+ N EIQ+LGR C+ ++N    +++ N    +K +T    FS V+ A+KQVVAG+ 
Sbjct  37   VANVQANREIQELGRYCVEQFNLREQREQGNIESISKTVTNTLKFSRVVSAQKQVVAGMK  96

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            Y+LRI+     G  R F++ + + P    K ++   P
Sbjct  97   YFLRIEVTQPDGSRRMFDSVVVIQPWLHYKRVIGFTP  133



>gb|AHV85520.1| cysteine proteinase inhibitor TrcC-6 [Secale cereale x Triticum 
aestivum]
Length=152

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 61/105 (58%), Gaps = 10/105 (10%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKK--KNNPAITAKMLTFSEVIKAEKQVVAGVN  134
            R  + DV+ + E+Q+LGR  + E+N   ++  + +  +  + L F+ V+ A++Q+V+G+ 
Sbjct  46   RTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGSGGVCGR-LEFARVVSAQRQMVSGIK  104

Query  133  YYLRIKAANSGG-------EVRTFNAEMYVGPGESSKELVTLAPS  20
            YYLR+ AA  GG       + R F+A + V P   S+ LV  AP+
Sbjct  105  YYLRVAAAEEGGAGSNGVSDGRVFDAVVVVKPWLQSRALVRFAPA  149



>ref|XP_010244063.1| PREDICTED: cysteine proteinase inhibitor B-like [Nelumbo nucifera]
Length=139

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 6/102 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKK-----NNPAITAKMLTFSEVIKAEKQVVAGVN  134
            + DV  N E+Q++GR  + E+N    ++        +     L FSEV+ A++QV+ GV 
Sbjct  38   VQDVGCNDEVQEVGRFSVDEFNRKQHQEAEARGQGSSSNGGDLVFSEVVMAKQQVITGVK  97

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            YYL I+A   G   R F+A + V P   SKEL+  +PSS  R
Sbjct  98   YYLYIEAFRDGFRQR-FDAIVAVKPWLQSKELLIFSPSSGYR  138



>emb|CDX79450.1| BnaC03g17860D [Brassica napus]
Length=752

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 6/98 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYN-NGLKKKNNPAITAKM-----LTFSEVIKAEKQVVAGV  137
            + +V+TN E+Q+LGR C+ ++N +    K N A +        LTFS V+ A++QVVAG+
Sbjct  649  VPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVVAGL  708

Query  136  NYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             YYLRI+     G  R F++ + V P   SK L+   P
Sbjct  709  KYYLRIEVTQPDGTNRMFDSVVVVQPWLHSKTLLGFTP  746



>emb|CAG38125.1| cystatin Hv-CPI9 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=143

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKK---NNPAITAKMLTFSEVIKAEKQVVAGV  137
            R  I DV  N  +Q LGR  + E+N  L      NN       L F+ V  A+KQV++GV
Sbjct  41   RTEISDVGKNKLVQSLGRFAVAEHNRRLGHGGSGNNGDPVQVQLAFTAVAAAQKQVISGV  100

Query  136  NYYLRI--KAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
             YYL++  +A   GG  R F+A + V     SKELV+  PS
Sbjct  101  VYYLKVIARAPAGGGGDRPFDAVVVVKAWAKSKELVSFMPS  141



>emb|CAJ20032.1| putative cystatin [Zea mays]
Length=120

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 9/102 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ + E+Q+LGR  + EYN  L+           L F  V+ A++QVV+G+ YY
Sbjct  21   RTEVRDVEGDGEVQELGRFSVAEYNRQLRDGG----GGGRLEFGRVVAAQRQVVSGLKYY  76

Query  127  LRIKA-----ANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ A         G  R F+A + V P   S+ L+T AP++
Sbjct  77   LRVVAVEEGGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPAA  118



>gb|KEH20629.1| cysteine protease inhibitor cystatin [Medicago truncatula]
Length=133

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + +V+TN E+Q+LGR  + EYN  +K           L F EV++A++QVV+G+ YY++I
Sbjct  38   VANVRTNDEVQELGRFAVEEYNRSVKIWKE---GEGELRFVEVVEAQQQVVSGIKYYMKI  94

Query  118  ---KAANSG-GEVRTFNAEMYVGPGESSKELVTLAPS  20
               +A + G G+   F++ + V P  +SK L+  APS
Sbjct  95   WVTQAKSDGVGDPTMFDSVVLVKPWLNSKHLLHFAPS  131



>emb|CAG38126.1| cystatin Hv-CPI5 [Hordeum vulgare subsp. vulgare]
 dbj|BAK02746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 10/102 (10%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKK--KNNPAITAKMLTFSEVIKAEKQVVAGVNYYL  125
            + DV+ + E+Q+LGR  + E+N   ++  +   A+  + L F+ V+ A++QVV+GV YYL
Sbjct  49   VRDVEGDREVQELGRYSVEEHNRRREEGCEGGGAVCGR-LEFARVVSAQRQVVSGVKYYL  107

Query  124  RIKAANSGG-------EVRTFNAEMYVGPGESSKELVTLAPS  20
            R+ AA + G       + R F+A + V P   S+ LV  AP+
Sbjct  108  RVAAAEANGAGSNGVSDGRVFDAVVVVKPWLQSRSLVRFAPA  149



>gb|ABK21379.1| unknown [Picea sitchensis]
 gb|ABK22996.1| unknown [Picea sitchensis]
 gb|ACN40467.1| unknown [Picea sitchensis]
Length=130

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I DV+   EIQ LGR  + EYN     + N  I+     FS+V+KA++QVV+G+ YYL I
Sbjct  43   IPDVEHKKEIQDLGRFAVDEYNT----QQNVGIS-----FSKVVKAQEQVVSGLLYYLTI  93

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            K    G + + + A+++V P E  K+L    P
Sbjct  94   K-TKEGSKTKLYAAKIWVKPWEKFKQLQEFKP  124



>gb|EAY93675.1| hypothetical protein OsI_15462 [Oryza sativa Indica Group]
Length=151

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 6/106 (6%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKK-KNNPAITAKM-LTFSEVIKAEKQVVAGVN  134
            R  I DV  N  +Q LGR  + E+N  L+     PA    + L F+ V++A+KQVV+GV 
Sbjct  46   RTEIRDVGGNKAVQSLGRFAVAEHNRRLRHGSGGPADPVPVKLAFARVVEAQKQVVSGVA  105

Query  133  YYLRIKAANSGGEV----RTFNAEMYVGPGESSKELVTLAPSSLSR  8
            YYL++ A +  G      R F+A + V     SKELV+  P++ ++
Sbjct  106  YYLKVAARDPRGGAAAGDRVFDAVVVVKAWLKSKELVSFTPAASTK  151



>ref|XP_010522274.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=132

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I  V  N E+Q LGR C+ E+N   ++KN        L F+ V++A +QVV+G  Y+
Sbjct  39   KTEIQGVDGNKEVQDLGRYCVEEFNRKEQEKNG---NVAPLVFNRVVEARQQVVSGTKYF  95

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLA  26
            L+I+   S    + FN+ + V P   S+ELV  +
Sbjct  96   LKIETTLSDRTTKMFNSVVVVKPWLQSRELVDFS  129



>gb|EMT28873.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=152

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKM-LTFSEVIKAEKQVVAGVNY  131
            R  + DV+ + E Q+LGR  + E+N   ++           L F+ V+ A++QVV+G+ Y
Sbjct  46   RTEVTDVEGDREGQELGRYSVEEHNRRREEGCEGGGGVCGRLEFARVVSAQRQVVSGIKY  105

Query  130  YLRIKAANSGG-------EVRTFNAEMYVGPGESSKELVTLAPS  20
            YLR+ AA  GG       + R F+A + V P   S+ L+  AP+
Sbjct  106  YLRVAAAEEGGAGSNGVTDGRVFDAVVVVKPWLQSRALIRFAPA  149



>ref|XP_004971036.1| PREDICTED: cysteine proteinase inhibitor 4-like [Setaria italica]
Length=160

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 14/105 (13%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ + E+Q+LGR  + EYN               L F+ V+ A++QVV+G+ YY
Sbjct  60   RTEVRDVEGDEEVQELGRFSVAEYNR------RRVGGGGRLEFARVVAAQRQVVSGLKYY  113

Query  127  LRIKAANSGGE--------VRTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ A   GG          R F+A + V P   S+ L+  AP++
Sbjct  114  LRVAAEEEGGAENAGSGEGERVFDAVVVVKPWLESRTLLRFAPAA  158



>emb|CDM85644.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 9/105 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAI--TAKMLTFSEVIKAEKQVVAGVN  134
            R  + DV+ + E+Q+LGR  + E+N   ++            L F+ V+ A++QVV+G+ 
Sbjct  46   RTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGGGGGVCARLEFARVVSAQRQVVSGIK  105

Query  133  YYLRIKAANSGG-------EVRTFNAEMYVGPGESSKELVTLAPS  20
            YYLR+ AA   G       + R F+A + V P   S+ LV  AP+
Sbjct  106  YYLRVAAAVDNGAGSNGISDGRVFDAVVVVKPWLQSRALVRFAPA  150



>emb|CDY14750.1| BnaC04g47470D [Brassica napus]
Length=129

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 10/90 (11%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + + EI+ L R  I E+NN   K+N      K+L F +++KA +QVVAG+ YYL ++ AN
Sbjct  49   QNSGEIESLARFAIQEHNN---KEN------KVLEFKKIVKARQQVVAGMMYYLTLE-AN  98

Query  106  SGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
             GG+ + F A+++V P  + K+L     SS
Sbjct  99   EGGQAKNFEAKVWVKPWMNFKQLREFKESS  128



>emb|CDY06956.1| BnaA04g23590D [Brassica napus]
Length=130

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+NN   ++N      K+L F +++KA +QVVAG  YY
Sbjct  43   VHDLRGNQNSGEIESLARFAIQEHNN---REN------KVLEFKKIVKAREQVVAGTMYY  93

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ AN GG+ + F A+++V P  + K+L     SS
Sbjct  94   LTLE-ANEGGQAKNFEAKVWVKPWMNFKQLQEFKESS  129



>ref|XP_004504436.1| PREDICTED: cysteine proteinase inhibitor 4-like [Cicer arietinum]
Length=130

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 9/103 (9%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I +V+TN E+Q +GR  + EYN   + K         L F EV++A++QVV+G+ YY
Sbjct  30   KTEISNVRTNEEVQDIGRYSVEEYN---RSKKVWKEGEGELQFVEVVEAQQQVVSGIKYY  86

Query  127  LRIKAANS-----GGEVRT-FNAEMYVGPGESSKELVTLAPSS  17
            +++    S     G  V T F++ + V P  +SK L+  APS+
Sbjct  87   MKLWVTRSQIDGDGDGVPTMFDSVVVVKPWLNSKHLLHFAPST  129



>ref|XP_006646602.1| PREDICTED: cysteine proteinase inhibitor 4-like [Oryza brachyantha]
Length=146

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 60/110 (55%), Gaps = 16/110 (15%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ + E+Q+LGR  + E+N     +         L FS V+ A++QVV+G+ YY
Sbjct  41   RTEVMDVEGDREVQELGRFSVEEHN-----RRRDCCGDVRLEFSRVVAAQRQVVSGLMYY  95

Query  127  LRIKAA---------NSGGE--VRTFNAEMYVGPGESSKELVTLAPSSLS  11
            LR+ AA         N GG+   R ++A + V P   S+ L+T AP++ S
Sbjct  96   LRVAAAEEGAAAADQNGGGDHHARVYDAVVVVKPWLESRTLLTFAPAADS  145



