BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23490_g3_i2 len=1710 path=[3288:0-388 3677:389-415 3704:416-493
13536:494-496 7126:497-579 10954:580-671 12715:672-919
11046:920-1709]

Length=1710
                                                                      Score     E

ref|XP_009767378.1|  PREDICTED: growth-regulating factor 1-like         182   4e-48   
ref|XP_009596803.1|  PREDICTED: growth-regulating factor 1-like         178   9e-47   
ref|XP_004243717.1|  PREDICTED: growth-regulating factor 1-like         177   1e-46   
ref|XP_006342364.1|  PREDICTED: growth-regulating factor 1-like         177   2e-46   
ref|XP_009615805.1|  PREDICTED: growth-regulating factor 1-like         171   2e-44   
ref|XP_010047492.1|  PREDICTED: growth-regulating factor 1 isofor...    172   3e-44   
ref|XP_010047491.1|  PREDICTED: growth-regulating factor 1 isofor...    172   3e-44   
ref|XP_011093817.1|  PREDICTED: growth-regulating factor 1-like         168   4e-43   
ref|XP_007138669.1|  hypothetical protein PHAVU_009G228000g             167   6e-43   
ref|XP_009781044.1|  PREDICTED: growth-regulating factor 1-like         167   6e-43   
ref|XP_010656124.1|  PREDICTED: growth-regulating factor 1 isofor...    166   6e-42   
emb|CBI27820.3|  unnamed protein product                                166   6e-42   
ref|XP_010656126.1|  PREDICTED: growth-regulating factor 1 isofor...    166   7e-42   
ref|XP_003547502.2|  PREDICTED: growth-regulating factor 1-like         164   1e-41   
gb|KHG19107.1|  hypothetical protein F383_07760                         164   1e-41   
ref|XP_007012669.1|  Growth-regulating factor 5 isoform 3               164   2e-41   
ref|XP_007012667.1|  Growth-regulating factor 5 isoform 1               164   2e-41   
ref|XP_007012668.1|  Growth-regulating factor 5 isoform 2               164   2e-41   
ref|XP_006372002.1|  hypothetical protein POPTR_0018s07140g             164   2e-41   
ref|XP_011045985.1|  PREDICTED: growth-regulating factor 1 isofor...    163   3e-41   
ref|XP_011045982.1|  PREDICTED: growth-regulating factor 1 isofor...    164   3e-41   
ref|XP_007135443.1|  hypothetical protein PHAVU_010G130000g             162   3e-41   
ref|XP_011045984.1|  PREDICTED: growth-regulating factor 1 isofor...    163   3e-41   
ref|XP_011045983.1|  PREDICTED: growth-regulating factor 1 isofor...    163   3e-41   
ref|XP_007154592.1|  hypothetical protein PHAVU_003G131800g             163   3e-41   
ref|XP_003534945.2|  PREDICTED: growth-regulating factor 1-like         163   4e-41   
gb|KEH32452.1|  growth-regulating factor-like protein                   164   4e-41   
gb|KHN06084.1|  hypothetical protein glysoja_035990                     162   4e-41   
ref|XP_008363050.1|  PREDICTED: growth-regulating factor 5-like         156   7e-41   
gb|KHN12274.1|  hypothetical protein glysoja_026166                     161   1e-40   
ref|XP_010090133.1|  hypothetical protein L484_027365                   162   1e-40   
ref|XP_003547719.2|  PREDICTED: growth-regulating factor 5-like i...    160   2e-40   
ref|XP_006381639.1|  hypothetical protein POPTR_0006s14560g             161   3e-40   
ref|XP_006598831.1|  PREDICTED: growth-regulating factor 5-like i...    160   4e-40   
ref|XP_006598832.1|  PREDICTED: growth-regulating factor 5-like i...    160   4e-40   
ref|XP_003529835.1|  PREDICTED: growth-regulating factor 5-like         159   5e-40   
gb|EPS64309.1|  hypothetical protein M569_10478                         153   6e-40   
gb|KHN01405.1|  hypothetical protein glysoja_009611                     159   8e-40   
ref|XP_003551131.2|  PREDICTED: growth-regulating factor 1-like         159   8e-40   
ref|XP_002516290.1|  conserved hypothetical protein                     155   9e-40   Ricinus communis
ref|XP_010666262.1|  PREDICTED: growth-regulating factor 1              159   1e-39   
ref|XP_010086824.1|  hypothetical protein L484_009597                   159   1e-39   
ref|XP_008450915.1|  PREDICTED: growth-regulating factor 4-like         157   1e-39   
ref|XP_008459738.1|  PREDICTED: growth-regulating factor 6-like         157   2e-39   
ref|XP_002298093.2|  hypothetical protein POPTR_0001s16920g             157   2e-39   Populus trichocarpa [western balsam poplar]
gb|KHN17714.1|  hypothetical protein glysoja_005911                     158   2e-39   
gb|KDO53514.1|  hypothetical protein CISIN_1g023105mg                   156   2e-39   
gb|KHN39631.1|  hypothetical protein glysoja_020709                     158   2e-39   
ref|XP_008344036.1|  PREDICTED: growth-regulating factor 1-like i...    157   2e-39   
ref|XP_008344034.1|  PREDICTED: growth-regulating factor 1-like i...    157   2e-39   
ref|XP_004144026.1|  PREDICTED: growth-regulating factor 5-like         156   3e-39   
gb|KHN07909.1|  hypothetical protein glysoja_032453                     157   3e-39   
ref|XP_006593944.1|  PREDICTED: growth-regulating factor 1-like i...    157   3e-39   
ref|XP_003541304.1|  PREDICTED: growth-regulating factor 1-like i...    157   3e-39   
ref|XP_011035717.1|  PREDICTED: growth-regulating factor 5-like         156   3e-39   
ref|XP_008242218.1|  PREDICTED: growth-regulating factor 1-like i...    157   4e-39   
ref|XP_006490823.1|  PREDICTED: growth-regulating factor 5-like i...    155   5e-39   
ref|XP_011009586.1|  PREDICTED: growth-regulating factor 1-like         157   5e-39   
ref|XP_010654438.1|  PREDICTED: growth-regulating factor 1-like         156   6e-39   
ref|XP_006451560.1|  hypothetical protein CICLE_v10008922mg             155   8e-39   
ref|XP_002521329.1|  conserved hypothetical protein                     155   1e-38   Ricinus communis
gb|KEH37559.1|  growth-regulating factor-like protein                   155   1e-38   
gb|KEH37561.1|  growth-regulating factor-like protein                   155   1e-38   
gb|KEH37560.1|  growth-regulating factor-like protein                   155   1e-38   
ref|XP_009361694.1|  PREDICTED: growth-regulating factor 1-like i...    155   1e-38   
ref|XP_009361693.1|  PREDICTED: growth-regulating factor 1-like i...    155   1e-38   
emb|CDP03099.1|  unnamed protein product                                157   2e-38   
ref|XP_007204778.1|  hypothetical protein PRUPE_ppa015791mg             155   2e-38   
ref|XP_010273921.1|  PREDICTED: growth-regulating factor 1 isofor...    155   2e-38   
ref|XP_009372336.1|  PREDICTED: growth-regulating factor 5 isofor...    154   2e-38   
ref|XP_004303687.1|  PREDICTED: growth-regulating factor 5-like         154   3e-38   
ref|XP_009372335.1|  PREDICTED: growth-regulating factor 5 isofor...    154   3e-38   
ref|XP_007024621.1|  Growth-regulating factor 5, putative               154   3e-38   
ref|XP_008391391.1|  PREDICTED: growth-regulating factor 5              153   3e-38   
ref|XP_004148588.1|  PREDICTED: growth-regulating factor 5-like         154   3e-38   
ref|XP_004287622.1|  PREDICTED: growth-regulating factor 1-like         154   3e-38   
ref|XP_008463996.1|  PREDICTED: growth-regulating factor 5 isofor...    154   3e-38   
ref|XP_008463995.1|  PREDICTED: growth-regulating factor 5 isofor...    154   4e-38   
gb|KDP33905.1|  hypothetical protein JCGZ_07476                         154   5e-38   
ref|XP_010273920.1|  PREDICTED: growth-regulating factor 1 isofor...    155   6e-38   
ref|XP_004141176.1|  PREDICTED: growth-regulating factor 5-like         152   6e-38   
ref|XP_010534927.1|  PREDICTED: growth-regulating factor 5              152   8e-38   
ref|XP_010261922.1|  PREDICTED: growth-regulating factor 1-like         153   8e-38   
ref|XP_004165889.1|  PREDICTED: growth-regulating factor 5-like         153   1e-37   
ref|XP_004513476.1|  PREDICTED: growth-regulating factor 1-like         152   2e-37   
ref|XP_011036429.1|  PREDICTED: growth-regulating factor 5-like         150   3e-37   
ref|XP_008242216.1|  PREDICTED: growth-regulating factor 1-like i...    152   4e-37   
ref|XP_003627270.1|  GRL2                                               146   1e-36   
emb|CDX71979.1|  BnaC08g28950D                                          150   2e-36   
ref|XP_002303244.2|  hypothetical protein POPTR_0003s06360g             149   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009413829.1|  PREDICTED: growth-regulating factor 1-like         142   3e-36   
emb|CDY39081.1|  BnaA01g29750D                                          149   3e-36   
ref|XP_010465271.1|  PREDICTED: growth-regulating factor 5-like         149   3e-36   
ref|XP_004510466.1|  PREDICTED: growth-regulating factor 5-like i...    147   5e-36   
ref|XP_004510465.1|  PREDICTED: growth-regulating factor 5-like i...    147   5e-36   
gb|AET01746.2|  growth-regulating factor-like protein                   147   6e-36   
ref|XP_007214861.1|  hypothetical protein PRUPE_ppa017593mg             147   1e-35   
ref|XP_008228199.1|  PREDICTED: growth-regulating factor 5 isofor...    147   1e-35   
ref|XP_008228198.1|  PREDICTED: growth-regulating factor 5 isofor...    147   1e-35   
emb|CDX97531.1|  BnaA05g25480D                                          147   1e-35   
emb|CDY55209.1|  BnaCnng28460D                                          147   1e-35   
ref|XP_006426651.1|  hypothetical protein CICLE_v10025855mg             147   2e-35   
gb|KDO65037.1|  hypothetical protein CISIN_1g047108mg                   147   2e-35   
ref|XP_006297825.1|  hypothetical protein CARUB_v10013860mg             147   2e-35   
ref|XP_009117339.1|  PREDICTED: LOW QUALITY PROTEIN: growth-regul...    147   2e-35   
ref|XP_009414810.1|  PREDICTED: growth-regulating factor 1-like i...    146   2e-35   
ref|XP_009414811.1|  PREDICTED: growth-regulating factor 1-like i...    145   3e-35   
ref|XP_009146430.1|  PREDICTED: growth-regulating factor 5-like         146   3e-35   
gb|EYU25864.1|  hypothetical protein MIMGU_mgv1a010559mg                144   3e-35   
ref|XP_002882864.1|  hypothetical protein ARALYDRAFT_478803             145   8e-35   
ref|XP_006375983.1|  hypothetical protein POPTR_0013s07500g             144   8e-35   
ref|XP_011044430.1|  PREDICTED: growth-regulating factor 4-like         144   8e-35   
ref|XP_008234521.1|  PREDICTED: growth-regulating factor 4-like         143   1e-34   
ref|XP_007219489.1|  hypothetical protein PRUPE_ppa022199mg             143   1e-34   
gb|KHN46482.1|  hypothetical protein glysoja_035158                     142   2e-34   
ref|XP_003540042.1|  PREDICTED: growth-regulating factor 4-like         142   2e-34   
gb|KFK38750.1|  hypothetical protein AALP_AA3G156000                    144   2e-34   
ref|XP_003517558.1|  PREDICTED: growth-regulating factor 4-like         142   3e-34   
ref|XP_011012401.1|  PREDICTED: growth-regulating factor 4-like         142   3e-34   
ref|XP_003537666.1|  PREDICTED: growth-regulating factor 4-like         141   4e-34   
gb|KHN34128.1|  hypothetical protein glysoja_038617                     140   6e-34   
ref|XP_006407145.1|  hypothetical protein EUTSA_v10020873mg             142   7e-34   
ref|XP_010487179.1|  PREDICTED: growth-regulating factor 5              142   1e-33   
ref|XP_010533032.1|  PREDICTED: growth-regulating factor 6-like         140   1e-33   
ref|XP_010251960.1|  PREDICTED: growth-regulating factor 2              144   1e-33   
gb|KDP39549.1|  hypothetical protein JCGZ_02569                         140   1e-33   
ref|XP_010541983.1|  PREDICTED: growth-regulating factor 6              139   2e-33   
dbj|BAH30450.1|  hypothetical protein                                   141   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936937.1|  PREDICTED: growth-regulating factor 1-like         139   2e-33   
ref|NP_188012.2|  growth-regulating factor 5                            141   2e-33   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02326.1|  unnamed protein product                                141   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135347.1|  PREDICTED: growth-regulating factor 5-like i...    140   2e-33   
ref|XP_009135348.1|  PREDICTED: growth-regulating factor 5-like i...    140   3e-33   
emb|CDX82503.1|  BnaA03g33180D                                          140   3e-33   
ref|XP_006437422.1|  hypothetical protein CICLE_v10032065mg             138   5e-33   
emb|CDX75742.1|  BnaC03g38250D                                          139   5e-33   
gb|KHG06614.1|  dna double-strand break repair rad50 atpase             138   6e-33   
ref|XP_010501463.1|  PREDICTED: growth-regulating factor 5-like         140   6e-33   
ref|XP_011092609.1|  PREDICTED: growth-regulating factor 4-like i...    139   6e-33   
ref|XP_009605690.1|  PREDICTED: growth-regulating factor 4-like i...    139   6e-33   
ref|XP_009605688.1|  PREDICTED: growth-regulating factor 4-like i...    139   6e-33   
ref|XP_009797591.1|  PREDICTED: growth-regulating factor 4-like i...    139   7e-33   
gb|KDO48006.1|  hypothetical protein CISIN_1g020051mg                   138   7e-33   
ref|XP_010552235.1|  PREDICTED: growth-regulating factor 5-like         138   7e-33   
gb|KEH17760.1|  growth-regulating factor                                138   7e-33   
ref|XP_009797585.1|  PREDICTED: growth-regulating factor 4-like i...    138   8e-33   
gb|KHG13640.1|  dna double-strand break repair rad50 atpase             138   9e-33   
ref|XP_006371207.1|  hypothetical protein POPTR_0019s05910g             137   9e-33   
ref|XP_011092605.1|  PREDICTED: growth-regulating factor 4-like i...    138   1e-32   
ref|XP_010932723.1|  PREDICTED: growth-regulating factor 1-like         133   1e-32   
ref|XP_002866933.1|  predicted protein                                  140   1e-32   
ref|XP_004506549.1|  PREDICTED: growth-regulating factor 4-like i...    137   1e-32   
ref|NP_195488.2|  growth-regulating factor 2                            140   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307837.1|  PREDICTED: growth-regulating factor 5-like         137   1e-32   
ref|XP_004506550.1|  PREDICTED: growth-regulating factor 4-like i...    137   1e-32   
ref|XP_004246199.2|  PREDICTED: growth-regulating factor 4-like         138   1e-32   
ref|XP_002301140.2|  hypothetical protein POPTR_0002s11590g             139   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010255823.1|  PREDICTED: growth-regulating factor 4-like         137   2e-32   
gb|KGN63355.1|  hypothetical protein Csa_2G432230                       137   2e-32   
ref|XP_007157086.1|  hypothetical protein PHAVU_002G041800g             136   2e-32   
ref|XP_003539001.1|  PREDICTED: growth-regulating factor 5-like         137   2e-32   
gb|KHN39845.1|  hypothetical protein glysoja_020585                     136   2e-32   
ref|XP_004238069.1|  PREDICTED: growth-regulating factor 1-like         140   3e-32   
ref|XP_006356839.1|  PREDICTED: growth-regulating factor 6-like         140   3e-32   
gb|EYU28340.1|  hypothetical protein MIMGU_mgv1a008605mg                137   3e-32   
emb|CDY66422.1|  BnaA08g30080D                                          135   4e-32   
ref|XP_010324484.1|  PREDICTED: growth-regulating factor 4-like i...    136   5e-32   
emb|CDP01011.1|  unnamed protein product                                140   5e-32   
ref|XP_010324483.1|  PREDICTED: growth-regulating factor 4-like i...    136   5e-32   
ref|XP_008462790.1|  PREDICTED: growth-regulating factor 4-like         135   6e-32   
ref|XP_006846580.1|  hypothetical protein AMTR_s00018p00250840          139   6e-32   
gb|EMT04093.1|  hypothetical protein F775_24390                         132   6e-32   
ref|XP_004151910.1|  PREDICTED: growth-regulating factor 3-like         135   6e-32   
ref|XP_004976689.1|  PREDICTED: growth-regulating factor 3-like i...    136   8e-32   
emb|CDY55116.1|  BnaA03g54950D                                          134   8e-32   
ref|XP_004976691.1|  PREDICTED: growth-regulating factor 3-like i...    135   8e-32   
ref|XP_008786732.1|  PREDICTED: growth-regulating factor 1-like         130   9e-32   
ref|XP_006361251.1|  PREDICTED: growth-regulating factor 4-like         135   9e-32   
gb|AFQ22738.1|  growth-regulating factor 2J                             137   1e-31   
ref|XP_006854210.1|  hypothetical protein AMTR_s00048p00216350          134   1e-31   
emb|CBI19365.3|  unnamed protein product                                137   1e-31   
ref|XP_010940818.1|  PREDICTED: growth-regulating factor 5-like i...    135   1e-31   
ref|XP_008812758.1|  PREDICTED: growth-regulating factor 4-like         135   1e-31   
ref|XP_010940817.1|  PREDICTED: growth-regulating factor 5-like i...    135   1e-31   
ref|XP_009138528.1|  PREDICTED: growth-regulating factor 2-like         136   1e-31   
gb|KHG11416.1|  hypothetical protein F383_00237                         138   1e-31   
ref|XP_010664482.1|  PREDICTED: growth-regulating factor 6-like i...    136   2e-31   
ref|XP_003572853.1|  PREDICTED: growth-regulating factor 4-like         135   2e-31   
gb|AFQ22739.1|  growth-regulating factor 2P                             135   3e-31   
gb|AFB74092.1|  growth-regulating factor 2                              136   3e-31   
ref|XP_011017086.1|  PREDICTED: growth-regulating factor 1-like i...    137   3e-31   
ref|XP_011017085.1|  PREDICTED: growth-regulating factor 1-like i...    137   3e-31   
emb|CDX75672.1|  BnaA01g00300D                                          135   3e-31   
ref|XP_009626682.1|  PREDICTED: growth-regulating factor 1-like         137   3e-31   
ref|XP_006647996.1|  PREDICTED: growth-regulating factor 1-like         134   3e-31   
ref|XP_002283504.2|  PREDICTED: growth-regulating factor 1-like i...    137   3e-31   Vitis vinifera
ref|XP_002270427.2|  PREDICTED: growth-regulating factor 4-like i...    133   4e-31   Vitis vinifera
ref|XP_010662088.1|  PREDICTED: growth-regulating factor 4-like i...    133   4e-31   
emb|CBI26466.3|  unnamed protein product                                134   4e-31   
ref|XP_008780324.1|  PREDICTED: growth-regulating factor 1-like         127   4e-31   
ref|XP_009133704.1|  PREDICTED: growth-regulating factor 2              135   4e-31   
ref|XP_010685314.1|  PREDICTED: growth-regulating factor 5 isofor...    130   5e-31   
ref|XP_009784651.1|  PREDICTED: growth-regulating factor 1-like         137   5e-31   
gb|AFB74090.1|  growth-regulating factor 2                              135   5e-31   
emb|CDY29584.1|  BnaA03g54290D                                          134   5e-31   
gb|EYU23268.1|  hypothetical protein MIMGU_mgv1a009029mg                133   5e-31   
ref|XP_006283492.1|  hypothetical protein CARUB_v10004544mg             135   6e-31   
ref|XP_001778905.1|  predicted protein                                  126   7e-31   
ref|XP_010446629.1|  PREDICTED: growth-regulating factor 2              135   9e-31   
gb|KFK30384.1|  hypothetical protein AALP_AA7G254100                    135   9e-31   
emb|CDX72654.1|  BnaC07g46760D                                          134   9e-31   
ref|XP_010526698.1|  PREDICTED: growth-regulating factor 1-like i...    134   1e-30   
ref|XP_010526699.1|  PREDICTED: growth-regulating factor 1-like i...    134   1e-30   
gb|AAP45157.2|  hypothetical protein SBB1_21t00001                      134   1e-30   Solanum bulbocastanum [ornamental nightshade]
ref|XP_010432035.1|  PREDICTED: growth-regulating factor 2-like         135   1e-30   
ref|XP_009794508.1|  PREDICTED: growth-regulating factor 4-like i...    131   1e-30   
ref|XP_010548469.1|  PREDICTED: growth-regulating factor 1-like         134   1e-30   
ref|XP_007029701.1|  Growth-regulating factor 5                         132   1e-30   
dbj|BAJ85032.1|  predicted protein                                      133   2e-30   
dbj|BAJ87627.1|  predicted protein                                      133   2e-30   
ref|XP_006411855.1|  hypothetical protein EUTSA_v10024915mg             134   2e-30   
ref|XP_009420425.1|  PREDICTED: growth-regulating factor 5-like         132   2e-30   
gb|AAP45172.2|  hypothetical protein SBB1_14t00021                      134   2e-30   Solanum bulbocastanum [ornamental nightshade]
ref|XP_010685313.1|  PREDICTED: growth-regulating factor 5 isofor...    130   2e-30   
ref|XP_010267408.1|  PREDICTED: growth-regulating factor 7-like i...    134   2e-30   
ref|XP_010267409.1|  PREDICTED: growth-regulating factor 7-like i...    134   2e-30   
ref|XP_011075906.1|  PREDICTED: growth-regulating factor 2-like         134   2e-30   
ref|XP_010919180.1|  PREDICTED: growth-regulating factor 10-like        130   2e-30   
ref|XP_010679671.1|  PREDICTED: growth-regulating factor 2-like         135   2e-30   
ref|XP_007018432.1|  Growth-regulating factor 1                         135   3e-30   
emb|CDX69322.1|  BnaC01g01310D                                          133   3e-30   
ref|XP_011074968.1|  PREDICTED: growth-regulating factor 4-like         131   3e-30   
ref|XP_009606791.1|  PREDICTED: growth-regulating factor 4-like         130   3e-30   
gb|AFB74089.1|  growth-regulating factor 2                              133   3e-30   
ref|XP_007039372.1|  Growth-regulating factor 8, putative isoform 3     133   3e-30   
ref|XP_007039370.1|  Growth-regulating factor 8, putative isoform 1     133   3e-30   
gb|EAZ24805.1|  hypothetical protein OsJ_08584                          131   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010314819.1|  PREDICTED: growth-regulating factor 4-like i...    130   3e-30   
ref|XP_010314820.1|  PREDICTED: growth-regulating factor 4-like i...    130   3e-30   
ref|XP_009790531.1|  PREDICTED: growth-regulating factor 4-like i...    131   3e-30   
ref|XP_009588672.1|  PREDICTED: growth-regulating factor 4-like i...    130   3e-30   
ref|XP_003580449.1|  PREDICTED: growth-regulating factor 3-like         131   3e-30   
ref|XP_007136458.1|  hypothetical protein PHAVU_009G047000g             134   3e-30   
ref|XP_008803299.1|  PREDICTED: growth-regulating factor 10-like ...    127   4e-30   
gb|KDO40072.1|  hypothetical protein CISIN_1g0182081mg                  126   4e-30   
ref|XP_002320016.2|  hypothetical protein POPTR_0014s01320g             133   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_010917179.1|  PREDICTED: growth-regulating factor 1-like         130   5e-30   
