BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23490_g5_i1 len=581 path=[5593:0-580]

Length=581
                                                                      Score     E

ref|XP_009596803.1|  PREDICTED: growth-regulating factor 1-like       84.0    5e-16   
ref|XP_009767378.1|  PREDICTED: growth-regulating factor 1-like       83.2    1e-15   
ref|XP_009781044.1|  PREDICTED: growth-regulating factor 1-like       74.3    1e-12   
ref|XP_006342364.1|  PREDICTED: growth-regulating factor 1-like       72.4    6e-12   
ref|XP_004243717.1|  PREDICTED: growth-regulating factor 1-like       72.4    7e-12   
ref|XP_009615805.1|  PREDICTED: growth-regulating factor 1-like       72.0    8e-12   
ref|XP_011093817.1|  PREDICTED: growth-regulating factor 1-like       65.9    1e-09   
ref|XP_002516291.1|  conserved hypothetical protein                   59.7    2e-08   Ricinus communis
emb|CDP03099.1|  unnamed protein product                              60.5    1e-07   
ref|XP_004507988.1|  PREDICTED: growth-regulating factor 3-like       53.5    3e-06   
gb|KDP33905.1|  hypothetical protein JCGZ_07476                       55.5    4e-06   
ref|XP_011009586.1|  PREDICTED: growth-regulating factor 1-like       53.9    2e-05   
ref|XP_011078072.1|  PREDICTED: growth-regulating factor 1            53.5    2e-05   
emb|CAN67378.1|  hypothetical protein VITISV_017916                   53.9    2e-05   Vitis vinifera
ref|XP_006372002.1|  hypothetical protein POPTR_0018s07140g           53.1    3e-05   
emb|CBI27820.3|  unnamed protein product                              53.1    3e-05   
gb|KHG19107.1|  hypothetical protein F383_07760                       52.4    5e-05   
ref|XP_007012669.1|  Growth-regulating factor 5 isoform 3             52.4    6e-05   
ref|XP_007012667.1|  Growth-regulating factor 5 isoform 1             52.4    6e-05   
ref|XP_007012668.1|  Growth-regulating factor 5 isoform 2             52.4    6e-05   
ref|XP_010932423.1|  PREDICTED: growth-regulating factor 1-like       50.1    7e-05   
ref|XP_007154592.1|  hypothetical protein PHAVU_003G131800g           52.0    8e-05   
ref|XP_010656126.1|  PREDICTED: growth-regulating factor 1 isofor...  51.6    9e-05   
gb|KHN17714.1|  hypothetical protein glysoja_005911                   51.6    9e-05   
ref|XP_003551131.2|  PREDICTED: growth-regulating factor 1-like       51.6    9e-05   
ref|XP_010656124.1|  PREDICTED: growth-regulating factor 1 isofor...  51.6    9e-05   
gb|KEH32452.1|  growth-regulating factor-like protein                 51.6    1e-04   
ref|XP_008786731.1|  PREDICTED: growth-regulating factor 1-like       49.7    1e-04   
ref|XP_003541304.1|  PREDICTED: growth-regulating factor 1-like i...  51.2    1e-04   
gb|KHN07909.1|  hypothetical protein glysoja_032453                   51.2    1e-04   
ref|XP_006593944.1|  PREDICTED: growth-regulating factor 1-like i...  51.2    1e-04   
ref|XP_008784299.1|  PREDICTED: growth-regulating factor 1            48.9    2e-04   
ref|XP_008344036.1|  PREDICTED: growth-regulating factor 1-like i...  50.4    2e-04   
ref|XP_008344034.1|  PREDICTED: growth-regulating factor 1-like i...  50.4    2e-04   
ref|XP_009361693.1|  PREDICTED: growth-regulating factor 1-like i...  50.4    2e-04   
ref|XP_009361694.1|  PREDICTED: growth-regulating factor 1-like i...  50.4    2e-04   
gb|KDO53514.1|  hypothetical protein CISIN_1g023105mg                 50.1    2e-04   
gb|KEH37559.1|  growth-regulating factor-like protein                 49.7    4e-04   
gb|KEH37561.1|  growth-regulating factor-like protein                 49.7    4e-04   
ref|XP_010917179.1|  PREDICTED: growth-regulating factor 1-like       49.7    4e-04   
gb|KEH37560.1|  growth-regulating factor-like protein                 49.7    4e-04   
ref|XP_004513476.1|  PREDICTED: growth-regulating factor 1-like       49.7    4e-04   
ref|XP_010273920.1|  PREDICTED: growth-regulating factor 1 isofor...  49.7    4e-04   
ref|XP_010273921.1|  PREDICTED: growth-regulating factor 1 isofor...  49.7    4e-04   