>emb|CDY14748.1| BnaC04g47450D [Brassica napus]
Length=93

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I ++NN   ++N      K+L F +++KA +QVVAG  YY
Sbjct  6    VHDLRGNQNSGEIENLARFAIQQHNN---REN------KVLEFKKIVKAREQVVAGTMYY  56

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ AN GG+ + F A+++V P  + K+L     SS
Sbjct  57   LTLE-ANEGGQAKNFEAKVWVKPWMNFKQLQEFKESS  92



>gb|KDO52834.1| hypothetical protein CISIN_1g035532mg, partial [Citrus sinensis]
Length=112

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNN--PAITAKMLTFSEVIKAEKQVVAGVN  134
            R  + DVK N E+Q+LG+  + E+N   +++      +    L FS+V++A+KQVV+G+ 
Sbjct  31   RSEVKDVKKNKEVQELGKFSVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIK  90

Query  133  YYLRIKAAN-SGGEVRTFNA  77
            YYL I+A     GE++ F++
Sbjct  91   YYLTIEATTGENGEIQMFDS  110



>gb|ABK23108.1| unknown [Picea sitchensis]
Length=128

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I   +   EIQ LGR  + EYN     + N  I      FS V+KA++QVV+G+ YYLR+
Sbjct  41   IPGFEHKKEIQDLGRFAVNEYNV----QQNARIL-----FSRVLKAQEQVVSGLLYYLRV  91

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +  + GG+ + + A+++V P E  ++L    P
Sbjct  92   ETMD-GGKTKLYAAKIWVKPWEKFRQLQEFKP  122



>ref|XP_006411355.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
 gb|ESQ52808.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
Length=127

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+NN   ++N      K+L F +++KA +QVVAG  Y+
Sbjct  40   VHDLRGNQNSGEIESLARFAIQEHNN---RQN------KVLEFKKIVKAREQVVAGTMYH  90

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ AN GG+ + F A+++V P  + K+L     SS
Sbjct  91   LTLE-ANEGGQAKNFEAKVWVKPWMNFKQLQEFKESS  126



>pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Full Length Adhiron
 pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Truncated Adhiron
Length=79

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 10/84 (12%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI++L R  + E+N    KK N      +L F  V+KA++QVVAG  YYL ++A + GG+
Sbjct  5    EIEELARFAVDEHN----KKENA-----LLEFVRVVKAKEQVVAGTMYYLTLEAKD-GGK  54

Query  94   VRTFNAEMYVGPGESSKELVTLAP  23
             + + A+++V P E+ KEL    P
Sbjct  55   KKLYEAKVWVKPWENFKELQEFKP  78



>gb|ABS11040.1| cysteine proteinase inhibitor [Brassica oleracea var. gemmifera]
Length=70

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 10/78 (13%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI+ L R  I E+NN   K+N      K+L F +++KA +QVVAG+ YYL ++ AN GG+
Sbjct  3    EIESLARFAIQEHNN---KEN------KVLEFKKIVKARQQVVAGMMYYLTLE-ANEGGQ  52

Query  94   VRTFNAEMYVGPGESSKE  41
             + F A+++V P  + K+
Sbjct  53   AKNFEAKVWVTPWMNFKQ  70



>ref|XP_009141947.1| PREDICTED: cysteine proteinase inhibitor 3-like [Brassica rapa]
Length=130

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+NN   ++N       +L F +++KA +QVVAG  YY
Sbjct  43   VHDLRGNQNSGEIESLARFAIQEHNN---REN------MVLEFKKIVKAREQVVAGTMYY  93

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ AN GG+ + F A+++V P  + K+L     SS
Sbjct  94   LTLE-ANEGGQAKNFEAKVWVKPWMNFKQLQEFKESS  129



>ref|XP_002465058.1| hypothetical protein SORBIDRAFT_01g031440 [Sorghum bicolor]
 gb|EER92056.1| hypothetical protein SORBIDRAFT_01g031440 [Sorghum bicolor]
Length=125

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 59/94 (63%), Gaps = 12/94 (13%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DV  + EIQ++GR  ++E++         A  +  L FS+V++ E+QVVAG NY L 
Sbjct  41   PITDVN-DPEIQEIGRWAVSEHD---------AAASDSLVFSKVVRGEEQVVAGTNYKLV  90

Query  121  IKAA-NSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            I+A   +GG++ T+ A +Y    +++++L++ AP
Sbjct  91   IEATKGAGGKIATYGAVVY-EKVDNTRQLLSFAP  123



>emb|CDY04170.1| BnaA09g19480D [Brassica napus]
Length=213

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 55/106 (52%), Gaps = 17/106 (16%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK NA I ++G   ++EYN   K           L F EV+  E Q+VAG+NY L 
Sbjct  31   PISDVK-NAHIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGESQIVAGMNYRL-  79

Query  121  IKAANSG------GEVRTFNAEMYVGPGESSKELVTLAPSSLSRRR  2
            I AAN G      GE + + A ++  P   S  L +  P+ L+R++
Sbjct  80   ILAANEGVAIAGNGESKKYEAVVWEKPWLKSMNLTSFKPAMLTRKQ  125



>ref|NP_001146946.1| cysteine proteinase inhibitor B precursor [Zea mays]
 gb|ACG24630.1| cysteine proteinase inhibitor B [Zea mays]
Length=150

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 7/101 (7%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ + E+Q+LGR  + EYN   ++          L F  V+ A++QVV+G+ YY
Sbjct  51   RTEVRDVEGDGEVQELGRFSVAEYN---RQLREGGGGGGRLEFGRVVAAQRQVVSGLKYY  107

Query  127  LRIKA----ANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ A        G  R F+A + V P   S+ L+T AP++
Sbjct  108  LRVVAVEEGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPAA  148



>gb|AFW84200.1| putative cystatin [Zea mays]
Length=155

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 8/102 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ + E+Q+LGR  + EYN   ++          L F  V+ A++QVV+G+ YY
Sbjct  55   RTEVRDVEGDGEVQELGRFSVAEYN---RQLREGGGGGGRLEFGRVVAAQRQVVSGLKYY  111

Query  127  LRIKA-----ANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ A         G  R F+A + V P   S+ L+T AP++
Sbjct  112  LRVVAVEEGGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPAA  153



>tpe|CAG29029.1| TPA: putative cystatin [Zea mays]
Length=155

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 8/102 (8%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ + E+Q+LGR  + EYN   ++          L F  V+ A++QVV+G+ YY
Sbjct  55   RTEVPDVEGDGEVQELGRFSVAEYN---RQLREGGGGGGRLEFGRVVAAQRQVVSGLKYY  111

Query  127  LRIKA-----ANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ A         G  R F+A + V P   S+ L+T AP++
Sbjct  112  LRVVAVEEGGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPAA  153



>ref|XP_007153806.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
 gb|ESW25800.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
Length=173

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I +V  N E+Q LG+  + E N  +K+    A     LTF EV++A+KQVV+   YYL+I
Sbjct  85   IANVNMNKEVQDLGQFAVEERNQSMKE---IAFAKPELTFVEVLEAQKQVVSVTKYYLKI  141

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
                SGG  +T+++ + V P  SSK+L+    S
Sbjct  142  STNKSGGS-KTYDSVVVVKP--SSKQLLNFTAS  171



>ref|NP_001105948.1| cystatin6 precursor [Zea mays]
 tpe|CAG29026.1| TPA: putative cystatin [Zea mays]
 emb|CAJ20028.1| putative cystatin [Zea mays]
 gb|ACF82598.1| unknown [Zea mays]
 gb|ACG48712.1| cystatin [Zea mays]
Length=116

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI +V ++  IQ+LG   +TE+   +++ N+       L F EV   E+QVV+G+NY L 
Sbjct  32   PIRNV-SDPHIQELGGWAVTEH---VRRAND------GLRFGEVTGGEEQVVSGMNYKLV  81

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            + A ++ G+V  + A +Y     +++ELV+ AP+S
Sbjct  82   LDATDADGKVAAYGAFVYEQSWTNTRELVSFAPAS  116



>sp|Q10992.1|CYTA_HELAN RecName: Full=Cysteine proteinase inhibitor A; AltName: Full=Cystatin-A; 
AltName: Full=SCA [Helianthus annuus]
Length=82

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI +L R  + E+N    KK N      +L F +V+  ++QVVAG  YY+ ++A N GG 
Sbjct  3    EIDELARFAVDEHN----KKQNA-----LLEFGKVVNTKEQVVAGKMYYITLEATN-GGV  52

Query  94   VRTFNAEMYVGPGESSKELVTLAP  23
             +T+ A+++V P E+ KEL    P
Sbjct  53   KKTYEAKVWVKPWENFKELQEFKP  76



>gb|EMT28874.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=149

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 7/90 (8%)
 Frame = -1

Query  268  QQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGG---  98
            ++LGR  + E+N    +          L F+ V+ A++QVV+GV YYLR+ AA   G   
Sbjct  57   EELGRYSVEEHNRRRGEGCEDGGVCGRLEFARVVSAQRQVVSGVKYYLRVAAAEENGAGT  116

Query  97   ----EVRTFNAEMYVGPGESSKELVTLAPS  20
                + R F+A + V P   S+ LV  AP+
Sbjct  117  NGVSDGRVFDAVVVVKPWLQSRALVRFAPA  146



>ref|XP_003564913.1| PREDICTED: cysteine proteinase inhibitor 4-like [Brachypodium 
distachyon]
Length=161

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (52%), Gaps = 22/112 (20%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            R  + DV+ N E+Q+LGR  + E+N   +++ +       L F  V+ A++QVV+G+ YY
Sbjct  55   RTEVRDVEGNREVQELGRYSVDEHN---RRREDDG----RLEFGRVVSAQRQVVSGLKYY  107

Query  127  LRIKAA------------NSGGEV---RTFNAEMYVGPGESSKELVTLAPSS  17
            LR+ AA            N+   V   R F+A + V P   S+ L+  AP+ 
Sbjct  108  LRVAAAELPQQQQEEGINNNNKAVEGERVFDAVVVVKPWLDSRALLRFAPAH  159



>gb|KFK41155.1| hypothetical protein AALP_AA2G092800 [Arabis alpina]
Length=117

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 11/96 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK +  + Q+G   ++EY+   K           L F  V++ E QVVAG NY LR
Sbjct  33   PITDVK-DPHVVQIGEFAVSEYDKRSKSG---------LKFETVVRGETQVVAGTNYRLR  82

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSL  14
            +  AN GGE + + A ++  P   S  L +  P+  
Sbjct  83   V-TANDGGESKNYEAIVWEKPWLKSMNLTSFKPARF  117



>ref|XP_010522275.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=142

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (58%), Gaps = 15/99 (15%)
 Frame = -1

Query  292  DVKTNAEIQQLGRDCITEYN---------NGLKKKNNPAITAKMLTFSEVIKAEKQVVAG  140
            DV +N E+Q+LGR C+ E+N         +G ++  NP      L F EV++ ++QVV+G
Sbjct  41   DVASNKELQELGRYCVEEFNLKEQREHGKSGGEEGFNP------LMFGEVVEVQRQVVSG  94

Query  139  VNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            + Y+LRI+A       R FN+ + V P   SKEL+  +P
Sbjct  95   IKYFLRIQATLPDRTTRMFNSVVVVKPWLQSKELLDFSP  133