ref|XP_010943629.1|  PREDICTED: growth-regulating factor 4-like i...    130   5e-30   
ref|XP_008803298.1|  PREDICTED: growth-regulating factor 10-like ...    128   5e-30   
ref|XP_008337024.1|  PREDICTED: growth-regulating factor 1-like         129   5e-30   
ref|XP_010943630.1|  PREDICTED: growth-regulating factor 4-like i...    130   6e-30   
ref|XP_003570521.1|  PREDICTED: growth-regulating factor 1-like         131   6e-30   
ref|NP_001048288.1|  Os02g0776900                                       131   6e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002271355.3|  PREDICTED: growth-regulating factor 4 isofor...    133   6e-30   Vitis vinifera
ref|XP_010429218.1|  PREDICTED: growth-regulating factor 1-like         131   6e-30   
ref|XP_010662924.1|  PREDICTED: growth-regulating factor 4 isofor...    133   6e-30   
ref|XP_008813471.1|  PREDICTED: growth-regulating factor 4-like         130   6e-30   
sp|A2XA73.1|GRF1_ORYSI  RecName: Full=Growth-regulating factor 1;...    130   7e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_009386841.1|  PREDICTED: growth-regulating factor 5-like         130   7e-30   
ref|XP_009385239.1|  PREDICTED: growth-regulating factor 10-like        127   8e-30   
gb|KCW71336.1|  hypothetical protein EUGRSUZ_F04420                     126   8e-30   
ref|XP_010933923.1|  PREDICTED: growth-regulating factor 10-like        127   8e-30   
ref|XP_007136459.1|  hypothetical protein PHAVU_009G047000g             133   8e-30   
gb|EPS67843.1|  hypothetical protein M569_06931                         123   9e-30   
gb|AFB74091.1|  growth-regulating factor 2                              131   9e-30   
ref|XP_006342493.1|  PREDICTED: growth-regulating factor 4-like         129   9e-30   
ref|XP_007131487.1|  hypothetical protein PHAVU_011G017700g             129   9e-30   
ref|XP_010314818.1|  PREDICTED: growth-regulating factor 4-like i...    129   9e-30   
emb|CBI23073.3|  unnamed protein product                                133   1e-29   
gb|KHG03220.1|  ATP synthase subunit delta                              132   1e-29   
ref|XP_004253086.1|  PREDICTED: growth-regulating factor 4-like i...    129   1e-29   
ref|XP_008780035.1|  PREDICTED: growth-regulating factor 10-like        128   1e-29   
ref|XP_007136460.1|  hypothetical protein PHAVU_009G047000g             132   1e-29   
gb|KFK30383.1|  hypothetical protein AALP_AA7G254000                    131   1e-29   
gb|EPS59351.1|  hypothetical protein M569_15457                         124   1e-29   
ref|XP_006432586.1|  hypothetical protein CICLE_v10001613mg             129   1e-29   
ref|XP_004953585.1|  PREDICTED: growth-regulating factor 4-like         130   1e-29   
ref|XP_006432587.1|  hypothetical protein CICLE_v10001613mg             129   1e-29   
gb|KHG13807.1|  Uncharacterized protein F383_19022                      132   1e-29   
sp|Q6AWY7.1|GRF2_ORYSJ  RecName: Full=Growth-regulating factor 2;...    128   1e-29   
ref|XP_007039182.1|  Growth-regulating factor 7, putative isoform 1     132   2e-29   
ref|NP_179869.1|  growth-regulating factor 1                            131   2e-29   
gb|ACV71017.1|  UPA17                                                   132   2e-29   
ref|XP_003549367.1|  PREDICTED: growth-regulating factor 6-like         132   2e-29   
ref|XP_010528592.1|  PREDICTED: growth-regulating factor 3-like i...    128   2e-29   
ref|XP_004292769.1|  PREDICTED: growth-regulating factor 6-like         132   2e-29   
ref|XP_011017084.1|  PREDICTED: growth-regulating factor 1-like i...    132   2e-29   
ref|XP_002448459.1|  hypothetical protein SORBIDRAFT_06g027465          129   2e-29   
ref|XP_008365585.1|  PREDICTED: growth-regulating factor 1-like         132   2e-29   
gb|EYU29085.1|  hypothetical protein MIMGU_mgv1a024321mg                129   2e-29   
gb|EEC80200.1|  hypothetical protein OsI_22082                          127   2e-29   
ref|XP_006293984.1|  hypothetical protein CARUB_v10022975mg             131   2e-29   
ref|XP_002878638.1|  hypothetical protein ARALYDRAFT_481147             131   2e-29   
ref|XP_004512413.1|  PREDICTED: growth-regulating factor 5-like i...    128   2e-29   
ref|XP_010528591.1|  PREDICTED: growth-regulating factor 3-like i...    128   2e-29   
gb|KDP25215.1|  hypothetical protein JCGZ_20371                         130   2e-29   
ref|XP_010064038.1|  PREDICTED: growth-regulating factor 5              127   3e-29   
ref|XP_006404750.1|  hypothetical protein EUTSA_v10000124mg             130   3e-29   
gb|EPS65941.1|  hypothetical protein M569_08839                         121   3e-29   
emb|CDX83200.1|  BnaA03g23060D                                          129   3e-29   
ref|XP_007208030.1|  hypothetical protein PRUPE_ppa003017mg             131   4e-29   
ref|XP_010273550.1|  PREDICTED: growth-regulating factor 6-like i...    131   4e-29   
gb|KEH39997.1|  growth-regulating factor                                130   4e-29   
ref|XP_010273541.1|  PREDICTED: growth-regulating factor 6-like i...    131   4e-29   
ref|XP_008440426.1|  PREDICTED: growth-regulating factor 1-like         130   5e-29   
gb|KDP46916.1|  hypothetical protein JCGZ_10610                         128   5e-29   
ref|XP_004143409.1|  PREDICTED: growth-regulating factor 1-like         130   5e-29   
gb|KDP41582.1|  hypothetical protein JCGZ_15989                         131   5e-29   
ref|XP_010106901.1|  hypothetical protein L484_012995                   131   5e-29   
ref|XP_010472281.1|  PREDICTED: growth-regulating factor 1              130   5e-29   
ref|XP_009589483.1|  PREDICTED: growth-regulating factor 1-like         131   5e-29   
ref|XP_006466427.1|  PREDICTED: growth-regulating factor 1-like         131   5e-29   
gb|KDO78868.1|  hypothetical protein CISIN_1g007514mg                   130   5e-29   
ref|NP_027759.1|  growth-regulating factor 6                            125   6e-29   
ref|XP_007160951.1|  hypothetical protein PHAVU_001G031000g             130   6e-29   
ref|XP_006426135.1|  hypothetical protein CICLE_v10025209mg             130   6e-29   
gb|KHG00974.1|  hypothetical protein F383_23443                         128   6e-29   
ref|XP_009361143.1|  PREDICTED: growth-regulating factor 1-like         130   7e-29   
gb|KFK32783.1|  hypothetical protein AALP_AA6G287800                    129   7e-29   
gb|KEH39998.1|  growth-regulating factor                                131   7e-29   
gb|KHN36988.1|  hypothetical protein glysoja_009016                     130   7e-29   
ref|XP_003549368.1|  PREDICTED: growth-regulating factor 6-like         130   7e-29   
ref|XP_010553873.1|  PREDICTED: growth-regulating factor 4-like i...    126   7e-29   
ref|XP_010553871.1|  PREDICTED: growth-regulating factor 4-like i...    126   7e-29   
gb|KHN17179.1|  hypothetical protein glysoja_010638                     130   7e-29   
ref|XP_010059815.1|  PREDICTED: growth-regulating factor 6-like         130   8e-29   
ref|XP_008798914.1|  PREDICTED: growth-regulating factor 6-like i...    130   8e-29   
ref|XP_008798915.1|  PREDICTED: growth-regulating factor 6-like i...    129   8e-29   
gb|EMT06854.1|  hypothetical protein F775_52301                         130   8e-29   
gb|ADO21120.1|  growth-regulating factor 1                              127   9e-29   
ref|XP_009133993.1|  PREDICTED: growth-regulating factor 1              129   9e-29   
ref|XP_002883734.1|  hypothetical protein ARALYDRAFT_480218             124   9e-29   
ref|XP_010419272.1|  PREDICTED: growth-regulating factor 1-like         130   1e-28   
ref|XP_006595999.1|  PREDICTED: growth-regulating factor 6-like         130   1e-28   
ref|XP_009790956.1|  PREDICTED: growth-regulating factor 1-like         130   1e-28   
ref|XP_008444523.1|  PREDICTED: growth-regulating factor 6-like i...    130   1e-28   
ref|XP_008237479.1|  PREDICTED: growth-regulating factor 1              130   1e-28   
ref|XP_001782903.1|  predicted protein                                  120   1e-28   
gb|KHN17178.1|  hypothetical protein glysoja_010637                     130   1e-28   
sp|Q6AWY6.2|GRF3_ORYSJ  RecName: Full=Growth-regulating factor 3;...    127   1e-28   
ref|XP_010412907.1|  PREDICTED: growth-regulating factor 6-like         125   1e-28   
ref|NP_001047843.1|  Os02g0701300                                       127   1e-28   
ref|XP_009412847.1|  PREDICTED: growth-regulating factor 10-like        123   1e-28   
ref|XP_007047598.1|  Growth-regulating factor 1, putative isoform 2     128   1e-28   
ref|XP_008811877.1|  PREDICTED: growth-regulating factor 7-like i...    129   1e-28   
emb|CAH67857.1|  B0403H10-OSIGBa0105A11.9                               127   1e-28   
gb|ACM18109.1|  growth-regulating factor 3                              127   2e-28   
ref|XP_008444524.1|  PREDICTED: growth-regulating factor 6-like i...    130   2e-28   
ref|XP_004171939.1|  PREDICTED: growth-regulating factor 6-like         130   2e-28   
emb|CAN62265.1|  hypothetical protein VITISV_018459                     128   2e-28   
ref|XP_004143032.1|  PREDICTED: growth-regulating factor 6-like         130   2e-28   
emb|CDY21475.1|  BnaC03g27220D                                          128   2e-28   
ref|XP_011099411.1|  PREDICTED: growth-regulating factor 1-like         129   2e-28   
gb|KGN62426.1|  hypothetical protein Csa_2G354030                       130   2e-28   
ref|XP_009402070.1|  PREDICTED: growth-regulating factor 10-like        122   2e-28   
ref|XP_006857080.1|  hypothetical protein AMTR_s00065p00092420          129   2e-28   
ref|XP_006652759.1|  PREDICTED: LOW QUALITY PROTEIN: growth-regul...    126   2e-28   
tpg|DAA05207.1|  TPA: growth-regulating factor 3                        127   2e-28   
emb|CBI33069.3|  unnamed protein product                                128   3e-28   
ref|XP_007209638.1|  hypothetical protein PRUPE_ppa011917mg             121   3e-28   
gb|EEE57634.1|  hypothetical protein OsJ_08054                          126   3e-28   
gb|EEC73842.1|  hypothetical protein OsI_08594                          126   3e-28   
ref|XP_003635376.1|  PREDICTED: growth-regulating factor 1-like         128   3e-28   
ref|XP_004498953.1|  PREDICTED: growth-regulating factor 6-like         129   4e-28   
ref|XP_008811878.1|  PREDICTED: growth-regulating factor 7-like i...    127   4e-28   
gb|KHG13446.1|  Pyridoxine 5'-phosphate synthase                        126   4e-28   
ref|XP_007047597.1|  Growth-regulating factor 1, putative isoform 1     128   5e-28   
ref|XP_010999912.1|  PREDICTED: growth-regulating factor 1-like         128   5e-28   
ref|XP_011015778.1|  PREDICTED: growth-regulating factor 1-like         128   5e-28   
ref|XP_011074333.1|  PREDICTED: growth-regulating factor 6-like         128   5e-28   
ref|XP_010316034.1|  PREDICTED: growth-regulating factor 2-like i...    128   6e-28   
ref|XP_010488793.1|  PREDICTED: growth-regulating factor 6-like         122   6e-28   
ref|XP_009339165.1|  PREDICTED: growth-regulating factor 1-like i...    127   6e-28   
ref|XP_009339386.1|  PREDICTED: growth-regulating factor 1-like         127   6e-28   
ref|XP_010110131.1|  hypothetical protein L484_003760                   127   6e-28   
ref|XP_006363835.1|  PREDICTED: growth-regulating factor 1-like         127   7e-28   
ref|XP_004231946.1|  PREDICTED: growth-regulating factor 1-like i...    127   7e-28   
ref|XP_009415313.1|  PREDICTED: growth-regulating factor 6-like         127   8e-28   
ref|XP_009392381.1|  PREDICTED: growth-regulating factor 6 isofor...    127   8e-28   
ref|XP_008342096.1|  PREDICTED: growth-regulating factor 1 isofor...    127   8e-28   
ref|XP_009412290.1|  PREDICTED: growth-regulating factor 6-like i...    127   8e-28   
gb|KHF99600.1|  hypothetical protein F383_17440                         127   8e-28   
ref|XP_007227185.1|  hypothetical protein PRUPE_ppa019623mg             127   8e-28   
ref|XP_009415171.1|  PREDICTED: growth-regulating factor 5-like         124   8e-28   
ref|XP_009385873.1|  PREDICTED: growth-regulating factor 5-like i...    124   9e-28   
ref|XP_002974366.1|  hypothetical protein SELMODRAFT_442384             128   1e-27   
ref|XP_002975239.1|  hypothetical protein SELMODRAFT_442763             128   1e-27   
ref|XP_008234659.1|  PREDICTED: growth-regulating factor 7 isofor...    126   1e-27   
ref|XP_008234660.1|  PREDICTED: growth-regulating factor 7 isofor...    126   1e-27   
ref|XP_009385874.1|  PREDICTED: growth-regulating factor 5-like i...    123   1e-27   
gb|ADL36701.1|  GRF domain class transcription factor                   127   1e-27   
ref|XP_009586687.1|  PREDICTED: growth-regulating factor 3-like i...    121   1e-27   
ref|XP_003560274.1|  PREDICTED: growth-regulating factor 6-like         126   1e-27   
ref|XP_009362603.1|  PREDICTED: growth-regulating factor 1-like i...    126   2e-27   
ref|XP_010918298.1|  PREDICTED: growth-regulating factor 7-like i...    125   2e-27   
ref|XP_010918299.1|  PREDICTED: growth-regulating factor 7-like i...    125   2e-27   
emb|CBI34794.3|  unnamed protein product                                120   2e-27   
ref|XP_002281639.1|  PREDICTED: growth-regulating factor 10-like ...    120   2e-27   
ref|XP_008220402.1|  PREDICTED: growth-regulating factor 6-like         126   2e-27   
ref|XP_010661586.1|  PREDICTED: growth-regulating factor 10-like ...    120   2e-27   
emb|CAN67378.1|  hypothetical protein VITISV_017916                   95.1    2e-27   
ref|XP_002272535.3|  PREDICTED: growth-regulating factor 8              125   2e-27   
ref|XP_010941955.1|  PREDICTED: growth-regulating factor 6-like         125   2e-27   
ref|XP_009411325.1|  PREDICTED: growth-regulating factor 6-like         126   2e-27   
gb|KDP41583.1|  hypothetical protein JCGZ_15990                         126   2e-27   
ref|XP_008238100.1|  PREDICTED: growth-regulating factor 4-like         122   2e-27   
ref|XP_008376804.1|  PREDICTED: growth-regulating factor 4              125   2e-27   
ref|XP_010556485.1|  PREDICTED: growth-regulating factor 1-like         125   2e-27   
ref|XP_009771979.1|  PREDICTED: growth-regulating factor 3-like         122   3e-27   
ref|XP_002518921.1|  conserved hypothetical protein                     124   3e-27   
ref|XP_007158190.1|  hypothetical protein PHAVU_002G131700g             122   3e-27   
ref|XP_004289366.1|  PREDICTED: growth-regulating factor 1-like         125   3e-27   
ref|XP_006647745.1|  PREDICTED: LOW QUALITY PROTEIN: growth-regul...    123   3e-27   
ref|XP_002521932.1|  conserved hypothetical protein                     124   3e-27   
ref|NP_001051155.1|  Os03g0729500                                       124   4e-27   
ref|XP_002510052.1|  conserved hypothetical protein                     125   4e-27   
ref|XP_008785738.1|  PREDICTED: growth-regulating factor 6-like         121   4e-27   
ref|XP_003522532.1|  PREDICTED: growth-regulating factor 7-like i...    125   5e-27   
gb|ACF81811.1|  unknown                                                 121   5e-27   
gb|EYU44521.1|  hypothetical protein MIMGU_mgv1a003526mg                125   5e-27   
ref|XP_006578874.1|  PREDICTED: growth-regulating factor 7-like i...    125   5e-27   
ref|XP_010467119.1|  PREDICTED: growth-regulating factor 6              120   5e-27   
ref|XP_010666149.1|  PREDICTED: growth-regulating factor 7              124   5e-27   
ref|XP_006368308.1|  hypothetical protein POPTR_0001s01480g             121   5e-27   
ref|XP_003612622.1|  hypothetical protein MTR_5g027030                  121   6e-27   
ref|NP_001106027.1|  putative growth-regulating factor 9                122   6e-27   
emb|CDY33407.1|  BnaA07g04320D                                          122   6e-27   
gb|EEE59860.1|  hypothetical protein OsJ_12442                          124   6e-27   
ref|XP_009412291.1|  PREDICTED: growth-regulating factor 6-like i...    124   7e-27   
gb|AGT16676.1|  growth-regulating factor                                122   7e-27   
ref|XP_002320668.1|  hypothetical protein POPTR_0014s00780g             124   8e-27   
ref|XP_008785737.1|  PREDICTED: growth-regulating factor 6-like         124   8e-27   
ref|XP_010318056.1|  PREDICTED: growth-regulating factor 3-like         122   9e-27   
ref|XP_007220959.1|  hypothetical protein PRUPE_ppa024293mg             124   9e-27   
ref|XP_006651774.1|  PREDICTED: growth-regulating factor 6-like         123   9e-27   
ref|XP_009412289.1|  PREDICTED: growth-regulating factor 6-like i...    124   9e-27   
ref|XP_009361294.1|  PREDICTED: growth-regulating factor 6              123   9e-27   
ref|XP_006299696.1|  hypothetical protein CARUB_v10015887mg             119   9e-27   
ref|XP_010531313.1|  PREDICTED: growth-regulating factor 1              123   9e-27   
gb|AGT16705.1|  growth-regulating protein                               122   1e-26   
ref|XP_008342107.1|  PREDICTED: growth-regulating factor 1 isofor...    124   1e-26   
gb|AGT16655.1|  growth-regulating factor                                122   1e-26   
ref|XP_010910363.1|  PREDICTED: growth-regulating factor 3 isofor...    121   1e-26   
gb|AGT16115.1|  growth-regulating factor                                121   1e-26   
emb|CAB38922.1|  putative protein                                       123   1e-26   
ref|XP_008239263.1|  PREDICTED: growth-regulating factor 8              123   1e-26   
ref|XP_006851561.1|  hypothetical protein AMTR_s00040p00189460          122   1e-26   
ref|XP_010276023.1|  PREDICTED: growth-regulating factor 10             119   1e-26   
gb|AFW67713.1|  hypothetical protein ZEAMMB73_839183                    122   1e-26   
ref|XP_008342110.1|  PREDICTED: growth-regulating factor 1 isofor...    124   1e-26   
ref|NP_001106029.1|  putative growth-regulating factor 11               120   1e-26   
dbj|BAK07599.1|  predicted protein                                      120   1e-26   
ref|XP_008373454.1|  PREDICTED: growth-regulating factor 5-like         120   1e-26   
tpg|DAA51152.1|  TPA: hypothetical protein ZEAMMB73_866785              118   2e-26   
ref|XP_009365741.1|  PREDICTED: growth-regulating factor 4-like         120   2e-26   
ref|XP_009362604.1|  PREDICTED: growth-regulating factor 1-like i...    123   2e-26   
ref|XP_009392380.1|  PREDICTED: growth-regulating factor 6 isofor...    124   2e-26   
emb|CDP04999.1|  unnamed protein product                                123   2e-26   
ref|NP_001056618.1|  Os06g0116200                                       120   2e-26   
ref|XP_003533459.1|  PREDICTED: growth-regulating factor 4-like         120   2e-26   
gb|ACG42410.1|  atGRF5                                                  120   2e-26   
ref|XP_003516492.1|  PREDICTED: growth-regulating factor 3-like         120   2e-26   
gb|ACG34905.1|  growth-regulating factor                                120   2e-26   
ref|XP_006343776.1|  PREDICTED: growth-regulating factor 8-like         121   2e-26   
gb|ACR36087.1|  unknown                                                 122   2e-26   
ref|XP_004246560.1|  PREDICTED: growth-regulating factor 3-like i...    120   2e-26   
ref|XP_010910364.1|  PREDICTED: growth-regulating factor 3 isofor...    119   2e-26   
gb|AFW64282.1|  atGRF5                                                  120   2e-26   
ref|NP_001106024.1|  putative growth-regulating factor 5                120   2e-26   
ref|NP_001106022.1|  putative growth-regulating factor 3                120   2e-26   
sp|Q6AWY3.2|GRF6_ORYSJ  RecName: Full=Growth-regulating factor 6;...    123   2e-26   
ref|XP_008676418.1|  PREDICTED: putative growth-regulating factor...    120   2e-26   
gb|KDP42705.1|  hypothetical protein JCGZ_23645                         121   2e-26   
ref|XP_004954097.1|  PREDICTED: growth-regulating factor 1-like         120   2e-26   
ref|XP_009339166.1|  PREDICTED: growth-regulating factor 1-like i...    123   3e-26   
gb|AFW59348.1|  growth-regulating factor                                120   3e-26   
ref|XP_009586688.1|  PREDICTED: growth-regulating factor 3-like i...    117   3e-26   
ref|XP_008342100.1|  PREDICTED: growth-regulating factor 1 isofor...    122   3e-26   
ref|XP_011018425.1|  PREDICTED: growth-regulating factor 5-like         119   3e-26   
ref|XP_011031322.1|  PREDICTED: growth-regulating factor 1-like         122   3e-26   
ref|XP_007211032.1|  hypothetical protein PRUPE_ppa019752mg             122   4e-26   
ref|XP_010091182.1|  hypothetical protein L484_002577                   121   4e-26   
ref|XP_002454651.1|  hypothetical protein SORBIDRAFT_04g034800          120   4e-26   
gb|ACG36157.1|  growth-regulating factor                                119   4e-26   
ref|XP_008647265.1|  PREDICTED: putative growth-regulating factor...    119   4e-26   
ref|XP_006581673.1|  PREDICTED: growth-regulating factor 7-like i...    120   4e-26   
ref|XP_006476277.1|  PREDICTED: growth-regulating factor 8-like i...    121   4e-26   
ref|XP_009791787.1|  PREDICTED: growth-regulating factor 3-like i...    122   4e-26   
ref|XP_002310328.2|  hypothetical protein POPTR_0007s14720g             122   4e-26   
ref|XP_010110133.1|  hypothetical protein L484_003762                   118   4e-26   
ref|XP_002436657.1|  hypothetical protein SORBIDRAFT_10g006690          119   4e-26   
ref|XP_010936184.1|  PREDICTED: growth-regulating factor 6-like         122   4e-26   
ref|XP_008647264.1|  PREDICTED: putative growth-regulating factor...    119   4e-26   
ref|XP_009791786.1|  PREDICTED: growth-regulating factor 3-like i...    122   4e-26   
ref|XP_006476278.1|  PREDICTED: growth-regulating factor 8-like i...    121   4e-26   
ref|NP_001106045.1|  putative growth-regulating factor 14               119   4e-26   
gb|AFW75298.1|  putative growth-regulating factor 14                    119   4e-26   
gb|KDO52814.1|  hypothetical protein CISIN_1g009918mg                   120   5e-26   
ref|XP_008661281.1|  PREDICTED: putative growth-regulating factor...    120   5e-26   
ref|XP_006341255.1|  PREDICTED: growth-regulating factor 3-like         119   5e-26   



