BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23499_g1_i1 len=820 path=[657:0-304 962:305-352 355:353-419
422:420-451 2266:452-484 1140:485-539 25:540-653 139:654-713
610:714-759 656:760-819]

Length=820
                                                                      Score     E

ref|XP_009589279.1|  PREDICTED: cysteine proteinase inhibitor B-like    100   2e-22   
gb|ADV02771.1|  cysteine protease inhibitor                           99.8    4e-22   
gb|AEQ54766.1|  cysteine proteinase inhibitor CPI-1                   97.8    2e-21   
ref|XP_009588279.1|  PREDICTED: cysteine proteinase inhibitor B-like  97.8    2e-21   
ref|XP_009763807.1|  PREDICTED: cysteine proteinase inhibitor B-like  96.3    8e-21   
gb|EYU28504.1|  hypothetical protein MIMGU_mgv1a016168mg              94.4    3e-20   
ref|XP_009762060.1|  PREDICTED: cysteine proteinase inhibitor B-like  94.7    3e-20   
ref|XP_010314744.1|  PREDICTED: cysteine proteinase inhibitor B-like  94.0    4e-20   
gb|EYU24293.1|  hypothetical protein MIMGU_mgv1a016063mg              92.0    2e-19   
ref|XP_006349967.1|  PREDICTED: cysteine proteinase inhibitor B-like  91.7    3e-19   
ref|XP_011084146.1|  PREDICTED: cysteine proteinase inhibitor B       88.2    5e-18   
ref|XP_010326957.1|  PREDICTED: cysteine proteinase inhibitor B       87.4    8e-18   
ref|XP_006358790.1|  PREDICTED: cysteine proteinase inhibitor B-like  84.3    1e-16   
ref|XP_002265736.1|  PREDICTED: cysteine proteinase inhibitor 4       84.3    1e-16   Vitis vinifera
sp|Q10993.1|CYTB_HELAN  RecName: Full=Cysteine proteinase inhibit...  82.8    2e-16   Helianthus annuus
pir||JE0308  cysteine proteinase inhibitor - common sunflower         81.3    1e-15
ref|XP_007163791.1|  hypothetical protein PHAVU_001G264400g           81.3    1e-15   
ref|XP_007223412.1|  hypothetical protein PRUPE_ppa013391mg           81.3    1e-15   
gb|KHN44464.1|  Cysteine proteinase inhibitor 2                       81.6    2e-15   
ref|XP_003538534.1|  PREDICTED: cysteine proteinase inhibitor 4       80.1    3e-15   
ref|XP_007034159.1|  Cystatin                                         79.7    4e-15   
ref|NP_180758.1|  cysteine proteinase inhibitor 2                     80.1    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64985.1|  putative cysteine proteinase inhibitor B (cystati...  80.1    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792948.1|  PREDICTED: cysteine proteinase inhibitor 4       79.7    4e-15   
ref|XP_010926673.1|  PREDICTED: cysteine proteinase inhibitor 5       79.3    5e-15   
ref|XP_009378164.1|  PREDICTED: cysteine proteinase inhibitor B-like  79.0    8e-15   
ref|XP_010101112.1|  Cysteine proteinase inhibitor 10                 79.3    8e-15   
ref|XP_008365221.1|  PREDICTED: cysteine proteinase inhibitor B-like  78.6    1e-14   
gb|ACK87021.1|  cysteine protease inhibitor                           78.2    1e-14   Gossypium hirsutum [American cotton]
gb|ACU17144.1|  unknown                                               78.2    1e-14   Glycine max [soybeans]
gb|ABS52572.1|  cysteine proteinase inhibitor                         77.8    2e-14   Gossypium hirsutum [American cotton]
ref|XP_009371093.1|  PREDICTED: cysteine proteinase inhibitor B       77.0    4e-14   
ref|XP_008799565.1|  PREDICTED: cysteine proteinase inhibitor 10-...  78.6    5e-14   
ref|XP_002862941.1|  hypothetical protein ARALYDRAFT_497243           77.0    5e-14   
gb|ACD85810.1|  cystcine proteinase inhibitor                         76.3    6e-14   Gossypium hirsutum [American cotton]
ref|XP_002301749.1|  cystatin family protein                          76.3    7e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009373605.1|  PREDICTED: cysteine proteinase inhibitor B-like  75.9    1e-13   
ref|XP_002320446.1|  cystatin family protein                          75.9    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_004297057.1|  PREDICTED: cysteine proteinase inhibitor B-like  75.9    1e-13   
ref|XP_006840905.1|  hypothetical protein AMTR_s00087p00085650        75.5    1e-13   
ref|XP_008337489.1|  PREDICTED: cysteine proteinase inhibitor B       75.5    1e-13   
ref|XP_006492987.1|  PREDICTED: cysteine proteinase inhibitor 2-like  75.5    1e-13   
ref|XP_010469645.1|  PREDICTED: cysteine proteinase inhibitor 2-like  75.5    2e-13   
dbj|BAA20464.1|  extracellular insoluble cystatin                     75.1    2e-13   Daucus carota [carrots]
ref|XP_006296241.1|  hypothetical protein CARUB_v10025408mg           75.5    2e-13   
emb|CDY68279.1|  BnaC04g54180D                                        74.7    3e-13   
ref|XP_010243158.1|  PREDICTED: cysteine proteinase inhibitor 4-like  73.9    5e-13   
ref|XP_011024794.1|  PREDICTED: cysteine proteinase inhibitor B-like  73.9    5e-13   
ref|XP_006421050.1|  hypothetical protein CICLE_v10006584mg           73.6    5e-13   
ref|XP_002516375.1|  Cysteine proteinase inhibitor B, putative        73.9    6e-13   Ricinus communis
ref|XP_010414055.1|  PREDICTED: cysteine proteinase inhibitor 2-like  73.9    6e-13   
ref|XP_010673372.1|  PREDICTED: cysteine proteinase inhibitor B       73.6    8e-13   
ref|XP_006410333.1|  hypothetical protein EUTSA_v10017392mg           73.2    1e-12   
gb|KDP32576.1|  hypothetical protein JCGZ_13126                       73.9    1e-12   
ref|XP_010510121.1|  PREDICTED: cysteine proteinase inhibitor 2-like  73.2    1e-12   
ref|XP_002456830.1|  hypothetical protein SORBIDRAFT_03g043680        73.2    1e-12   Sorghum bicolor [broomcorn]
ref|XP_009144029.1|  PREDICTED: cysteine proteinase inhibitor 2-like  72.8    1e-12   
emb|CDY42085.1|  BnaA05g11010D                                        72.8    1e-12   
ref|XP_003524913.1|  PREDICTED: cysteine proteinase inhibitor 4-l...  72.0    2e-12   
gb|KHN24041.1|  Cysteine proteinase inhibitor 2                       72.4    2e-12   
ref|XP_003552894.1|  PREDICTED: cysteine proteinase inhibitor 4-like  72.4    2e-12   
ref|XP_006840903.1|  hypothetical protein AMTR_s00087p00084520        71.6    2e-12   
ref|XP_009387215.1|  PREDICTED: cysteine proteinase inhibitor 4-like  72.0    2e-12   
ref|XP_004504436.1|  PREDICTED: cysteine proteinase inhibitor 4-like  71.6    3e-12   
ref|XP_009132828.1|  PREDICTED: cysteine proteinase inhibitor 2-like  71.6    3e-12   
emb|CAN70300.1|  hypothetical protein VITISV_001398                   72.4    4e-12   Vitis vinifera
ref|XP_004502264.1|  PREDICTED: cysteine proteinase inhibitor 2-like  70.5    9e-12   
emb|CDX84749.1|  BnaA03g14810D                                        74.7    9e-12   
ref|XP_004160226.1|  PREDICTED: cysteine proteinase inhibitor B-like  69.7    2e-11   
emb|CDX79450.1|  BnaC03g17860D                                        73.9    2e-11   
ref|XP_007153801.1|  hypothetical protein PHAVU_003G065700g           69.7    2e-11   
ref|XP_010243160.1|  PREDICTED: cysteine proteinase inhibitor 2-like  69.7    2e-11   
gb|KEH20629.1|  cysteine protease inhibitor cystatin                  68.9    3e-11   
ref|XP_009402733.1|  PREDICTED: cysteine proteinase inhibitor 4-like  68.6    5e-11   
ref|XP_004138536.1|  PREDICTED: cysteine proteinase inhibitor B-like  67.4    9e-11   
gb|KFK31166.1|  hypothetical protein AALP_AA6G077400                  67.4    1e-10   
gb|AFK48234.1|  unknown                                               67.4    1e-10   
ref|XP_010557035.1|  PREDICTED: cysteine proteinase inhibitor 2-like  67.4    1e-10   
ref|XP_010542782.1|  PREDICTED: cysteine proteinase inhibitor 2-like  67.0    2e-10   
ref|XP_010039949.1|  PREDICTED: cysteine proteinase inhibitor B       66.6    3e-10   
emb|CAJ20032.1|  putative cystatin                                    65.9    3e-10   Zea mays [maize]
emb|CAG38126.1|  cystatin Hv-CPI5                                     66.2    4e-10   Hordeum vulgare [barley]
ref|XP_006645220.1|  PREDICTED: cysteine proteinase inhibitor 5-like  65.9    4e-10   
ref|XP_010522274.1|  PREDICTED: cysteine proteinase inhibitor 2-like  65.1    7e-10   
gb|AHV85520.1|  cysteine proteinase inhibitor TrcC-6                  65.1    9e-10   
ref|XP_009141203.1|  PREDICTED: cysteine proteinase inhibitor 2-like  65.1    9e-10   
emb|CDY62192.1|  BnaCnng39540D                                        64.7    1e-09   
ref|XP_008465470.1|  PREDICTED: cysteine proteinase inhibitor B       63.9    2e-09   
ref|NP_001052530.1|  Os04g0350100                                     64.3    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007153806.1|  hypothetical protein PHAVU_003G066200g           64.7    2e-09   
ref|NP_001172709.1|  Os01g0915401                                     63.9    2e-09   
ref|XP_004971036.1|  PREDICTED: cysteine proteinase inhibitor 4-like  63.9    3e-09   
emb|CDM85644.1|  unnamed protein product                              63.9    3e-09   
ref|XP_003601729.1|  Cysteine proteinase inhibitor                    63.2    3e-09   
gb|AES71980.2|  phloem filament protein PP1                           63.2    4e-09   
ref|NP_001045185.1|  Os01g0915200                                     63.2    5e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76949.1|  hypothetical protein OsI_04907                        63.2    5e-09   Oryza sativa Indica Group [Indian rice]
gb|EMT28873.1|  Cysteine proteinase inhibitor 4                       61.6    2e-08   
ref|XP_010244063.1|  PREDICTED: cysteine proteinase inhibitor B-like  60.5    4e-08   
ref|NP_001146946.1|  cysteine proteinase inhibitor B precursor        60.1    6e-08   Zea mays [maize]
gb|EAY93675.1|  hypothetical protein OsI_15462                        60.1    7e-08   Oryza sativa Indica Group [Indian rice]
gb|AFW84200.1|  putative cystatin                                     59.7    9e-08   
tpe|CAG29029.1|  TPA: putative cystatin                               59.7    1e-07   
gb|KDO52834.1|  hypothetical protein CISIN_1g035532mg                 58.5    1e-07   
emb|CAG38125.1|  cystatin Hv-CPI9                                     58.5    2e-07   Hordeum vulgare [barley]
gb|EMT28874.1|  Cysteine proteinase inhibitor 4                       56.2    1e-06   
gb|ABK21379.1|  unknown                                               54.7    4e-06   Picea sitchensis
pdb|4N6T|A  Chain A, Adhiron: A Stable And Versatile Peptide Disp...  53.5    6e-06   
ref|XP_007153809.1|  hypothetical protein PHAVU_003G066500g           53.9    8e-06   
ref|XP_003579572.1|  PREDICTED: cysteine proteinase inhibitor 10-...  53.5    9e-06   
ref|XP_007153804.1|  hypothetical protein PHAVU_003G066000g           53.1    1e-05   
ref|XP_003564913.1|  PREDICTED: cysteine proteinase inhibitor 4-like  53.9    1e-05   
ref|XP_010522275.1|  PREDICTED: cysteine proteinase inhibitor 2-like  53.5    1e-05   
gb|ABK23108.1|  unknown                                               52.8    2e-05   Picea sitchensis
emb|CDY14750.1|  BnaC04g47470D                                        52.8    2e-05   
ref|XP_006646602.1|  PREDICTED: cysteine proteinase inhibitor 4-like  52.8    2e-05   
sp|Q10992.1|CYTA_HELAN  RecName: Full=Cysteine proteinase inhibit...  50.4    7e-05   Helianthus annuus
emb|CDY14748.1|  BnaC04g47450D                                        50.1    9e-05   
emb|CDY06956.1|  BnaA04g23590D                                        50.8    1e-04   
emb|CDY04170.1|  BnaA09g19480D                                        51.6    1e-04   
sp|Q10Q47.1|CYT7_ORYSJ  RecName: Full=Putative cysteine proteinas...  50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003532730.1|  PREDICTED: cysteine proteinase inhibitor 4-like  49.7    2e-04   
gb|ABS11040.1|  cysteine proteinase inhibitor                         48.9    2e-04   Brassica oleracea var. gemmifera
gb|AHA85335.1|  cysteine protease inhibitor                           51.2    2e-04   
ref|XP_006836222.1|  hypothetical protein AMTR_s00101p00100170        50.8    2e-04   
ref|XP_006411355.1|  hypothetical protein EUTSA_v10017418mg           49.3    3e-04   
ref|XP_007153810.1|  hypothetical protein PHAVU_003G066600g           48.9    4e-04   
gb|KFK36955.1|  hypothetical protein AALP_AA4G194100                  48.5    4e-04   
emb|CBI32827.3|  unnamed protein product                              50.1    4e-04   
ref|XP_007216188.1|  hypothetical protein PRUPE_ppa015901mg           48.5    6e-04   
ref|XP_010230219.1|  PREDICTED: putative cysteine proteinase inhi...  48.5    6e-04   
ref|XP_002531171.1|  Cysteine proteinase inhibitor, putative          48.1    6e-04   Ricinus communis
ref|XP_009141947.1|  PREDICTED: cysteine proteinase inhibitor 3-like  48.1    7e-04   
emb|CDY35433.1|  BnaA03g19270D                                        47.8    7e-04   
ref|XP_002283400.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.1    7e-04   Vitis vinifera