>sp|Q10Q47.1|CYT7_ORYSJ RecName: Full=Putative cysteine proteinase inhibitor 7; AltName: 
Full=Oryzacystatin VII; Short=OC-VII; AltName: Full=Oryzacystatin-7; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF94587.1| Cystatin, putative [Oryza sativa Japonica Group]
 gb|EAY88996.1| hypothetical protein OsI_10479 [Oryza sativa Indica Group]
 gb|EAZ26018.1| hypothetical protein OsJ_09871 [Oryza sativa Japonica Group]
Length=117

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 11/94 (12%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            P+D    +  +Q+LGR  + E + G        + A  LTF  V   EKQVVAGVNY L 
Sbjct  32   PVD--INDPHVQELGRWAVAEEDRG--------VAAGGLTFERVTDGEKQVVAGVNYRLT  81

Query  121  IKAANSGGEVRTFNAEMY-VGPGESSKELVTLAP  23
            ++A++SG +   + A +Y   P  ++++LV+  P
Sbjct  82   LEASSSGAKDGRYEAVVYEQDPRSNARKLVSFEP  115



>tpg|DAA45942.1| TPA: hypothetical protein ZEAMMB73_294169 [Zea mays]
Length=176

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI +V ++  IQ+LG   +TE+   +++ N+       L F EV   E+QVV+G+NY L 
Sbjct  92   PIRNV-SDPHIQELGGWAVTEH---VRRAND------GLRFGEVTGGEEQVVSGMNYKLV  141

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            + A ++ G+V  + A +Y     +++ELV+ AP+S
Sbjct  142  LDATDADGKVAAYGAFVYEQSWTNTRELVSFAPAS  176



>gb|KFK36955.1| hypothetical protein AALP_AA4G194100 [Arabis alpina]
Length=93

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+NN   K+N      K+L F +++KA +QVVAG  Y+
Sbjct  6    VHDLRGNQNSGEIESLARFAIQEHNN---KEN------KVLEFKKIVKAREQVVAGTMYH  56

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++A   G + + F A+++V P  + K+L     SS
Sbjct  57   LTLEAK-EGDKTKNFEAKVWVKPWMNFKQLQEFKESS  92



>emb|CDY35433.1| BnaA03g19270D [Brassica napus]
Length=94

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTNAE---IQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N     I  L R  I E+NN   ++N      K+L F +++KA +QVVAG  Y+
Sbjct  7    VHDLRVNHSSGVISSLARFAIQEHNN---REN------KVLAFKKIVKAREQVVAGTMYH  57

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++A+  GG+ + F A+++V P  + K+L     SS
Sbjct  58   LTLEAS-EGGKSKNFEAKVWVKPWMNFKQLQEFKESS  93



>dbj|BAB17683.1| cysteine proteinase inhibitor homolog [Arabidopsis thaliana]
Length=92

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+N   K++N      K+L F +++KA +QVVAG  Y+
Sbjct  5    VHDLRGNQNSGEIESLARFAIQEHN---KQQN------KILEFKKIVKAREQVVAGTMYH  55

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ A  G + + F A+++V P  + K+L     SS
Sbjct  56   LTLE-AKEGDQTKNFEAKVWVKPWMNFKQLQEFKESS  91



>gb|ADK13078.1| phytocystatin 5-3 [Brassica rapa subsp. pekinensis]
Length=120

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 50/100 (50%), Gaps = 17/100 (17%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK NA I ++G   ++EYN   K           L F EV+  E Q+VAG+NY L 
Sbjct  31   PISDVK-NAHIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGESQIVAGMNYRL-  79

Query  121  IKAANSG------GEVRTFNAEMYVGPGESSKELVTLAPS  20
            I AAN G      GE + + A ++  P   S  L +  P+
Sbjct  80   ILAANEGVAIAGNGESKKYEAVVWEKPWLKSMNLTSFKPA  119



>ref|XP_007153809.1| hypothetical protein PHAVU_003G066500g [Phaseolus vulgaris]
 gb|ESW25803.1| hypothetical protein PHAVU_003G066500g [Phaseolus vulgaris]
Length=125

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 6/97 (6%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I +VK N E+Q +GR  + + N  +K+    A     LTF EV++A+KQVV+G  YY
Sbjct  34   KTKIANVKMNKEVQDVGRFAVEDSNRIMKEM---ASAKPELTFVEVLEAQKQVVSGTKYY  90

Query  127  LRIKAANSGGEVR-TFNAEMYVGPGESSKELVTLAPS  20
            L+I    +GG    T+N+ + V    SSKEL  L  S
Sbjct  91   LKILVNENGGRNSITYNSVVVVKG--SSKELQILTVS  125



>ref|NP_001049339.1| Os03g0210200 [Oryza sativa Japonica Group]
 sp|Q10Q46.1|CYT6_ORYSJ RecName: Full=Cysteine proteinase inhibitor 6; AltName: Full=Oryzacystatin 
VI; Short=OC-VI; AltName: Full=Oryzacystatin-6; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF94588.1| Cystatin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11253.1| Os03g0210200 [Oryza sativa Japonica Group]
 gb|EAZ26019.1| hypothetical protein OsJ_09872 [Oryza sativa Japonica Group]
 gb|EEC74740.1| hypothetical protein OsI_10480 [Oryza sativa Indica Group]
Length=113

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 53/92 (58%), Gaps = 10/92 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI ++  +  IQ+LGR  ITE        NN    +  LTF  V   E+QVV+G+NY L 
Sbjct  25   PIKNID-DPHIQELGRWAITE--------NNRVSPSDELTFHRVTGGEQQVVSGMNYRLE  75

Query  121  IKAANSGGEVR-TFNAEMYVGPGESSKELVTL  29
            I+AA+ GG+V  ++ A ++     ++++L++ 
Sbjct  76   IEAASGGGDVTGSYGAVVFEQEWSNTRKLISF  107



>ref|XP_008788566.1| PREDICTED: cysteine proteinase inhibitor A-like [Phoenix dactylifera]
Length=105

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 53/90 (59%), Gaps = 10/90 (11%)
 Frame = -1

Query  292  DVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKA  113
            +++ + EI++L R  + EY+    KK N      +L F  V+K ++QVVAG+ YY+ I+ 
Sbjct  12   EIENSVEIEELARFAVEEYD----KKANA-----LLEFVRVVKVKEQVVAGIVYYITIEV  62

Query  112  ANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             + GG+ + + A+++V P    KEL   +P
Sbjct  63   ID-GGKKKLYEAKVWVKPWMKFKELQEFSP  91



>ref|XP_010906414.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=202

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 54/90 (60%), Gaps = 10/90 (11%)
 Frame = -1

Query  292  DVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKA  113
            +++ + EI++L R  + E+N   KK N       +L F  V+K ++QVV+G+ YY+ I+A
Sbjct  12   EIQNSVEIEELARFAVEEHN---KKANT------LLEFGRVVKVKEQVVSGIIYYITIEA  62

Query  112  ANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            ++ GG+ + + A+++V P    KEL    P
Sbjct  63   SD-GGKKKLYEAKVWVKPWMKFKELQEFIP  91



>ref|XP_008786873.1| PREDICTED: cysteine proteinase inhibitor 12-like [Phoenix dactylifera]
Length=202

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 53/90 (59%), Gaps = 10/90 (11%)
 Frame = -1

Query  292  DVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKA  113
            +++ + EI++L R  + E+N   KK N       +L F  V+K ++QVVAG+ YY+ I+A
Sbjct  12   EIENSVEIEELARFAVEEHN---KKANT------LLEFVRVVKVKEQVVAGIIYYITIEA  62

Query  112  ANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
               GG+ + + A+++V P    KEL   +P
Sbjct  63   IE-GGKKKLYEAKVWVKPWMKFKELQEFSP  91



>gb|AAL86314.1| putative cysteine proteinase inhibitor cystatin B [Arabidopsis 
thaliana]
Length=116

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+N   K++N      K+L F +++KA +QVVAG  Y+
Sbjct  29   VHDLRGNQNSGEIESLARFAIQEHN---KQQN------KILEFKKIVKAREQVVAGTMYH  79

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ A  G + + F A+++V P  + K+L     SS
Sbjct  80   LTLE-AKEGDQTKNFEAKVWVKPWMNFKQLQEFKESS  115



>ref|NP_181620.1| cysteine proteinase inhibitor 3 [Arabidopsis thaliana]
 sp|Q41906.2|CYT3_ARATH RecName: Full=Cysteine proteinase inhibitor 3; Short=AtCYS-3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86448.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 gb|AAM61337.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 gb|AAN13009.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 gb|AEC09892.1| cysteine proteinase inhibitor 3 [Arabidopsis thaliana]
Length=125

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+N   K++N      K+L F +++KA +QVVAG  Y+
Sbjct  38   VHDLRGNQNSGEIESLARFAIQEHN---KQQN------KILEFKKIVKAREQVVAGTMYH  88

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ A  G + + F A+++V P  + K+L     SS
Sbjct  89   LTLE-AKEGDQTKNFEAKVWVKPWMNFKQLQEFKESS  124



>gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa]
Length=228

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 55/86 (64%), Gaps = 10/86 (12%)
 Frame = -1

Query  295  DDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIK  116
            D  + +AE+++L R  + E+N   KK+N      ++L F+ V+KA++QVVAG  +YL ++
Sbjct  39   DGAQNSAELEELARFAVEEHN---KKEN------RLLEFTRVVKAKEQVVAGTLHYLTLE  89

Query  115  AANSGGEVRTFNAEMYVGPGESSKEL  38
            A ++G + + + A+++V P    KEL
Sbjct  90   AIDAGKK-KLYEAKVWVKPWLHFKEL  114



>pdb|3IMA|B Chain B, Complex Strcuture Of Tarocystatin And Papain
 pdb|3IMA|D Chain D, Complex Strcuture Of Tarocystatin And Papain
Length=91

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 57/94 (61%), Gaps = 10/94 (11%)
 Frame = -1

Query  304  IPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYL  125
            + ++  + +AE+++L R  + E+N    KK N      +L FS ++KA++QVV+G+ ++L
Sbjct  7    VDVEGAQNSAEVEELARFAVDEHN----KKENA-----LLQFSRLVKAKQQVVSGIMHHL  57

Query  124  RIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             ++    GG+ + + A+++V    +SK+L   +P
Sbjct  58   TVEVI-EGGKKKVYEAKVWVQAWLNSKKLHEFSP  90



>gb|AGF33489.1| cysteine proteinase inhibitor [Curcuma alismatifolia]
Length=123

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 14/91 (15%)
 Frame = -1

Query  298  IDDVKTNA----EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNY  131
            I DV+  A    EI+QLGR  + ++N    KK N      +L F+ VIKA +QVVAG  +
Sbjct  33   IRDVEGEAANGLEIEQLGRFAVDQHN----KKENA-----LLEFARVIKAREQVVAGTLH  83

Query  130  YLRIKAANSGGEVRTFNAEMYVGPGESSKEL  38
            +L ++  ++G + +T+ A+++V P  + KEL
Sbjct  84   HLTVEVIDAGKK-KTYEAKVWVKPWLNFKEL  113



>emb|CAG38129.1| cystatin Hv-CPI8 [Hordeum vulgare subsp. vulgare]
 dbj|BAK04930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 52/95 (55%), Gaps = 10/95 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK +A IQ+LG         G   + + ++ +  L F  V + E+QVV+G+NY L 
Sbjct  37   PIPDVK-DAHIQELG---------GWAVEQHASLASDGLRFRRVTRGEQQVVSGMNYRLF  86

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            + AA+  G    + AE+Y     ++++L +  P++
Sbjct  87   VDAADGSGRSAPYVAEVYEQSWTNTRQLRSFKPAA  121