>ref|XP_009767378.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=364

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  RSR PFT  QWQELEHQALIYKYMVSGMPVPPDLLY+IRRS+DSSLSSKL+LHQP
Sbjct  2    MSTAARSRFPFTANQWQELEHQALIYKYMVSGMPVPPDLLYTIRRSMDSSLSSKLVLHQP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H GWN FQMGFGKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   HHIGWNCFQMGFGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  121

Query  577  I  579
            I
Sbjct  122  I  122



>ref|XP_009596803.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=361

 Score =   178 bits (452),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  RSR PFT  QWQELEHQALIYKYMVSGMPVPPDLLY+IRRSLDSSLSSKL+LHQP
Sbjct  2    MSTTARSRFPFTANQWQELEHQALIYKYMVSGMPVPPDLLYTIRRSLDSSLSSKLILHQP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H GWN FQMGFGKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   HHIGWNCFQMGFGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  121

Query  577  I  579
            I
Sbjct  122  I  122



>ref|XP_004243717.1| PREDICTED: growth-regulating factor 1-like [Solanum lycopersicum]
Length=344

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M S GRSR PFT  QWQELEHQALIYKYMVSGMPVP DLLY+IRRSLDSSLSSKLL+HQP
Sbjct  2    MSSTGRSRFPFTANQWQELEHQALIYKYMVSGMPVPADLLYTIRRSLDSSLSSKLLIHQP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H GWN FQMGFGKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   HHIGWNCFQMGFGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  121

Query  577  I  579
            I
Sbjct  122  I  122



>ref|XP_006342364.1| PREDICTED: growth-regulating factor 1-like [Solanum tuberosum]
Length=340

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M S GRSR PFT  QWQELEHQALIYKYMVSGMPVP DLLY+IRRSLDSSLSSKL++HQP
Sbjct  2    MSSTGRSRFPFTANQWQELEHQALIYKYMVSGMPVPADLLYTIRRSLDSSLSSKLIIHQP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H GWN FQMGFGKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   HHIGWNCFQMGFGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  121

Query  577  I  579
            I
Sbjct  122  I  122



>ref|XP_009615805.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=325

 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 97/120 (81%), Gaps = 6/120 (5%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            MS  RS  PFT  QWQELEHQALIYKYM SGMPVPPDLLY+IRRSLDSS       HQPQ
Sbjct  1    MSRARSGYPFTATQWQELEHQALIYKYMASGMPVPPDLLYTIRRSLDSSN------HQPQ  54

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            H GWN FQ+GFGKKIDPEPGRCRRTDGKKWRCS++   D KYCERH H+ R RSRKPVE+
Sbjct  55   HIGWNCFQLGFGKKIDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGRNRSRKPVEV  114



>ref|XP_010047492.1| PREDICTED: growth-regulating factor 1 isoform X2 [Eucalyptus 
grandis]
Length=378

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 105/134 (78%), Gaps = 5/134 (4%)
 Frame = +1

Query  217  MMSGG-RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrs----ldsslsskl  381
            MMSGG  SR PFT  QWQELEHQALIYKY++SG+P+PPDLL+S++RS      S  S K 
Sbjct  3    MMSGGMSSRFPFTASQWQELEHQALIYKYLISGIPIPPDLLFSLKRSPSCFDSSHFSPKF  62

Query  382  llHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRS  561
            L HQPQH GWN FQMG GKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RS
Sbjct  63   LSHQPQHVGWNCFQMGLGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRS  122