>ref|XP_009589279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76376.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=136

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAK-MLTFLEVIKAEKQVVAGVKY  417
            R  + +VKT+ E+Q LGK C+ EYN  L+K+     +   +L+F EV++AEKQVV+G+KY
Sbjct  36   RTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNGLLSFSEVVEAEKQVVSGIKY  95

Query  416  YLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            YL++ ATTS+GA K FDA +VV   E  KEL+  +PS  T+
Sbjct  96   YLKISATTSSGAPKMFDAVLVVKAWEKKKELLNFSPSPATK  136



>gb|ADV02771.1| cysteine protease inhibitor [Ipomoea batatas]
Length=134

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            +  V +VKT+AEVQ LG+  + E+N  L  K NP  +AK L F EVIKAEKQVVAG KY+
Sbjct  35   KTEVSDVKTNAEVQNLGRKAVMEFNKRLNVKVNPENNAKRLVFTEVIKAEKQVVAGEKYF  94

Query  413  LRLKATTSAGATKTFDAEMVVGPG-ESSKELVTLAPS  306
            L +KAT+  G TKT+++EM V PG E+  E++  AP+
Sbjct  95   LTIKATSEDGQTKTYESEMWVKPGDETVHEMLNFAPA  131



>gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora]
Length=139

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            +++VK++ EVQ+LG+ C++EYN  L+KKNN   S   + F  V++AEKQVVAG+KYYL++
Sbjct  43   IEDVKSNKEVQELGEYCVSEYNKSLRKKNNE--SGAPIIFTSVVEAEKQVVAGIKYYLKI  100

Query  404  KATTSAGATKTFDAEMVVGPGESSK--ELVTLAPSTLTR  294
            KATTS+G  K +DA +VV P   +K  +L+  +PS  T+
Sbjct  101  KATTSSGVPKVYDAIVVVRPWVHTKPRQLLNFSPSPATK  139



>ref|XP_009588279.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana tomentosiformis]
 gb|AIE76382.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=142

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R P+ +VKT+ ++Q LGK C+ EYN  L+K        + + L+F EV++AE QVV+G+K
Sbjct  35   RTPIKDVKTNKKIQDLGKYCVEEYNRSLRKYKQILQEDNIEFLSFAEVLEAETQVVSGIK  94

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            YYL++ A  S+G  KTFDAE+V+ P E  KEL+   P
Sbjct  95   YYLKISAIVSSGIPKTFDAELVIKPWEEKKELIHFLP  131



>ref|XP_009763807.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=142

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R P+ +VKT+ ++Q LGK C+ EYN  L+K        + + L+F EV++AE QVV+G+K
Sbjct  35   RTPIKDVKTNKKIQDLGKYCVEEYNRSLRKYKQILQEDNIEFLSFAEVVEAETQVVSGIK  94

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            YYL++ AT S+   K FDAE+V+ P E  KEL+  +P
Sbjct  95   YYLKISATVSSETPKMFDAELVIKPWEKKKELIHFSP  131



>gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata]
Length=132

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V NVK + +VQ LG+ C+ EYN  L++K N     K+L F +V+ AE QVV+G+KYY
Sbjct  31   RTEVKNVKANKDVQDLGRYCVQEYNRQLQQKAN---GTKLLVFSQVVAAETQVVSGIKYY  87

Query  413  LRLKATT-SAGATKTFDAEMVVGPGESSKELVTLAPSTLTRR  291
            L++ A T   GA K+F+A +VV P   SKELV  APST   R
Sbjct  88   LKISAATRGGGAAKSFEAVIVVKPWIHSKELVNFAPSTPPSR  129



>ref|XP_009762060.1| PREDICTED: cysteine proteinase inhibitor B-like [Nicotiana sylvestris]
Length=138

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAK---MLTFLEVIKAEKQVVAGV  423
            R  + +VKT+ E+Q LGK C+ EYN  L+K+     +     +L+F EV++AEKQVV+G+
Sbjct  36   RTQIQDVKTNKEIQDLGKFCVEEYNRNLQKQKQKVNNNNNNGLLSFSEVVEAEKQVVSGI  95

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            KYYL++ ATTS+G+ K FDA +VV   E  KEL+  +PS  T+
Sbjct  96   KYYLKISATTSSGSPKMFDAVLVVKAWEKKKELLNFSPSPATK  138



>ref|XP_010314744.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum lycopersicum]
Length=136

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R P+ +VKT+ ++Q+LGK C+ EYN+ LKK N+     + + L F+EV++AE Q+V+G+K
Sbjct  35   RTPIKDVKTNKKIQELGKYCVEEYNHSLKKYNHIMQKDNIEFLNFVEVLEAETQIVSGIK  94

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            YYL++ +T + G  K FDAE+V+   E  KEL+  +P
Sbjct  95   YYLKI-STFTLGMVKIFDAELVIKSWEKKKELIHFSP  130



>gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata]
Length=135

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V NVK + +VQ LG+ C+ EYN  L++K N     K+L F +V+ AE QVV+G+KYY
Sbjct  35   RTEVKNVKANKDVQDLGRYCVQEYNRQLQQKAN---GTKLLVFSQVVAAETQVVSGIKYY  91

Query  413  LRLKATT-SAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            L++ A T   G  K F+A +VV P   SKELV  APST  R
Sbjct  92   LKISAATRGGGPAKNFEAVIVVKPWIHSKELVNFAPSTPPR  132



>ref|XP_006349967.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=136

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R P+ +VKT+ ++Q+LGK C+ EYN+ L+K N      + ++L F+EV++AE QVV+G+K
Sbjct  35   RTPIKDVKTNKKIQELGKYCVEEYNHSLRKYNQIMQKDNIELLNFVEVLEAETQVVSGIK  94

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            YYL++ +T + G  K +DAE+V+   E  KEL+  +P
Sbjct  95   YYLKI-STFTLGIVKVYDAELVIKSWEKKKELIHFSP  130



>ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum]
Length=131

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V NVK + E+Q+LG+ C+ EYN+ L+ K N    +  L F +V+ AE QV++G+KYY
Sbjct  31   RTQVKNVKQNQEIQELGRYCVGEYNHQLQLKAN---GSTALVFSQVVAAETQVISGIKYY  87

Query  413  LRLKATTSAGA-TKTFDAEMVVGPGESSKELVTLAPS  306
            L++ A T  GA  +TFDA +VV P   SKEL+  APS
Sbjct  88   LKISAVTRDGAPARTFDAVVVVKPWLHSKELLNFAPS  124



>ref|XP_010326957.1| PREDICTED: cysteine proteinase inhibitor B [Solanum lycopersicum]
Length=134

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + NVKT+ E+Q LGK C+ E+N  L+  N  A+S+ +L+F +V++AEKQVV+GVKYY
Sbjct  34   RTQIKNVKTNQEIQDLGKYCVEEHNRDLRHING-ALSS-LLSFSQVVEAEKQVVSGVKYY  91

Query  413  LRLKA-TTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            L++ A   S+ + K FDA +VV   E  KEL+T +PS
Sbjct  92   LKISAIVKSSSSPKLFDAVVVVKAWEKKKELLTFSPS  128



>ref|XP_006358790.1| PREDICTED: cysteine proteinase inhibitor B-like [Solanum tuberosum]
Length=135

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 69/98 (70%), Gaps = 4/98 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + +VKT+ E+Q LGK C+ E+N  L+K+N  A+S+ +L+F +V++AEKQVV+GVKYY
Sbjct  34   RTQIKDVKTNQEIQDLGKYCVEEHNRNLRKQNG-ALSS-LLSFSQVVEAEKQVVSGVKYY  91

Query  413  LRLKA-TTSAGATKTFDAEMVVGPGESSK-ELVTLAPS  306
            L++ A   S+ + K FDA +VV   E  K EL+T  PS
Sbjct  92   LKISAIVKSSSSPKLFDAVVVVKSWEKKKEELLTFFPS  129



>ref|XP_002265736.1| PREDICTED: cysteine proteinase inhibitor 4 [Vitis vinifera]
Length=140

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 7/104 (7%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAI------SAKMLTFLEVIKAEKQVV  432
            R  + +VKT+ EVQQLG+  + EYN    ++   AI        + LTF EV++A+KQVV
Sbjct  37   RTEIKDVKTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVEAQKQVV  96

Query  431  AGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTL  300
            +G KYYL++ AT + G   TFDA +VV P   SK+L+  +PS++
Sbjct  97   SGFKYYLKIAATQN-GVRNTFDAVVVVKPWLPSKQLLHFSPSSI  139



>sp|Q10993.1|CYTB_HELAN RecName: Full=Cysteine proteinase inhibitor B; AltName: Full=Cystatin-B; 
AltName: Full=SCB [Helianthus annuus]
Length=101

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V NVKTD E+QQLG   + EYN   + K      A  L F +VI AE QVVAG KYY
Sbjct  5    RTKVKNVKTDTEIQQLGSYSVDEYNRLQRTKKT---GAGDLKFSQVIAAETQVVAGTKYY  61

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            L+++A T  G  K FDAE+VV   + SK+L+   P+ + +
Sbjct  62   LKIEAITKGGKMKVFDAEVVVQSWKHSKKLLGFKPAPVDK  101



>pir||JE0308 cysteine proteinase inhibitor - common sunflower
Length=123

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V NVKTD E+QQLG   + EYN   + K      A  L F +VI AE QVVAG KYY
Sbjct  27   RTKVKNVKTDTEIQQLGSYSVDEYNRLQRTKKT---GAGDLKFSQVIAAETQVVAGTKYY  83

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            L+++A    G  K FDAE+VV   + SK+L+   P+ + +
Sbjct  84   LKIEAIYKGGKMKVFDAEVVVQSWKHSKKLLGFKPAPVDK  123



>ref|XP_007163791.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
 gb|ESW35785.1| hypothetical protein PHAVU_001G264400g [Phaseolus vulgaris]
Length=130

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            + +V+T+ EVQ+LG+  + EYNNGLK  N+     + LTF EV++A++QVV+GVKYYL++
Sbjct  30   IPDVRTNREVQELGRFSVEEYNNGLKLYNDS--DNEKLTFSEVVEAQQQVVSGVKYYLKI  87

Query  404  KATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
             A T  G  K F + +VV P   SK+L+  +P++
Sbjct  88   SA-THRGIHKMFSSVVVVKPWIHSKKLLHFSPAS  120



>ref|XP_007223412.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
 ref|XP_008222787.1| PREDICTED: cysteine proteinase inhibitor B [Prunus mume]
 gb|EMJ24611.1| hypothetical protein PRUPE_ppa013391mg [Prunus persica]
Length=125

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  +++VKT+ EVQ+LG+  + EYN   ++K++ +     L FLEV++A+ QVV+G+KYY
Sbjct  29   RQQIEDVKTNKEVQKLGRFSVAEYNR-TQRKSHQSNGGGELQFLEVVEAQSQVVSGIKYY  87

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            L++ A  + GA   FD+E+VV P   SK+L+  AP
Sbjct  88   LKVSAVRN-GAHMLFDSEVVVKPWLHSKQLLNFAP  121



>gb|KHN44464.1| Cysteine proteinase inhibitor 2 [Glycine soja]
Length=169

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 67/98 (68%), Gaps = 5/98 (5%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKK-KNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            V +V+T+ EVQ+LG+  + EYN GLK+ KNN    ++ L F EV++A++QVV+G+KYYL+
Sbjct  30   VPDVRTNREVQELGRFAVEEYNRGLKQWKNN---GSEQLNFSEVVEAQQQVVSGMKYYLK  86

Query  407  LKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            + A T  G  K F + +VV P   SK+L+  AP+  +R
Sbjct  87   ISA-THKGVHKMFTSVVVVKPWLHSKQLLHFAPAAPSR  123



>ref|XP_003538534.1| PREDICTED: cysteine proteinase inhibitor 4 [Glycine max]
Length=126

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 5/94 (5%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKK-KNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            V +V+T+ EVQ+LG+  + EYN GLK+ KNN    ++ L F EV++A++QVV+G+KYYL+
Sbjct  30   VPDVRTNREVQELGRFAVEEYNRGLKQWKNN---GSEQLNFSEVVEAQQQVVSGMKYYLK  86