>emb|CDY33126.1| BnaC09g22220D [Brassica napus]
Length=140

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 17/100 (17%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK N+ I ++G   ++EYN   K           L F EV+  E Q+VAG+NY L 
Sbjct  51   PISDVK-NSHIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGESQIVAGINYRL-  99

Query  121  IKAANSG------GEVRTFNAEMYVGPGESSKELVTLAPS  20
            I AAN G      GE + + A ++  P   S  L +  P+
Sbjct  100  IVAANEGVAITGNGESKKYEAVVWETPWLKSMNLTSFKPA  139



>ref|XP_009792732.1| PREDICTED: cysteine proteinase inhibitor 1-like [Nicotiana sylvestris]
 gb|AIE76381.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=134

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 11/91 (12%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI ++ T+ EI ++G+  + E+N   K K         + F +++K E QVVAG NY L 
Sbjct  38   PIKNI-TDPEIVEIGKFAVNEHNKEAKTK---------IEFEKIMKGESQVVAGTNYRLV  87

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTL  29
            I AA  GGE   + AE++  P E  + L + 
Sbjct  88   I-AAKDGGEPHQYMAEVWDKPWEKYRNLTSF  117



>ref|XP_009629445.1| PREDICTED: cysteine proteinase inhibitor 1 {ECO:0000303|PubMed:14697268}-like 
[Nicotiana tomentosiformis]
Length=137

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (54%), Gaps = 11/91 (12%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI ++ T+ E+ ++G+  + E+N   K K         L F +++  E QVVAG+NY L 
Sbjct  41   PIKNI-TDPEVVEIGKFAVNEHNKEAKTK---------LEFEKIMNGESQVVAGINYRLV  90

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTL  29
            I AA  GGE   + AE++  P E  + L + 
Sbjct  91   I-AAKDGGEPHQYMAEVWDKPWEKYRNLTSF  120



>gb|EPS68642.1| cysteine proteinase inhibitor, partial [Genlisea aurea]
Length=79

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + + E++ LGR  I E+N    K  N A     L F+ V+KAE+QVV+G  Y+L ++A +
Sbjct  1    QNDGEVESLGRFAIQEHN----KNQNAA-----LEFTRVVKAEQQVVSGKLYHLTVEAVD  51

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
             GG+ + + A+++V P  + K+L
Sbjct  52   -GGQKQVYEAKVWVKPWLNFKQL  73



>ref|XP_006295236.1| hypothetical protein CARUB_v10024323mg [Capsella rubella]
 gb|EOA28134.1| hypothetical protein CARUB_v10024323mg [Capsella rubella]
Length=125

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D + N    EI+ L R  I E+N   K++N      K+L F +++KA +QVVAG  Y+
Sbjct  38   VHDFRGNQNSGEIESLARFAIQEHN---KQQN------KILEFKKIVKAREQVVAGTMYH  88

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ A  G +++ F A+++V P  + K+L     +S
Sbjct  89   LTLE-AKEGDQMKNFEAKVWVKPWMNFKQLQEFKETS  124



>gb|ACY06329.1| cystatin precursor [Dactylis glomerata]
Length=122

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = -1

Query  304  IPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYL  125
             PI DV T+  IQ+LG   +T++           + +  L F  V + E+QVV+G+NY L
Sbjct  36   FPIPDV-TDQHIQELGGWAVTQHAK---------LASDRLQFRRVTRGEEQVVSGMNYRL  85

Query  124  RIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
             ++A +  G    + AE+Y      ++EL +  P+
Sbjct  86   FVEAVDGAGSSAPYVAEVYEQSWTRTRELTSFKPA  120



>gb|AHX83554.1| cysteine proteinase inhibitor [Secale cereale x Triticum aestivum]
Length=123

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 51/95 (54%), Gaps = 10/95 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DV+ +A IQ+LG         G   + +  + +  L F  V + E+QVV+G+NY L 
Sbjct  38   PIPDVR-DAHIQELG---------GWAVEQHARLASDGLRFRRVTRGEQQVVSGMNYRLF  87

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            + AA+  G    + AE+Y     ++++L +  P++
Sbjct  88   VDAADGSGNSAPYVAEVYEQSWTNTRQLTSFKPAA  122



>gb|ABW03251.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03252.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03253.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03254.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03255.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03256.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03257.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03258.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
Length=74

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 10/79 (13%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI+ L R  + E+N   KK+N+      +L F +V+KA++QVVAG  YY+ ++A + GG 
Sbjct  5    EIEALARFAVDEHN---KKENS------LLQFGKVVKAKQQVVAGTVYYITVEATD-GGV  54

Query  94   VRTFNAEMYVGPGESSKEL  38
             + + A+++V P    KEL
Sbjct  55   KKLYEAKVWVKPWMDFKEL  73



>ref|XP_009114123.1| PREDICTED: cysteine proteinase inhibitor 5-like [Brassica rapa]
 gb|ADK13077.1| phytocystatin 5-2 [Brassica rapa subsp. pekinensis]
 emb|CDY04171.1| BnaA09g19490D [Brassica napus]
Length=120

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 50/100 (50%), Gaps = 17/100 (17%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK+ A I ++G   ++EYN   K           L F EV+  E Q+VAG+NY L 
Sbjct  31   PISDVKS-AHIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGESQIVAGMNYRL-  79

Query  121  IKAANSG------GEVRTFNAEMYVGPGESSKELVTLAPS  20
            I AAN G      GE + + A ++  P   S  L +  P+
Sbjct  80   ILAANEGVAIAGNGESKKYEAVVWEKPWLKSMNLTSFKPA  119



>gb|AAA32672.1| cystatin proteinase inhibitor [Ambrosia artemisiifolia]
Length=92

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 10/91 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
             + D   + +  +L +  I E+N    KK N A     L F +VI+ ++Q V G  YY++
Sbjct  9    EVKDNDNSVDFDELAKFAIAEHN----KKENAA-----LEFGKVIEKKQQAVQGTMYYIK  59

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTL  29
            ++A N GGE +T+ A+++V   E+ KEL  L
Sbjct  60   VEA-NDGGEKKTYEAKVWVKLWENFKELQEL  89



>dbj|BAA95416.1| multicystatin [Helianthus annuus]
Length=282

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 52/92 (57%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + D   +  I  L R  + EYN   KK+N       +L F +V+ A++Q+V+G  YY+ +
Sbjct  10   VKDFANSIVIDDLARFAVDEYN---KKQNT------LLEFRKVLNAKEQIVSGTLYYITL  60

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             AAN GG ++T+ A+++V   E+ KEL    P
Sbjct  61   DAAN-GGIIKTYEAKVWVKKWENLKELQEFKP  91


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 53/92 (58%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + D   + EI+ L R  + E+N   KK+N       +L F +V+ A++Q+VAG   Y+ +
Sbjct  105  VKDFANSLEIEDLARFAVDEHN---KKQNT------LLEFGKVLNAKEQIVAGKLCYITL  155

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +A + GG  +T+ A+++V P E+ KEL    P
Sbjct  156  EATD-GGVKKTYEAKVWVKPWENFKELQEFKP  186



>ref|XP_006649608.1| PREDICTED: cysteine proteinase inhibitor 6-like, partial [Oryza 
brachyantha]
Length=104

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 54/92 (59%), Gaps = 9/92 (10%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI+D+  + +IQ LGR  ++E N     + +P  +   LTF  V   E+QVVAGVNY L 
Sbjct  16   PINDID-DWQIQGLGRWAVSENN-----RRSP--SGDALTFLAVTGGEQQVVAGVNYRLD  67

Query  121  IKAANS-GGEVRTFNAEMYVGPGESSKELVTL  29
            I A++S  G   ++ A ++ G G +++ L++ 
Sbjct  68   IDASSSRDGIGGSYKAVLFEGLGGNTRRLISF  99



>ref|XP_010931548.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=202

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 51/89 (57%), Gaps = 10/89 (11%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
            ++ + EI++L R  + E N   KK N       +L F  V+K ++QVV+G+ YY+ I+A 
Sbjct  13   IENSVEIEELARFAVEEQN---KKANT------LLEFVRVVKVKEQVVSGIIYYITIEAI  63

Query  109  NSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            + GGE + + A+++V P    KEL    P
Sbjct  64   D-GGEKKLYEAKVWVKPWMKFKELQEFIP  91



>ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
Length=206

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 54/83 (65%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI++L R  + E+N    KK+N      +L F+ V+KA++QVVAG  Y+L ++A +
Sbjct  15   QNSAEIEELARFAVQEHN----KKSNS-----LLEFARVVKAKEQVVAGTLYHLTLEAID  65

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G   + + A++++ P E+ KEL
Sbjct  66   AGKN-KLYEAKVWLKPWENFKEL  87



>ref|XP_002879896.1| FL3-27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56155.1| FL3-27 [Arabidopsis lyrata subsp. lyrata]
Length=125

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 54/97 (56%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + D++ N    EI+ L R  I E+N   K++N      K+L F +++KA +QVV+G  Y+
Sbjct  38   VHDLRGNQNSGEIESLARFAIQEHN---KQQN------KVLEFKKIVKAREQVVSGTMYH  88

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++ A  G   + F A+++V P  + K+L     SS
Sbjct  89   LTLE-AKEGDHTKNFEAKVWVKPWMNFKQLQEFKESS  124



>gb|EMT18217.1| Cysteine proteinase inhibitor 10 [Aegilops tauschii]
Length=144

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAK----MLTFSEVIKAEKQVVAG  140
            R  I DV  N  +Q LGR  ++E+N  L     P          L F+ V  A+KQV +G
Sbjct  41   RTEIRDVGKNKLVQSLGRFAVSEHNRRLSHGGGPVNNGDPVKVQLVFTAVAAAQKQVASG  100

Query  139  VNYYLRIKAAN--SGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            V YYL++ A +   GG  R F+A + V     SKELV+L PS
Sbjct  101  VVYYLKVIARDRAGGGGDRPFDAVVVVKAWIKSKELVSLMPS  142



>ref|XP_004975327.1| PREDICTED: cysteine proteinase inhibitor 10-like [Setaria italica]
Length=135

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 4/100 (4%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAK----MLTFSEVIKAEKQVVAG  140
            R  I DV +N  +Q LG+  + E+N  L++      ++     +L+F  V  A++QVVAG
Sbjct  34   RRDIKDVGSNKLVQSLGQFAVAEHNRHLRRNGGVGTSSDPVTALLSFRAVAAAQQQVVAG  93

Query  139  VNYYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            V YYL++ A + GG  R F+A + V     SKELV+  PS
Sbjct  94   VAYYLKVIARDHGGGDRPFDAVVVVKAWLKSKELVSFTPS  133



>emb|CBI32827.3| unnamed protein product [Vitis vinifera]
Length=201

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 19/105 (18%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
            ++ +AEI+ + R  + E+N     KN  A    +L F++V+KA++QVVAG  YYL ++A 
Sbjct  13   IQNSAEIESIARFAVQEHN-----KNQNA----LLEFAKVLKAKEQVVAGKIYYLTLEAI  63

Query  109  NSGGEVRTFNAEMYVGPGESSKELV---------TLAPSSLSRRR  2
            ++G + + + A+++V P  + KEL          + APS L  ++
Sbjct  64   DAGKK-KIYEAKVWVKPWMNFKELQEFKHSQETKSFAPSDLGVKQ  107



>gb|ABK23526.1| unknown [Picea sitchensis]
 gb|ABK24580.1| unknown [Picea sitchensis]
 gb|ABK25596.1| unknown [Picea sitchensis]
 gb|ABK26416.1| unknown [Picea sitchensis]
 gb|ABR16656.1| unknown [Picea sitchensis]
 gb|ACN40019.1| unknown [Picea sitchensis]
 gb|ACN40233.1| unknown [Picea sitchensis]
 gb|ACN40884.1| unknown [Picea sitchensis]
 gb|ACN41060.1| unknown [Picea sitchensis]
Length=141