Query  562  RKPVEIQSHKNSPN  603
            RKPVE+ S  +S +
Sbjct  123  RKPVEVLSSISSAS  136



>ref|XP_010047491.1| PREDICTED: growth-regulating factor 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW79425.1| hypothetical protein EUGRSUZ_C00823 [Eucalyptus grandis]
Length=381

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 105/134 (78%), Gaps = 5/134 (4%)
 Frame = +1

Query  217  MMSGG-RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrs----ldsslsskl  381
            MMSGG  SR PFT  QWQELEHQALIYKY++SG+P+PPDLL+S++RS      S  S K 
Sbjct  3    MMSGGMSSRFPFTASQWQELEHQALIYKYLISGIPIPPDLLFSLKRSPSCFDSSHFSPKF  62

Query  382  llHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRS  561
            L HQPQH GWN FQMG GKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RS
Sbjct  63   LSHQPQHVGWNCFQMGLGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRS  122

Query  562  RKPVEIQSHKNSPN  603
            RKPVE+ S  +S +
Sbjct  123  RKPVEVLSSISSAS  136



>ref|XP_011093817.1| PREDICTED: growth-regulating factor 1-like [Sesamum indicum]
Length=357

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = +1

Query  241  LPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYF  420
             PFT  QWQELEHQAL++KYMVSG+PVPPDLL++IRRSLDSSLSSK L+HQPQH GWN F
Sbjct  17   FPFTATQWQELEHQALVFKYMVSGVPVPPDLLFTIRRSLDSSLSSKFLIHQPQHIGWNSF  76

Query  421  QMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK---  591
             MGFG+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVEI S     
Sbjct  77   HMGFGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEILSQTTAT  136

Query  592  ----NSPNHNNNYPVTVPSFQFPATAS  660
                N+   NNN  +T  + Q  + +S
Sbjct  137  ATAPNAIPINNNTSITNKNTQIISPSS  163



>ref|XP_007138669.1| hypothetical protein PHAVU_009G228000g [Phaseolus vulgaris]
 gb|ESW10663.1| hypothetical protein PHAVU_009G228000g [Phaseolus vulgaris]
Length=357

 Score =   167 bits (424),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 104/139 (75%), Gaps = 3/139 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQP  396
            M  GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+RS   S  S  LL +QP
Sbjct  1    MMNGRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH+GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHFGWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  IQSHKNSPNHNNNYPVTVP  633
            +   K +P  N N     P
Sbjct  121  VL--KTTPTTNTNASTQQP  137



>ref|XP_009781044.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=328

 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 96/120 (80%), Gaps = 3/120 (3%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            MS  RS  PFT  QWQELEHQALIYKYM SGMPVPPDLLY+IRRSLDSS       HQPQ
Sbjct  1    MSRARSGYPFTATQWQELEHQALIYKYMASGMPVPPDLLYTIRRSLDSSNLFL---HQPQ  57

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            H GWN  Q+GFGKKIDPEPGRCRRTDGKKWRCS++   D KYCERH H+ R RSRKPVE+
Sbjct  58   HIGWNCIQLGFGKKIDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGRNRSRKPVEV  117



>ref|XP_010656124.1| PREDICTED: growth-regulating factor 1 isoform X1 [Vitis vinifera]
Length=388

 Score =   166 bits (419),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll--lHQ  393
            M  GR+R PFT  QWQELEHQALI+KYM SGMP+PPDL++SI+RSLDS L +  L   HQ
Sbjct  1    MMSGRNRFPFTATQWQELEHQALIFKYMASGMPIPPDLIFSIKRSLDSPLPTSKLFPTHQ  60

Query  394  PQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
             QH GWN FQMG G+K+DPEPGRCRRTDGKKWRC+++  PD KYCERH H+ R RSRKPV
Sbjct  61   SQHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGRNRSRKPV  120

Query  574  EI  579
            E+
Sbjct  121  EV  122



>emb|CBI27820.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   166 bits (419),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll--lHQ  393
            M  GR+R PFT  QWQELEHQALI+KYM SGMP+PPDL++SI+RSLDS L +  L   HQ
Sbjct  1    MMSGRNRFPFTATQWQELEHQALIFKYMASGMPIPPDLIFSIKRSLDSPLPTSKLFPTHQ  60

Query  394  PQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
             QH GWN FQMG G+K+DPEPGRCRRTDGKKWRC+++  PD KYCERH H+ R RSRKPV
Sbjct  61   SQHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGRNRSRKPV  120

Query  574  EI  579
            E+
Sbjct  121  EV  122



>ref|XP_010656126.1| PREDICTED: growth-regulating factor 1 isoform X2 [Vitis vinifera]
Length=387

 Score =   166 bits (419),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll--lHQ  393
            M  GR+R PFT  QWQELEHQALI+KYM SGMP+PPDL++SI+RSLDS L +  L   HQ
Sbjct  1    MMSGRNRFPFTATQWQELEHQALIFKYMASGMPIPPDLIFSIKRSLDSPLPTSKLFPTHQ  60

Query  394  PQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
             QH GWN FQMG G+K+DPEPGRCRRTDGKKWRC+++  PD KYCERH H+ R RSRKPV
Sbjct  61   SQHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGRNRSRKPV  120

Query  574  EI  579
            E+
Sbjct  121  EV  122



>ref|XP_003547502.2| PREDICTED: growth-regulating factor 1-like [Glycine max]
Length=365

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQP  396
            M  GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+RS   S  S  LL +QP
Sbjct  1    MMNGRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH+GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHFGWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  I  579
            +
Sbjct  121  V  121



>gb|KHG19107.1| hypothetical protein F383_07760 [Gossypium arboreum]
Length=375

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrs-ldsslssklllHQP  396
            M  GR+R PFT  Q+QELEHQALI+KYMVSG+P+PPDLL++I+RS LD+SLSS+L  +QP
Sbjct  1    MMSGRNRFPFTASQYQELEHQALIFKYMVSGIPIPPDLLFTIKRSCLDTSLSSRLFSYQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH GWN FQMG G+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  I  579
            +
Sbjct  121  V  121



>ref|XP_007012669.1| Growth-regulating factor 5 isoform 3 [Theobroma cacao]
 gb|EOY30288.1| Growth-regulating factor 5 isoform 3 [Theobroma cacao]
Length=377

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDll-ysirrsldsslssklllHQP  396
            M  GR+R PFT  QWQELEHQALI+KYMVSG+P+PPDLL    R  LDSSLSS+L   QP
Sbjct  1    MMSGRNRFPFTASQWQELEHQALIFKYMVSGIPIPPDLLFTIKRSCLDSSLSSRLFSRQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH GWN FQMG G+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  IQS  585
            + +
Sbjct  121  VTT  123



>ref|XP_007012667.1| Growth-regulating factor 5 isoform 1 [Theobroma cacao]
 gb|EOY30286.1| Growth-regulating factor 5 isoform 1 [Theobroma cacao]
Length=379

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDll-ysirrsldsslssklllHQP  396
            M  GR+R PFT  QWQELEHQALI+KYMVSG+P+PPDLL    R  LDSSLSS+L   QP
Sbjct  1    MMSGRNRFPFTASQWQELEHQALIFKYMVSGIPIPPDLLFTIKRSCLDSSLSSRLFSRQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH GWN FQMG G+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  IQS  585
            + +
Sbjct  121  VTT  123



>ref|XP_007012668.1| Growth-regulating factor 5 isoform 2 [Theobroma cacao]
 gb|EOY30287.1| Growth-regulating factor 5 isoform 2 [Theobroma cacao]
Length=380

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDll-ysirrsldsslssklllHQP  396
            M  GR+R PFT  QWQELEHQALI+KYMVSG+P+PPDLL    R  LDSSLSS+L   QP
Sbjct  1    MMSGRNRFPFTASQWQELEHQALIFKYMVSGIPIPPDLLFTIKRSCLDSSLSSRLFSRQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH GWN FQMG G+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHIGWNCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  IQS  585
            + +
Sbjct  121  VTT  123



>ref|XP_006372002.1| hypothetical protein POPTR_0018s07140g [Populus trichocarpa]
 gb|ERP49799.1| hypothetical protein POPTR_0018s07140g [Populus trichocarpa]
Length=382

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 108/150 (72%), Gaps = 12/150 (8%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            +MSGG +R PFT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS+    S     HQ 
Sbjct  2    IMSGG-NRFPFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSVCLDSSKLFP-HQH  59

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H+ W+ FQMG G+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  60   PHFAWSCFQMGLGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  119

Query  577  I--QSHKNSP--------NHNNNYPVTVPS  636
            +  Q+   SP        NH+NN  +T  S
Sbjct  120  VATQTQSTSPPTVSSITRNHSNNSLLTTSS  149



>ref|XP_011045985.1| PREDICTED: growth-regulating factor 1 isoform X4 [Populus euphratica]
Length=383

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 11/148 (7%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH--  390
            +MSGG +R PFT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS     S    L   
Sbjct  2    IMSGG-NRFPFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPR  60

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            QP H+ W+ FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKP
Sbjct  61   QPPHFSWSCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKP  120

Query  571  VEIQSHKNSP--------NHNNNYPVTV  630
            VE+ +   +         NH+NN  +T 
Sbjct  121  VEVATQSTTAPTVSSITRNHSNNSLLTT  148



>ref|XP_011045982.1| PREDICTED: growth-regulating factor 1 isoform X1 [Populus euphratica]
Length=390

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 11/148 (7%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH--  390
            +MSGG +R PFT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS     S    L   
Sbjct  2    IMSGG-NRFPFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPR  60

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            QP H+ W+ FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKP
Sbjct  61   QPPHFSWSCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKP  120

Query  571  VEIQSHKNSP--------NHNNNYPVTV  630
            VE+ +   +         NH+NN  +T 
Sbjct  121  VEVATQSTTAPTVSSITRNHSNNSLLTT  148



>ref|XP_007135443.1| hypothetical protein PHAVU_010G130000g [Phaseolus vulgaris]
 gb|ESW07437.1| hypothetical protein PHAVU_010G130000g [Phaseolus vulgaris]
Length=339

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 21/173 (12%)
 Frame = +1

Query  217  MMSG---GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MMS     R+R PFT  QWQELE QAL++KYMV+G P+PPDL+YSI+RSLDSS+SS+L  
Sbjct  1    MMSASASARNRSPFTPTQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDSSISSRLFP  60

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
            H P   GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  61   HHP--IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  118

Query  568  PVEIQSHKNSPNHNN-------------NYPVTVPSFQF---PATASCDQNRF  678
            PVE+ S  ++  + +             N  +T PSF F   P++ SCD   F
Sbjct  119  PVEVSSATSTATNTSQTIPSYTRNLSLTNPTITSPSFPFSPLPSSLSCDSQAF  171



>ref|XP_011045984.1| PREDICTED: growth-regulating factor 1 isoform X3 [Populus euphratica]
Length=385

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 11/148 (7%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH--  390
            +MSGG +R PFT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS     S    L   
Sbjct  2    IMSGG-NRFPFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPR  60

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            QP H+ W+ FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKP
Sbjct  61   QPPHFSWSCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKP  120

Query  571  VEIQSHKNSP--------NHNNNYPVTV  630
            VE+ +   +         NH+NN  +T 
Sbjct  121  VEVATQSTTAPTVSSITRNHSNNSLLTT  148



>ref|XP_011045983.1| PREDICTED: growth-regulating factor 1 isoform X2 [Populus euphratica]
Length=386

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 11/148 (7%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH--  390
            +MSGG +R PFT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS     S    L   
Sbjct  2    IMSGG-NRFPFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPR  60

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            QP H+ W+ FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKP
Sbjct  61   QPPHFSWSCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKP  120

Query  571  VEIQSHKNSP--------NHNNNYPVTV  630
            VE+ +   +         NH+NN  +T 
Sbjct  121  VEVATQSTTAPTVSSITRNHSNNSLLTT  148



>ref|XP_007154592.1| hypothetical protein PHAVU_003G131800g [Phaseolus vulgaris]
 gb|ESW26586.1| hypothetical protein PHAVU_003G131800g [Phaseolus vulgaris]
Length=374

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQP  396
            M  GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+R+   S  S  LL HQ 
Sbjct  1    MMNGRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRTHLDSPLSSRLLPHQS  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH+GWNY  MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHFGWNYLPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  I  579
            +
Sbjct  121  V  121



>ref|XP_003534945.2| PREDICTED: growth-regulating factor 1-like [Glycine max]
Length=365

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQP  396
            M  GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+RS   S  S  LL +QP
Sbjct  1    MMNGRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH+GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   QHFGWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  I  579
            +
Sbjct  121  V  121



>gb|KEH32452.1| growth-regulating factor-like protein [Medicago truncatula]
Length=430

 Score =   164 bits (415),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            M  GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL +I+RS   S       HQ Q
Sbjct  1    MMNGRNRYPFTPTQWQELEHQALIYKYMASGISIPPDLLLTIKRSYLDSSRLSP--HQSQ  58

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            H+GWNY  MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  59   HFGWNYLPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  118

Query  580  QSHKNS  597
                N+
Sbjct  119  LKTTNT  124



>gb|KHN06084.1| hypothetical protein glysoja_035990 [Glycine soja]
Length=364

 Score =   162 bits (411),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQPQHY  405
            GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+RS   S  S  LL +QPQH+
Sbjct  3    GRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQPQHF  62

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  63   GWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  120



>ref|XP_008363050.1| PREDICTED: growth-regulating factor 5-like [Malus domestica]
Length=180

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +1

Query  217  MMSGGR-SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk---ll  384
            M S GR SR PFT  QWQELEHQALIYKYMVSG+ +PPDLL+S++RS  +  S     L 
Sbjct  1    MNSTGRNSRFPFTPTQWQELEHQALIYKYMVSGISIPPDLLFSLKRSTYNLDSPLPPKLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
             H P H GWN FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSR
Sbjct  61   SHHPPHIGWNCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCEKHMHRGKNRSR  120

Query  565  KPVEI  579
            KPVE+
Sbjct  121  KPVEV  125



>gb|KHN12274.1| hypothetical protein glysoja_026166 [Glycine soja]
Length=364

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQPQHY  405
            GR+R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+RS   S  S  LL +QPQH+
Sbjct  3    GRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQPQHF  62

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  63   GWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  120



>ref|XP_010090133.1| hypothetical protein L484_027365 [Morus notabilis]
 gb|EXB38930.1| hypothetical protein L484_027365 [Morus notabilis]
Length=391

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHY  405
             GR+R PFT  QWQELEHQALI+KYM SG+P+PPDLL++I+ S   S  S  LL  PQH 
Sbjct  2    SGRNRFPFTASQWQELEHQALIFKYMASGIPIPPDLLFTIKNSYLDSSLSSKLL-IPQHV  60

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            GWN FQMG GKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  61   GWNCFQMGLGKKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKNRSRKPVEV  118



>ref|XP_003547719.2| PREDICTED: growth-regulating factor 5-like isoform X1 [Glycine 
max]
Length=360

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 8/143 (6%)
 Frame = +1

Query  217  MMS---GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MMS   G R+R PFT IQWQELE QAL++KYMV+G P+PPDL+YSI+RSLD+S+SS+L  
Sbjct  1    MMSASAGARNRSPFTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFP  60

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
            H P   GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  61   HHP--IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  118

Query  568  PVEIQSHKNSPNHNNNYPVTVPS  636
            PVE+ S  ++     N   T+PS
Sbjct  119  PVEVSSATSTA---TNTSQTIPS  138



>ref|XP_006381639.1| hypothetical protein POPTR_0006s14560g [Populus trichocarpa]
 gb|ERP59436.1| hypothetical protein POPTR_0006s14560g [Populus trichocarpa]
Length=383

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 104/147 (71%), Gaps = 11/147 (7%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH--Q  393
            MSGG +R PFT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS     S    L   Q
Sbjct  1    MSGG-NRFPFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSGCLDSSLSSKLFPRQ  59

Query  394  PQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
            P H+ W  FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKPV
Sbjct  60   PPHFSWGCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPV  119

Query  574  EIQSHKNSP--------NHNNNYPVTV  630
            E+ +   +         NH+NN  +T 
Sbjct  120  EVATQSITAPTVSSMTRNHSNNSLLTT  146



>ref|XP_006598831.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Glycine 
max]
Length=374

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 8/143 (6%)
 Frame = +1

Query  217  MMS---GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MMS   G R+R PFT IQWQELE QAL++KYMV+G P+PPDL+YSI+RSLD+S+SS+L  
Sbjct  1    MMSASAGARNRSPFTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFP  60

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
            H P   GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  61   HHP--IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  118

Query  568  PVEIQSHKNSPNHNNNYPVTVPS  636
            PVE+ S  ++     N   T+PS
Sbjct  119  PVEVSSATSTA---TNTSQTIPS  138



>ref|XP_006598832.1| PREDICTED: growth-regulating factor 5-like isoform X3 [Glycine 
max]
Length=373

 Score =   160 bits (404),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 8/143 (6%)
 Frame = +1

Query  217  MMS---GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MMS   G R+R PFT IQWQELE QAL++KYMV+G P+PPDL+YSI+RSLD+S+SS+L  
Sbjct  1    MMSASAGARNRSPFTQIQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFP  60