Query  407  LKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            + A T  G  K F + +VV P   SK+L+  AP+
Sbjct  87   ISA-THKGVHKMFTSVVVVKPWLHSKQLLHFAPA  119



>ref|XP_007034159.1| Cystatin [Theobroma cacao]
 gb|EOY05085.1| Cystatin [Theobroma cacao]
Length=127

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 67/101 (66%), Gaps = 9/101 (9%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYN---NGLKKKNNPAISAKMLTFLEVIKAEKQVVAGV  423
            +  +++VKT+ EVQ+LG+  + E+N    GL+           L F +V++A+KQVV+G+
Sbjct  33   KTEINDVKTNKEVQELGRFSVEEFNRSRGGLRSNGGTE-----LVFSQVVEAQKQVVSGI  87

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTL  300
            KYYL+++A  S G T+TF++ +VV P E SKEL+  +PS L
Sbjct  88   KYYLKIEAMQS-GLTRTFESVVVVKPWEDSKELLNFSPSPL  127



>ref|NP_180758.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
 sp|Q8L5T9.2|CYT2_ARATH RecName: Full=Cysteine proteinase inhibitor 2; Short=AtCYS-2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD15406.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 dbj|BAF01107.1| putative cysteine proteinase inhibitor B [Arabidopsis thaliana]
 gb|AEC08615.1| cysteine proteinase inhibitor 2 [Arabidopsis thaliana]
Length=147

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNN---------GLKKKNNPAISAKMLTFLEVIKAEKQVV  432
            V N++T+ E+QQLG+ C+ ++N          G   K + AIS   L F  V+ A+KQVV
Sbjct  42   VPNIRTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNP-LQFSRVVSAQKQVV  100

Query  431  AGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            AG+KYYLR++ T   G+T+ FD+ +V+ P   SK+L+   P
Sbjct  101  AGLKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  141



>gb|AAM64985.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
Length=144

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNN---------GLKKKNNPAISAKMLTFLEVIKAEKQVV  432
            V N++T+ E+QQLG+ C+ ++N          G   K + AIS   L F  V+ A+KQVV
Sbjct  39   VPNIRTNREIQQLGRYCVEQFNQQAQNEQGNIGSIAKTDTAISNP-LQFSRVVSAQKQVV  97

Query  431  AGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            AG+KYYLR++ T   G+T+ FD+ +V+ P   SK+L+   P
Sbjct  98   AGLKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  138



>ref|XP_008792948.1| PREDICTED: cysteine proteinase inhibitor 4 [Phoenix dactylifera]
Length=125

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 8/125 (6%)
 Frame = -3

Query  680  FNLILVAMAVAIICgeqvgaqlgggavgGRIPVDNVKTDAEVQQLGKDCITEYNNGLKKK  501
            + L+ + +AVA           GG  VGGR  V +V+++ EVQ LG  C+ EYN  L   
Sbjct  6    YRLLFLLLAVASSATAFQLGDGGGRKVGGRTEVPHVESNKEVQDLGLFCVEEYNQHLHG-  64

Query  500  NNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELV  321
                   ++LTFL V+ AE+QVV+G+KYYL++ A    G  ++FDA +VV P   S+ L+
Sbjct  65   -----GGEVLTFLRVLAAERQVVSGIKYYLKIAARD--GRERSFDAVVVVKPWLKSRSLL  117

Query  320  TLAPS  306
            + APS
Sbjct  118  SFAPS  122



>ref|XP_010926673.1| PREDICTED: cysteine proteinase inhibitor 5 [Elaeis guineensis]
Length=126

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V++D EVQ LG  C+ EYN  L    + A     LTFL V+ AE+QVV+G+KYY
Sbjct  35   RTEVPHVESDKEVQDLGLFCVEEYNQRLHGGRSEA-----LTFLRVVAAERQVVSGIKYY  89

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            L++ A    G  +TFDA +VV P   S+ L++  PS
Sbjct  90   LKIAARD--GRERTFDAIVVVKPWLKSRSLLSFTPS  123



>ref|XP_009378164.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=124

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  ++NVK++ EVQ+LG+  + EYN+  +K +        L FLEV++A+ QVV+G+KYY
Sbjct  28   RRQIENVKSNKEVQELGRFSVAEYNS-RQKASRKMDGGGELQFLEVVEAQSQVVSGIKYY  86

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            L++ A  + GA   FD+E+VV P   SK+L+  AP
Sbjct  87   LKVSAVKN-GAHMLFDSEVVVKPWLRSKQLLNFAP  120



>ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
 gb|EXB87085.1| Cysteine proteinase inhibitor 10 [Morus notabilis]
Length=143

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 67/105 (64%), Gaps = 8/105 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNG----LKKKNNPA---ISAKMLTFLEVIKAEKQV  435
            R  + +VKT+ EVQ+LG+  + EYN      +++ N  A        L+F +V++AEKQV
Sbjct  33   RTAISDVKTNEEVQELGRFSVEEYNRRSQKLIRRGNGGARDGYGDGELSFSQVVEAEKQV  92

Query  434  VAGVKYYLRLKAT-TSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            V+G+KYYL++ AT T  G ++ FD+ +VV P   S++L+  APST
Sbjct  93   VSGIKYYLKVSATATETGESRIFDSVVVVKPWLRSRQLLNFAPST  137



>ref|XP_008365221.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 ref|XP_008365234.1| PREDICTED: cysteine proteinase inhibitor B-like [Malus domestica]
 gb|AAO18638.1| cystatin [Malus domestica]
 gb|AHZ92268.1| cystatin 2 [Malus prunifolia]
Length=123

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = -3

Query  674  LILVAMAVAIICgeqvgaqlgggavgGRIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN  495
            ++ V +   +IC   V +   GG VGGR  ++NVKT+ EVQ+LG+  + EYN   ++   
Sbjct  1    MMKVPIFALLICLLFVASNGYGGMVGGRKEIENVKTNKEVQELGRFSVEEYNR--QRGTQ  58

Query  494  PAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTL  315
                   L FLEV++A+ QVV+G+KYYL++ A  + G  + FD+E+VV P   SK+L+  
Sbjct  59   KMDGGGELQFLEVVEAQSQVVSGIKYYLKVSAVRN-GVHRLFDSEVVVKPWLRSKQLLNF  117

Query  314  AP  309
            AP
Sbjct  118  AP  119



>gb|ACK87021.1| cysteine protease inhibitor [Gossypium hirsutum]
Length=119

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 67/101 (66%), Gaps = 5/101 (5%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAIS----AKMLTFLEVIKAEKQVVAG  426
            R+ +++VK + EVQ+LG+  + EYN   + +   +++    +  L F +V+ AEKQVVAG
Sbjct  19   RMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAG  78

Query  425  VKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            +KYYL++KA    G TKTF++ ++V P   SK+L+  +PST
Sbjct  79   IKYYLKIKA-MQGGVTKTFESVVLVKPWVQSKDLLNFSPST  118



>gb|ACU17144.1| unknown [Glycine max]
Length=122

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKK-KNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            V +V+T+ EVQ+LG+  + EYN GLK+ KNN    ++ L F EV++A++QVV+G+ YYL+
Sbjct  30   VPDVRTNREVQELGRFAVEEYNRGLKQWKNN---GSEQLNFSEVVEAQQQVVSGMMYYLK  86

Query  407  LKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            + A T  G  K F + +VV P   SK+L+  AP+
Sbjct  87   ISA-THKGVHKMFTSVVVVKPWLHSKQLLHFAPA  119



>gb|ABS52572.1| cysteine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 67/101 (66%), Gaps = 5/101 (5%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAIS----AKMLTFLEVIKAEKQVVAG  426
            R+ +++VK + EVQ+LG+  + EYN   + +   +++    +  L F +V+ AEKQVVAG
Sbjct  25   RMRINDVKNNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAG  84

Query  425  VKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            +KYYL++KA    G TKTF++ ++V P   SK+L+  +PST
Sbjct  85   IKYYLKIKA-MQGGVTKTFESVVLVKPWVQSKDLLNFSPST  124



>ref|XP_009371093.1| PREDICTED: cysteine proteinase inhibitor B [Pyrus x bretschneideri]
Length=123

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -3

Query  674  LILVAMAVAIICgeqvgaqlgggavgGRIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN  495
            ++ V +   +IC   V +   GG +GGR  ++NVKT+ EVQ+LG+  + EYN   ++   
Sbjct  1    MMKVPIFALVICLLFVASNGYGGMLGGRKEIENVKTNKEVQELGRFSVEEYNR--QRGTQ  58

Query  494  PAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTL  315
                   L FLEV++A+ QVV+G+KYYL++ A  + G    FD+E+VV P   SK+L+  
Sbjct  59   KMDGGGELQFLEVVEAQSQVVSGLKYYLKVSAVRN-GVHMLFDSEVVVKPWLRSKQLLNF  117

Query  314  AP  309
            AP
Sbjct  118  AP  119



>ref|XP_008799565.1| PREDICTED: cysteine proteinase inhibitor 10-like [Phoenix dactylifera]
Length=219

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V NV++D EVQ LG  C+ EYN+  +         ++LTFL V+ AE+QVV+G+KYYL++
Sbjct  131  VPNVESDKEVQDLGLFCVEEYNHRRRVGGE-----ELLTFLRVVAAERQVVSGIKYYLKI  185

Query  404  KATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
             A    G   TFDA +VV P   S+ L++ APS+
Sbjct  186  AARD--GREVTFDAVVVVRPWLDSRFLLSFAPSS  217



>ref|XP_002862941.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002881207.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39200.1| hypothetical protein ARALYDRAFT_497243 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57466.1| hypothetical protein ARALYDRAFT_482126 [Arabidopsis lyrata subsp. 
lyrata]
Length=147

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 10/101 (10%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNN---------GLKKKNNPAISAKMLTFLEVIKAEKQVV  432
            V N++T+ E+Q+LG+ C+ ++N          G   K + A+S   L F  V+ A+KQVV
Sbjct  42   VPNIRTNREIQELGRYCVEQFNQQEQTEQGNIGSIAKTDTAMSNP-LVFSRVVSAQKQVV  100

Query  431  AGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            AG KYYLR++ T   G+T+ FD+ +V+ P   SK+L+   P
Sbjct  101  AGTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  141



>gb|ACD85810.1| cystcine proteinase inhibitor [Gossypium hirsutum]
Length=125

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAIS----AKMLTFLEVIKAEKQVVAG  426
            R+ +++VK + EVQ+LG+  + EYN   + +   +++    +  L F +V+ AEKQVVAG
Sbjct  25   RMRINDVKKNKEVQELGRFSVEEYNRRSQGRLRFSLANGGPSTALVFSQVVGAEKQVVAG  84

Query  425  VKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            +KYYL +KA    G TKTF++ ++V P   SK+L+  +PST
Sbjct  85   IKYYLEIKA-MQGGVTKTFESVVLVKPWVQSKDLLKFSPST  124



>ref|XP_002301749.1| cystatin family protein [Populus trichocarpa]
 gb|EEE81022.1| cystatin family protein [Populus trichocarpa]
Length=135

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +VKT+ E+Q+LG+  + E+NN  +           L F EV++A+ QVV+GVKYY
Sbjct  36   RAKVSDVKTNKEIQELGRFSVKEFNNH-RSTYGKGGEVGELMFSEVVEAQTQVVSGVKYY  94

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            L+++ATT +     FD+ +VV P   SKEL+   PS
Sbjct  95   LKIEATTQSEEKLMFDSVLVVKPWLRSKELLAFEPS  130



>ref|XP_009373605.1| PREDICTED: cysteine proteinase inhibitor B-like [Pyrus x bretschneideri]
Length=123

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -3

Query  674  LILVAMAVAIICgeqvgaqlgggavgGRIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN  495
            ++ V +   +IC   V +   GG +GGR  ++NVKT+ EVQ+LG+  + EYN   ++   
Sbjct  1    MLKVPIFALVICLLFVASNGYGGMLGGRKEIENVKTNEEVQELGRFSVEEYNR--QRGTQ  58

Query  494  PAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTL  315
                   L FLEV++A+ QVV+G+KYY+++ A  + G    FD+E+VV P   SK+L+  
Sbjct  59   KMDGGGELQFLEVVEAQSQVVSGLKYYIKVSAVRN-GVHMLFDSEVVVKPWLRSKQLLNF  117

Query  314  AP  309
            AP
Sbjct  118  AP  119



>ref|XP_002320446.1| cystatin family protein [Populus trichocarpa]
 gb|EEE98761.1| cystatin family protein [Populus trichocarpa]
Length=138

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +VKT+ +VQ+LG+  + E+N+            K++ F EV++A KQVV+G+KYY
Sbjct  37   RSEVSDVKTNKQVQELGRFSVKEFNSHRSLYWKGGGVGKLM-FSEVVEAHKQVVSGLKYY  95

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            L + ATT  G  + FD+ +VV PG  + EL+T  PS
Sbjct  96   LNIVATTQNGEKRMFDSVVVVQPGLRTTELLTFEPS  131



>ref|XP_004297057.1| PREDICTED: cysteine proteinase inhibitor B-like [Fragaria vesca 
subsp. vesca]
Length=138