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + D + + E   LGR  + E+N   K++N        +TF  V+ A++QVVAG  Y+L I
Sbjct  43   VKDFQNSIETLDLGRFAVDEHN---KQQNGD------ITFRRVVAAQEQVVAGTMYHLTI  93

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +A + G   + + A+++V P E+ K L    P
Sbjct  94   EAED-GDHPKLYKAKVWVKPWENFKRLEDFKP  124



>gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta]
Length=205

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 57/94 (61%), Gaps = 10/94 (11%)
 Frame = -1

Query  304  IPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYL  125
            + ++  + +AE+++L R  + E+N    KK N      +L FS ++KA++QVV+G+ ++L
Sbjct  8    VDVEGAQNSAEVEELARFAVDEHN----KKENA-----LLQFSRLVKAKQQVVSGIMHHL  58

Query  124  RIKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
             ++    GG+ + + A+++V    +SK+L   +P
Sbjct  59   TVEVI-EGGKKKVYEAKVWVQAWLNSKKLHEFSP  91



>ref|XP_010494993.1| PREDICTED: cysteine proteinase inhibitor 5-like [Camelina sativa]
Length=122

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 11/100 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK +  + ++G   ++EY+   K           L F  V+  E QVVAG NY L 
Sbjct  31   PISDVK-DPHVVEIGEFAVSEYDKRSKLG---------LKFETVVSGETQVVAGTNYRLT  80

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRRR  2
            + AAN GG  + + A ++  P      L +  P +  RRR
Sbjct  81   V-AANDGGASKNYEAMVWEKPWLKFMNLTSFKPVNNGRRR  119



>ref|XP_004308672.1| PREDICTED: cysteine proteinase inhibitor 6-like [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 10/84 (12%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            E  +L R  + E+N   KK+N       +L F  V+K ++QVV+G  YYL I+A + GG+
Sbjct  94   ETDELARFAVQEHN---KKEN------ALLEFVRVVKTKEQVVSGTVYYLTIEATD-GGQ  143

Query  94   VRTFNAEMYVGPGESSKELVTLAP  23
             + F A+++V P  + KE+    P
Sbjct  144  KKLFEAKVWVKPWLNFKEVQEFKP  167



>ref|XP_006346810.1| PREDICTED: cysteine proteinase inhibitor 5-like [Solanum tuberosum]
Length=134

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 11/96 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI ++ TN E+ ++G+  + E+N   K K         L F E+ + E QVVAG+NY L 
Sbjct  40   PITNL-TNPEVVEIGKFAVDEHNKEAKTK---------LKFQEITEGESQVVAGINYRLV  89

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSL  14
            I A +S      + AE++  P E  + L +    SL
Sbjct  90   ISAKDSDSP-HNYLAEVWDKPWEKFRNLTSFVECSL  124



>ref|XP_002465060.1| hypothetical protein SORBIDRAFT_01g031460 [Sorghum bicolor]
 gb|EER92058.1| hypothetical protein SORBIDRAFT_01g031460 [Sorghum bicolor]
Length=123

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 53/98 (54%), Gaps = 18/98 (18%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEY----NNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVN  134
            PI +V +   IQ+LG   +TE+    N+GL+             F EV   E+QVV+G+N
Sbjct  39   PIRNV-SEPHIQELGGWAVTEHVRVANDGLR-------------FGEVTSGEQQVVSGMN  84

Query  133  YYLRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPS  20
            Y L + A ++ G+V  + A +Y     +++EL++ A +
Sbjct  85   YRLVLHATDADGDVAAYGALVYEQSWTNTRELMSFASA  122



>ref|XP_007153810.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
 gb|ESW25804.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
Length=126

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 45/87 (52%), Gaps = 4/87 (5%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I D KTN E+Q LGR  + E N  LK+         ++ F  V++A+KQVV+G  YYL+I
Sbjct  37   IADAKTNQEVQDLGRFAVDERNRKLKE---SGAMRPVVAFVTVLEAQKQVVSGTKYYLKI  93

Query  118  KAANSGGEVRTFNAEMYVGPGESSKEL  38
                +          + V  G SSKEL
Sbjct  94   STNQNEARESVIYDSVVVVKG-SSKEL  119



>gb|AGX28142.1| cysteine protease inhibitor, partial [Populus euphratica]
Length=107

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N    KK N      +L F+ V+KA++QVVAG  ++L I+A+ 
Sbjct  14   QNSAEIDSLARFAVDEHN----KKENA-----ILEFARVVKAKEQVVAGTMHHLTIEASE  64

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  65   AGKK-KLYEAKVWVKPWLNFKEL  86



>emb|CAH57551.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       ML F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AMLEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>ref|XP_003532730.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=103

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 5/87 (6%)
 Frame = -1

Query  277  AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN--S  104
            A +Q LGR  + E+N  L++              EV++A+ QVV+G+ YY++I A     
Sbjct  2    AVVQDLGRFSVEEHNRMLRQAQKEEEEVTF---EEVVEAQSQVVSGIKYYMKISATQGGD  58

Query  103  GGEVRTFNAEMYVGPGESSKELVTLAP  23
            GG+ R F + + V P   SK+L+  AP
Sbjct  59   GGDSRIFESVVVVKPWLRSKQLLNFAP  85



>ref|XP_002283400.1| PREDICTED: cysteine proteinase inhibitor 12-like [Vitis vinifera]
Length=234

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 59/101 (58%), Gaps = 19/101 (19%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
            ++ +AEI+ + R  + E+N     KN  A    +L F++V+KA++QVVAG  YYL ++A 
Sbjct  46   IQNSAEIESIARFAVQEHN-----KNQNA----LLEFAKVLKAKEQVVAGKIYYLTLEAI  96

Query  109  NSGGEVRTFNAEMYVGPGESSKELV---------TLAPSSL  14
            ++G + + + A+++V P  + KEL          + APS L
Sbjct  97   DAGKK-KIYEAKVWVKPWMNFKELQEFKHSQETKSFAPSDL  136



>ref|XP_010910533.1| PREDICTED: cysteine proteinase inhibitor 1-like [Elaeis guineensis]
Length=119

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 11/93 (12%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI +V  +A +Q++ +  ++E+N          +    L FS+V+K E QVV+G+NY L 
Sbjct  35   PIKNV-NDAHVQEIAKFAVSEHNK---------LANSRLAFSKVVKGETQVVSGINYRLV  84

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            ++A N GG +  + A ++    E  ++L +  P
Sbjct  85   VEAKN-GGAMAKYEAIVWEKAWEGFRKLTSFQP  116



>ref|XP_002531171.1| Cysteine proteinase inhibitor, putative [Ricinus communis]
 gb|EEF31214.1| Cysteine proteinase inhibitor, putative [Ricinus communis]
Length=119

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 12/93 (13%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI+++ T+  + ++G+  + EYN   + K N       L    ++K E QVVAG NY L 
Sbjct  36   PINNL-TDPHVVEIGKFAVREYNK--RSKTN-------LELKSIVKGESQVVAGTNYKLV  85

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +  A SGG+ + + A ++  P E  +EL +  P
Sbjct  86   L--AVSGGDSKKYEAVVWEKPWEKFRELTSFKP  116



>ref|XP_007216188.1| hypothetical protein PRUPE_ppa015901mg, partial [Prunus persica]
 gb|EMJ17387.1| hypothetical protein PRUPE_ppa015901mg, partial [Prunus persica]
Length=139

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I+DVK N E+Q+LG   + E +N  ++K++ +   + + F EV+K ++Q+V+G+ YYL++
Sbjct  1    IEDVKMNKEVQELGTFSM-EQDNQSQRKSHQSNVGEEIQFLEVVKEQRQMVSGIKYYLKV  59



>emb|CAN78115.1| hypothetical protein VITISV_031522 [Vitis vinifera]
 emb|CBI24312.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI+ L R  + E+N   KK+N       +L F+ V+K  +QVVAG  YY+ + A + GG+
Sbjct  18   EIENLARFAVDEHN---KKQNT------LLEFNGVVKVRQQVVAGTIYYITLDATD-GGK  67

Query  94   VRTFNAEMYVGPGESSKELVTLAP  23
               + A+++V P  + KEL    P
Sbjct  68   KNKYEAKIWVKPWLNFKELQEFKP  91



>ref|XP_002277752.1| PREDICTED: cysteine proteinase inhibitor 5-like [Vitis vinifera]
Length=112

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (53%), Gaps = 12/93 (13%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI+DVK N  +Q++G+  +  +N          +TA  L F  VIK + QVVAG NY L 
Sbjct  31   PIEDVK-NPHVQEIGKFAVEAHNK---------LTATKLKFQSVIKGQTQVVAGTNYRLT  80

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            + A N G   + + A ++    + +K+L +  P
Sbjct  81   VMAKN-GAASKKYEAVVWEKL-DGTKQLTSFQP  111



>ref|XP_004493324.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum]
Length=230

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 53/86 (62%), Gaps = 10/86 (12%)
 Frame = -1

Query  295  DDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIK  116
            +D    AEI+ L R  + ++NN   K+N       +L F +V+KA++QVVAG  YYL ++
Sbjct  40   EDTPKVAEIESLARFAVQQHNN---KENT------LLEFVKVLKAKEQVVAGKIYYLTLE  90

Query  115  AANSGGEVRTFNAEMYVGPGESSKEL  38
            A ++G + + + A+++V P  + K+L
Sbjct  91   AVDAGKK-KIYEAKIWVKPWMNFKQL  115



>ref|XP_009361915.1| PREDICTED: cysteine proteinase inhibitor A-like [Pyrus x bretschneideri]
Length=95

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 51/88 (58%), Gaps = 10/88 (11%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            E + L R  + E+N   KK+N+      +L F  V+  + QVV+G  +YL+I+A + GG+
Sbjct  18   ETENLARYAVDEHN---KKEND------LLEFVRVLDDKVQVVSGTMHYLKIEATD-GGK  67

Query  94   VRTFNAEMYVGPGESSKELVTLAPSSLS  11
             + + A+++V P E+ K++    P S S
Sbjct  68   KKVYEAKVWVKPWENFKQVQEFKPVSDS  95



>ref|XP_007153804.1| hypothetical protein PHAVU_003G066000g [Phaseolus vulgaris]
 gb|ESW25798.1| hypothetical protein PHAVU_003G066000g [Phaseolus vulgaris]
Length=102

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -1

Query  307  RIPIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            +  I +VK N E+Q LGR  + E N  +K+K   A    ++ F +V++A+KQ V+G  YY
Sbjct  10   KTEIANVKMNKEVQDLGRFAVDERNRNVKEK---AFARPIVAFVQVLEAQKQEVSGTKYY  66

Query  127  LRI  119
            L+I
Sbjct  67   LKI  69



>ref|XP_010031030.1| PREDICTED: cysteine proteinase inhibitor 12 [Eucalyptus grandis]
 gb|KCW50300.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=239

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 53/83 (64%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + + E++ LGR  + E+N+   K+N       +L F+ V+KA +QVVAG  ++L I+A +
Sbjct  52   ENSVEVESLGRFAVDEHNS---KENG------LLEFARVVKAHEQVVAGTLHHLTIEAVD  102

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  +SKEL
Sbjct  103  AGKK-KLYEAKIWVRPWMNSKEL  124