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
            H P   GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  61   HHP--IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  118

Query  568  PVEIQSHKNSPNHNNNYPVTVPS  636
            PVE+ S  ++     N   T+PS
Sbjct  119  PVEVSSATSTA---TNTSQTIPS  138



>ref|XP_003529835.1| PREDICTED: growth-regulating factor 5-like [Glycine max]
Length=345

 Score =   159 bits (402),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  R+R PFT  QWQELEHQAL++KYMV+G P+PPDL+YSI+RSLD+S+SS+L  H P
Sbjct  2    MSASARNRSPFTQTQWQELEHQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFPHHP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   --IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119

Query  577  IQSHKNSPNHNNNYPVTVPS  636
            + S  ++     N   T+PS
Sbjct  120  VSSAISTA---TNTSQTIPS  136



>gb|EPS64309.1| hypothetical protein M569_10478, partial [Genlisea aurea]
Length=158

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 96/120 (80%), Gaps = 5/120 (4%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGW  411
            RSR PFT  QWQELEHQAL+YKYM+SG+P+PPDLL++IRRSLDSS        QPQ  GW
Sbjct  7    RSRYPFTASQWQELEHQALVYKYMISGIPIPPDLLFTIRRSLDSSTFLLP---QPQQIGW  63

Query  412  NYFQMG--FGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            + F MG  FG+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVEI S
Sbjct  64   SGFHMGMGFGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEILS  123



>gb|KHN01405.1| hypothetical protein glysoja_009611 [Glycine soja]
Length=359

 Score =   159 bits (401),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 5/140 (4%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  R+R PFT  QWQELEHQAL++KYMV+G P+PPDL+YSI+RSLD+S+SS+L  H P
Sbjct  2    MSASARNRSPFTQTQWQELEHQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFPHHP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   --IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119

Query  577  IQSHKNSPNHNNNYPVTVPS  636
            + S  ++  + +    T+PS
Sbjct  120  VSSAISTATNTSQ---TIPS  136



>ref|XP_003551131.2| PREDICTED: growth-regulating factor 1-like [Glycine max]
Length=377

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 110/168 (65%), Gaps = 20/168 (12%)
 Frame = +1

Query  217  MMSG---GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MM+G     +R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+R+     S  L  
Sbjct  1    MMNGRNVDTNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRTTHLDSSRLL--  58

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
              PQH+GWNY  MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRK
Sbjct  59   --PQHFGWNYLPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRK  116

Query  568  PVEIQSHKNSP-----NHNNNYPVTVPSFQ------FPATASCDQNRF  678
            PVE+   K +P     N + + P T+ S        FP T S   + +
Sbjct  117  PVEVL--KTTPMTAATNTDASTPTTILSITKNSPVLFPTTHSLSHDTY  162



>ref|XP_002516290.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46292.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQP  396
            M  G ++ PFT  QWQELEHQALI+KYMVSG+P+P DLL++I+RS   S  S  L   QP
Sbjct  1    MMSGTNKFPFTASQWQELEHQALIFKYMVSGIPIPSDLLFTIKRSCLDSPLSSKLFPRQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H GW+ FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   PHIGWSCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  I  579
            +
Sbjct  121  V  121



>ref|XP_010666262.1| PREDICTED: growth-regulating factor 1 [Beta vulgaris subsp. vulgaris]
Length=380

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGW  411
            RS+ PFT  QWQELEHQALIYKYM +G+P+PPDLL++I+RSLDSSLSSKL  +QP   GW
Sbjct  16   RSKFPFTATQWQELEHQALIYKYMAAGVPIPPDLLFTIKRSLDSSLSSKLFPYQPSPLGW  75

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            N +QMG+GKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  76   NPYQMGYGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  130



>ref|XP_010086824.1| hypothetical protein L484_009597 [Morus notabilis]
 gb|EXB23834.1| hypothetical protein L484_009597 [Morus notabilis]
Length=378

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 99/119 (83%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            +  R+R PFT  QWQELEHQALI+KYMVSG+P+PPDL+YS++RSLDSS SS+L  H P  
Sbjct  6    ASARNRSPFTATQWQELEHQALIFKYMVSGVPIPPDLIYSVKRSLDSSFSSRLFSHHPT-  64

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
             GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+
Sbjct  65   -GWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  122



>ref|XP_008450915.1| PREDICTED: growth-regulating factor 4-like [Cucumis melo]
Length=334

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQPQH  402
              RS  PFT  QWQELEHQALI+KYMVSG+P+PP+LL+SI+RS   S  +  L  H PQ 
Sbjct  2    SARSMFPFTSAQWQELEHQALIFKYMVSGIPIPPELLFSIKRSALDSPFTSKLFPHHPQP  61

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI-  579
             GWNY QM  G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV++ 
Sbjct  62   VGWNYLQMSLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVDVL  121

Query  580  -QSHKNSPNHNNN  615
              +  N  NH +N
Sbjct  122  KTTATNEINHLSN  134



>ref|XP_008459738.1| PREDICTED: growth-regulating factor 6-like [Cucumis melo]
Length=316

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 107/151 (71%), Gaps = 10/151 (7%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQ-PQ  399
              R+R PFT  QWQELEHQALI+KYMVSG+P+PP+LLYSI+ +   +     L  HQ PQ
Sbjct  2    SARNRFPFTAAQWQELEHQALIFKYMVSGVPIPPELLYSIKATSLDTPFISRLFPHQYPQ  61

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE 
Sbjct  62   AVGWNYLQMGSGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE-  120

Query  580  QSHKNSPNHNNNYPVTVPSFQFPATASCDQN  672
            Q  K +P +++N P T      PA +S   N
Sbjct  121  QVSKTTPLNSSN-PST------PAISSITHN  144



>ref|XP_002298093.2| hypothetical protein POPTR_0001s16920g, partial [Populus trichocarpa]
 gb|EEE82898.2| hypothetical protein POPTR_0001s16920g, partial [Populus trichocarpa]
Length=338

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGW  411
            R+R PFT  QWQELEHQALIYKYMVSG+PVPP+LLYS++RSL SSL+S+L  HQP   GW
Sbjct  8    RNRFPFTATQWQELEHQALIYKYMVSGVPVPPELLYSVKRSLGSSLASRLFPHQP--IGW  65

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              FQ GFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+
Sbjct  66   GCFQAGFGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRSRSRKPVEL  121



>gb|KHN17714.1| hypothetical protein glysoja_005911 [Glycine soja]
Length=376

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 105/158 (66%), Gaps = 17/158 (11%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+R+     S  L    PQH+GWNY
Sbjct  10   RFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRTTHLDSSRLL----PQHFGWNY  65

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
              MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+   K +
Sbjct  66   LPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEVL--KTT  123

Query  598  P-----NHNNNYPVTVPSFQ------FPATASCDQNRF  678
            P     N + + P T+ S        FP T S   + +
Sbjct  124  PMTAATNTDASTPTTILSITKNSPVLFPTTHSLSHDTY  161



>gb|KDO53514.1| hypothetical protein CISIN_1g023105mg [Citrus sinensis]
Length=287

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldss----lssklllHQPQHY  405
            R PFT  QWQELEHQALI+KYMVSG+PVPPDLL++I+RS         ++K   HQ QH 
Sbjct  13   RFPFTASQWQELEHQALIFKYMVSGIPVPPDLLFTIKRSYYFDRSPPSAAKHFTHQHQHV  72

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
             WN FQ+G G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+ +
Sbjct  73   EWNCFQVGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVELNT  132

Query  586  HKNSPNHNNNYPVTVPSFQFPATASCDQNRFLLIPKS*ALVFCSILCLFDW  738
               + N +++    +  + +      D++ F   P      F ++     W
Sbjct  133  STCTANKSSS---ALSRYVYGPKEEVDEHAFFSEPSGKVRSFSAVSMDDSW  180



>gb|KHN39631.1| hypothetical protein glysoja_020709 [Glycine soja]
Length=373

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 8/143 (6%)
 Frame = +1

Query  217  MMS---GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MMS   G R+R PFT  QWQELE QAL++KYMV+G P+PPDL+YSI+RSLD+S+SS+L  
Sbjct  1    MMSASAGARNRSPFTQTQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRLFP  60

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
            H P   GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  61   HHP--IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  118

Query  568  PVEIQSHKNSPNHNNNYPVTVPS  636
            PVE+ S  ++     N   T+PS
Sbjct  119  PVEVSSATSTA---TNTSQTIPS  138



>ref|XP_008344036.1| PREDICTED: growth-regulating factor 1-like isoform X3 [Malus 
domestica]
Length=365

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +1

Query  217  MMSGGR-SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslss---kll  384
            M S GR SR PFT  QWQELEHQALIYKYMVSG+ +PPDLL+S++RS  +  S    KL 
Sbjct  1    MNSTGRNSRFPFTPTQWQELEHQALIYKYMVSGISIPPDLLFSLKRSTYNLDSPLPPKLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
             H P H GWN FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSR
Sbjct  61   SHHPPHIGWNCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCEKHMHRGKNRSR  120

Query  565  KPVEI  579
            KPVE+
Sbjct  121  KPVEV  125



>ref|XP_008344034.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Malus 
domestica]
 ref|XP_008344035.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Malus 
domestica]
Length=367

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +1

Query  217  MMSGGR-SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslss---kll  384
            M S GR SR PFT  QWQELEHQALIYKYMVSG+ +PPDLL+S++RS  +  S    KL 
Sbjct  1    MNSTGRNSRFPFTPTQWQELEHQALIYKYMVSGISIPPDLLFSLKRSTYNLDSPLPPKLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
             H P H GWN FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSR
Sbjct  61   SHHPPHIGWNCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCEKHMHRGKNRSR  120

Query  565  KPVEI  579
            KPVE+
Sbjct  121  KPVEV  125



>ref|XP_004144026.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 ref|XP_004161107.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 gb|KGN66287.1| hypothetical protein Csa_1G595880 [Cucumis sativus]
Length=333

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQPQH  402
              RS  PFT  QWQELEHQALI+KYMVSG+P+PP+LL+SI+RS   S  +  L  H PQ 
Sbjct  2    SARSMFPFTSAQWQELEHQALIFKYMVSGIPIPPELLFSIKRSALDSPFTSKLFPHHPQP  61

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI-  579
             GWNY QM  G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV++ 
Sbjct  62   VGWNYLQMSLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVDVL  121

Query  580  -QSHKNSPNHNNN  615
              +  N  NH +N
Sbjct  122  KTTATNDINHLSN  134



>gb|KHN07909.1| hypothetical protein glysoja_032453 [Glycine soja]
Length=382

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+R+     S  L  H PQH+GWNY
Sbjct  10   RFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRTTHLDSSRLLP-HHPQHFGWNY  68

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  69   LPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  122



>ref|XP_006593944.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Glycine 
max]
Length=384

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+R+     S  L  H PQH+GWNY
Sbjct  10   RFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRTTHLDSSRLLP-HHPQHFGWNY  68

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  69   LPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  122



>ref|XP_003541304.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Glycine 
max]
Length=382

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELEHQALIYKYM SG+ +PPDLL++I+R+     S  L  H PQH+GWNY
Sbjct  10   RFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRTTHLDSSRLLP-HHPQHFGWNY  68

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  69   LPMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  122



>ref|XP_011035717.1| PREDICTED: growth-regulating factor 5-like [Populus euphratica]
Length=340

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGW  411
            R+R PFT  QWQELEHQALIYKYMVSG+PVPP+LLYS++RSL SSL+S+L  HQP   GW
Sbjct  8    RNRFPFTATQWQELEHQALIYKYMVSGVPVPPELLYSVKRSLGSSLASRLFPHQP--IGW  65

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
              FQ GFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  66   GCFQAGFGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRSRSRKPVE  120



>ref|XP_008242218.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Prunus 
mume]
Length=377

 Score =   157 bits (398),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHY  405
             GR+R PFT  QWQELEHQALIYKYMVSG+ +PPDLL+SI+RS   S     L   P H 
Sbjct  2    SGRTRFPFTPSQWQELEHQALIYKYMVSGISIPPDLLFSIKRSCLDSPLPSKLFSHPPHI  61

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            GW+ FQMG G+K+DPEPGRCRRTDGKKWRCS++   D KYCERH H+ + RSRKPVE+  
Sbjct  62   GWSCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAFADSKYCERHMHRGKNRSRKPVEVFK  121

Query  586  HKNSPNHNNNYPV  624
               + N N + P 
Sbjct  122  TPITTNSNPSSPT  134



>ref|XP_006490823.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Citrus 
sinensis]
Length=291

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldss----lssklllHQPQHY  405
            R PFT  QWQELEHQALI+KYMVSG+PVPPDLL++I+RS         ++K   HQ QH 
Sbjct  13   RFPFTASQWQELEHQALIFKYMVSGIPVPPDLLFTIKRSYYFDRSPPSAAKHFTHQHQHV  72

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
             WN FQ+G G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+ +
Sbjct  73   EWNCFQVGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVELNT  132

Query  586  HKNSPNHNNN  615
               + N +++
Sbjct  133  STCTANKSSS  142



>ref|XP_011009586.1| PREDICTED: growth-regulating factor 1-like [Populus euphratica]
Length=384

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 12/143 (8%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            +MSGG +R  FT  QWQELEHQALIYKYMVSG+P+PPDLL++I+RS+    S+      P
Sbjct  2    IMSGG-NRFLFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIKRSVCLDSSNLFPRQHP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H+ W+ FQMG G+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   -HFAWSCFQMGLGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  119

Query  577  I--QSHKNSP--------NHNNN  615
            +  Q+   SP        NH+NN
Sbjct  120  VATQTQSTSPPTVSSITRNHSNN  142



>ref|XP_010654438.1| PREDICTED: growth-regulating factor 1-like [Vitis vinifera]
 ref|XP_010654439.1| PREDICTED: growth-regulating factor 1-like [Vitis vinifera]
 ref|XP_010654440.1| PREDICTED: growth-regulating factor 1-like [Vitis vinifera]
 emb|CBI35876.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 101/126 (80%), Gaps = 2/126 (2%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            MM   R+R PFT  QWQELEHQALI+KY+VSG+P+P DL+ +++RSLDSSLSS+L  HQP
Sbjct  1    MMMSARNRSPFTASQWQELEHQALIFKYIVSGVPIPADLICTVKRSLDSSLSSRLFPHQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  FQMGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   --IGWGCFQMGFGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  118

Query  577  IQSHKN  594
            + S  N
Sbjct  119  VISATN  124



>ref|XP_006451560.1| hypothetical protein CICLE_v10008922mg [Citrus clementina]
 ref|XP_006490822.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR64800.1| hypothetical protein CICLE_v10008922mg [Citrus clementina]
Length=322

 Score =   155 bits (391),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldss----lssklllHQPQHY  405
            R PFT  QWQELEHQALI+KYMVSG+PVPPDLL++I+RS         ++K   HQ QH 
Sbjct  13   RFPFTASQWQELEHQALIFKYMVSGIPVPPDLLFTIKRSYYFDRSPPSAAKHFTHQHQHV  72

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
             WN FQ+G G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+ +
Sbjct  73   EWNCFQVGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVELNT  132

Query  586  HKNSPNHNNN  615
               + N +++
Sbjct  133  STCTANKSSS  142



>ref|XP_002521329.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40997.1| conserved hypothetical protein [Ricinus communis]
Length=340

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 100/119 (84%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            +  R+R PFT  QWQELEHQALIYKYMVSG+P+PP+L+++++RSL+SSL+S+L  HQP  
Sbjct  5    TSTRNRSPFTPSQWQELEHQALIYKYMVSGIPIPPELIFTVKRSLESSLASRLFPHQP--  62

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
             GW  FQ+GFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+
Sbjct  63   IGWGCFQVGFGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEL  121



>gb|KEH37559.1| growth-regulating factor-like protein [Medicago truncatula]
Length=357

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll--lHQPQH  402
             +++ PFT  QWQELEHQALIYKYM SG+ +PPDLL++IR+S   S  S  L    Q QH
Sbjct  2    NKNKFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIRKSYLDSPLSSRLFPSQQHQH  61

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            +GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  62   FGWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  120



>gb|KEH37561.1| growth-regulating factor-like protein [Medicago truncatula]
Length=356

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll--lHQPQHY  405
            +++ PFT  QWQELEHQALIYKYM SG+ +PPDLL++IR+S   S  S  L    Q QH+
Sbjct  3    KNKFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIRKSYLDSPLSSRLFPSQQHQHF  62

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  63   GWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  120



>gb|KEH37560.1| growth-regulating factor-like protein [Medicago truncatula]
Length=356

 Score =   155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll--lHQPQHY  405
            +++ PFT  QWQELEHQALIYKYM SG+ +PPDLL++IR+S   S  S  L    Q QH+
Sbjct  3    KNKFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIRKSYLDSPLSSRLFPSQQHQHF  62

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  63   GWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEV  120