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R PV++VKT+ EVQ+LG+  + EYN  +++++  +     L F EV++AE QVV+G+KYY
Sbjct  35   RRPVEDVKTNKEVQELGRFSVAEYNR-MQRQSLRSNGGGELQFREVVEAETQVVSGIKYY  93

Query  413  LRL---KATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            L++   +   + G    FD+++VV P   SK L+  AP +
Sbjct  94   LKISTVRNGLNGGTPLLFDSQVVVKPWLRSKRLLNFAPHS  133



>ref|XP_006840905.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
 gb|ERN02580.1| hypothetical protein AMTR_s00087p00085650 [Amborella trichopoda]
Length=120

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (61%), Gaps = 10/97 (10%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + NVK+  EVQ LGK C+  YN    + ++P      L F EV+K E+QVV+G+KYY
Sbjct  33   RAEIPNVKSSTEVQDLGKFCVETYN----QDHHP-----QLDFNEVVKGERQVVSGIKYY  83

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            L ++A    G  K FDA +VV     SK++++ +PST
Sbjct  84   LLIEA-KDGGVLKKFDAVVVVQAWRHSKQMLSFSPST  119



>ref|XP_008337489.1| PREDICTED: cysteine proteinase inhibitor B [Malus domestica]
Length=123

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -3

Query  674  LILVAMAVAIICgeqvgaqlgggavgGRIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN  495
            ++ V +   +IC   V +   GG +GGR  ++NVKT+ EVQ+LG+  + EYN   ++   
Sbjct  1    MMKVPIFALLICLLFVASNGYGGMLGGRKEIENVKTNKEVQELGRFSVEEYNR--QRGTQ  58

Query  494  PAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTL  315
                   L FLEV++A+ QVV+G+KYY+++ A  + G    FD+E+VV P   SK+L+  
Sbjct  59   KMDGGGELQFLEVVEAQSQVVSGIKYYVKVSAVRN-GVHMLFDSEVVVKPWLRSKQLLNF  117

Query  314  AP  309
            AP
Sbjct  118  AP  119



>ref|XP_006492987.1| PREDICTED: cysteine proteinase inhibitor 2-like [Citrus sinensis]
Length=130

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 3/99 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R  V +VK + EVQ+LGK C+ E+N   +++      ++   L F +V++A+KQVV+G+K
Sbjct  31   RSEVKDVKKNKEVQELGKFCVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIK  90

Query  419  YYLRLKATTSA-GATKTFDAEMVVGPGESSKELVTLAPS  306
            YYL ++ATT   G  + F++ +VV P   SKEL+  APS
Sbjct  91   YYLIIEATTGENGEIQMFNSIVVVKPWLHSKELLKFAPS  129



>ref|XP_010469645.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 8/100 (8%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNN-GLKKKNNPAISAKM-------LTFLEVIKAEKQVVA  429
            V NVK + E+Q+LG+ C+ ++N  G  ++ N    AK        L F  V+ A+KQVVA
Sbjct  41   VANVKANREIQELGRYCVEQFNQRGQSEEGNVESIAKTDTDMSNPLRFSRVVSAQKQVVA  100

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G KYYLR++ T   G+T+ FD+ +V+ P   SK+L+   P
Sbjct  101  GTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  140



>dbj|BAA20464.1| extracellular insoluble cystatin [Daucus carota]
Length=133

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKN--NPAISAKMLTFLEVIKAEKQVVAGVK  420
            R  + +V+++ E+QQLG+  + +YN      +  +   SA  L F++V+ AEKQVVAG+K
Sbjct  35   RTEIPDVESNEEIQQLGEYSVEQYNQQHHNGDGGDSTDSAGDLKFVKVVAAEKQVVAGIK  94

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            YYL++ A    G  K FDAE+VV   + +K+L++ APS
Sbjct  95   YYLKIVA-AKGGHKKKFDAEIVVQAWKKTKQLMSFAPS  131



>ref|XP_006296241.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
 gb|EOA29139.1| hypothetical protein CARUB_v10025408mg [Capsella rubella]
Length=144

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 8/100 (8%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKK--NNPAIS------AKMLTFLEVIKAEKQVVA  429
            V NVK + E+QQLG+ C+ ++N   + +  N  +I+      +  L F  V+ A+KQVVA
Sbjct  39   VPNVKANREIQQLGRYCVEQFNQREQSEEGNVESIAKTDTDMSNPLMFSRVVSAQKQVVA  98

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G KYYLR++ T   G+T+ FD+ +V+ P   SK+L+   P
Sbjct  99   GTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  138



>emb|CDY68279.1| BnaC04g54180D [Brassica napus]
Length=140

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 60/103 (58%), Gaps = 8/103 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYN-NGLKKKNNPAISAKM-------LTFLEVIKAEKQ  438
            R  V NV+T+ E+Q+LG+ C+ ++N     K+ N A +A+        L F  V  A+KQ
Sbjct  32   RSDVGNVRTNMEIQELGRYCVKQFNLQQQSKQGNDATNARTDTAVLSPLKFSRVESAQKQ  91

Query  437  VVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            VVAG KYYLR+  T   G ++ FD+ +V+ P   SK+L+   P
Sbjct  92   VVAGTKYYLRIAVTQPDGTSRMFDSVIVIQPWLFSKKLIEFTP  134



>ref|XP_010243158.1| PREDICTED: cysteine proteinase inhibitor 4-like [Nelumbo nucifera]
Length=133

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  +++VK + EVQ+LG+  + E+N   +++     +   L F EV++AE+QVV+G+KYY
Sbjct  38   RTEIEDVKDNEEVQELGRFSVEEFNRSQREEERSRGNV-YLVFSEVVRAERQVVSGIKYY  96

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            L ++A    G  K FDA +VV P   SK+L+T  P T
Sbjct  97   LNVEA-LEEGEAKKFDAVVVVKPWLESKQLLTFIPCT  132



>ref|XP_011024794.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
 ref|XP_011011101.1| PREDICTED: cysteine proteinase inhibitor B-like [Populus euphratica]
Length=137

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V++VK + E+Q+LG+  + E+NN  +           L F EV++A+ QVV+G+KYY
Sbjct  36   RAKVNDVKNNKEIQELGRFSVKEFNNH-RSTYGKGGEVGELMFSEVVEAQTQVVSGLKYY  94

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTRRR  288
            L+++ TT +     FD+ +VV P   SKEL++  PS   R R
Sbjct  95   LKIEVTTQSEEKLVFDSVLVVKPWLRSKELLSFEPSIGLRVR  136



>ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
 gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina]
Length=130

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R  V +VK + EVQ+LGK  + E+N   +++      ++   L F +V++A+KQVV+G+K
Sbjct  31   RSEVKDVKKNKEVQELGKFSVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIK  90

Query  419  YYLRLKATTSA-GATKTFDAEMVVGPGESSKELVTLAPS  306
            YYL ++ATT   G  + FD+ +V+ P   SKEL+  APS
Sbjct  91   YYLTIEATTGENGEIQMFDSIVVIKPWLHSKELLKFAPS  129



>ref|XP_002516375.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
 gb|EEF45992.1| Cysteine proteinase inhibitor B, putative [Ricinus communis]
Length=138

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 3/105 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISA---KMLTFLEVIKAEKQVVAGV  423
            R  V +VK++  VQ+LG+ C+ E+N    ++ +   +    ++L F EV+ AE QVV+G+
Sbjct  30   RTQVRDVKSNEAVQELGRFCVKEFNKQQLRQQHGGSNGGGGELLMFSEVVAAETQVVSGI  89

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTRRR  288
            KYYL++ A+   G  K FD+ +VV      K+L+T  P+     R
Sbjct  90   KYYLKIAASNGKGEAKVFDSVVVVKAWIDDKQLITFEPAAANELR  134



>ref|XP_010414055.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 8/100 (8%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN--NGLKKKNNPAIS------AKMLTFLEVIKAEKQVVA  429
            V NVK + E+Q+LG+ C+ ++N  +  ++ N  +I+      +  L F  V+ A+KQVVA
Sbjct  41   VANVKANREIQELGRYCVEQFNQRDQSEEGNVESIAKTDTDMSNPLRFSRVVSAQKQVVA  100

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G KYYLR++ T   G+TK FD+ +V+ P   SK+L+   P
Sbjct  101  GTKYYLRIEVTQPNGSTKMFDSVVVIQPWLHSKQLLGFTP  140



>ref|XP_010673372.1| PREDICTED: cysteine proteinase inhibitor B [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 65/102 (64%), Gaps = 9/102 (9%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNG-LKKKNNPAISAKM------LTFLEVIKAEKQVVAG  426
            + +V T+ EVQ+LGK  + EYN   L  + +P  S  +      L F++V+KA+KQVVAG
Sbjct  35   ITDVNTNKEVQELGKFSVEEYNREILNMQQSPLRSVGLGDTNGPLNFVKVVKAQKQVVAG  94

Query  425  VKYYLRLKATTSAGATKTFDAEMVVGPG-ESSKELVTLAPST  303
            +KYYL+++AT   G T+ FDA +VV P    SK+L+   PS+
Sbjct  95   LKYYLKVEATKD-GVTRIFDAVVVVKPWVHESKKLLNFGPSS  135



>ref|XP_006410333.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
 gb|ESQ51786.1| hypothetical protein EUTSA_v10017392mg [Eutrema salsugineum]
Length=142

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 60/101 (59%), Gaps = 10/101 (10%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKK---------KNNPAISAKMLTFLEVIKAEKQVV  432
            + NV+T+ E+Q+LG+ C+ ++N   +          K +PA+    L F  V+ A+KQVV
Sbjct  37   ISNVQTNMEIQELGRYCVEQFNLQEQSEQGNVASIAKTDPAV-LNPLKFSRVVSAQKQVV  95

Query  431  AGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            AG KYYLR++ +   G T+ FD+ +V+ P   S++L+   P
Sbjct  96   AGTKYYLRIEVSQPDGTTRMFDSVLVIQPWLHSRKLLGFTP  136



>gb|KDP32576.1| hypothetical protein JCGZ_13126 [Jatropha curcas]
Length=197

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+T+ EVQ LGK  + E+N  + +  N     + L F EV++A++QVV+G+KYY
Sbjct  31   RTEVKDVETNQEVQDLGKFSVEEFNEQIHRHGN---GGEELIFSEVVEAQRQVVSGIKYY  87

Query  413  LRLKATTSA-GATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            L+++A T   G  K FD+ +VV     SKEL++  P    R
Sbjct  88   LKIEAATKVNGEMKVFDSVVVVKAWLESKELISFEPDVKLR  128



>ref|XP_010510121.1| PREDICTED: cysteine proteinase inhibitor 2-like [Camelina sativa]
Length=146

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAIS--------AKMLTFLEVIKAEKQVVA  429
            V NVK + E+Q+LG+ C+ ++N   + +     S        +  L F  V+ A+KQVVA
Sbjct  41   VANVKANREIQELGRYCVEQFNQRDQSEEGKVESIAKSDTDMSNPLRFSRVVSAQKQVVA  100

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G KYYLR++ T   G+T+ FD+ +V+ P   SK+L+   P
Sbjct  101  GTKYYLRIEVTQPNGSTRMFDSVVVIQPWLHSKQLLGFTP  140



>ref|XP_002456830.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
 gb|EES01950.1| hypothetical protein SORBIDRAFT_03g043680 [Sorghum bicolor]
Length=155

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 9/101 (9%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V++D EVQ+LG+  + EYN  L+           L F  V+ A++QVV+G+KYY
Sbjct  58   RTEVRDVESDGEVQELGRFSVAEYNRQLRGDGG-----GRLEFGRVVAAQRQVVSGLKYY  112

Query  413  LRLKA----TTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            LR+ A      +AG  + FDA +VV P   S+ L+T AP+ 
Sbjct  113  LRVAAVEEGAQNAGGERAFDAVVVVKPWLESRTLLTFAPAA  153



>ref|XP_009144029.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ABB97037.1| cystatin-like protein [Brassica rapa]
Length=136

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 8/100 (8%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN-NGLKKKNNPAISAKM-------LTFLEVIKAEKQVVA  429
            V NV+T+ E+Q+LG+ C+ ++N     K+ N A +A+        L F  V  A+KQVVA
Sbjct  35   VGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQVVA  94

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G KYYLR+  T   G ++ FD+ +V+ P   SK+L+   P
Sbjct  95   GTKYYLRIAVTQPDGTSRMFDSVIVIQPWLFSKKLLEFTP  134



>emb|CDY42085.1| BnaA05g11010D [Brassica napus]
Length=136

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 8/100 (8%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN-NGLKKKNNPAISAKM-------LTFLEVIKAEKQVVA  429
            V NV+T+ E+Q+LG+ C+ ++N     K+ N A +A+        L F  V  A+KQVVA
Sbjct  35   VGNVRTNIEIQELGRYCVKQFNLQQQSKQGNEASNARTDAAVLSPLKFSRVESAQKQVVA  94

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G KYYLR+  T   G ++ FD+ +V+ P   SK+L+   P
Sbjct  95   GTKYYLRIAVTQPDGTSRMFDSVIVIQPWLFSKKLLEFTP  134



>ref|XP_003524913.1| PREDICTED: cysteine proteinase inhibitor 4-like isoform 1 [Glycine 
max]
Length=130