>ref|XP_009596803.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=361

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = -2

Query  499  VGMMNPEDQQ--PKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            V  M  EDQQ  PKKVMHHFFDEWPK+NKDSWLDS   DK+S      LSIS+PN SHDF
Sbjct  297  VKSMKIEDQQQQPKKVMHHFFDEWPKDNKDSWLDS--EDKFSGLSKTQLSISIPNPSHDF  354

Query  325  FITHN  311
            FIT N
Sbjct  355  FITTN  359



>ref|XP_009767378.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=364

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -2

Query  490  MNPEDQQ--PKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDFFIT  317
            +  EDQQ  PKKVMHHFFDEWPK+NKDSWLDS   DK+S      LSIS+PN SHDFFIT
Sbjct  303  LETEDQQHQPKKVMHHFFDEWPKDNKDSWLDS--EDKFSGLSKTQLSISIPNPSHDFFIT  360

Query  316  HN  311
             N
Sbjct  361  TN  362



>ref|XP_009781044.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=328

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 43/59 (73%), Gaps = 12/59 (20%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWP--KENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDFFITHNGE  305
            QQPKKVMHHFFDE P  + NKDSWLDS            HLSISVP+SSHDFFITHNG+
Sbjct  280  QQPKKVMHHFFDELPPDQHNKDSWLDSKT----------HLSISVPDSSHDFFITHNGK  328



>ref|XP_006342364.1| PREDICTED: growth-regulating factor 1-like [Solanum tuberosum]
Length=340

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEW-PKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDFFITHN  311
            ED QPKKVMHHFFDEW PK+NK SWLDS   DK+S      LSIS+PN S D FIT N
Sbjct  283  EDHQPKKVMHHFFDEWPPKDNKHSWLDS--DDKFSGLSKTQLSISIPNPSQDLFITTN  338



>ref|XP_004243717.1| PREDICTED: growth-regulating factor 1-like [Solanum lycopersicum]
Length=344

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEW-PKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDFFITHN  311
            ED QPKKVMHHFFDEW PK+NK SWLDS   DK+S      LSIS+PN S D FIT N
Sbjct  287  EDHQPKKVMHHFFDEWPPKDNKHSWLDS--DDKFSGLSRTQLSISIPNPSQDLFITTN  342



>ref|XP_009615805.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=325

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 42/59 (71%), Gaps = 12/59 (20%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWP--KENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDFFITHNGE  305
            QQPKKVMHHFFDE P  + NKDSWLDS            HLSISVP+SS DFFITHNG+
Sbjct  277  QQPKKVMHHFFDELPPDQHNKDSWLDSKT----------HLSISVPDSSRDFFITHNGK  325



>ref|XP_011093817.1| PREDICTED: growth-regulating factor 1-like [Sesamum indicum]
Length=357

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -2

Query  508  TVGVGMMNPEDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHD  329
            T  + +    D QPKKVMHHF DEWP  +KDSWL S D    +      LSIS PNS HD
Sbjct  295  TCDMALNLERDDQPKKVMHHFLDEWPPRDKDSWLTSEDK---TPTHKTQLSISTPNSMHD  351

Query  328  FFIT  317
            FF+T
Sbjct  352  FFMT  355



>ref|XP_002516291.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46293.1| conserved hypothetical protein [Ricinus communis]
Length=121

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYS-APRGPHLSISVPNSSHDFFI----T  317
            ++++P+K +H FFDEWP +NKDSWLD  D    S +     LSIS+P+SSHDF I    T
Sbjct  58   KEEEPQKTVHRFFDEWPPKNKDSWLDLDDKSPNSTSASTTRLSISIPSSSHDFPIFNSRT  117

Query  316  HN  311
            HN
Sbjct  118  HN  119



>emb|CDP03099.1| unnamed protein product [Coffea canephora]
Length=430

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = -2

Query  496  GMMNPEDQQPKKVMHHFFDEW-PKENKDS-WLDSGDGDKYSAPRGPHLSISVPNSS--HD  329
            G+ + +D Q K+VMH FFDEW PK+NKDS WLD+ D   +   +   LSIS+PN+S  HD
Sbjct  363  GLGDRDDHQNKRVMHRFFDEWPPKDNKDSCWLDNNDHHDHKLSK-IQLSISMPNASSHHD  421