>ref|XP_009361694.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=367

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +1

Query  217  MMSGGR-SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslss---kll  384
            M S GR SR PFT  QWQELEHQALIYKYMVSG+ +PPDLL+S++RS  +  S    KL 
Sbjct  1    MNSTGRNSRFPFTPSQWQELEHQALIYKYMVSGISIPPDLLFSLKRSTYNLDSPLPPKLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
             H P   GWN FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSR
Sbjct  61   SHHPPQIGWNCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKNRSR  120

Query  565  KPVEI  579
            KPVE+
Sbjct  121  KPVEV  125



>ref|XP_009361693.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=369

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +1

Query  217  MMSGGR-SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslss---kll  384
            M S GR SR PFT  QWQELEHQALIYKYMVSG+ +PPDLL+S++RS  +  S    KL 
Sbjct  1    MNSTGRNSRFPFTPSQWQELEHQALIYKYMVSGISIPPDLLFSLKRSTYNLDSPLPPKLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
             H P   GWN FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSR
Sbjct  61   SHHPPQIGWNCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKNRSR  120

Query  565  KPVEI  579
            KPVE+
Sbjct  121  KPVEV  125



>emb|CDP03099.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +1

Query  241  LPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY-  417
             PFT  QWQELEHQALI+KYMVSG PVPPDLLY++RRSLDSSLSSKLL HQPQ  GWN  
Sbjct  14   FPFTASQWQELEHQALIFKYMVSGTPVPPDLLYTVRRSLDSSLSSKLLFHQPQ-LGWNSC  72

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            FQMGFG+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q
Sbjct  73   FQMGFGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEQQ  127



>ref|XP_007204778.1| hypothetical protein PRUPE_ppa015791mg, partial [Prunus persica]
 gb|EMJ05977.1| hypothetical protein PRUPE_ppa015791mg, partial [Prunus persica]
Length=377

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldssls-sklllHQPQH  402
             GR+R PFT  QWQELEHQALIYKYMVSG+ +PPDLL+SI+RS   S   SKL  H P H
Sbjct  2    SGRTRFPFTPSQWQELEHQALIYKYMVSGISIPPDLLFSIKRSCLDSPLPSKLFSHHPPH  61

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
             GW+ FQMG G+K+DPEPGRCRRTDGKKWRCS++   D KYCERH H+ + RSRKPVE+
Sbjct  62   IGWSCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAFADSKYCERHMHRGKNRSRKPVEV  120



>ref|XP_010273921.1| PREDICTED: growth-regulating factor 1 isoform X2 [Nelumbo nucifera]
Length=372

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            M   R+  PFT  QWQELEHQALI+KYMVSG+PVPP+L++ I+RSLD+S+SS+L  HQP 
Sbjct  1    MMSARNGSPFTASQWQELEHQALIFKYMVSGVPVPPELIFPIKRSLDASISSRLFPHQP-  59

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              GW  FQMGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+
Sbjct  60   -IGWGCFQMGFGRKPDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGRNRSRKPVEV  118



>ref|XP_009372336.1| PREDICTED: growth-regulating factor 5 isoform X2 [Pyrus x bretschneideri]
Length=330

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = +1

Query  217  MMSG-----GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskl  381
            MMSG      R+R PFT  QWQELEHQALI+KYM SG+P+P DL+YS +R LDSS+SS+L
Sbjct  1    MMSGNPSSAARNRYPFTATQWQELEHQALIFKYMASGVPIPNDLVYSFKRRLDSSISSRL  60

Query  382  llHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRS  561
              H P   GW  ++MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RS
Sbjct  61   FPHHPM--GWGCYEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRS  118

Query  562  RKPVEI  579
            RKPVE+
Sbjct  119  RKPVEV  124



>ref|XP_004303687.1| PREDICTED: growth-regulating factor 5-like [Fragaria vesca subsp. 
vesca]
Length=328

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 98/127 (77%), Gaps = 8/127 (6%)
 Frame = +1

Query  217  MMSGG------RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk  378
            MMSGG        R PFT  QWQELEHQALI+KYMVSG+PVP DL+YS +R LDSS+SS+
Sbjct  1    MMSGGSPSSARNFRYPFTATQWQELEHQALIFKYMVSGVPVPTDLVYSFKRRLDSSMSSR  60

Query  379  lllHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPR  558
            L  H P  +GW  + MGFG+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R R
Sbjct  61   LFPHHP--FGWGCYDMGFGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNR  118

Query  559  SRKPVEI  579
            SRKPVE 
Sbjct  119  SRKPVEA  125



>ref|XP_009372335.1| PREDICTED: growth-regulating factor 5 isoform X1 [Pyrus x bretschneideri]
Length=347

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = +1

Query  217  MMSG-----GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskl  381
            MMSG      R+R PFT  QWQELEHQALI+KYM SG+P+P DL+YS +R LDSS+SS+L
Sbjct  1    MMSGNPSSAARNRYPFTATQWQELEHQALIFKYMASGVPIPNDLVYSFKRRLDSSISSRL  60

Query  382  llHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRS  561
              H P   GW  ++MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RS
Sbjct  61   FPHHPM--GWGCYEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRS  118

Query  562  RKPVEI  579
            RKPVE+
Sbjct  119  RKPVEV  124



>ref|XP_007024621.1| Growth-regulating factor 5, putative [Theobroma cacao]
 gb|EOY27243.1| Growth-regulating factor 5, putative [Theobroma cacao]
Length=357

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 2/122 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            M   R+R PFT  QWQELEHQALI+KYMVSG+P+PP+L+YS++RSLDSSL+S+L  HQP 
Sbjct  1    MISARNRSPFTPTQWQELEHQALIFKYMVSGVPIPPELIYSVKRSLDSSLASRLFPHQP-  59

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              GW  FQ+GFG+K DPEPGRCRRTDGKKWRCS++  P+ KYCERH H+ R RSRKPVE+
Sbjct  60   -IGWGCFQVGFGRKADPEPGRCRRTDGKKWRCSKEAYPESKYCERHMHRGRNRSRKPVEV  118

Query  580  QS  585
             S
Sbjct  119  NS  120



>ref|XP_008391391.1| PREDICTED: growth-regulating factor 5 [Malus domestica]
Length=325

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            S  R+R PFT  QWQELEHQALI+KYM SG+P+P DL+YS +R LDSS+SS+L  H P  
Sbjct  8    SAARNRYPFTATQWQELEHQALIFKYMASGVPIPNDLVYSFKRRLDSSISSRLFPHHPM-  66

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
             GW  ++MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+
Sbjct  67   -GWGCYEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV  124



>ref|XP_004148588.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 gb|KGN58502.1| hypothetical protein Csa_3G651860 [Cucumis sativus]
Length=351

 Score =   154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QWQELEHQALI+K+MVSG+P+PPDL++S++RSLDSS+S++L  HQP   GW  F+
Sbjct  11   PFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLFPHQP--IGWGCFE  68

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            MGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVEI S
Sbjct  69   MGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEISS  122



>ref|XP_004287622.1| PREDICTED: growth-regulating factor 1-like [Fragaria vesca subsp. 
vesca]
Length=369

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +1

Query  223  SGGRS-RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            S GR  R PFT  QWQELEHQALIYKYMVSG+P+PPDLL+SI+RS   S      L  P 
Sbjct  6    SAGRGMRFPFTPSQWQELEHQALIYKYMVSGIPIPPDLLFSIKRSCLDSPPLSSKLFSP-  64

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
            H GWN FQMG G+KIDPEPGRCRRTDGKKWRCS++   D KYCERH H+ + RSRKPVE+
Sbjct  65   HIGWNCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYADSKYCERHMHRGKNRSRKPVEV  124



>ref|XP_008463996.1| PREDICTED: growth-regulating factor 5 isoform X2 [Cucumis melo]
Length=342

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QWQELEHQALI+K+MVSG+P+PPDL++S++RSLDSS+S++L  HQP   GW  F+
Sbjct  11   PFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLFPHQP--IGWGCFE  68

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            MGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVEI S
Sbjct  69   MGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEISS  122



>ref|XP_008463995.1| PREDICTED: growth-regulating factor 5 isoform X1 [Cucumis melo]
Length=350

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QWQELEHQALI+K+MVSG+P+PPDL++S++RSLDSS+S++L  HQP   GW  F+
Sbjct  11   PFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLFPHQP--IGWGCFE  68

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            MGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVEI S
Sbjct  69   MGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEISS  122



>gb|KDP33905.1| hypothetical protein JCGZ_07476 [Jatropha curcas]
Length=399

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQP  396
            M    ++ PFT  QWQELEHQALI+KYMVSG+P+P DLL++I+RS   S  S  L   QP
Sbjct  1    MMSETAKFPFTASQWQELEHQALIFKYMVSGIPIPSDLLFTIKRSCLDSPLSSKLFPRQP  60

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             H GW+ FQMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  61   SHIGWSCFQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  120

Query  577  IQSHKNSPN  603
            + +   + N
Sbjct  121  VPTQTVTAN  129



>ref|XP_010273920.1| PREDICTED: growth-regulating factor 1 isoform X1 [Nelumbo nucifera]
Length=423

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            M   R+  PFT  QWQELEHQALI+KYMVSG+PVPP+L++ I+RSLD+S+SS+L  HQP 
Sbjct  1    MMSARNGSPFTASQWQELEHQALIFKYMVSGVPVPPELIFPIKRSLDASISSRLFPHQP-  59

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              GW  FQMGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+
Sbjct  60   -IGWGCFQMGFGRKPDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGRNRSRKPVEV  118



>ref|XP_004141176.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 ref|XP_004157965.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
 gb|KGN60508.1| hypothetical protein Csa_2G000170 [Cucumis sativus]
Length=319

 Score =   152 bits (385),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 107/153 (70%), Gaps = 12/153 (8%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll-HQ-PQ  399
              R+R PFT  QWQELEHQALI+KYMVSG+P+PP+LLYSI+ +   +     L  HQ PQ
Sbjct  2    SARNRFPFTAAQWQELEHQALIFKYMVSGVPIPPELLYSIKATSLDTPFISRLFPHQYPQ  61

Query  400  --HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
                GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV
Sbjct  62   VSAVGWNYLQMGSGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPV  121

Query  574  EIQSHKNSPNHNNNYPVTVPSFQFPATASCDQN  672
            E Q  K +P +++N P T      PA +S   N
Sbjct  122  E-QVLKTTPLNSSN-PST------PAISSITHN  146



>ref|XP_010534927.1| PREDICTED: growth-regulating factor 5 [Tarenaya hassleriana]
Length=336

 Score =   152 bits (385),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 112/148 (76%), Gaps = 2/148 (1%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            SG   R PFT IQWQELEHQAL+YKYMVSG+PVPP+L++SIRRSLDSS +++LL HQP  
Sbjct  9    SGRSERPPFTPIQWQELEHQALVYKYMVSGVPVPPELVFSIRRSLDSSFAARLLPHQP--  66

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GW  FQMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK +E  
Sbjct  67   FGWGCFQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLESP  126

Query  583  SHKNSPNHNNNYPVTVPSFQFPATASCD  666
            +  +  N ++N     P+    +++S D
Sbjct  127  TALSFTNSSSNKSFPSPNLSSSSSSSVD  154



>ref|XP_010261922.1| PREDICTED: growth-regulating factor 1-like [Nelumbo nucifera]
Length=372

 Score =   153 bits (387),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHY  405
              RS  PFT  QWQELEHQALI+KYMVSG+P+PPDL++ I+RS+D+S+SS+L  HQP   
Sbjct  2    SARSGSPFTASQWQELEHQALIFKYMVSGVPIPPDLIFPIKRSMDASVSSRLFSHQP--I  59

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            GW  FQM F +K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE+ +
Sbjct  60   GWGCFQMSFSRKADPEPGRCRRTDGKKWRCSKEACPDSKYCERHMHRGRNRSRKPVEVIT  119

Query  586  HKNS  597
               S
Sbjct  120  ANTS  123



>ref|XP_004165889.1| PREDICTED: growth-regulating factor 5-like [Cucumis sativus]
Length=383

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QWQELEHQALI+K+MVSG+P+PPDL++S++RSLDSS+S++L  HQP   GW  F+
Sbjct  11   PFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVKRSLDSSISARLFPHQP--IGWGCFE  68

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            MGFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVEI S
Sbjct  69   MGFGRKTDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEISS  122



>ref|XP_004513476.1| PREDICTED: growth-regulating factor 1-like [Cicer arietinum]
Length=352

 Score =   152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll----lHQP  396
             ++R PFT  QWQELEHQAL+YKYM SG+ +PPDLL++IRRS   S            Q 
Sbjct  2    NKNRFPFTPSQWQELEHQALVYKYMASGISIPPDLLFTIRRSFFDSPLISSTLLPNQTQQ  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            QH+GWNY QMG G+KIDPEPGRCRRTDGKKWRCS++   D KYCERH H+ + RSRKPVE
Sbjct  62   QHFGWNYLQMGIGRKIDPEPGRCRRTDGKKWRCSKEAYQDSKYCERHMHRGKNRSRKPVE  121

Query  577  I  579
            +
Sbjct  122  V  122



>ref|XP_011036429.1| PREDICTED: growth-regulating factor 5-like [Populus euphratica]
Length=339

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            +  R+ L FT  QW ELEHQALIYKYMVSG+PVPP+LLYS++RSL+SSL+S+L  HQP  
Sbjct  5    TSARNSLLFTATQWHELEHQALIYKYMVSGVPVPPELLYSVKRSLESSLASRLFPHQPT-  63

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
             GW  FQ G G+K DPEPGRCRRTDGKKWRCS++V PD KYCERH H+ R RSRKPVE+
Sbjct  64   -GWVCFQAGVGRKADPEPGRCRRTDGKKWRCSKEVYPDSKYCERHMHRGRNRSRKPVEL  121



>ref|XP_008242216.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Prunus 
mume]
Length=381

 Score =   152 bits (383),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 96/137 (70%), Gaps = 4/137 (3%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH-  402
             GR+R PFT  QWQELEHQALIYKYMVSG+ +PPDLL+SI+RS   S     L   P H 
Sbjct  2    SGRTRFPFTPSQWQELEHQALIYKYMVSGISIPPDLLFSIKRSCLDSPLPSKLFSHPPHS  61

Query  403  ---YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
                GW+ FQMG G+K+DPEPGRCRRTDGKKWRCS++   D KYCERH H+ + RSRKPV
Sbjct  62   KPTIGWSCFQMGLGRKVDPEPGRCRRTDGKKWRCSKEAFADSKYCERHMHRGKNRSRKPV  121

Query  574  EIQSHKNSPNHNNNYPV  624
            E+     + N N + P 
Sbjct  122  EVFKTPITTNSNPSSPT  138



>ref|XP_003627270.1| GRL2 [Medicago truncatula]
Length=231

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  R+R  FT  QWQELE QAL++KYMV+G P+PPDL+YSI+RSLD+S+SS++  H P
Sbjct  2    MSASSRNRSLFTPNQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRIFPHPP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   --IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119

Query  577  I  579
            +
Sbjct  120  L  120



>emb|CDX71979.1| BnaC08g28950D [Brassica napus]
Length=385

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 105/137 (77%), Gaps = 10/137 (7%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELEHQALIYKYMVSG+PVPPDL++SIRRSLDSSL S+LL HQP   GW  
Sbjct  14   RPPFTPTQWQELEHQALIYKYMVSGVPVPPDLIFSIRRSLDSSLVSRLLPHQP--LGWGC  71

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++ QS   +
Sbjct  72   YQMGFGRKQDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKSID-QSQTTA  130

Query  598  PNHNNNYPVTVPSFQFP  648
                   P+T PS  FP
Sbjct  131  -------PLTSPSLSFP  140



>ref|XP_002303244.2| hypothetical protein POPTR_0003s06360g [Populus trichocarpa]
 gb|EEE78223.2| hypothetical protein POPTR_0003s06360g [Populus trichocarpa]
Length=340

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            +  R+ L FT  QW ELEHQALIYKYMVSG+PVPP+LLYS++RSL+SSL+S+L  HQP  
Sbjct  5    TSARNSLLFTATQWHELEHQALIYKYMVSGVPVPPELLYSVKRSLESSLASRLFPHQPT-  63

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
             GW  FQ G G+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE+
Sbjct  64   -GWGCFQAGVGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEL  121



>ref|XP_009413829.1| PREDICTED: growth-regulating factor 1-like, partial [Musa acuminata 
subsp. malaccensis]
Length=141

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 2/139 (1%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M+ GG SR PFT  QWQELE QALI+KYMVSG+PVPPDL+  IRRSL     +   L   
Sbjct  4    MVVGGGSRYPFTASQWQELELQALIFKYMVSGIPVPPDLILCIRRSLFVEPQTLPFLPHR  63

Query  397  QHYGWNYFQMGFGKK-IDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
               GW  +Q+G G+K +DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV
Sbjct  64   PTVGWEAYQVGDGRKAVDPEPGRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKSRSRKPV  123

Query  574  EIQSHKNSPNHNNNYPVTV  630
            E+ S   +P  ++  P T 
Sbjct  124  EL-SLATTPISSHFPPPTA  141



>emb|CDY39081.1| BnaA01g29750D [Brassica napus]
Length=398

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 108/144 (75%), Gaps = 12/144 (8%)
 Frame = +1