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + +VK + +VQ LG+  + E+N  L++        + +TF+EV++A++QVV+G+KYY
Sbjct  34   RSKIPDVKANKKVQDLGRFSVEEHNRMLRQAQK---EEEQVTFVEVVEAQQQVVSGIKYY  90

Query  413  LRLKATT--SAGATKTFDAEMVVGPGESSKELVTLAPST  303
            +++ AT     G ++ F++ +VV P   SK+L+  APST
Sbjct  91   MKISATQGGDGGDSRIFESVVVVKPWLRSKQLLNFAPST  129



>gb|KHN24041.1| Cysteine proteinase inhibitor 2, partial [Glycine soja]
Length=151

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLK--KKNNPAISAKMLTFLEVIKAEKQVVAGVKYYL  411
            +  V+ + +VQ+LG+  + EYN GLK  K NN     + L F  V++A++QVV+G+KYYL
Sbjct  39   IPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYL  98

Query  410  RLKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            ++ AT + G  + F++ +VV P   SK+L+  AP+
Sbjct  99   KISATHN-GVHEMFNSVVVVKPWLHSKQLLHFAPA  132



>ref|XP_003552894.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=142

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLK--KKNNPAISAKMLTFLEVIKAEKQVVAGVKYYL  411
            +  V+ + +VQ+LG+  + EYN GLK  K NN     + L F  V++A++QVV+G+KYYL
Sbjct  30   IPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYL  89

Query  410  RLKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            ++ AT + G  + F++ +VV P   SK+L+  AP+
Sbjct  90   KISATHN-GVHEMFNSVVVVKPWLHSKQLLHFAPA  123



>ref|XP_006840903.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
 gb|ERN02578.1| hypothetical protein AMTR_s00087p00084520 [Amborella trichopoda]
Length=120

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 10/97 (10%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + NVK++ EVQ LGK C+ +YN          +    L F EV++ E+QVV+G+KYY
Sbjct  33   RSAIPNVKSNTEVQDLGKFCVEKYNQ---------VHDSRLVFSEVVQGERQVVSGMKYY  83

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            L ++A       K FDA +VV     SK++++ +PST
Sbjct  84   LLIEA-KDGDVLKKFDAVVVVQAWRHSKQMLSFSPST  119



>ref|XP_009387215.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=140

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V +V+++ EVQ LG+  + EYN    +   PA     LTF  V+ A++QVV+G+KYYLR+
Sbjct  49   VRDVESNKEVQDLGRYSVEEYN----RHQGPA---HPLTFARVVGAQRQVVSGIKYYLRV  101

Query  404  KATT----SAGATKTFDAEMVVGPGESSKELVTLAPST  303
             AT     SAG  +T+DA +VV     S+EL++  P T
Sbjct  102  LATEGDGGSAGQQRTYDAVVVVKAWLGSRELISFVPIT  139



>ref|XP_004504436.1| PREDICTED: cysteine proteinase inhibitor 4-like [Cicer arietinum]
Length=130

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 9/100 (9%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            + NV+T+ EVQ +G+  + EYN   + K         L F+EV++A++QVV+G+KYY++L
Sbjct  33   ISNVRTNEEVQDIGRYSVEEYN---RSKKVWKEGEGELQFVEVVEAQQQVVSGIKYYMKL  89

Query  404  KATTSA------GATKTFDAEMVVGPGESSKELVTLAPST  303
              T S       G    FD+ +VV P  +SK L+  APST
Sbjct  90   WVTRSQIDGDGDGVPTMFDSVVVVKPWLNSKHLLHFAPST  129



>ref|XP_009132828.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10747.1| phytocystatin 2-2 [Brassica rapa subsp. pekinensis]
Length=141

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN-NGLKKKNNPAISAKM-----LTFLEVIKAEKQVVAGV  423
            V NV+T+ EVQ+LG+ C+ ++N +    K N A S        LTF  V+ A++QVVAG+
Sbjct  38   VPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVVAGL  97

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            KYYLR++ T     ++ FD+ +VV P   SK L+   P
Sbjct  98   KYYLRIEVTQPDRTSRMFDSVVVVQPWLHSKTLLGFTP  135



>emb|CAN70300.1| hypothetical protein VITISV_001398 [Vitis vinifera]
Length=199

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 7/88 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAI------SAKMLTFLEVIKAEKQVV  432
            R  + +VKT+ EVQQLG+  + EYN    ++   AI        + LTF EV++A+KQVV
Sbjct  37   RTEIKDVKTNKEVQQLGRFSVEEYNRSHGRRWREAIGNVLGMDYEYLTFSEVVEAQKQVV  96

Query  431  AGVKYYLRLKATTSAGATKTFDAEMVVG  348
            +G KYYL++ AT + G   TFDA +VVG
Sbjct  97   SGFKYYLKIAATQN-GVRNTFDAVVVVG  123



>ref|XP_004502264.1| PREDICTED: cysteine proteinase inhibitor 2-like [Cicer arietinum]
Length=134

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            +  + + +T+ EVQ+LGK  + EYN   K+  N     + L F+EV++A++QVV+G+KYY
Sbjct  29   KTEISDARTNREVQELGKFAVEEYN--YKQGLNNGGGGEALKFVEVVEAQQQVVSGMKYY  86

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTRR  291
            L + AT  +G  + F + +VV P    K+L+   P + T +
Sbjct  87   LNISATDRSGIHRMFTSVVVVKPWLQYKKLLHFEPLSTTHQ  127



>emb|CDX84749.1| BnaA03g14810D [Brassica napus]
Length=757

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN-NGLKKKNNPAISAKM-----LTFLEVIKAEKQVVAGV  423
            V NV+T+ EVQ+LG+ C+ ++N +    K N A S +      LTF  V+ A++QVVAG+
Sbjct  654  VPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIERAVLNPLTFSRVVSAQQQVVAGL  713

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            KYYLR++ T   G  + FD+ +VV P   SK L+   P
Sbjct  714  KYYLRIEVTQPDGTNRMFDSVVVVQPWLHSKTLLGFTP  751



>ref|XP_004160226.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
Length=128

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 58/100 (58%), Gaps = 8/100 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R+ V +V+ + EVQ+LG+  + EYN  +            + F  V+ AE+QVV+G KYY
Sbjct  31   RMEVKDVRRNEEVQRLGRFSVEEYNRRMG-------GGGEVKFTAVVAAERQVVSGTKYY  83

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            LR+  T + G  K FD+ ++V P   SK L+  +PST+ R
Sbjct  84   LRILGTQN-GERKVFDSVVIVKPWIGSKRLLDFSPSTVFR  122



>emb|CDX79450.1| BnaC03g17860D [Brassica napus]
Length=752

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN-NGLKKKNNPAISAKM-----LTFLEVIKAEKQVVAGV  423
            V NV+T+ EVQ+LG+ C+ ++N +    K N A S        LTF  V+ A++QVVAG+
Sbjct  649  VPNVQTNMEVQELGRYCVEQFNLHEQSGKGNVASSIDRAVLNPLTFSRVVSAQQQVVAGL  708

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            KYYLR++ T   G  + FD+ +VV P   SK L+   P
Sbjct  709  KYYLRIEVTQPDGTNRMFDSVVVVQPWLHSKTLLGFTP  746



>ref|XP_007153801.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
 gb|ESW25795.1| hypothetical protein PHAVU_003G065700g [Phaseolus vulgaris]
Length=130

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            +  + +VK + EVQ LG   + E+N  L++       ++   F+EV++A+KQ+V+G KYY
Sbjct  33   KTEITDVKRNKEVQDLGSFSVEEHNRMLRQALKGM--SEETKFVEVVEAQKQMVSGTKYY  90

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            L++ AT S G    FD+ +VV PG +SK+L++ APS+
Sbjct  91   LKISATQS-GNPVMFDSVVVVQPGLASKDLLSFAPSS  126



>ref|XP_010243160.1| PREDICTED: cysteine proteinase inhibitor 2-like [Nelumbo nucifera]
Length=145

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 9/105 (9%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAK--------MLTFLEVIKAEKQ  438
            R  V NVK + E+Q+LG+  + E+N   +++    +  +         L F EV+ AE+Q
Sbjct  38   RTDVKNVKCNHEIQKLGRFSVEEFNRRKQQEEVVLLHGQGTSNSDDGELVFSEVVMAERQ  97

Query  437  VVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            VV+G+ YYL ++A    G TK FDA + V P   SK+L+  +PST
Sbjct  98   VVSGINYYLHIEALQH-GMTKRFDAVVAVKPWLPSKQLLAFSPST  141



>gb|KEH20629.1| cysteine protease inhibitor cystatin [Medicago truncatula]
Length=133

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 7/97 (7%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V NV+T+ EVQ+LG+  + EYN  +K           L F+EV++A++QVV+G+KYY+++
Sbjct  38   VANVRTNDEVQELGRFAVEEYNRSVKIWKE---GEGELRFVEVVEAQQQVVSGIKYYMKI  94

Query  404  KATTS----AGATKTFDAEMVVGPGESSKELVTLAPS  306
              T +     G    FD+ ++V P  +SK L+  APS
Sbjct  95   WVTQAKSDGVGDPTMFDSVVLVKPWLNSKHLLHFAPS  131



>ref|XP_009402733.1| PREDICTED: cysteine proteinase inhibitor 4-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 10/100 (10%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+T+ EVQ LG   + EYN  L  +      A +LTF  V  A++QVV+G+KYY
Sbjct  34   RTEVQDVETNKEVQDLGLFSVDEYNRRLALRG-----AGLLTFSRVAAAQRQVVSGIKYY  88

Query  413  LRLKATTSAGAT-----KTFDAEMVVGPGESSKELVTLAP  309
            L++ A            +TFDA ++V P  SS+ LV+ AP
Sbjct  89   LQVVAAVEGTGEEGQQHRTFDAVVIVKPWLSSRSLVSFAP  128



>ref|XP_004138536.1| PREDICTED: cysteine proteinase inhibitor B-like [Cucumis sativus]
 gb|KGN45922.1| Cystatin [Cucumis sativus]
Length=128

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 8/100 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R+ V +V+ + EVQ+LG+  + EYN  +            + F  V+ AE+QVV+G KYY
Sbjct  31   RMEVKDVRRNEEVQRLGRFSVEEYNRRMG-------GGGEVKFTAVVAAERQVVSGTKYY  83

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
            LR+  T + G  K FD+ ++V P   SK L+  +PS + R
Sbjct  84   LRILGTQN-GERKVFDSVVIVKPWIGSKRLLDFSPSAVFR  122



>gb|KFK31166.1| hypothetical protein AALP_AA6G077400 [Arabis alpina]
Length=139

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN--NGLKKKNNPAISAKM---LTFLEVIKAEKQVVAGVK  420
            V NV+ + E+Q+LG+ C+ ++N     ++ N  +IS  +   L F  V+ A+KQVVAG+K
Sbjct  37   VANVQANREIQELGRYCVEQFNLREQREQGNIESISKTVTNTLKFSRVVSAQKQVVAGMK  96

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            Y+LR++ T   G+ + FD+ +V+ P    K ++   P
Sbjct  97   YFLRIEVTQPDGSRRMFDSVVVIQPWLHYKRVIGFTP  133



>gb|AFK48234.1| unknown [Medicago truncatula]
Length=133

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 60/103 (58%), Gaps = 3/103 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + +V T+ EVQ+LGK  + EYN   K+  N     + L F+EV++AE+QVV+G+KYY
Sbjct  30   RTEISDVGTNKEVQELGKFAVKEYN--YKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYY  87

Query  413  LRLKATTSAGATKTFDAEMVVGPG-ESSKELVTLAPSTLTRRR  288
            L + A    G  + F++ +VV P     K+++   PS+   + 
Sbjct  88   LNISAVDHNGVQRMFNSVVVVKPWLHQYKKVIHFGPSSTFHQH  130



>ref|XP_010557035.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=149

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 61/105 (58%), Gaps = 8/105 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYN--------NGLKKKNNPAISAKMLTFLEVIKAEKQ  438
            R  V +V+++ E+Q+LG+ C+ E+N         G    +  A     L F  V++A++Q
Sbjct  36   RSEVQDVESNRELQELGRYCVQEFNLREEREHEKGRGSTSEEAAVFDPLMFSRVVEAQEQ  95

Query  437  VVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            VV+G+KY+L+++ T S   T+ F + +V+ P   S+EL+  +P T
Sbjct  96   VVSGIKYFLKIEVTLSDRTTRMFTSVVVIKPWLQSRELLDFSPVT  140



>ref|XP_010542782.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=145

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 63/99 (64%), Gaps = 5/99 (5%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN--NGLKKKNNPAISAKML---TFLEVIKAEKQVVAGVK  420
            V +V+++ E+Q+LG+ C+ E+N   G ++K +     ++L    F  V++A++QVV+G+K
Sbjct  40   VPDVESNKELQELGRYCVEEFNLKEGRREKGSGEEEEEVLGPLVFSRVVEAQRQVVSGIK  99

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPST  303
            Y+L+++ T     T+ F + +VV P   S+EL+  +P T
Sbjct  100  YFLKIEVTLPDRTTRMFSSVVVVKPWLPSRELLDFSPLT  138



>ref|XP_010039949.1| PREDICTED: cysteine proteinase inhibitor B [Eucalyptus grandis]
 gb|KCW45610.1| hypothetical protein EUGRSUZ_L00642 [Eucalyptus grandis]
Length=146