Query  328  FFITHNG  308
            FF+T NG
Sbjct  422  FFMTRNG  428



>ref|XP_004507988.1| PREDICTED: growth-regulating factor 3-like [Cicer arietinum]
Length=129

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K+ H FFDEWP ++++SWLD  D    +      LSIS+P SSHDF
Sbjct  74   EEPQKIFHRFFDEWPPKSRNSWLDLDDKSSTT-----QLSISIPTSSHDF  118



>gb|KDP33905.1| hypothetical protein JCGZ_07476 [Jatropha curcas]
Length=399

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 39/62 (63%), Gaps = 6/62 (10%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAP-RGPHLSISVPNSSHDFFI----T  317
             ++QP+K +H FFDEWP +NKDSWLD  D    S       LSIS+P SSHDF I    T
Sbjct  337  REEQPQKTVHRFFDEWPPKNKDSWLDLDDKSPNSTSVSTTRLSISIP-SSHDFPIFNSRT  395

Query  316  HN  311
            HN
Sbjct  396  HN  397



>ref|XP_011009586.1| PREDICTED: growth-regulating factor 1-like [Populus euphratica]
Length=384

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  499  VGMMNPEDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAP-RGPHLSISVPNSSHDFF  323
            +G +  E ++P+K +H FFDEWP + K SWL  GD    SA      LSIS+P SSHDF 
Sbjct  315  LGPIKMEKEEPQKTVHRFFDEWPPKKKQSWLYFGDKSSNSASVSTTRLSISIP-SSHDFL  373

Query  322  ITHNGE  305
             + N  
Sbjct  374  PSFNSR  379



>ref|XP_011078072.1| PREDICTED: growth-regulating factor 1 [Sesamum indicum]
Length=273

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 6/63 (10%)
 Frame = -2

Query  493  MMNPEDQ---QPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISV-PNSSHDF  326
            ++NP+ +   QPKKVMHHF DE P ++KDSW +  +    S+     LSIS  PNS HDF
Sbjct  211  LLNPDQRDHDQPKKVMHHFLDELPPKHKDSWPNPDEN--LSSSHRTQLSISAPPNSLHDF  268

Query  325  FIT  317
            F+T
Sbjct  269  FMT  271



>emb|CAN67378.1| hypothetical protein VITISV_017916 [Vitis vinifera]
Length=1213

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = -2

Query  481   EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSA-PRGPHLSISVPNSSHDFFIT----  317
             E ++P+K +H FFDEWP +++D W DS D     A      LSIS+PNSS DF I+    
Sbjct  1150  EREEPEKTVHRFFDEWPPKSRDPWPDSEDKSPRDALVSTTQLSISMPNSSFDFSISNSRP  1209

Query  316   HNG  308
             HNG
Sbjct  1210  HNG  1212



>ref|XP_006372002.1| hypothetical protein POPTR_0018s07140g [Populus trichocarpa]
 gb|ERP49799.1| hypothetical protein POPTR_0018s07140g [Populus trichocarpa]
Length=382

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  499  VGMMNPEDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAP-RGPHLSISVPNSSHDFF  323
            +G +  E ++P+K +H FFDEWP +NK+SW D  +    SA      LSIS+P SSHDF 
Sbjct  313  LGPIKMEKEEPQKTVHRFFDEWPPKNKESWFDLDNRSSNSASVSTTRLSISIP-SSHDFL  371

Query  322  ITHNGE  305
               N  
Sbjct  372  PIFNSR  377



>emb|CBI27820.3| unnamed protein product [Vitis vinifera]
Length=387

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSA-PRGPHLSISVPNSSHDFFIT----  317
            E ++P+K +H FFDEWP +++D W DS D     A      LSIS+PNSS DF I+    
Sbjct  324  EREEPEKTVHRFFDEWPPKSRDPWPDSEDKSPRDALVSTTQLSISMPNSSFDFSISNSRP  383