>gb|KCW50301.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=218

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 53/83 (64%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + + E++ LGR  + E+N+   K+N       +L F+ V+KA +QVVAG  ++L I+A +
Sbjct  52   ENSVEVESLGRFAVDEHNS---KENG------LLEFARVVKAHEQVVAGTLHHLTIEAVD  102

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  +SKEL
Sbjct  103  AGKK-KLYEAKIWVRPWMNSKEL  124



>prf||2203261A Cys protease inhibitor
Length=100

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = -1

Query  280  NAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSG  101
            +AE ++L R  + E+N   KK N        L FS V+KA++QVVAG  YY+ ++   + 
Sbjct  14   SAETEELARFAVQEHN---KKANT------RLEFSRVVKAKEQVVAGTMYYITLEVVEA-  63

Query  100  GEVRTFNAEMYVGPGESSKELVTLAP  23
            G+ + + A+++V   E+ KEL    P
Sbjct  64   GQKKIYEAKVWVKLWENFKELQEFKP  89



>ref|XP_002268378.1| PREDICTED: cysteine proteinase inhibitor A [Vitis vinifera]
 ref|XP_003632227.1| PREDICTED: cysteine proteinase inhibitor A [Vitis vinifera]
Length=124

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 10/84 (12%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI+ L R  + E+N   KK+N       +L F+ V+K  +QVVAG  YY+ + A + GG+
Sbjct  41   EIENLARFAVDEHN---KKQNT------LLEFNGVVKVRQQVVAGTIYYITLDATD-GGK  90

Query  94   VRTFNAEMYVGPGESSKELVTLAP  23
               + A+++V P  + KEL    P
Sbjct  91   KNKYEAKIWVKPWLNFKELQEFKP  114



>gb|ABK22339.1| unknown [Picea sitchensis]
Length=231

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + D + + E   LGR  + E+N   K++N        +TF  V+ A++QVVAG  Y+L I
Sbjct  43   VKDFQNSIETLDLGRFAVDEHN---KQQNGD------ITFRRVVAAQEQVVAGTMYHLTI  93

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +A + G   + + A+++V P E+ K L    P
Sbjct  94   EAED-GDHPKLYKAKVWVKPWENFKRLEDFKP  124



>emb|CAH57571.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARLAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + R + A+++V P  + KEL
Sbjct  100  AGKK-RLYEAKVWVKPWLNFKEL  121



>gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis]
Length=95

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
            V  + E + L R  + E+N   KK+N+      +L F  V+  + QVV+G  +YL+I+A 
Sbjct  13   VANSVETESLARYAVDEHN---KKEND------LLEFVRVLDDKVQVVSGTMHYLKIEAT  63

Query  109  NSGGEVRTFNAEMYVGPGESSKELVTLAPSSLS  11
              GG+ + + A+++V P E+ K++    P S S
Sbjct  64   -EGGKKKVYEAKVWVKPWENFKQVQEFKPVSDS  95



>gb|ABK22677.1| unknown [Picea sitchensis]
 gb|ABK25151.1| unknown [Picea sitchensis]
 gb|ABK26069.1| unknown [Picea sitchensis]
 gb|ABR17453.1| unknown [Picea sitchensis]
 gb|ACN40099.1| unknown [Picea sitchensis]
 gb|ACN40953.1| unknown [Picea sitchensis]
Length=141

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + D + + E   LGR  + E+N   K++N        ++F  V+ A++QVVAG  Y+L I
Sbjct  43   VKDFQNSIETLDLGRFAVDEHN---KQQNGD------ISFRRVVAAQEQVVAGTMYHLTI  93

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +A + G   + + A+++V P E+ K L    P
Sbjct  94   EAED-GDHPKLYKAKVWVKPWENFKRLEDFKP  124



>ref|NP_001106013.1| cystatin2 precursor [Zea mays]
 dbj|BAA07327.1| cystatin II [Zea mays]
Length=134

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 15/96 (16%)
 Frame = -1

Query  298  IDDVKTNA---EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            I DV  N     +Q+L R  + E+N    KK N      +L F +++KA+ QVVAG  YY
Sbjct  43   IQDVPENENDLHLQELARFAVDEHN----KKANA-----LLGFEKLVKAKTQVVAGTMYY  93

Query  127  LRIKAANSGGEVRT-FNAEMYVGPGESSKELVTLAP  23
            L I+  +  GEV+  + A+++  P E  KEL    P
Sbjct  94   LTIEVKD--GEVKKLYEAKVWEKPWEKFKELQEFKP  127



>ref|XP_010245150.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera]
Length=204

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 54/95 (57%), Gaps = 10/95 (11%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
            V+ + EI+ LGR  + EYN   KK+N       +L F  V++A++Q+VAG  ++L ++  
Sbjct  16   VQNSVEIESLGRFAVDEYN---KKQN------ALLEFGRVVEAKEQLVAGTLHHLTLEVT  66

Query  109  NSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRR  5
             +G + + + A+++V P  + KEL    P S   R
Sbjct  67   EAGMK-KLYEAKVWVKPWLNFKELQEFTPVSDDPR  100



>gb|ABK26812.1| unknown [Picea sitchensis]
Length=231

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            + D + + E   LGR  + E+N   K++N        +TF  V+ A++QVVAG  Y+L I
Sbjct  43   VKDFQNSIETLDLGRFAVDEHN---KQQNGD------ITFRRVVAAQEQVVAGTMYHLTI  93

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            +A + G   + + A+++V P E+ K L    P
Sbjct  94   EAED-GDHPKLYKAKVWVKPWENFKRLEDFKP  124



>ref|XP_009383251.1| PREDICTED: cysteine proteinase inhibitor A-like [Musa acuminata 
subsp. malaccensis]
Length=136

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 10/84 (12%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
             + +AEIQ L R  + EYN   KK+N       +L F +++KA++QVVAG  YYL ++  
Sbjct  47   FQNSAEIQGLARFAVEEYN---KKQN------ALLEFIQLLKAKEQVVAGKMYYLTVQ-T  96

Query  109  NSGGEVRTFNAEMYVGPGESSKEL  38
            N+ G+   + A+++V P  +  EL
Sbjct  97   NNCGKKNHYEAKVWVKPWMNFMEL  120



>emb|CDY66113.1| BnaCnng49600D [Brassica napus]
Length=120

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 17/100 (17%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            P  DVK NA I ++G   ++EYN   K           L F EV+  + Q+VAG+NY L 
Sbjct  31   PTSDVK-NAHIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGKSQIVAGMNYRL-  79

Query  121  IKAANSG------GEVRTFNAEMYVGPGESSKELVTLAPS  20
            I AAN G      GE + + A ++  P   S  L +  P+
Sbjct  80   IVAANEGVAIAGNGESKKYEAIVWEKPWLKSMNLTSFKPA  119



>ref|XP_009384360.1| PREDICTED: cysteine proteinase inhibitor A-like [Musa acuminata 
subsp. malaccensis]
Length=99

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 9/83 (11%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + ++++++L R  I E+N    KK N       L    V+K ++QVVAG  YYL ++A  
Sbjct  14   QNSSKVEELARFAIDEHN----KKANAT-----LELVGVVKVKEQVVAGQMYYLTLEAKE  64

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            S GE + + A+++V P    KEL
Sbjct  65   SNGEKKLYEAKIWVKPWMDFKEL  87



>ref|XP_010481310.1| PREDICTED: cysteine proteinase inhibitor 5-like [Camelina sativa]
Length=124

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 11/100 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK +  + ++G   ++EY+   K           L F  V+  E QVV+G NY L 
Sbjct  33   PISDVK-DPHVVEIGEFAVSEYDKRSKLG---------LKFETVVSGETQVVSGTNYRLT  82

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRRR  2
            + AAN GG  + + A ++  P      L +  P +  RRR
Sbjct  83   V-AANDGGASKNYEAMVWEKPWLKFMNLTSFKPVNNGRRR  121



>gb|AGX28141.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28143.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28144.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28145.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28146.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28147.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28148.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28149.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28150.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28151.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28152.1| cysteine protease inhibitor, partial [Populus pruinosa]
Length=107

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N    KK N      +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  14   QNSAEIDSLARFAVDEHN----KKENA-----ILEFARVVKAKEQVVAGTMHHLTIEAIE  64

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  65   AGKK-KLYEAKVWVKPWLNFKEL  86



>dbj|BAB21558.1| cystatin [Coix lacryma-jobi]
Length=135

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 15/96 (16%)
 Frame = -1

Query  298  IDDVKTNA---EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            I DV  N     +Q+L R  + E+N    KK N      +L + +++KA+ QVVAG  YY
Sbjct  44   IKDVPANENDLHLQELARFAVDEHN----KKANA-----LLGYEKLVKAKTQVVAGTMYY  94

Query  127  LRIKAANSGGEVRT-FNAEMYVGPGESSKELVTLAP  23
            L I+  +  GEV+  + A+++  P E+ KEL+   P
Sbjct  95   LTIEVKD--GEVKKLYEAKVWEKPWENFKELLEFKP  128



>pdb|2W9P|A Chain A, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|B Chain B, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|C Chain C, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|D Chain D, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|E Chain E, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|F Chain F, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|G Chain G, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|H Chain H, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|I Chain I, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|J Chain J, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|K Chain K, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|L Chain L, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|M Chain M, Crystal Structure Of Potato Multicystatin
 pdb|2W9P|N Chain N, Crystal Structure Of Potato Multicystatin
 pdb|2W9Q|A Chain A, Crystal Structure Of Potato Multicystatin-P212121
Length=87

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 9/84 (11%)
 Frame = -1

Query  280  NAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSG  101
            N + Q+L R  I +YN    KK N       L F E +  ++QVVAG+ YY+ + A +  
Sbjct  10   NTKFQELARFAIQDYN----KKQNA-----HLEFVENLNVKEQVVAGIMYYITLAATDDA  60

Query  100  GEVRTFNAEMYVGPGESSKELVTL  29
            G+ + + A+++V   E  K++V  
Sbjct  61   GKKKIYKAKIWVKEWEDFKKVVEF  84



>gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa]
Length=143

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDSLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>gb|ACO39793.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N    KK N      +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  33   QNSAEIDSLARFAVDEHN----KKENA-----ILEFARVVKAKEQVVAGTMHHLTIEAVE  83

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P    KEL
Sbjct  84   AGKK-KLYEAKVWVKPWLHFKEL  105



>ref|XP_010441439.1| PREDICTED: cysteine proteinase inhibitor 5-like [Camelina sativa]
Length=124

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 11/100 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK +  + ++G   ++EY+   K           L F  V+  E QVV+G NY L 
Sbjct  33   PISDVK-DPHVVEIGEFAVSEYDKRSKLG---------LKFETVVSGETQVVSGTNYRLT  82

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSRRR  2
            + AAN GG  + + A ++  P      L +  P +  RRR
Sbjct  83   V-AANDGGASKNYEAMVWEKPWLKFMNLTSFKPVNNGRRR  121



>ref|XP_001771745.1| predicted protein [Physcomitrella patens]
 gb|EDQ63353.1| predicted protein [Physcomitrella patens]
Length=139

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 55/97 (57%), Gaps = 8/97 (8%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I +   + EI +L    + +Y +   ++N+ A+    +TFS+V+ A++QVV G  YY  I
Sbjct  9    ISNFPNSVEIDELANFAVDQYKS---RQNSIAV----ITFSKVLSAKEQVVQGKMYYFTI  61

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAPSSLSR  8
            +   +G   + ++A+++V P E  KEL +  PS+ S 
Sbjct  62   EVMENGVP-KNYDAKVWVKPWEGYKELESFLPSAPSH  97