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 56/98 (57%), Gaps = 6/98 (6%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKM-----LTFLEVIKAEKQVVA  429
            R  V +V+++ EVQ LG+  + EYN   + +              + F EV+ AE+QVVA
Sbjct  32   RTAVPDVRSNQEVQDLGRYSVEEYNRMQRWQRGGGGGRGGGDNGEIVFGEVVGAERQVVA  91

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTL  315
            G+KYYL+++     GA K F++ +VV P   SKELVT 
Sbjct  92   GIKYYLKIEGMQR-GARKVFESVVVVRPWVRSKELVTF  128



>emb|CAJ20032.1| putative cystatin [Zea mays]
Length=120

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 56/101 (55%), Gaps = 9/101 (9%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ D EVQ+LG+  + EYN  L+           L F  V+ A++QVV+G+KYY
Sbjct  21   RTEVRDVEGDGEVQELGRFSVAEYNRQLRDGG----GGGRLEFGRVVAAQRQVVSGLKYY  76

Query  413  LRLKAT-----TSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            LR+ A         G  + FDA +VV P   S+ L+T AP+
Sbjct  77   LRVVAVEEGGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPA  117



>emb|CAG38126.1| cystatin Hv-CPI5 [Hordeum vulgare subsp. vulgare]
 dbj|BAK02746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 10/102 (10%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKK--KNNPAISAKMLTFLEVIKAEKQVVAGVKYYL  411
            V +V+ D EVQ+LG+  + E+N   ++  +   A+  + L F  V+ A++QVV+GVKYYL
Sbjct  49   VRDVEGDREVQELGRYSVEEHNRRREEGCEGGGAVCGR-LEFARVVSAQRQVVSGVKYYL  107

Query  410  RLKATTSAGA-------TKTFDAEMVVGPGESSKELVTLAPS  306
            R+ A  + GA        + FDA +VV P   S+ LV  AP+
Sbjct  108  RVAAAEANGAGSNGVSDGRVFDAVVVVKPWLQSRSLVRFAPA  149



>ref|XP_006645220.1| PREDICTED: cysteine proteinase inhibitor 5-like [Oryza brachyantha]
Length=143

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (57%), Gaps = 9/99 (9%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V++V+ + EVQ+LG  C+ E+N    ++ +P      L F  V+ A+ QVVAG+KYYLR+
Sbjct  44   VEDVEGNREVQELGLFCVVEHN----RRGSPTARGHRLVFSRVVAAQTQVVAGIKYYLRI  99

Query  404  KATT-----SAGATKTFDAEMVVGPGESSKELVTLAPST  303
             A            K FDA +VV     S+E+++ AP+ 
Sbjct  100  AARNGLREGDDDEEKVFDAVVVVKAWVPSREMLSFAPAA  138



>ref|XP_010522274.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=132

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            +  +  V  + EVQ LG+ C+ E+N   ++KN    +   L F  V++A +QVV+G KY+
Sbjct  39   KTEIQGVDGNKEVQDLGRYCVEEFNRKEQEKNG---NVAPLVFNRVVEARQQVVSGTKYF  95

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLA  312
            L+++ T S   TK F++ +VV P   S+ELV  +
Sbjct  96   LKIETTLSDRTTKMFNSVVVVKPWLQSRELVDFS  129



>gb|AHV85520.1| cysteine proteinase inhibitor TrcC-6 [Secale cereale x Triticum 
aestivum]
Length=152

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 10/105 (10%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKK--KNNPAISAKMLTFLEVIKAEKQVVAGVK  420
            R  V +V+ D EVQ+LG+  + E+N   ++  + +  +  + L F  V+ A++Q+V+G+K
Sbjct  46   RTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGSGGVCGR-LEFARVVSAQRQMVSGIK  104

Query  419  YYLRLKATTSAGA-------TKTFDAEMVVGPGESSKELVTLAPS  306
            YYLR+ A    GA        + FDA +VV P   S+ LV  AP+
Sbjct  105  YYLRVAAAEEGGAGSNGVSDGRVFDAVVVVKPWLQSRALVRFAPA  149



>ref|XP_009141203.1| PREDICTED: cysteine proteinase inhibitor 2-like [Brassica rapa]
 gb|ADD10746.1| phytocystatin 2-1 [Brassica rapa subsp. pekinensis]
 emb|CDY60964.1| BnaA04g28930D [Brassica napus]
Length=142

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 59/98 (60%), Gaps = 6/98 (6%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN--NGLKKKNNPAISAKM----LTFLEVIKAEKQVVAGV  423
            + NV+T+ E+Q+LG+ C+ ++N     ++ N  +I+       L F  V+ A+KQVVAG+
Sbjct  39   IPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIADTAVLNPLNFSRVVSAQKQVVAGL  98

Query  422  KYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            KY LR++     G ++ FD+ +++ P   SK+L+   P
Sbjct  99   KYDLRIEVIQPDGTSRMFDSVVIIQPWLHSKKLLGFTP  136



>emb|CDY62192.1| BnaCnng39540D [Brassica napus]
Length=142

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 56/100 (56%), Gaps = 10/100 (10%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYN--------NGLKKKNNPAISAKMLTFLEVIKAEKQVVA  429
            + NV+T+ E+Q+LG+ C+ ++N        N     N   ++   L F  V+ A+KQVVA
Sbjct  39   IPNVQTNIEIQELGRYCVEQFNLMEESEQGNAESIANTAVLNP--LNFSRVVSAQKQVVA  96

Query  428  GVKYYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            G+KY LR++     G  + FD+ +++ P   SK+L+   P
Sbjct  97   GLKYDLRIEVIQPDGTNRMFDSVVIIQPWLHSKKLLGFTP  136



>ref|XP_008465470.1| PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]
Length=128

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 8/98 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R+ + +VK + EVQ+LG+  + EYN  +            + F  V+ A++QVV+G KYY
Sbjct  31   RMEIKDVKRNEEVQRLGRFSVEEYNRRMG-------GGGEVKFTAVVAADRQVVSGTKYY  83

Query  413  LRLKATTSAGATKTFDAEMVVGPGESSKELVTLAPSTL  300
            LR+    + G  K FD+ ++V P   SK L+  +PST+
Sbjct  84   LRILGIQN-GERKIFDSVVIVKPWIGSKRLLDFSPSTV  120



>ref|NP_001052530.1| Os04g0350100 [Oryza sativa Japonica Group]
 sp|A2XS65.2|CYT10_ORYSI RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Indica Group]
 sp|P0C579.1|CYT10_ORYSJ RecName: Full=Cysteine proteinase inhibitor 10; AltName: Full=Oryzacystatin 
X; Short=OC-X; AltName: Full=Oryzacystatin-10; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE05518.1| OSJNBa0038P21.11 [Oryza sativa Japonica Group]
 dbj|BAF14444.1| Os04g0350100 [Oryza sativa Japonica Group]
 emb|CAH66615.1| OSIGBa0144C23.1 [Oryza sativa Indica Group]
 dbj|BAG88896.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95408.1| unnamed protein product [Oryza sativa Japonica Group]
Length=151

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 10/110 (9%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKK--KNNPAISAKM-LTFLEVIKAEKQVVAGV  423
            R  + +V ++  VQ LG+  + E+N  L+      PA    + L F  V++A+KQVV+GV
Sbjct  42   RTEIRDVGSNKAVQSLGRFAVAEHNRRLRHGGSGGPADPVPVKLAFARVVEAQKQVVSGV  101

Query  422  KYYLRLKAT-------TSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
             YYL++ A+        +AG  + FDA +VV     SKELV+  P++ T+
Sbjct  102  AYYLKVAASARDPRGGAAAGGDRVFDAVVVVKAWLKSKELVSFTPASSTK  151



>ref|XP_007153806.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
 gb|ESW25800.1| hypothetical protein PHAVU_003G066200g [Phaseolus vulgaris]
Length=173

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 6/93 (6%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            + NV  + EVQ LG+  + E N  +K+    A +   LTF+EV++A+KQVV+  KYYL++
Sbjct  85   IANVNMNKEVQDLGQFAVEERNQSMKE---IAFAKPELTFVEVLEAQKQVVSVTKYYLKI  141

Query  404  KATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
             +T  +G +KT+D+ +VV P  SSK+L+    S
Sbjct  142  -STNKSGGSKTYDSVVVVKP--SSKQLLNFTAS  171



>ref|NP_001172709.1| Os01g0915401 [Oryza sativa Japonica Group]
 sp|Q0JGM8.2|CYT5_ORYSJ RecName: Full=Cysteine proteinase inhibitor 5; AltName: Full=Oryzacystatin 
V; Short=OC-V; AltName: Full=Oryzacystatin-5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|EAY76950.1| hypothetical protein OsI_04908 [Oryza sativa Indica Group]
 gb|EAZ14606.1| hypothetical protein OsJ_04531 [Oryza sativa Japonica Group]
 dbj|BAH91439.1| Os01g0915401 [Oryza sativa Japonica Group]
Length=148

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V++V+ + EVQ+LG  C+ E+N    ++   A   + L F  V+ A+ QVV+G+KYYLR+
Sbjct  55   VEDVEGNREVQELGLFCVVEHN----RRGGSATRGRGLVFSRVVAAQTQVVSGIKYYLRI  110

Query  404  KATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
             A   A     FDA +VV     S+E+V+  P+
Sbjct  111  -AAQEADDELVFDAVVVVKAWVPSREMVSFVPA  142



>ref|XP_004971036.1| PREDICTED: cysteine proteinase inhibitor 4-like [Setaria italica]
Length=160

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 14/105 (13%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ D EVQ+LG+  + EYN               L F  V+ A++QVV+G+KYY
Sbjct  60   RTEVRDVEGDEEVQELGRFSVAEYNR------RRVGGGGRLEFARVVAAQRQVVSGLKYY  113

Query  413  LRLKATTSAGA--------TKTFDAEMVVGPGESSKELVTLAPST  303
            LR+ A    GA         + FDA +VV P   S+ L+  AP+ 
Sbjct  114  LRVAAEEEGGAENAGSGEGERVFDAVVVVKPWLESRTLLRFAPAA  158



>emb|CDM85644.1| unnamed protein product [Triticum aestivum]
Length=153

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 9/105 (9%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAIS--AKMLTFLEVIKAEKQVVAGVK  420
            R  V +V+ D EVQ+LG+  + E+N   ++            L F  V+ A++QVV+G+K
Sbjct  46   RTEVRDVEGDREVQELGRYSVEEHNRRREEGCEGGGGGVCARLEFARVVSAQRQVVSGIK  105

Query  419  YYLRLKATTSAGA-------TKTFDAEMVVGPGESSKELVTLAPS  306
            YYLR+ A    GA        + FDA +VV P   S+ LV  AP+
Sbjct  106  YYLRVAAAVDNGAGSNGISDGRVFDAVVVVKPWLQSRALVRFAPA  150



>ref|XP_003601729.1| Cysteine proteinase inhibitor [Medicago truncatula]
Length=129

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + +V T+ EVQ+LGK  + EYN   K+  N     + L F+EV++AE+QVV+G+KYY
Sbjct  29   RTEISDVGTNKEVQELGKFAVKEYN--YKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYY  86

Query  413  LRLKATTSAGATKTFDAEMVVGP  345
            L + A    G  + F++ +VV P
Sbjct  87   LNISAVDHNGVQRMFNSVVVVKP  109



>gb|AES71980.2| phloem filament protein PP1 [Medicago truncatula]
Length=130

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + +V T+ EVQ+LGK  + EYN   K+  N     + L F+EV++AE+QVV+G+KYY
Sbjct  30   RTEISDVGTNKEVQELGKFAVKEYN--YKQGLNNGGGGEGLKFVEVVEAEQQVVSGMKYY  87

Query  413  LRLKATTSAGATKTFDAEMVVGP  345
            L + A    G  + F++ +VV P
Sbjct  88   LNISAVDHNGVQRMFNSVVVVKP  110



>ref|NP_001045185.1| Os01g0915200 [Oryza sativa Japonica Group]
 sp|Q5N806.1|CYT4_ORYSJ RecName: Full=Cysteine proteinase inhibitor 4; AltName: Full=Oryzacystatin 
IV; Short=OC-IV; AltName: Full=Oryzacystatin-4; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD82395.1| putative cystatin [Oryza sativa Japonica Group]
 dbj|BAF07099.1| Os01g0915200 [Oryza sativa Japonica Group]
 gb|EAZ14605.1| hypothetical protein OsJ_04530 [Oryza sativa Japonica Group]
 dbj|BAH00694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=158

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 9/99 (9%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V +V+ D EVQ+LG+  + E+N   + ++   +    L F  V+ A++QVV+G+KYYLR+
Sbjct  56   VRDVEGDREVQELGRFSVEEHNRRRRSRDCGDVR---LEFGRVVAAQRQVVSGLKYYLRV  112

Query  404  ------KATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
                   A  + G  + FDA +VV P   S+ L+T AP+
Sbjct  113  AAAEEGAAGQNGGEPRVFDAVVVVKPWLESRTLLTFAPA  151



>gb|EAY76949.1| hypothetical protein OsI_04907 [Oryza sativa Indica Group]
Length=159