Query  316  HNG  308
            HNG
Sbjct  384  HNG  386



>gb|KHG19107.1| hypothetical protein F383_07760 [Gossypium arboreum]
Length=375

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGD-GDKYSAPRGPHLSISVPNSSHDFFI  320
            E  +P+K +H FFDEWP +++DSWLD  D     S+     LSIS+P++SHDF I
Sbjct  312  EKGEPQKTVHRFFDEWPPKHRDSWLDLDDKSSNSSSVSTTRLSISIPSTSHDFPI  366



>ref|XP_007012669.1| Growth-regulating factor 5 isoform 3 [Theobroma cacao]
 gb|EOY30288.1| Growth-regulating factor 5 isoform 3 [Theobroma cacao]
Length=377

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGD-GDKYSAPRGPHLSISVPNSSHDFFI  320
            E  +P+K +H FFDEWP +++DSWLD  D     S+     LSIS+P++SHDF I
Sbjct  314  EKGEPQKTVHRFFDEWPPKHRDSWLDLDDKSSNSSSVSTTRLSISIPSTSHDFPI  368



>ref|XP_007012667.1| Growth-regulating factor 5 isoform 1 [Theobroma cacao]
 gb|EOY30286.1| Growth-regulating factor 5 isoform 1 [Theobroma cacao]
Length=379

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGD-GDKYSAPRGPHLSISVPNSSHDFFI  320
            E  +P+K +H FFDEWP +++DSWLD  D     S+     LSIS+P++SHDF I
Sbjct  316  EKGEPQKTVHRFFDEWPPKHRDSWLDLDDKSSNSSSVSTTRLSISIPSTSHDFPI  370



>ref|XP_007012668.1| Growth-regulating factor 5 isoform 2 [Theobroma cacao]
 gb|EOY30287.1| Growth-regulating factor 5 isoform 2 [Theobroma cacao]
Length=380

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGD-GDKYSAPRGPHLSISVPNSSHDFFI  320
            E  +P+K +H FFDEWP +++DSWLD  D     S+     LSIS+P++SHDF I
Sbjct  317  EKGEPQKTVHRFFDEWPPKHRDSWLDLDDKSSNSSSVSTTRLSISIPSTSHDFPI  371



>ref|XP_010932423.1| PREDICTED: growth-regulating factor 1-like [Elaeis guineensis]
Length=143

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 5/65 (8%)
 Frame = -2

Query  505  VGVGMMNPEDQQPKKVMHHFFDEWPKENKDSWLD--SGDGDKYSAPRGPHLSISVPNSSH  332
            V V     E Q+P   + HFFDEWP+ ++DSW+D    + ++ S      LSIS+P S H
Sbjct  74   VKVEREQEEGQRP---LRHFFDEWPQRSRDSWVDLEQENSNQASTYSKTQLSISIPMSHH  130

Query  331  DFFIT  317
            DF +T
Sbjct  131  DFPVT  135



>ref|XP_007154592.1| hypothetical protein PHAVU_003G131800g [Phaseolus vulgaris]
 gb|ESW26586.1| hypothetical protein PHAVU_003G131800g [Phaseolus vulgaris]
Length=374

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K +H FFDEWP +++ SWLD  D    +      LSIS+P SSHDF
Sbjct  319  EEPQKTVHRFFDEWPPKSRGSWLDLDDKSSTT-----QLSISIPTSSHDF  363



>ref|XP_010656126.1| PREDICTED: growth-regulating factor 1 isoform X2 [Vitis vinifera]
Length=387

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSA-PRGPHLSISVPNSSHDFFITHN  311
            E ++P+K +H FFDEWP +++D W DS D     A      LSIS+PNSS DF I+++
Sbjct  324  EREEPEKTVHRFFDEWPPKSRDPWPDSEDKSPRDALVSTTQLSISMPNSSFDFSISNS  381



>gb|KHN17714.1| hypothetical protein glysoja_005911 [Glycine soja]
Length=376

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K +H FFDEWP +++ SWLD  D    +      LSIS+P S+HDF
Sbjct  321  EEPQKTVHRFFDEWPPKSRGSWLDLDDKSSTT-----QLSISIPTSTHDF  365



>ref|XP_003551131.2| PREDICTED: growth-regulating factor 1-like [Glycine max]
Length=377

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K +H FFDEWP +++ SWLD  D    +      LSIS+P S+HDF
Sbjct  322  EEPQKTVHRFFDEWPPKSRGSWLDLDDKSSTT-----QLSISIPTSTHDF  366



>ref|XP_010656124.1| PREDICTED: growth-regulating factor 1 isoform X1 [Vitis vinifera]
Length=388