Query  223  SGGR--SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR   R PFT  QWQELEHQALIYKYMVSG+PVPPDL++SIRRSLDSSL S+LL HQP
Sbjct  7    SSGRPIGRPPFTPTQWQELEHQALIYKYMVSGVPVPPDLIFSIRRSLDSSLVSRLLPHQP  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++
Sbjct  67   --LGWGCYQMGFGRKQDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKSID  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
             QS   +       P+T PS  FP
Sbjct  125  -QSQTAA-------PLTSPSLSFP  140



>ref|XP_010465271.1| PREDICTED: growth-regulating factor 5-like [Camelina sativa]
Length=409

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 106/144 (74%), Gaps = 11/144 (8%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R PFT  QWQELEHQALIYKYMVSG+PVPP+L++SIRRSLDS+L S+LL HQ 
Sbjct  7    SSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELIFSIRRSLDSALVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  67   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
                    N     P+T PS  FP
Sbjct  125  -------QNQTTTNPLTSPSLSFP  141



>ref|XP_004510466.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Cicer 
arietinum]
Length=354

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  R+R PFT  QWQELE QAL++KYMV+G P+P DL++SI+RSLD+S+SS++  H P
Sbjct  2    MSASSRNRSPFTPNQWQELEQQALVFKYMVTGTPIPSDLIFSIKRSLDTSISSRIFPHHP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   --IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119



>ref|XP_004510465.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Cicer 
arietinum]
Length=356

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  R+R PFT  QWQELE QAL++KYMV+G P+P DL++SI+RSLD+S+SS++  H P
Sbjct  2    MSASSRNRSPFTPNQWQELEQQALVFKYMVTGTPIPSDLIFSIKRSLDTSISSRIFPHHP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   --IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119



>gb|AET01746.2| growth-regulating factor-like protein [Medicago truncatula]
Length=348

 Score =   147 bits (371),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M +  R+R  FT  QWQELE QAL++KYMV+G P+PPDL+YSI+RSLD+S+SS++  H P
Sbjct  2    MSASSRNRSLFTPNQWQELEQQALVFKYMVTGTPIPPDLIYSIKRSLDTSISSRIFPHPP  61

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  F+MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  62   --IGWGCFEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119

Query  577  I  579
            +
Sbjct  120  L  120



>ref|XP_007214861.1| hypothetical protein PRUPE_ppa017593mg [Prunus persica]
 gb|EMJ16060.1| hypothetical protein PRUPE_ppa017593mg [Prunus persica]
Length=363

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = +1

Query  217  MMSG----GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll  384
            M+SG     R+R PFT  QWQELEHQALI+KYM SG+P+P DL+YS++R LD+S+SS+L 
Sbjct  1    MLSGNPNTARNRYPFTPNQWQELEHQALIFKYMASGIPIPTDLVYSLKRRLDNSISSRLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
               P   GW  ++MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSR
Sbjct  61   ---PHPMGWGCYEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSR  117

Query  565  KPVEI  579
            KPVE+
Sbjct  118  KPVEV  122



>ref|XP_008228199.1| PREDICTED: growth-regulating factor 5 isoform X2 [Prunus mume]
Length=363

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = +1

Query  217  MMSG----GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll  384
            M+SG     R+R PFT  QWQELEHQALI+KYM SG+P+P DL++S++R LD+S+SS+L 
Sbjct  1    MLSGNPNTARNRYPFTPNQWQELEHQALIFKYMASGIPIPTDLVFSLKRRLDNSISSRLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
               P   GW  ++MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSR
Sbjct  61   ---PHPMGWGCYEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSR  117

Query  565  KPVEI  579
            KPVE+
Sbjct  118  KPVEV  122



>ref|XP_008228198.1| PREDICTED: growth-regulating factor 5 isoform X1 [Prunus mume]
Length=364

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = +1

Query  217  MMSG----GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskll  384
            M+SG     R+R PFT  QWQELEHQALI+KYM SG+P+P DL++S++R LD+S+SS+L 
Sbjct  1    MLSGNPNTARNRYPFTPNQWQELEHQALIFKYMASGIPIPTDLVFSLKRRLDNSISSRLF  60

Query  385  lHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
               P   GW  ++MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSR
Sbjct  61   ---PHPMGWGCYEMGFGRKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSR  117

Query  565  KPVEI  579
            KPVE+
Sbjct  118  KPVEV  122



>emb|CDX97531.1| BnaA05g25480D [Brassica napus]
Length=388

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 109/150 (73%), Gaps = 16/150 (11%)
 Frame = +1

Query  217  MMS----GGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk  378
            MMS    GGR+  R PFT  QWQELE+QALIYKYMVSG+PVPP+L++SIRRSLDSSL S+
Sbjct  1    MMSLSGNGGRTIERPPFTPTQWQELENQALIYKYMVSGVPVPPELIFSIRRSLDSSLVSR  60

Query  379  lllHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPR  558
            LL HQ    GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R
Sbjct  61   LLPHQS--IGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNR  118

Query  559  SRKPVEIQSHKNSPNHNNNYPVTVPSFQFP  648
            +RK ++         +    P+T PS  FP
Sbjct  119  ARKSID--------QNQTTAPLTSPSLSFP  140



>emb|CDY55209.1| BnaCnng28460D [Brassica napus]
Length=390

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 109/150 (73%), Gaps = 16/150 (11%)
 Frame = +1

Query  217  MMS----GGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk  378
            MMS    GGR+  R PFT  QWQELE+QALIYKYMVSG+PVPP+L++SIRRSLDSSL S+
Sbjct  1    MMSLSGNGGRTIERPPFTPTQWQELENQALIYKYMVSGVPVPPELIFSIRRSLDSSLVSR  60

Query  379  lllHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPR  558
            LL HQ    GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R
Sbjct  61   LLPHQS--IGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNR  118

Query  559  SRKPVEIQSHKNSPNHNNNYPVTVPSFQFP  648
            +RK ++         +    P+T PS  FP
Sbjct  119  ARKSID--------QNQTTAPLTSPSLSFP  140



>ref|XP_006426651.1| hypothetical protein CICLE_v10025855mg [Citrus clementina]
 gb|ESR39891.1| hypothetical protein CICLE_v10025855mg [Citrus clementina]
Length=378

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  Q QELEHQALI+KYMVSG+P+PP+L+YS++RSLDSSL S L   Q  H GW  
Sbjct  20   RSPFTPTQLQELEHQALIFKYMVSGVPIPPELIYSVKRSLDSSLVSSLFPPQAPHVGWGC  79

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            FQ+GFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+
Sbjct  80   FQVGFGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEAQA  135



>gb|KDO65037.1| hypothetical protein CISIN_1g047108mg [Citrus sinensis]
Length=378

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  Q QELEHQALI+KYMVSG+P+PP+L+YS++RSLDSSL S L   Q  H GW  
Sbjct  20   RSPFTPTQLQELEHQALIFKYMVSGVPIPPELIYSVKRSLDSSLVSSLFPPQAPHVGWGC  79

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            FQ+GFG+K DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+
Sbjct  80   FQVGFGRKADPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEAQA  135



>ref|XP_006297825.1| hypothetical protein CARUB_v10013860mg [Capsella rubella]
 gb|EOA30723.1| hypothetical protein CARUB_v10013860mg [Capsella rubella]
Length=403

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 108/150 (72%), Gaps = 16/150 (11%)
 Frame = +1

Query  217  MMS----GGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk  378
            MMS     GR+  R PFT  QWQELEHQALIYKYMVSG+PVPP+L++SIRRSLDS+L S+
Sbjct  1    MMSLSGNSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELIFSIRRSLDSTLVSR  60

Query  379  lllHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPR  558
            LL HQ    GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R
Sbjct  61   LLPHQS--LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNR  118

Query  559  SRKPVEIQSHKNSPNHNNNYPVTVPSFQFP  648
            +RK ++         +    P+T PS  FP
Sbjct  119  ARKSLD--------QNQTTTPLTSPSLSFP  140



>ref|XP_009117339.1| PREDICTED: LOW QUALITY PROTEIN: growth-regulating factor 5-like 
[Brassica rapa]
Length=393

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 106/144 (74%), Gaps = 12/144 (8%)
 Frame = +1

Query  223  SGGR--SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR   R PFT   WQELEHQALIYKYMVSG+PVPPDL++SIRRSLDS L S+LL HQP
Sbjct  7    SSGRPIGRPPFTPTXWQELEHQALIYKYMVSGVPVPPDLIFSIRRSLDSFLVSRLLPHQP  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++
Sbjct  67   --LGWGCYQMGFGRKQDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKSID  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
             QS   +       P+T PS  FP
Sbjct  125  -QSQTAA-------PLTSPSLSFP  140



>ref|XP_009414810.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=372

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            MM GG SR PFT  QWQELE QAL++KYMVSG+PVP DL+  IRRSL     +   +  P
Sbjct  1    MMMGGGSRYPFTASQWQELELQALVFKYMVSGIPVPSDLILCIRRSLFMDPQALPFIPNP  60

Query  397  QHYGWNYFQMGFGKK-IDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
               GW  +Q+G G+K +DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV
Sbjct  61   PTIGWGAYQLGDGRKPVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKSRSRKPV  120

Query  574  EIQSHKN  594
            E+    N
Sbjct  121  ELSLATN  127



>ref|XP_009414811.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            MM GG SR PFT  QWQELE QAL++KYMVSG+PVP DL+  IRRSL     +   +  P
Sbjct  1    MMMGGGSRYPFTASQWQELELQALVFKYMVSGIPVPSDLILCIRRSLFMDPQALPFIPNP  60

Query  397  QHYGWNYFQMGFGKK-IDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
               GW  +Q+G G+K +DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV
Sbjct  61   PTIGWGAYQLGDGRKPVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKSRSRKPV  120

Query  574  EIQSHKN  594
            E+    N
Sbjct  121  ELSLATN  127



>ref|XP_009146430.1| PREDICTED: growth-regulating factor 5-like [Brassica rapa]
Length=390

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 109/150 (73%), Gaps = 16/150 (11%)
 Frame = +1

Query  217  MMS----GGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk  378
            MMS    GGR+  R PFT  QWQELE+QALIYKYMVSG+PVPP+L++SIRRSLDSSL S+
Sbjct  1    MMSLSGNGGRTIERPPFTPTQWQELENQALIYKYMVSGVPVPPELIFSIRRSLDSSLVSR  60

Query  379  lllHQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPR  558
            LL HQ    GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R
Sbjct  61   LLPHQS--IGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNR  118

Query  559  SRKPVEIQSHKNSPNHNNNYPVTVPSFQFP  648
            +RK ++         +    P+T PS  FP
Sbjct  119  ARKSID--------QNQTTAPLTSPSLSFP  140



>gb|EYU25864.1| hypothetical protein MIMGU_mgv1a010559mg [Erythranthe guttata]
Length=309

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 102/159 (64%), Gaps = 21/159 (13%)
 Frame = +1

Query  217  MMS----GGRSRL-PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslsskl  381
            MMS    G  SR  PFT  QWQELEHQAL+YKYMV G+P+PPDLL++IRRSL    SS  
Sbjct  1    MMSNNNIGRSSRFNPFTPSQWQELEHQALVYKYMVYGIPIPPDLLFTIRRSLHHHHSSST  60

Query  382  llHQPQHYG--WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRP  555
                  H+   WN F MGFGKKIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R 
Sbjct  61   TFLLHHHHSGSWNSFNMGFGKKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRN  120

Query  556  RSRKPVEIQSHKNSPNHNNNYPVTVPSFQFPATASCDQN  672
            RSRKPVE               V +P     A + C++N
Sbjct  121  RSRKPVET--------------VLLPHSSTAANSPCNRN  145



>ref|XP_002882864.1| hypothetical protein ARALYDRAFT_478803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59123.1| hypothetical protein ARALYDRAFT_478803 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R PFT  QW+ELEHQALIYKYMVSG+PVPP+L++SIRRSLD+SL S+LL HQ 
Sbjct  7    SSGRTIGRPPFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRRSLDTSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  67   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQF  645
                    N     P+T PS  F
Sbjct  125  -------QNQTRTTPLTSPSLSF  140



>ref|XP_006375983.1| hypothetical protein POPTR_0013s07500g [Populus trichocarpa]
 gb|ERP53780.1| hypothetical protein POPTR_0013s07500g [Populus trichocarpa]
Length=340

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALIYKYMV+G+PVPPDL+  I+RS +S        H+  H+    
Sbjct  34   RSPFTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRSFESIS------HRFFHHPTMS  87

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  88   YCTFYGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQS  147

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  148  SSTVTSLTVTGSS  160



>ref|XP_011044430.1| PREDICTED: growth-regulating factor 4-like [Populus euphratica]
Length=340

 Score =   144 bits (362),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALIYKYMV+G+PVPPDL+  I+RS +S        H+  H+    
Sbjct  34   RSPFTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRSFESIS------HRFFHHPTMS  87

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  88   YCTFYGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQS  147

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  148  SSTVTSLTVTGSS  160



>ref|XP_008234521.1| PREDICTED: growth-regulating factor 4-like [Prunus mume]
Length=329

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALI+KYM++GMPVPPDL+  I++S +S        H P   G+  
Sbjct  23   RSPFTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQKSFESISQRLF--HHPT-MGYCS  79

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  80   F---YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQS  136

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  137  SSTVTSLTVTASS  149



>ref|XP_007219489.1| hypothetical protein PRUPE_ppa022199mg [Prunus persica]
 gb|EMJ20688.1| hypothetical protein PRUPE_ppa022199mg [Prunus persica]
Length=332

 Score =   143 bits (360),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALI+KYM++GMPVPPDL+  I++S +S        H P   G+  
Sbjct  25   RSPFTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQKSFESISQRFF--HHPT-MGYCS  81

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  82   F---YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQS  138

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  139  SSTVTSLTVTASS  151



>gb|KHN46482.1| hypothetical protein glysoja_035158 [Glycine soja]
Length=323

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            S GRS  PFTV QWQELEHQALI+KYMV+G+PVPPDL+  I++S DS+LS     H    
Sbjct  5    SNGRS--PFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKSFDSTLSHAFFHHPTLS  62

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            Y   Y     GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q
Sbjct  63   YCSFY-----GKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQ  117

Query  583  SHKNSPNHNNNYPVT  627
            +  +S +   +  VT
Sbjct  118  TMTHSSSTVTSLTVT  132



>ref|XP_003540042.1| PREDICTED: growth-regulating factor 4-like [Glycine max]
Length=327

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            S GRS  PFTV QWQELEHQALI+KYMV+G+PVPPDL+  I++S DS+LS     H    
Sbjct  15   SNGRS--PFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKSFDSTLSHAFFHHPTLS  72

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            Y   Y     GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q
Sbjct  73   YCSFY-----GKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQ  127

Query  583  SHKNSPNHNNNYPVT  627
            +  +S +   +  VT
Sbjct  128  TMTHSSSTVTSLTVT  142



>gb|KFK38750.1| hypothetical protein AALP_AA3G156000 [Arabis alpina]
Length=397

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QW+ELEHQALIYKYMVSG+PVPPDL+ SIRRSLDS+L S+LL HQ   +GW  
Sbjct  14   RPPFTPTQWRELEHQALIYKYMVSGVPVPPDLIVSIRRSLDSTLVSRLLPHQS--FGWGC  71

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  72   YQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  124



>ref|XP_003517558.1| PREDICTED: growth-regulating factor 4-like [Glycine max]
Length=318

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 95/137 (69%), Gaps = 4/137 (3%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHY  405
            G  S+ PFT+ QWQELEHQALIYKYMV+G+PVPPDL+  I+ S  S   + L  H     
Sbjct  7    GEMSKWPFTMSQWQELEHQALIYKYMVAGLPVPPDLVLPIQNSFHSISQTFLH-HPSTTM  65

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
             +  F   +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+
Sbjct  66   SYCSF---YGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQT  122

Query  586  HKNSPNHNNNYPVTVPS  636
               S ++ ++  VT  S
Sbjct  123  MTQSSSNVSSLTVTAGS  139



>ref|XP_011012401.1| PREDICTED: growth-regulating factor 4-like [Populus euphratica]
Length=336

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALIYKYMV+G+PVPPDL+  I+RS +S        H P   G+  
Sbjct  30   RSPFTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRSFESISHRFF--HHPA-MGYCT  86

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  87   F---YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQS  143

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  144  LSTVTSLTVTGSS  156



>ref|XP_003537666.1| PREDICTED: growth-regulating factor 4-like [Glycine max]
Length=308

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            S+ PFT+ QWQELEHQALIYKYMV+G+PVPPDL+  I+ S  S   + L  H      + 
Sbjct  2    SKWPFTISQWQELEHQALIYKYMVAGLPVPPDLVIPIQNSFHSISQTFLH-HPSTTMSYC  60

Query  415  YFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKN  594
             F   +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+   
Sbjct  61   SF---YGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMTQ  117

Query  595  SPNHNNNYPVTVPS  636
            S ++ ++  VT  S
Sbjct  118  SSSNVSSLTVTAGS  131



>gb|KHN34128.1| hypothetical protein glysoja_038617 [Glycine soja]
Length=310

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            S+ PFT+ QWQELEHQALIYKYMV+G+PVPPDL+  I+ S  S   + L  H      + 
Sbjct  2    SKWPFTMSQWQELEHQALIYKYMVAGLPVPPDLVLPIQNSFHSISQTFLH-HPSTTMSYC  60