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 58/99 (59%), Gaps = 9/99 (9%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            V +V+ D EVQ+LG+  + E+N   + ++   +    L F  V+ A++QVV+G+KYYLR+
Sbjct  57   VRDVEGDREVQELGRFSVEEHNRRRRSRDCGDVR---LEFGRVVAAQRQVVSGLKYYLRV  113

Query  404  ------KATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
                   A  + G  + FDA +VV P   S+ L+T AP+
Sbjct  114  AAAEEGAAGQNGGEPRVFDAVVVVKPWLESRTLLTFAPA  152



>gb|EMT28873.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=152

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKM-LTFLEVIKAEKQVVAGVKY  417
            R  V +V+ D E Q+LG+  + E+N   ++           L F  V+ A++QVV+G+KY
Sbjct  46   RTEVTDVEGDREGQELGRYSVEEHNRRREEGCEGGGGVCGRLEFARVVSAQRQVVSGIKY  105

Query  416  YLRLKATTSAGA-------TKTFDAEMVVGPGESSKELVTLAPS  306
            YLR+ A    GA        + FDA +VV P   S+ L+  AP+
Sbjct  106  YLRVAAAEEGGAGSNGVTDGRVFDAVVVVKPWLQSRALIRFAPA  149



>ref|XP_010244063.1| PREDICTED: cysteine proteinase inhibitor B-like [Nelumbo nucifera]
Length=139

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 7/132 (5%)
 Frame = -3

Query  674  LILVAMAVAIICgeqvgaqlgggavgGRIPVDNVKTDAEVQQLGKDCITEYNNGLKKK--  501
            L L+A+ V  +C            VGG   V +V  + EVQ++G+  + E+N    ++  
Sbjct  9    LFLLALYV-FLCCSWRAVHGRRIMVGGWTEVQDVGCNDEVQEVGRFSVDEFNRKQHQEAE  67

Query  500  ---NNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGATKTFDAEMVVGPGESSK  330
                  + +   L F EV+ A++QV+ GVKYYL ++A    G  + FDA + V P   SK
Sbjct  68   ARGQGSSSNGGDLVFSEVVMAKQQVITGVKYYLYIEAFRD-GFRQRFDAIVAVKPWLQSK  126

Query  329  ELVTLAPSTLTR  294
            EL+  +PS+  R
Sbjct  127  ELLIFSPSSGYR  138



>ref|NP_001146946.1| cysteine proteinase inhibitor B precursor [Zea mays]
 gb|ACG24630.1| cysteine proteinase inhibitor B [Zea mays]
Length=150

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ D EVQ+LG+  + EYN   ++          L F  V+ A++QVV+G+KYY
Sbjct  51   RTEVRDVEGDGEVQELGRFSVAEYN---RQLREGGGGGGRLEFGRVVAAQRQVVSGLKYY  107

Query  413  LRLKAT----TSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            LR+ A        G  + FDA +VV P   S+ L+T AP+
Sbjct  108  LRVVAVEEGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPA  147



>gb|EAY93675.1| hypothetical protein OsI_15462 [Oryza sativa Indica Group]
Length=151

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 57/106 (54%), Gaps = 6/106 (6%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKK-KNNPAISAKM-LTFLEVIKAEKQVVAGVK  420
            R  + +V  +  VQ LG+  + E+N  L+     PA    + L F  V++A+KQVV+GV 
Sbjct  46   RTEIRDVGGNKAVQSLGRFAVAEHNRRLRHGSGGPADPVPVKLAFARVVEAQKQVVSGVA  105

Query  419  YYLRLKATTSAGAT----KTFDAEMVVGPGESSKELVTLAPSTLTR  294
            YYL++ A    G      + FDA +VV     SKELV+  P+  T+
Sbjct  106  YYLKVAARDPRGGAAAGDRVFDAVVVVKAWLKSKELVSFTPAASTK  151



>gb|AFW84200.1| putative cystatin [Zea mays]
Length=155

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 8/101 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ D EVQ+LG+  + EYN   ++          L F  V+ A++QVV+G+KYY
Sbjct  55   RTEVRDVEGDGEVQELGRFSVAEYN---RQLREGGGGGGRLEFGRVVAAQRQVVSGLKYY  111

Query  413  LRLKAT-----TSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            LR+ A         G  + FDA +VV P   S+ L+T AP+
Sbjct  112  LRVVAVEEGGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPA  152



>tpe|CAG29029.1| TPA: putative cystatin [Zea mays]
Length=155

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 8/101 (8%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ D EVQ+LG+  + EYN   ++          L F  V+ A++QVV+G+KYY
Sbjct  55   RTEVPDVEGDGEVQELGRFSVAEYN---RQLREGGGGGGRLEFGRVVAAQRQVVSGLKYY  111

Query  413  LRLKAT-----TSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            LR+ A         G  + FDA +VV P   S+ L+T AP+
Sbjct  112  LRVVAVEEGGGAGNGGERVFDAVVVVKPWLDSRTLLTFAPA  152



>gb|KDO52834.1| hypothetical protein CISIN_1g035532mg, partial [Citrus sinensis]
Length=112

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNN--PAISAKMLTFLEVIKAEKQVVAGVK  420
            R  V +VK + EVQ+LGK  + E+N   +++      ++   L F +V++A+KQVV+G+K
Sbjct  31   RSEVKDVKKNKEVQELGKFSVEEFNRSQQRQGKVIRNVAFGRLRFSQVLEAQKQVVSGIK  90

Query  419  YYLRLKATTSA-GATKTFDA  363
            YYL ++ATT   G  + FD+
Sbjct  91   YYLTIEATTGENGEIQMFDS  110



>emb|CAG38125.1| cystatin Hv-CPI9 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91797.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=143

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 52/101 (51%), Gaps = 5/101 (5%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKK---NNPAISAKMLTFLEVIKAEKQVVAGV  423
            R  + +V  +  VQ LG+  + E+N  L      NN       L F  V  A+KQV++GV
Sbjct  41   RTEISDVGKNKLVQSLGRFAVAEHNRRLGHGGSGNNGDPVQVQLAFTAVAAAQKQVISGV  100

Query  422  KYYLRL--KATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
             YYL++  +A    G  + FDA +VV     SKELV+  PS
Sbjct  101  VYYLKVIARAPAGGGGDRPFDAVVVVKAWAKSKELVSFMPS  141



>gb|EMT28874.1| Cysteine proteinase inhibitor 4 [Aegilops tauschii]
Length=149

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 7/94 (7%)
 Frame = -3

Query  566  DAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSA  387
            + + ++LG+  + E+N    +          L F  V+ A++QVV+GVKYYLR+ A    
Sbjct  53   EGDREELGRYSVEEHNRRRGEGCEDGGVCGRLEFARVVSAQRQVVSGVKYYLRVAAAEEN  112

Query  386  GA-------TKTFDAEMVVGPGESSKELVTLAPS  306
            GA        + FDA +VV P   S+ LV  AP+
Sbjct  113  GAGTNGVSDGRVFDAVVVVKPWLQSRALVRFAPA  146



>gb|ABK21379.1| unknown [Picea sitchensis]
 gb|ABK22996.1| unknown [Picea sitchensis]
 gb|ACN40467.1| unknown [Picea sitchensis]
Length=130

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 10/92 (11%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            + +V+   E+Q LG+  + EYN     + N  IS     F +V+KA++QVV+G+ YYL +
Sbjct  43   IPDVEHKKEIQDLGRFAVDEYNT----QQNVGIS-----FSKVVKAQEQVVSGLLYYLTI  93

Query  404  KATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            K T     TK + A++ V P E  K+L    P
Sbjct  94   K-TKEGSKTKLYAAKIWVKPWEKFKQLQEFKP  124



>pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Full Length Adhiron
 pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Truncated Adhiron
Length=79

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = -3

Query  560  EVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGA  381
            E+++L +  + E+N    KK N      +L F+ V+KA++QVVAG  YYL L+A    G 
Sbjct  5    EIEELARFAVDEHN----KKENA-----LLEFVRVVKAKEQVVAGTMYYLTLEA-KDGGK  54

Query  380  TKTFDAEMVVGPGESSKELVTLAP  309
             K ++A++ V P E+ KEL    P
Sbjct  55   KKLYEAKVWVKPWENFKELQEFKP  78



>ref|XP_007153809.1| hypothetical protein PHAVU_003G066500g [Phaseolus vulgaris]
 gb|ESW25803.1| hypothetical protein PHAVU_003G066500g [Phaseolus vulgaris]
Length=125

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 4/93 (4%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            + NVK + EVQ +G+  + + N  +K+    A +   LTF+EV++A+KQVV+G KYYL++
Sbjct  37   IANVKMNKEVQDVGRFAVEDSNRIMKEM---ASAKPELTFVEVLEAQKQVVSGTKYYLKI  93

Query  404  KATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
                + G        +VV  G SSKEL  L  S
Sbjct  94   LVNENGGRNSITYNSVVVVKG-SSKELQILTVS  125



>ref|XP_003579572.1| PREDICTED: cysteine proteinase inhibitor 10-like [Brachypodium 
distachyon]
Length=129

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  + NV  +  VQ LG+  + E+N  L +   PA +   L F+ V  A+KQ+V+GVKYY
Sbjct  32   RTDIKNVGRNTFVQSLGRFAVAEHNR-LVRGVGPATA--QLKFVAVEAAQKQIVSGVKYY  88

Query  413  LRLKATTSAGATKTFDAEMVVGPG  342
            L++ A   A     FDA +VV  G
Sbjct  89   LKVIARARAAGNAPFDAVVVVKSG  112



>ref|XP_007153804.1| hypothetical protein PHAVU_003G066000g [Phaseolus vulgaris]
 gb|ESW25798.1| hypothetical protein PHAVU_003G066000g [Phaseolus vulgaris]
Length=102

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -3

Query  578  NVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKA  399
            NVK + EVQ LG+  + E N  +K+K   A +  ++ F++V++A+KQ V+G KYYL++ A
Sbjct  15   NVKMNKEVQDLGRFAVDERNRNVKEK---AFARPIVAFVQVLEAQKQEVSGTKYYLKI-A  70

Query  398  TTSAGATKTFDAEMVVGPGESSKEL  324
            T    A  +   + VV    SSKEL
Sbjct  71   TNQNEARDSVIYDSVVVVKGSSKEL  95



>ref|XP_003564913.1| PREDICTED: cysteine proteinase inhibitor 4-like [Brachypodium 
distachyon]
Length=161

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 22/111 (20%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ + EVQ+LG+  + E+N   +++ +       L F  V+ A++QVV+G+KYY
Sbjct  55   RTEVRDVEGNREVQELGRYSVDEHN---RRREDDG----RLEFGRVVSAQRQVVSGLKYY  107

Query  413  LRLKA---------------TTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            LR+ A                 +    + FDA +VV P   S+ L+  AP+
Sbjct  108  LRVAAAELPQQQQEEGINNNNKAVEGERVFDAVVVVKPWLDSRALLRFAPA  158



>ref|XP_010522275.1| PREDICTED: cysteine proteinase inhibitor 2-like [Tarenaya hassleriana]
Length=142

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 61/97 (63%), Gaps = 7/97 (7%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISA-----KMLTFLEVIKAEKQVVAGVK  420
            V +V ++ E+Q+LG+ C+ E+N  LK++     S        L F EV++ ++QVV+G+K
Sbjct  39   VLDVASNKELQELGRYCVEEFN--LKEQREHGKSGGEEGFNPLMFGEVVEVQRQVVSGIK  96

Query  419  YYLRLKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            Y+LR++AT     T+ F++ +VV P   SKEL+  +P
Sbjct  97   YFLRIQATLPDRTTRMFNSVVVVKPWLQSKELLDFSP  133



>gb|ABK23108.1| unknown [Picea sitchensis]
Length=128

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 10/84 (12%)
 Frame = -3

Query  560  EVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGA  381
            E+Q LG+  + EYN           +A++L F  V+KA++QVV+G+ YYLR++ T   G 
Sbjct  49   EIQDLGRFAVNEYN--------VQQNARIL-FSRVLKAQEQVVSGLLYYLRVE-TMDGGK  98

Query  380  TKTFDAEMVVGPGESSKELVTLAP  309
            TK + A++ V P E  ++L    P
Sbjct  99   TKLYAAKIWVKPWEKFRQLQEFKP  122



>emb|CDY14750.1| BnaC04g47470D [Brassica napus]
Length=129

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 10/90 (11%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +   E++ L +  I E+NN   K+N      K+L F +++KA +QVVAG+ YYL L+A  
Sbjct  49   QNSGEIESLARFAIQEHNN---KEN------KVLEFKKIVKARQQVVAGMMYYLTLEA-N  98

Query  392  SAGATKTFDAEMVVGPGESSKELVTLAPST  303
              G  K F+A++ V P  + K+L     S+
Sbjct  99   EGGQAKNFEAKVWVKPWMNFKQLREFKESS  128



>ref|XP_006646602.1| PREDICTED: cysteine proteinase inhibitor 4-like [Oryza brachyantha]
Length=146

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 55/107 (51%), Gaps = 16/107 (15%)
 Frame = -3

Query  593  RIPVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYY  414
            R  V +V+ D EVQ+LG+  + E+N     +         L F  V+ A++QVV+G+ YY
Sbjct  41   RTEVMDVEGDREVQELGRFSVEEHN-----RRRDCCGDVRLEFSRVVAAQRQVVSGLMYY  95