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSA-PRGPHLSISVPNSSHDFFITHN  311
            E ++P+K +H FFDEWP +++D W DS D     A      LSIS+PNSS DF I+++
Sbjct  325  EREEPEKTVHRFFDEWPPKSRDPWPDSEDKSPRDALVSTTQLSISMPNSSFDFSISNS  382



>gb|KEH32452.1| growth-regulating factor-like protein [Medicago truncatula]
Length=430

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 6/51 (12%)
 Frame = -2

Query  475  QQPKKVMHHFFDEW-PKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K+ H FFDEW PK +++SWLD  D    +      LSIS+P SSHDF
Sbjct  312  EEPQKIFHRFFDEWPPKSSRNSWLDLDDKSSTT-----QLSISIPTSSHDF  357



>ref|XP_008786731.1| PREDICTED: growth-regulating factor 1-like [Phoenix dactylifera]
Length=157

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 4/58 (7%)
 Frame = -2

Query  478  DQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPH----LSISVPNSSHDFFIT  317
            +Q+ ++ + HFFDEWP+++KDSW+D    +   A    +    LSIS+P S HDF +T
Sbjct  92   EQEGQRPLRHFFDEWPQKSKDSWVDMEQENPNQAAAAAYSKTQLSISIPMSHHDFPVT  149



>ref|XP_003541304.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Glycine 
max]
Length=382

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K +H FFDEWP +++ SWLD  D    +      LSIS+P S+HDF
Sbjct  327  EEPQKTVHRFFDEWPPKSRGSWLDLDDKSSTT-----QLSISIPTSTHDF  371



>gb|KHN07909.1| hypothetical protein glysoja_032453 [Glycine soja]
Length=382

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K +H FFDEWP +++ SWLD  D    +      LSIS+P S+HDF
Sbjct  327  EEPQKTVHRFFDEWPPKSRGSWLDLDDKSSTT-----QLSISIPTSTHDF  371



>ref|XP_006593944.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Glycine 
max]
Length=384

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = -2

Query  475  QQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++P+K +H FFDEWP +++ SWLD  D    +      LSIS+P S+HDF
Sbjct  329  EEPQKTVHRFFDEWPPKSRGSWLDLDDKSSTT-----QLSISIPTSTHDF  373



>ref|XP_008784299.1| PREDICTED: growth-regulating factor 1 [Phoenix dactylifera]
Length=143

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLD--SGDGDKYSAPRGPHLSISVPNSSHDFFIT  317
            E ++ ++ + HFFDEWP++++DSW+D    + ++ +A     LSIS+P S HD  +T
Sbjct  79   EQEEGRRPLRHFFDEWPQKSRDSWVDLERENSNQAAAYSKTQLSISIPMSHHDCPVT  135



>ref|XP_008344036.1| PREDICTED: growth-regulating factor 1-like isoform X3 [Malus 
domestica]
Length=365

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  466  KKVMHHFFDEWPKENKDSWLDSGDGDKYS-APRGPHLSISVPNSSHDFFI  320
            +K +H FFDEWP ++KDSWLD  D    S +     LSIS+P S+HDF I
Sbjct  307  QKTIHRFFDEWPPKDKDSWLDLDDKSSNSGSVSTTRLSISIPTSAHDFPI  356



>ref|XP_008344034.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Malus 
domestica]
 ref|XP_008344035.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Malus 
domestica]
Length=367

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  466  KKVMHHFFDEWPKENKDSWLDSGDGDKYS-APRGPHLSISVPNSSHDFFI  320
            +K +H FFDEWP ++KDSWLD  D    S +     LSIS+P S+HDF I
Sbjct  309  QKTIHRFFDEWPPKDKDSWLDLDDKSSNSGSVSTTRLSISIPTSAHDFPI  358



>ref|XP_009361693.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=369

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  466  KKVMHHFFDEWPKENKDSWLDSGDGDKYS-APRGPHLSISVPNSSHDFFI  320
            +K +H FFDEWP ++KDSWLD  D    S +     LSIS+P S+HDF I
Sbjct  311  QKTIHRFFDEWPPKDKDSWLDLDDKSSNSGSVSTTRLSISIPTSAHDFPI  360