>dbj|BAA09666.1| cysteine proteinase inhibitor [Zea mays]
 gb|AAY57865.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 emb|CAJ20024.1| putative cystatin [Zea mays]
 gb|AFW84824.1| cystatin2 [Zea mays]
 emb|CEJ09685.1| Cystatin protein [Zea mays]
Length=134

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 15/96 (16%)
 Frame = -1

Query  298  IDDVKTNA---EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            I DV  N     +Q+L R  + E+N    KK N      +L F +++KA+ QVVAG  YY
Sbjct  43   IKDVPGNENDLHLQELARFAVDEHN----KKANA-----LLGFEKLVKAKTQVVAGTMYY  93

Query  127  LRIKAANSGGEVRT-FNAEMYVGPGESSKELVTLAP  23
            L I+  +  GEV+  + A+++  P E+ KEL    P
Sbjct  94   LTIEVKD--GEVKKLYEAKVWEKPWENFKELQEFKP  127



>ref|XP_011070080.1| PREDICTED: cysteine proteinase inhibitor isoform X1 [Sesamum 
indicum]
Length=167

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (57%), Gaps = 10/90 (11%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            K +AEI+++GR  + ++NN              L F+ V++A++QVVAG  Y+L ++A +
Sbjct  80   KNSAEIERIGRFAVQQHNNN---------QNTFLEFARVLEAKEQVVAGKMYHLTLEAVD  130

Query  106  SGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
             GGE + + A+++  P  + K+L      S
Sbjct  131  -GGEKKMYGAKIWEKPWMNFKQLQEFKQRS  159



>ref|XP_009114124.1| PREDICTED: cysteine proteinase inhibitor 5-like [Brassica rapa]
Length=120

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 48/100 (48%), Gaps = 17/100 (17%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI DVK NA I ++G   ++EYN   K           L F EV+  E Q+ AG+NY L 
Sbjct  31   PISDVK-NARIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGESQIAAGMNYRL-  79

Query  121  IKAANSG------GEVRTFNAEMYVGPGESSKELVTLAPS  20
            I A N G      GE + + A ++  P   S  L +  P+
Sbjct  80   ILADNEGVAIAGNGESKKYEAVVWEKPWLKSMNLTSFKPA  119



>gb|KCW50299.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=240

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 53/83 (64%), Gaps = 9/83 (11%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + + E++ LGR  + E+N+  K+ N       +L F+ V+KA +QVVAG  ++L I+A +
Sbjct  52   ENSVEVESLGRFAVDEHNS--KEVNG------LLEFARVVKAHEQVVAGTLHHLTIEAVD  103

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  +SKEL
Sbjct  104  AGKK-KLYEAKIWVRPWMNSKEL  125



>gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39783.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39803.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N    KK N      +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  33   QNSAEIDSLARFAVDEHN----KKENA-----ILEFARVVKAKEQVVAGTMHHLTIEAVE  83

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  84   AGKK-KLYEAKVWVKPWLNFKEL  105



>emb|CAA60610.1| cysteine proteinase inhibitor [Zea mays]
Length=134

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 15/96 (16%)
 Frame = -1

Query  298  IDDVKTNA---EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            I DV  N     +Q+L R  + E+N    KK N      +L F +++KA+ QVVAG  YY
Sbjct  43   IKDVPGNENDLHLQELARFAVDEHN----KKANA-----LLGFEKLVKAKTQVVAGTMYY  93

Query  127  LRIKAANSGGEVRT-FNAEMYVGPGESSKELVTLAP  23
            L I+  +  GEV+  + A+++  P E+ KEL    P
Sbjct  94   LTIEVKD--GEVKKLYEAKVWEKPWENFKELQEFKP  127



>ref|XP_011070083.1| PREDICTED: cysteine proteinase inhibitor isoform X3 [Sesamum 
indicum]
Length=159

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            K +AEI+++GR  + ++NN              L F+ V++A++QVVAG  Y+L ++A +
Sbjct  80   KNSAEIERIGRFAVQQHNNN---------QNTFLEFARVLEAKEQVVAGKMYHLTLEAVD  130

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
             GGE + + A+++  P  + K+L
Sbjct  131  -GGEKKMYGAKIWEKPWMNFKQL  152



>emb|CAH57539.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  I E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAIDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39759.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39760.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39761.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39762.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39763.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39764.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39765.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39766.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39767.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39768.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39769.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39770.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39771.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39772.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39773.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39774.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39775.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39776.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39777.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39778.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39779.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39780.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39781.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39784.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39785.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39786.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39787.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39788.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39789.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39790.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39791.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39792.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39794.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39795.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39796.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39797.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39798.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39799.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39800.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39801.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39802.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39804.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39805.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39806.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39807.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39808.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39809.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39810.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39811.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39812.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39813.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39814.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39815.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39816.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39817.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39818.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39819.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39820.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39821.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39822.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39823.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39824.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39825.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39826.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39827.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39828.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39829.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39830.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39831.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39832.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39833.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39834.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39835.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39836.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39837.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39838.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39839.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39840.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39841.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N    KK N      +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  33   QNSAEIDSLARFAVDEHN----KKENA-----ILEFARVVKAKEQVVAGTMHHLTIEAVE  83

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  84   AGKK-KLYEAKVWVKPWLNFKEL  105



>ref|XP_011070084.1| PREDICTED: cysteine proteinase inhibitor isoform X4 [Sesamum 
indicum]
Length=158

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            K +AEI+++GR  + ++NN              L F+ V++A++QVVAG  Y+L ++A +
Sbjct  80   KNSAEIERIGRFAVQQHNNN---------QNTFLEFARVLEAKEQVVAGKMYHLTLEAVD  130

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
             GGE + + A+++  P  + K+L
Sbjct  131  -GGEKKMYGAKIWEKPWMNFKQL  152



>ref|XP_011070081.1| PREDICTED: cysteine proteinase inhibitor isoform X2 [Sesamum 
indicum]
Length=161

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            K +AEI+++GR  + ++NN              L F+ V++A++QVVAG  Y+L ++A +
Sbjct  80   KNSAEIERIGRFAVQQHNNN---------QNTFLEFARVLEAKEQVVAGKMYHLTLEAVD  130

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
             GGE + + A+++  P  + K+L
Sbjct  131  -GGEKKMYGAKIWEKPWMNFKQL  152



>gb|AEQ54767.1| cysteine proteinase inhibitor CPI-2 [Coffea canephora]
 emb|CDP09706.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI+ L +  + +YN    KK N      +L F +VI +++QVVAG  YYL I+  + G E
Sbjct  18   EIESLAKFAVDDYN----KKQNA-----LLEFQKVINSKEQVVAGTVYYLTIEVKD-GNE  67

Query  94   VRTFNAEMYVGPGESSKELVTLAPSS  17
             + + A+++V P  + KE+    P++
Sbjct  68   KKLYEAKVWVKPWLNFKEVQEFKPAA  93



>ref|XP_010465015.1| PREDICTED: cysteine proteinase inhibitor 6 [Camelina sativa]
Length=230

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + DV +N    E++ L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++
Sbjct  39   VRDVPSNQNSGEVESLARFAVDEHN---KKEN------ALLEFARVVKAKEQVVAGTLHH  89

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++   + GE + + A+++V P  + KEL    P+S
Sbjct  90   LTLEILEA-GEKKLYEAKVWVKPWLNFKELQEFKPAS  125



>ref|XP_008455746.1| PREDICTED: cysteine proteinase inhibitor A [Cucumis melo]
Length=122

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 50/83 (60%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            +   EI+ L R  + E+NN   K+N       +L F  V+KA++QVVAG  Y+L ++A +
Sbjct  43   QNRVEIESLARFAVQEHNN---KENG------LLEFDRVLKAKEQVVAGKLYHLTLEAID  93

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
             GG+ + + A+++V P  + K+L
Sbjct  94   -GGKKKVYEAKVWVKPWMNFKQL  115



>gb|AAY57859.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 15/96 (16%)
 Frame = -1

Query  298  IDDV---KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            I DV   + +  +Q+L R  + E+N    KK N      +L F +++KA+ QVVAG  YY
Sbjct  43   IQDVPGSENDLHLQELARFAVDEHN----KKANA-----LLGFEKLVKAKTQVVAGTMYY  93

Query  127  LRIKAANSGGEVRT-FNAEMYVGPGESSKELVTLAP  23
            L I+  +  GEV+  + A+++  P E+ KEL    P
Sbjct  94   LTIEVKD--GEVKKLYEAKVWEKPWENFKELQEFKP  127



>ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12 [Vitis vinifera]
Length=201

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 19/105 (18%)
 Frame = -1

Query  289  VKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAA  110
             + +AEI  L R  + E+N   KK+N       +L F+ V+KAE+QVVAG  ++L ++  
Sbjct  13   TQNSAEIDSLARFAVEEHN---KKEN------ALLEFARVVKAEEQVVAGTLHHLTLEVI  63

Query  109  NSGGEVRTFNAEMYVGPGESSKELV---------TLAPSSLSRRR  2
            ++G + + + A+++V P  + KEL          TL PS L  ++
Sbjct  64   DAGRK-KLYEAKVWVKPWMNFKELQEFKHAGDVPTLTPSDLGVKK  107



>ref|XP_009394087.1| PREDICTED: cysteine proteinase inhibitor-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI++L R  + E+N    KK N      +L F+ V+KA++QVV G  ++L ++A +
Sbjct  46   QNSAEIEELARFAVDEHN----KKENA-----LLEFARVVKAKEQVVTGTLHHLTVEAID  96

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P    KEL
Sbjct  97   AGKK-KLYEAKVWVKPWLHFKEL  118



>ref|XP_010499025.1| PREDICTED: cysteine proteinase inhibitor 6-like [Camelina sativa]
Length=232

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + DV +N    E++ L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++
Sbjct  41   VRDVPSNQNSGEVESLARFAVDEHN---KKEN------ALLEFARVVKAKEQVVAGTLHH  91

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++   + GE + + A+++V P  + KEL    P+S
Sbjct  92   LTLEILEA-GEKKLYEAKVWVKPWLNFKELQEFKPAS  127



>ref|XP_010505846.1| PREDICTED: cysteine proteinase inhibitor 3-like [Camelina sativa]
Length=132

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 52/88 (59%), Gaps = 10/88 (11%)
 Frame = -1

Query  280  NAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSG  101
            + EI+ L R  I E+N   K++N       +L F+++++A +QVVAG  Y+L ++ A  G
Sbjct  54   SGEIESLARFAIQEHN---KQQN------MVLEFTKIVRAREQVVAGTMYHLTLE-AKEG  103

Query  100  GEVRTFNAEMYVGPGESSKELVTLAPSS  17
             +++ F A+++V P  + K+L     +S
Sbjct  104  DQMKNFEAKVWVKPWMNFKQLQEFKETS  131



>gb|AAF72202.1|AF265551_1 cysteine protease inhibitor [Manihot esculenta]
Length=101

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 50/92 (54%), Gaps = 10/92 (11%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            +++   + EI  L R  + +YN   KK+N       +L F  V+  ++QVVAG  YY+ +
Sbjct  10   VEESANSVEIDNLARFAVDDYN---KKQN------ALLEFKRVVSTKQQVVAGTMYYITL  60

Query  118  KAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            + A+ GG+ + + A+++  P  + KE+    P
Sbjct  61   EVAD-GGQTKVYEAKVWEKPWLNFKEVQEFKP  91



>ref|XP_004239826.1| PREDICTED: cysteine proteinase inhibitor 5-like [Solanum lycopersicum]
Length=129