Query  413  LRLKATT--------SAGA---TKTFDAEMVVGPGESSKELVTLAPS  306
            LR+ A          + G     + +DA +VV P   S+ L+T AP+
Sbjct  96   LRVAAAEEGAAAADQNGGGDHHARVYDAVVVVKPWLESRTLLTFAPA  142



>sp|Q10992.1|CYTA_HELAN RecName: Full=Cysteine proteinase inhibitor A; AltName: Full=Cystatin-A; 
AltName: Full=SCA [Helianthus annuus]
Length=82

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 10/84 (12%)
 Frame = -3

Query  560  EVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGA  381
            E+ +L +  + E+N   KK+N       +L F +V+  ++QVVAG  YY+ L+A T+ G 
Sbjct  3    EIDELARFAVDEHN---KKQN------ALLEFGKVVNTKEQVVAGKMYYITLEA-TNGGV  52

Query  380  TKTFDAEMVVGPGESSKELVTLAP  309
             KT++A++ V P E+ KEL    P
Sbjct  53   KKTYEAKVWVKPWENFKELQEFKP  76



>emb|CDY14748.1| BnaC04g47450D [Brassica napus]
Length=93

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 10/90 (11%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +   E++ L +  I ++NN   ++N      K+L F +++KA +QVVAG  YYL L+A  
Sbjct  13   QNSGEIENLARFAIQQHNN---REN------KVLEFKKIVKAREQVVAGTMYYLTLEA-N  62

Query  392  SAGATKTFDAEMVVGPGESSKELVTLAPST  303
              G  K F+A++ V P  + K+L     S+
Sbjct  63   EGGQAKNFEAKVWVKPWMNFKQLQEFKESS  92



>emb|CDY06956.1| BnaA04g23590D [Brassica napus]
Length=130

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (56%), Gaps = 10/90 (11%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +   E++ L +  I E+NN   ++N      K+L F +++KA +QVVAG  YYL L+A  
Sbjct  50   QNSGEIESLARFAIQEHNN---REN------KVLEFKKIVKAREQVVAGTMYYLTLEA-N  99

Query  392  SAGATKTFDAEMVVGPGESSKELVTLAPST  303
              G  K F+A++ V P  + K+L     S+
Sbjct  100  EGGQAKNFEAKVWVKPWMNFKQLQEFKESS  129



>emb|CDY04170.1| BnaA09g19480D [Brassica napus]
Length=213

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (51%), Gaps = 15/106 (14%)
 Frame = -3

Query  587  PVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            P+ +VK +A + ++G+  ++EYN   K           L F+EV+  E Q+VAG+ Y L 
Sbjct  31   PISDVK-NAHIVEIGEFAVSEYNKQSKSG---------LKFVEVVSGESQIVAGMNYRLI  80

Query  407  LKATTSA-----GATKTFDAEMVVGPGESSKELVTLAPSTLTRRRL  285
            L A         G +K ++A +   P   S  L +  P+ LTR++L
Sbjct  81   LAANEGVAIAGNGESKKYEAVVWEKPWLKSMNLTSFKPAMLTRKQL  126



>sp|Q10Q47.1|CYT7_ORYSJ RecName: Full=Putative cysteine proteinase inhibitor 7; AltName: 
Full=Oryzacystatin VII; Short=OC-VII; AltName: Full=Oryzacystatin-7; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF94587.1| Cystatin, putative [Oryza sativa Japonica Group]
 gb|EAY88996.1| hypothetical protein OsI_10479 [Oryza sativa Indica Group]
 gb|EAZ26018.1| hypothetical protein OsJ_09871 [Oryza sativa Japonica Group]
Length=117

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 11/94 (12%)
 Frame = -3

Query  587  PVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            PVD    D  VQ+LG+  + E + G        ++A  LTF  V   EKQVVAGV Y L 
Sbjct  32   PVD--INDPHVQELGRWAVAEEDRG--------VAAGGLTFERVTDGEKQVVAGVNYRLT  81

Query  407  LKATTSAGATKTFDAEMV-VGPGESSKELVTLAP  309
            L+A++S      ++A +    P  ++++LV+  P
Sbjct  82   LEASSSGAKDGRYEAVVYEQDPRSNARKLVSFEP  115



>ref|XP_003532730.1| PREDICTED: cysteine proteinase inhibitor 4-like [Glycine max]
Length=103

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 5/87 (6%)
 Frame = -3

Query  563  AEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT--S  390
            A VQ LG+  + E+N  L++               V++A+ QVV+G+KYY+++ AT    
Sbjct  2    AVVQDLGRFSVEEHNRMLRQAQKEEEEVTFEE---VVEAQSQVVSGIKYYMKISATQGGD  58

Query  389  AGATKTFDAEMVVGPGESSKELVTLAP  309
             G ++ F++ +VV P   SK+L+  AP
Sbjct  59   GGDSRIFESVVVVKPWLRSKQLLNFAP  85



>gb|ABS11040.1| cysteine proteinase inhibitor [Brassica oleracea var. gemmifera]
Length=70

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 47/80 (59%), Gaps = 10/80 (13%)
 Frame = -3

Query  566  DAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSA  387
              E++ L +  I E+NN   K+N      K+L F +++KA +QVVAG+ YYL L+A    
Sbjct  1    SGEIESLARFAIQEHNN---KEN------KVLEFKKIVKARQQVVAGMMYYLTLEA-NEG  50

Query  386  GATKTFDAEMVVGPGESSKE  327
            G  K F+A++ V P  + K+
Sbjct  51   GQAKNFEAKVWVTPWMNFKQ  70



>gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa]
Length=228

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = -3

Query  581  DNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLK  402
            D  +  AE+++L +  + E+N   KK+N      ++L F  V+KA++QVVAG  +YL L+
Sbjct  39   DGAQNSAELEELARFAVEEHN---KKEN------RLLEFTRVVKAKEQVVAGTLHYLTLE  89

Query  401  ATTSAGATKTFDAEMVVGPGESSKEL  324
            A   AG  K ++A++ V P    KEL
Sbjct  90   A-IDAGKKKLYEAKVWVKPWLHFKEL  114



>ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
Length=206

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +  AE+++L +  + E+N    KK+N      +L F  V+KA++QVVAG  Y+L L+A  
Sbjct  15   QNSAEIEELARFAVQEHN----KKSNS-----LLEFARVVKAKEQVVAGTLYHLTLEA-I  64

Query  392  SAGATKTFDAEMVVGPGESSKEL  324
             AG  K ++A++ + P E+ KEL
Sbjct  65   DAGKNKLYEAKVWLKPWENFKEL  87



>ref|XP_006411355.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
 gb|ESQ52808.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
Length=127

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 50/90 (56%), Gaps = 10/90 (11%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +   E++ L +  I E+NN   ++N      K+L F +++KA +QVVAG  Y+L L+A  
Sbjct  47   QNSGEIESLARFAIQEHNN---RQN------KVLEFKKIVKAREQVVAGTMYHLTLEA-N  96

Query  392  SAGATKTFDAEMVVGPGESSKELVTLAPST  303
              G  K F+A++ V P  + K+L     S+
Sbjct  97   EGGQAKNFEAKVWVKPWMNFKQLQEFKESS  126



>ref|XP_007153810.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
 gb|ESW25804.1| hypothetical protein PHAVU_003G066600g [Phaseolus vulgaris]
Length=126

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKN--NPAISAKMLTFLEVIKAEKQVVAGVKYYL  411
            + + KT+ EVQ LG+  + E N  LK+     P ++     F+ V++A+KQVV+G KYYL
Sbjct  37   IADAKTNQEVQDLGRFAVDERNRKLKESGAMRPVVA-----FVTVLEAQKQVVSGTKYYL  91

Query  410  RLKATTSAGATKTFDAEMVVGPGESSKEL  324
            ++    +          +VV  G SSKEL
Sbjct  92   KISTNQNEARESVIYDSVVVVKG-SSKEL  119



>gb|KFK36955.1| hypothetical protein AALP_AA4G194100 [Arabis alpina]
Length=93

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (56%), Gaps = 10/90 (11%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +   E++ L +  I E+NN   K+N      K+L F +++KA +QVVAG  Y+L L+A  
Sbjct  13   QNSGEIESLARFAIQEHNN---KEN------KVLEFKKIVKAREQVVAGTMYHLTLEA-K  62

Query  392  SAGATKTFDAEMVVGPGESSKELVTLAPST  303
                TK F+A++ V P  + K+L     S+
Sbjct  63   EGDKTKNFEAKVWVKPWMNFKQLQEFKESS  92



>emb|CBI32827.3| unnamed protein product [Vitis vinifera]
Length=201

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = -3

Query  575  VKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKAT  396
            ++  AE++ + +  + E+N     KN  A    +L F +V+KA++QVVAG  YYL L+A 
Sbjct  13   IQNSAEIESIARFAVQEHN-----KNQNA----LLEFAKVLKAKEQVVAGKIYYLTLEA-  62

Query  395  TSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
              AG  K ++A++ V P  + KEL     S  T+
Sbjct  63   IDAGKKKIYEAKVWVKPWMNFKELQEFKHSQETK  96



>ref|XP_007216188.1| hypothetical protein PRUPE_ppa015901mg, partial [Prunus persica]
 gb|EMJ17387.1| hypothetical protein PRUPE_ppa015901mg, partial [Prunus persica]
Length=139

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -3

Query  584  VDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRL  405
            +++VK + EVQ+LG   + E +N  ++K++ +   + + FLEV+K ++Q+V+G+KYYL++
Sbjct  1    IEDVKMNKEVQELGTFSM-EQDNQSQRKSHQSNVGEEIQFLEVVKEQRQMVSGIKYYLKV  59



>ref|XP_010230219.1| PREDICTED: putative cysteine proteinase inhibitor 7 [Brachypodium 
distachyon]
Length=115

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 50/94 (53%), Gaps = 11/94 (12%)
 Frame = -3

Query  587  PVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            P+D    D  VQ+LGK  + E+   +KK ++       LTF +V + E+Q V GVKY L 
Sbjct  31   PID--VNDPHVQELGKWAVIEH---VKKAHD------GLTFSKVTRGEEQDVGGVKYRLS  79

Query  407  LKATTSAGATKTFDAEMVVGPGESSKELVTLAPS  306
            ++A   +G    +   ++  P   ++ L++ AP+
Sbjct  80   IEAVQGSGTVGKYSTVLIEEPRSKTRNLISFAPA  113



>ref|XP_002531171.1| Cysteine proteinase inhibitor, putative [Ricinus communis]
 gb|EEF31214.1| Cysteine proteinase inhibitor, putative [Ricinus communis]
Length=119

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 12/93 (13%)
 Frame = -3

Query  587  PVDNVKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLR  408
            P++N+ TD  V ++GK  + EYN   + K N       L    ++K E QVVAG  Y L 
Sbjct  36   PINNL-TDPHVVEIGKFAVREYNK--RSKTN-------LELKSIVKGESQVVAGTNYKLV  85

Query  407  LKATTSAGATKTFDAEMVVGPGESSKELVTLAP  309
            L    S G +K ++A +   P E  +EL +  P
Sbjct  86   L--AVSGGDSKKYEAVVWEKPWEKFRELTSFKP  116



>ref|XP_009141947.1| PREDICTED: cysteine proteinase inhibitor 3-like [Brassica rapa]
Length=130

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -3

Query  572  KTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATT  393
            +   E++ L +  I E+NN   ++N       +L F +++KA +QVVAG  YYL L+A  
Sbjct  50   QNSGEIESLARFAIQEHNN---REN------MVLEFKKIVKAREQVVAGTMYYLTLEA-N  99

Query  392  SAGATKTFDAEMVVGPGESSKELVTLAPST  303
              G  K F+A++ V P  + K+L     S+
Sbjct  100  EGGQAKNFEAKVWVKPWMNFKQLQEFKESS  129



>emb|CDY35433.1| BnaA03g19270D [Brassica napus]
Length=94

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 10/85 (12%)
 Frame = -3

Query  557  VQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKATTSAGAT  378
            +  L +  I E+NN   ++N      K+L F +++KA +QVVAG  Y+L L+A +  G +
Sbjct  19   ISSLARFAIQEHNN---REN------KVLAFKKIVKAREQVVAGTMYHLTLEA-SEGGKS  68

Query  377  KTFDAEMVVGPGESSKELVTLAPST  303
            K F+A++ V P  + K+L     S+
Sbjct  69   KNFEAKVWVKPWMNFKQLQEFKESS  93



>ref|XP_002283400.1| PREDICTED: cysteine proteinase inhibitor 12-like [Vitis vinifera]
Length=234

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = -3

Query  575  VKTDAEVQQLGKDCITEYNNGLKKKNNPAISAKMLTFLEVIKAEKQVVAGVKYYLRLKAT  396
            ++  AE++ + +  + E+N     KN  A    +L F +V+KA++QVVAG  YYL L+A 
Sbjct  46   IQNSAEIESIARFAVQEHN-----KNQNA----LLEFAKVLKAKEQVVAGKIYYLTLEA-  95

Query  395  TSAGATKTFDAEMVVGPGESSKELVTLAPSTLTR  294
              AG  K ++A++ V P  + KEL     S  T+
Sbjct  96   IDAGKKKIYEAKVWVKPWMNFKELQEFKHSQETK  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561306781368