>ref|XP_009361694.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=367

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  466  KKVMHHFFDEWPKENKDSWLDSGDGDKYS-APRGPHLSISVPNSSHDFFI  320
            +K +H FFDEWP ++KDSWLD  D    S +     LSIS+P S+HDF I
Sbjct  309  QKTIHRFFDEWPPKDKDSWLDLDDKSSNSGSVSTTRLSISIPTSAHDFPI  358



>gb|KDO53514.1| hypothetical protein CISIN_1g023105mg [Citrus sinensis]
Length=287

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -2

Query  478  DQQPKKVMHHFFDEWPKENKDSWLDSGD-GDKYSAPRGPHLSISVPNSSHDFFI  320
            ++ P+K +H FFDEWP +++DSWLD  D   K ++     LSIS+P SSHDF I
Sbjct  229  EEIPQKTVHRFFDEWPPKSRDSWLDLDDKSSKNASLSTASLSISIP-SSHDFPI  281



>gb|KEH37559.1| growth-regulating factor-like protein [Medicago truncatula]
Length=357

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = -2

Query  472  QPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF--FITHN  311
            +P+K +H FFDEWP + +D WLD  D    +      LSIS+P+S+H+F  F + N
Sbjct  302  EPQKTVHRFFDEWPHKGRDQWLDLDDKSSTT-----QLSISIPSSTHNFPTFTSRN  352



>gb|KEH37561.1| growth-regulating factor-like protein [Medicago truncatula]
Length=356

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = -2

Query  472  QPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF--FITHN  311
            +P+K +H FFDEWP + +D WLD  D    +      LSIS+P+S+H+F  F + N
Sbjct  302  EPQKTVHRFFDEWPHKGRDQWLDLDDKSSTT-----QLSISIPSSTHNFPTFTSRN  352



>ref|XP_010917179.1| PREDICTED: growth-regulating factor 1-like [Elaeis guineensis]
Length=349

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLD---SGDGDKYSAPRGPHLSISVPNSSHDFFIT  317
             +Q+ ++ + HFFDEWP+++KDSW+D          +A     LSIS+P S HDF +T
Sbjct  284  REQEGQRPLRHFFDEWPQKSKDSWVDLEQENSNQASAAYSKTQLSISIPMSHHDFPVT  341



>gb|KEH37560.1| growth-regulating factor-like protein [Medicago truncatula]
Length=356

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 35/56 (63%), Gaps = 7/56 (13%)
 Frame = -2

Query  472  QPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF--FITHN  311
            +P+K +H FFDEWP + +D WLD  D    +      LSIS+P+S+H+F  F + N
Sbjct  302  EPQKTVHRFFDEWPHKGRDQWLDLDDKSSTT-----QLSISIPSSTHNFPTFTSRN  352



>ref|XP_004513476.1| PREDICTED: growth-regulating factor 1-like [Cicer arietinum]
Length=352

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 4/52 (8%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDGDKYSAPRGPHLSISVPNSSHDF  326
            ++++P+K +H FFDEWP + ++ WL   D DK S  +   LSIS+P+S+HDF
Sbjct  294  QEKEPQKTVHRFFDEWPHKGREQWLHDLD-DKSSTTQ---LSISIPSSAHDF  341



>ref|XP_010273920.1| PREDICTED: growth-regulating factor 1 isoform X1 [Nelumbo nucifera]
Length=423

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 13/86 (15%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDG-DKYSAPRGPHLSISVPNSSHDFFITHNGE  305
            ++++P++ + HFFDEWP +++DSWLD  D     S+     LSIS+P  S DF ++    
Sbjct  309  KEEEPQQPLRHFFDEWPPKSRDSWLDLEDNRSNRSSFSTTQLSISIPMPSSDFAVS----  364

Query  304  K*ERFE*WHSESKAKRVLKIVVGQWF  227
                    +S ++  R   +   +W 
Sbjct  365  --------NSRTQNARTFLLTARRWL  382



>ref|XP_010273921.1| PREDICTED: growth-regulating factor 1 isoform X2 [Nelumbo nucifera]
Length=372

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -2

Query  481  EDQQPKKVMHHFFDEWPKENKDSWLDSGDG-DKYSAPRGPHLSISVPNSSHDFFITHN  311
            ++++P++ + HFFDEWP +++DSWLD  D     S+     LSIS+P  S DF ++++
Sbjct  309  KEEEPQQPLRHFFDEWPPKSRDSWLDLEDNRSNRSSFSTTQLSISIPMPSSDFAVSNS  366



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669965605652