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 13/93 (14%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            I D K ++++ ++G+  + +YN   K K         L F  V+K E QVVAG NY L I
Sbjct  44   ITDTK-DSKVAEIGKFAVDQYNENTKSK---------LVFKRVVKGETQVVAGTNYRLVI  93

Query  118  KAANSGGEVRT---FNAEMYVGPGESSKELVTL  29
             A + G   R+   + AE++  P  S + L + 
Sbjct  94   SATDGGRRSRSGDKYLAEVWDKPWMSWRNLTSF  126



>emb|CDP06249.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + N EI+ +GR  + E+N    KK N      +L F  VIKA++QVVAG  Y+L ++A +
Sbjct  51   QNNGEIESIGRFAVQEHN----KKENA-----LLEFGRVIKAKEQVVAGKVYHLTLEAID  101

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + K+L
Sbjct  102  AGKK-QIYEAKVWVKPWMNFKKL  123



>ref|XP_010031687.1| PREDICTED: cysteine proteinase inhibitor A-like [Eucalyptus grandis]
 ref|XP_010031688.1| PREDICTED: cysteine proteinase inhibitor A-like [Eucalyptus grandis]
 gb|KCW51051.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
 gb|KCW51052.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
 gb|KCW51053.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
 gb|KCW51054.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
Length=101

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 15/101 (15%)
 Frame = -1

Query  298  IDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRI  119
            +D  +   EI+ L R  + E+N    KK+N      ML + +V+KA++QVVAG  YY+ I
Sbjct  10   VDGKENTLEIEGLARFAVEEHN----KKDNA-----MLQYVKVVKAKEQVVAGTVYYITI  60

Query  118  KAANSGGEVRTFNAEMYVGPGESSKE-----LVTLAPSSLS  11
            +A + G   + + A+++V P  + KE     LV  AP   S
Sbjct  61   EAKD-GDAKKLYEAKVWVKPWMNFKEVQEFKLVEGAPGESS  100



>emb|CAH57573.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>emb|CAH57557.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>emb|CAH57534.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57535.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57536.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57552.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57556.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57561.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57565.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57566.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57569.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57575.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57576.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>ref|XP_011090213.1| PREDICTED: cysteine proteinase inhibitor A-like [Sesamum indicum]
Length=97

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 50/88 (57%), Gaps = 10/88 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            P++  + + EI  L R  + E     KK+N       +L F +V+ A++QVVAG  YY+ 
Sbjct  11   PVEGAQNSTEINDLARFAVNEQQ---KKENT------LLEFKKVLSAKEQVVAGTMYYIT  61

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKEL  38
            ++A   GG+ + + A+++V P  + KE+
Sbjct  62   LEAV-EGGKSKVYEAKVWVKPWMNFKEV  88



>gb|AAL79831.1|AF469485_1 cystatin [Sandersonia aurantiaca]
Length=110

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 53/83 (64%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +A++++L R  + E+N   KK+N       +L F  V+KA++QVVAG  ++L ++A +
Sbjct  15   ENSADVEELARFAVAEHN---KKEN------ALLEFGRVVKAKEQVVAGTLHHLTVEAID  65

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  66   AGNK-KLYEAKVWVKPWLNFKEL  87



>gb|ABK20186.1| cysteine protease inhibitor [Populus tomentosa]
Length=143

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDSLARFPVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>ref|XP_010486966.1| PREDICTED: cysteine proteinase inhibitor 6-like [Camelina sativa]
Length=232

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + DV +N    E++ L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++
Sbjct  41   VRDVPSNQNSGEVESLARFAVDEHN---KKEN------ALLEFARVVKAKEQVVAGTLHH  91

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++   + GE + + A+++V P  + KEL    P+S
Sbjct  92   LTLEILEA-GEKKLYEAKVWVKPWLNFKELQEFKPAS  127



>ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trichocarpa]
 gb|EEE78934.1| cysteine proteinase inhibitor [Populus trichocarpa]
Length=235

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDSLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAVE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>emb|CAH57538.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57543.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57544.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57558.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57563.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>emb|CAH57560.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57572.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>emb|CAH57541.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57542.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGTMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



>ref|XP_006449877.1| hypothetical protein CICLE_v10017209mg [Citrus clementina]
 gb|ESR63117.1| hypothetical protein CICLE_v10017209mg [Citrus clementina]
Length=118

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 11/93 (12%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI+D K    + ++G+  +TEYN    K++  A     L F  V K E QVV+G NY L 
Sbjct  34   PIEDPK-EKHVMEIGQFAVTEYN----KRSKSA-----LKFESVEKGETQVVSGTNYRL-  82

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            I     G   + F A ++  P E  K L +  P
Sbjct  83   ILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKP  115



>gb|ADD69946.1| cysteine protease inhibitor [Knorringia sibirica]
Length=111

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 53/89 (60%), Gaps = 10/89 (11%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            P++    + EI+ L +  + ++N    KK N      ML  S+V+ +++QVVAG  YY+ 
Sbjct  9    PVEGSANSLEIESLAKFAVEDHN----KKENA-----MLELSKVVSSKEQVVAGTMYYIT  59

Query  121  IKAANSGG-EVRTFNAEMYVGPGESSKEL  38
            ++A ++GG + + + A+++V P  + KE+
Sbjct  60   LEATDAGGKKKKVYEAKVWVKPWMNFKEV  88



>ref|XP_010909027.1| PREDICTED: cysteine proteinase inhibitor 6-like [Elaeis guineensis]
Length=243

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 10/79 (13%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI++LGR  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L ++   +G +
Sbjct  57   EIEELGRFAVQEHN---KKEN------ALLEFARVVKAKEQVVAGTLHHLTLEVMEAGKK  107

Query  94   VRTFNAEMYVGPGESSKEL  38
             + F A+++V P  + KEL
Sbjct  108  -KLFEAKVWVKPWLNFKEL  125



>gb|ABB89766.1| At3g12490-like protein [Boechera stricta]
Length=231

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + DV  N    E++ L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++
Sbjct  40   VRDVPANQNSGEVESLARFAVDEHN---KKEN------ALLEFARVVKAKEQVVAGTLHH  90

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++   + GE + + A+++V P  + KEL    P+S
Sbjct  91   LTLEILEA-GEKKLYEAKVWVKPWLNFKELQEFKPAS  126



>emb|CDY42150.1| BnaC05g40690D [Brassica napus]
Length=203

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 56/97 (58%), Gaps = 13/97 (13%)
 Frame = -1

Query  298  IDDVKTN---AEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYY  128
            + DV  N    E++ L R  + E+N   KK+N+      +L F+ V+KA++QVVAG  ++
Sbjct  7    VRDVPANQNSGEVESLARFAVDEHN---KKENS------LLEFARVVKAKEQVVAGTMHH  57

Query  127  LRIKAANSGGEVRTFNAEMYVGPGESSKELVTLAPSS  17
            L ++   +G + + + A+++V P  + KEL    P+S
Sbjct  58   LTLEIVEAGKK-KLYEAKVWVKPWLNFKELQEFKPAS  93



>ref|XP_010096012.1| Cysteine proteinase inhibitor 12 [Morus notabilis]
 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis]
Length=239

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 52/83 (63%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +A+++ L R  + E+N   KK+N       +L F+ V+KAE+QVVAG  ++L ++A  
Sbjct  49   ENSADVEDLARFAVQEHN---KKEN------ALLEFARVVKAEEQVVAGTLHHLTLEAI-  98

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
             GG+ + + A+++V P  + KEL
Sbjct  99   EGGKKKIYEAKVWVKPWLNFKEL  121



>ref|XP_006482025.1| PREDICTED: cysteine proteinase inhibitor 6-like [Citrus sinensis]
Length=222

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 52/83 (63%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI+ LGR  + E+N    KK N      +L F+ V+KA++QVVAG  YYL ++  +
Sbjct  42   QNSAEIEGLGRFAVQEHN----KKENA-----LLQFARVLKAKEQVVAGKLYYLTLEVID  92

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + K+L
Sbjct  93   AGKK-KIYEAKIWVKPWINFKQL  114



>gb|ABG89856.1| cystatin [Amaranthus hypochondriacus]
Length=247

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 52/81 (64%), Gaps = 10/81 (12%)
 Frame = -1

Query  280  NAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSG  101
            +AEI+ L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++  I+A ++G
Sbjct  57   DAEIESLARFAVDEHN---KKEN------ALLEFARVVKAKEQVVAGTLHHFTIEAIDAG  107

Query  100  GEVRTFNAEMYVGPGESSKEL  38
             + + ++A+++V P  + KEL
Sbjct  108  KK-KLYDAKVWVKPWMNFKEL  127



>ref|XP_009759630.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana sylvestris]
 gb|AHX74042.1| cystein protease inhibitor 1 [Nicotiana tabacum]
 gb|AIE76378.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=98

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = -1

Query  274  EIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSGGE  95
            EI  L R  + E+N    KK N      +L F +V+  ++QVVAG  YY+ ++ A  GG+
Sbjct  18   EINDLARFAVDEHN----KKQNA-----LLEFGKVVNVKEQVVAGTMYYITLE-ATEGGK  67

Query  94   VRTFNAEMYVGPGESSKEL  38
             + + A+++V P ++ K+L
Sbjct  68   KKAYEAKVWVKPWQNFKQL  86



>gb|AAG38521.1|AF283536_1 cystatin-like protein [Citrus x paradisi]
 gb|KDO78463.1| hypothetical protein CISIN_1g033492mg [Citrus sinensis]
Length=118

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 11/93 (12%)
 Frame = -1

Query  301  PIDDVKTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLR  122
            PI+D K    + ++G+  +TEYN    K++  A     L F  V K E QVV+G NY L 
Sbjct  34   PIEDPK-EKHVMEIGQFAVTEYN----KQSKSA-----LKFESVEKGETQVVSGTNYRL-  82

Query  121  IKAANSGGEVRTFNAEMYVGPGESSKELVTLAP  23
            I     G   + F A ++  P E  K L +  P
Sbjct  83   ILVVKDGPSTKKFEAVVWEKPWEHFKSLTSFKP  115



>ref|XP_010689648.1| PREDICTED: cysteine proteinase inhibitor 6-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 10/81 (12%)
 Frame = -1

Query  280  NAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAANSG  101
            +AEI+ L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++  I+A  +G
Sbjct  61   DAEIESLARFAVEEHN---KKEN------ALLEFARVVKAKEQVVAGTLHHFTIEAIEAG  111

Query  100  GEVRTFNAEMYVGPGESSKEL  38
             + + ++A+++V P  + KEL
Sbjct  112  KK-KLYDAKVWVKPWMNFKEL  131



>gb|AGX28139.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28140.1| cysteine protease inhibitor, partial [Populus euphratica]
Length=107

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 49/83 (59%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + + EI  L R  + E+N    KK N      +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  14   QNSVEIDSLARFAVDEHN----KKENA-----ILEFARVVKAKEQVVAGTMHHLTIEAIE  64

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  65   AGKK-KLYEAKVWVKPWLNFKEL  86



>emb|CAH57549.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57570.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -1

Query  286  KTNAEIQQLGRDCITEYNNGLKKKNNPAITAKMLTFSEVIKAEKQVVAGVNYYLRIKAAN  107
            + +AEI  L R  + E+N   KK+N       +L F+ V+KA++QVVAG  ++L I+A  
Sbjct  49   QNSAEIDGLARFAVDEHN---KKEN------AILEFARVVKAKEQVVAGPMHHLTIEAIE  99

Query  106  SGGEVRTFNAEMYVGPGESSKEL  38
            +G + + + A+++V P  + KEL
Sbjct  100  AGKK-KLYEAKVWVKPWLNFKEL  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520026522120