Query  415  YFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKN  594
             F   +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+   
Sbjct  61   SF---YGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMTQ  117

Query  595  SPNHNNNYPVTVPS  636
            S ++ ++  VT  S
Sbjct  118  SSSNVSSLTVTAGS  131



>ref|XP_006407145.1| hypothetical protein EUTSA_v10020873mg [Eutrema salsugineum]
 gb|ESQ48598.1| hypothetical protein EUTSA_v10020873mg [Eutrema salsugineum]
Length=396

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 101/137 (74%), Gaps = 10/137 (7%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QW+ELEHQALIYKYMVSG+PVPP+L++SIRRSLDSSL S+LL HQ    GW  
Sbjct  14   RPPFTPTQWKELEHQALIYKYMVSGVPVPPELIFSIRRSLDSSLVSRLLPHQS--LGWGC  71

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++       
Sbjct  72   YQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD-------  124

Query  598  PNHNNNYPVTVPSFQFP  648
              +    P+  PS  FP
Sbjct  125  -QNQTTAPLKSPSLSFP  140



>ref|XP_010487179.1| PREDICTED: growth-regulating factor 5 [Camelina sativa]
Length=403

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 98/120 (82%), Gaps = 4/120 (3%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R PFT  QWQELEHQALIYKYMVSG+PVPP+L++SIRRSLDS+L S+LL HQ 
Sbjct  7    SSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELIFSIRRSLDSALVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  67   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  124



>ref|XP_010533032.1| PREDICTED: growth-regulating factor 6-like [Tarenaya hassleriana]
Length=330

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ----H  402
            SR+PFT  QW+ELEHQALI+KY+V+G+PVPPDLL+ IRR+L SS S        +    H
Sbjct  4    SRVPFTESQWEELEHQALIFKYIVAGVPVPPDLLFPIRRTLISSSSHLSSKFFSRAAAPH  63

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            + W  + MG G+KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  64   FSWYVYDMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  121



>ref|XP_010251960.1| PREDICTED: growth-regulating factor 2 [Nelumbo nucifera]
Length=581

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 95/141 (67%), Gaps = 9/141 (6%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELE QALIYKYM++ +PVPPDLL +I R+    ++S+  + +        
Sbjct  107  RFPFTSTQWQELERQALIYKYMMASVPVPPDLLMTISRNPSQPIASQSTMGRGA-----C  161

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F + F    DPEPGRCRRTDGKKWRCSRDV PDQKYCERH H+ RPRSRKPVE+Q+    
Sbjct  162  FNLRFSSSTDPEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVELQAEGED  221

Query  598  PN-HNNNYPVTVPSFQFPATA  657
             N  +NN P    +   PATA
Sbjct  222  NNIASNNAPSATST---PATA  239



>gb|KDP39549.1| hypothetical protein JCGZ_02569 [Jatropha curcas]
Length=340

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALI+KYM++G+PVPPDL+  I++S +S        H P   G+  
Sbjct  33   RSPFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKSFESISHRFF--HHPT-VGYCS  89

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  90   F---YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTITQS  146

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  147  SSTVTSLTVTGSS  159



>ref|XP_010541983.1| PREDICTED: growth-regulating factor 6 [Tarenaya hassleriana]
Length=303

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 84/122 (69%), Gaps = 7/122 (6%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPD-------llysirrsldsslssklllHQ  393
            +R+PFT  QW+ELEHQA+I+KY+V+G+PVPPD        L S   S     S       
Sbjct  4    TRVPFTESQWEELEHQAVIFKYIVAGVPVPPDLLFPIRRTLISSSSSSLHLSSKFFSHAS  63

Query  394  PQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
              H+ WN + MGFG+K+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPV
Sbjct  64   TPHFSWNVYDMGFGRKMDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPV  123

Query  574  EI  579
            E 
Sbjct  124  EF  125



>dbj|BAH30450.1| hypothetical protein [Arabidopsis thaliana]
Length=396

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 4/120 (3%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R PFT  QW+ELEHQALIYKYMVSG+PVPP+L++SIRRSLD+SL S+LL HQ 
Sbjct  6    SSGRTIGRPPFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRRSLDTSLVSRLLPHQS  65

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  66   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  123



>ref|XP_010936937.1| PREDICTED: growth-regulating factor 1-like [Elaeis guineensis]
Length=304

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = +1

Query  217  MMSGG---RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            MM GG   RSR PFT  QWQELEHQALI+KY+ +G+P+P DL+  IRRSL     +    
Sbjct  3    MMIGGNGSRSRYPFTESQWQELEHQALIFKYLAAGIPIPNDLILPIRRSLLLDSPTLGFP  62

Query  388  HQPQHYGWNYFQMGFGKKI-DPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSR  564
            H P   GW  FQMG+G+K+ DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ +  SR
Sbjct  63   HPPS-IGWGCFQMGYGRKVEDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKRSSR  121

Query  565  KPVEIQSHKN  594
            K VE+    N
Sbjct  122  KHVELSLASN  131



>ref|NP_188012.2| growth-regulating factor 5 [Arabidopsis thaliana]
 sp|Q8L8A6.1|GRF5_ARATH RecName: Full=Growth-regulating factor 5; Short=AtGRF5; AltName: 
Full=Transcription activator GRF5 [Arabidopsis thaliana]
 gb|AAM52880.1| transcription activator [Arabidopsis thaliana]
 gb|AEE75445.1| growth-regulating factor 5 [Arabidopsis thaliana]
Length=397

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 4/120 (3%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R PFT  QW+ELEHQALIYKYMVSG+PVPP+L++SIRRSLD+SL S+LL HQ 
Sbjct  7    SSGRTIGRPPFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRRSLDTSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  67   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  124



>dbj|BAB02326.1| unnamed protein product [Arabidopsis thaliana]
Length=397

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 4/120 (3%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R PFT  QW+ELEHQALIYKYMVSG+PVPP+L++SIRRSLD+SL S+LL HQ 
Sbjct  7    SSGRTIGRPPFTPTQWEELEHQALIYKYMVSGVPVPPELIFSIRRSLDTSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  67   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLD  124



>ref|XP_009135347.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Brassica 
rapa]
Length=369

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            + GR+  R PFT  QWQELEHQALIYKYMVSG+PVPP+L+ SIRRSLDSSL S+LL HQ 
Sbjct  7    TSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELILSIRRSLDSSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMG G+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++
Sbjct  67   --IGWGCYQMGSGRKPDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKALD  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
                     +    P T PS  FP
Sbjct  125  --------QNQTIAPSTSPSLSFP  140



>ref|XP_009135348.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Brassica 
rapa]
 gb|AEK86528.1| growth-regulating factor 5 [Brassica rapa subsp. pekinensis]
Length=363

 Score =   140 bits (353),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            + GR+  R PFT  QWQELEHQALIYKYMVSG+PVPP+L+ SIRRSLDSSL S+LL HQ 
Sbjct  7    TSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELILSIRRSLDSSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMG G+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++
Sbjct  67   --IGWGCYQMGSGRKPDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKALD  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
                     +    P T PS  FP
Sbjct  125  --------QNQTIAPSTSPSLSFP  140



>emb|CDX82503.1| BnaA03g33180D [Brassica napus]
Length=366

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            + GR+  R PFT  QWQELEHQALIYKYMVSG+PVPP+L+ SIRRSLDSSL S+LL HQ 
Sbjct  7    TSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELILSIRRSLDSSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMG G+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++
Sbjct  67   --IGWGCYQMGSGRKPDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKALD  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
                     +    P T PS  FP
Sbjct  125  --------QNQTIAPSTSPSLSFP  140



>ref|XP_006437422.1| hypothetical protein CICLE_v10032065mg [Citrus clementina]
 ref|XP_006484683.1| PREDICTED: growth-regulating factor 4-like [Citrus sinensis]
 ref|XP_006484684.1| PREDICTED: growth-regulating factor 4-like [Citrus sinensis]
 gb|ESR50662.1| hypothetical protein CICLE_v10032065mg [Citrus clementina]
Length=332

 Score =   138 bits (348),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 91/131 (69%), Gaps = 6/131 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYMV+G+PVPPDL+  I++S +S        H P   G+  F 
Sbjct  25   PFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKSFESISHRFF--HHPT-MGYCSF-  80

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S +
Sbjct  81   --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTITQSSS  138

Query  604  HNNNYPVTVPS  636
               +   T  S
Sbjct  139  TVTSLTATGSS  149



>emb|CDX75742.1| BnaC03g38250D [Brassica napus]
Length=365

 Score =   139 bits (350),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            + GR+  R PFT  QWQE+EHQALIYKYMVSG+PV P+L++SIRRSLDSSL S+LL HQ 
Sbjct  7    TSGRTIDRPPFTPTQWQEMEHQALIYKYMVSGVPVAPELIFSIRRSLDSSLVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMG G+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R++K ++
Sbjct  67   --IGWGCYQMGLGRKPDPEPGRCRRTDGKKWRCSREAHPDSKYCEKHMHRGRNRAKKALD  124

Query  577  IQSHKNSPNHNNNYPVTVPSFQFP  648
                     +    P T PS  FP
Sbjct  125  --------QNQTTAPSTSPSLSFP  140



>gb|KHG06614.1| dna double-strand break repair rad50 atpase [Gossypium arboreum]
Length=308

 Score =   138 bits (347),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 91/128 (71%), Gaps = 6/128 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYM++G+PVPPDL+  I++S +S        H P   G+  F 
Sbjct  8    PFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKSFESISHRFF--HHPT-MGYCSF-  63

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S +
Sbjct  64   --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMAQSSS  121

Query  604  HNNNYPVT  627
               +  V+
Sbjct  122  TVTSLTVS  129



>ref|XP_010501463.1| PREDICTED: growth-regulating factor 5-like [Camelina sativa]
Length=406

 Score =   140 bits (352),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = +1

Query  223  SGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            S GR+  R  FT  QWQELEHQALIYKYMVSG+PVPP+L++SIR+SLDS+L S+LL HQ 
Sbjct  7    SSGRTIERPLFTPTQWQELEHQALIYKYMVSGVPVPPELIFSIRKSLDSALVSRLLPHQS  66

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GW  +QMGFG+K DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ R R+RK ++
Sbjct  67   --LGWGCYQMGFGRKPDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSID  124



>ref|XP_011092609.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Sesamum 
indicum]
Length=352

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  27   RAPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVMPIRRSFEALSARFF--HHPSLGYCSY  84

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK  591
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS+ 
Sbjct  85   Y----GKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVESQSNS  138



>ref|XP_009605690.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=355

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  20   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  77

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS   S
Sbjct  78   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQSASQS  133

Query  598  PNHNNNYPVTVPS  636
             + + ++  T  S
Sbjct  134  LSTSMSHITTGSS  146



>ref|XP_009605688.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009605689.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=356

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  20   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  77

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS   S
Sbjct  78   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQSASQS  133

Query  598  PNHNNNYPVTVPS  636
             + + ++  T  S
Sbjct  134  LSTSMSHITTGSS  146



>ref|XP_009797591.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Nicotiana 
sylvestris]
Length=353

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  20   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  77

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS   S
Sbjct  78   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQSASQS  133

Query  598  PNHNNNYPVTVPS  636
             + + ++  T  S
Sbjct  134  LSTSMSHITTGSS  146



>gb|KDO48006.1| hypothetical protein CISIN_1g020051mg [Citrus sinensis]
Length=332

 Score =   138 bits (348),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 91/131 (69%), Gaps = 6/131 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYMV+G+PVPPDL+  I++S +S        H P   G+  F 
Sbjct  25   PFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQKSFESISHRFF--HHPT-MGYCSF-  80

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S +
Sbjct  81   --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTITQSSS  138

Query  604  HNNNYPVTVPS  636
               +   T  S
Sbjct  139  TVTSLTATGSS  149



>ref|XP_010552235.1| PREDICTED: growth-regulating factor 5-like [Tarenaya hassleriana]
 ref|XP_010552236.1| PREDICTED: growth-regulating factor 5-like [Tarenaya hassleriana]
Length=331

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +1

Query  229  GRSRL-PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHY  405
            GRS + PFT  QWQELE QAL+YKYMVSG+PVPP+L++SIRRSL SS SS LL HQP  +
Sbjct  11   GRSEMYPFTTTQWQELEQQALVYKYMVSGVPVPPELIFSIRRSLHSSFSSPLLPHQP--F  68

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            GW  FQMG G+K D EPGRCRRTDGKKWRCSR+  P+ KYCE+H H+ R R+RK +E
Sbjct  69   GWGCFQMGLGRKPDTEPGRCRRTDGKKWRCSRESHPNSKYCEKHMHRGRNRTRKSLE  125



>gb|KEH17760.1| growth-regulating factor [Medicago truncatula]
Length=337

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 96/154 (62%), Gaps = 11/154 (7%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYMV+G+PVPPDL++ I  S  S  S+    H      +  F 
Sbjct  25   PFTVSQWQELEHQALIFKYMVAGLPVPPDLVHPIHSSFHSLSSNNFFHHPIPTLSYCSF-  83

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
              +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+   S +
Sbjct  84   --YGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMAQSTS  141

Query  604  HNNNYPVTVPSFQFPATASCDQNRFLLIPKS*AL  705
                   TV S    A  S     F  IP + A 
Sbjct  142  -------TVTSLTV-AGGSSRAGNFQNIPTTNAF  167



>ref|XP_009797585.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797586.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797587.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797588.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797590.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
Length=354

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 93/133 (70%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  20   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  77

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS   S
Sbjct  78   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQSASQS  133

Query  598  PNHNNNYPVTVPS  636
             + + ++  T  S
Sbjct  134  LSTSMSHITTGSS  146



>gb|KHG13640.1| dna double-strand break repair rad50 atpase [Gossypium arboreum]
Length=334

 Score =   138 bits (347),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYM++G+PVPPDL+  I++S +S        H P   G+  F 
Sbjct  31   PFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQKSFESISHRFF--HHPT-MGYCSF-  86

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  87   --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMAQS  142



>ref|XP_006371207.1| hypothetical protein POPTR_0019s05910g [Populus trichocarpa]
 gb|ERP49004.1| hypothetical protein POPTR_0019s05910g [Populus trichocarpa]
Length=296

 Score =   137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALIYKYMV+G+PVPPDL+  I+RS +S        H P   G+  
Sbjct  22   RSPFTVSQWQELEHQALIYKYMVAGLPVPPDLVLPIQRSFESISHRFF--HHPA-MGYCT  78

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F   +GKK+DPEPG+CRRTDGKKWRCS+D  P  KYCERH H+ R RSRK VE Q+   S
Sbjct  79   F---YGKKVDPEPGQCRRTDGKKWRCSKDAYPGSKYCERHMHRGRNRSRKAVESQTMTQS  135

Query  598  PNHNNNYPVTVPS  636
             +   +  VT  S
Sbjct  136  SSTVTSLTVTGSS  148



>ref|XP_011092605.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092606.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092607.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092608.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Sesamum 
indicum]
Length=365

 Score =   138 bits (348),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  27   RAPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVMPIRRSFEALSARFF--HHPSLGYCSY  84

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK  591
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS+ 
Sbjct  85   Y----GKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVESQSNS  138



>ref|XP_010932723.1| PREDICTED: growth-regulating factor 1-like [Elaeis guineensis]
Length=166

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 92/129 (71%), Gaps = 10/129 (8%)
 Frame = +1

Query  217  MMSGGR--SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldssls--skll  384
            MM  GR  SR PFT  QWQELEHQALI+KYM SG+P+P DL+  IRRS     +  S  L
Sbjct  1    MMMSGRNTSRYPFTPSQWQELEHQALIFKYMASGIPIPSDLILPIRRSFLLDSTIPSPTL  60

Query  385  lHQPQ---HYGWNYFQMGFGKKI-DPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNR  552
               PQ    +GWN  QMGFG+K  DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ +
Sbjct  61   AFPPQPSMSWGWN--QMGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGK  118

Query  553  PRSRKPVEI  579
             RSRKPVE+
Sbjct  119  NRSRKPVEM  127



>ref|XP_002866933.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43192.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=540

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELEHQALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  164  PFTLTQWAELEHQALIYKYITANVPVPSSLLISIKKSFYPYGSLP-----PSSFGWGTFH  218

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKN  594
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS +N
Sbjct  219  LGFAGSNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQSGQN  276



>ref|XP_004506549.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Cicer 
arietinum]
Length=344

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYMV+G+PVPPDL+  I+RS DS        H   H+    + 
Sbjct  21   PFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQRSFDSIS------HNFFHHPTLSYC  74

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
              +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+   S +
Sbjct  75   SFYGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMAQSSS  134

Query  604  HNNNYPVT  627
               +   T
Sbjct  135  TVTSLTAT  142



>ref|NP_195488.2| growth-regulating factor 2 [Arabidopsis thaliana]
 sp|Q8L8A8.1|GRF2_ARATH RecName: Full=Growth-regulating factor 2; Short=AtGRF2; AltName: 
Full=Transcription activator GRF2 [Arabidopsis thaliana]
 gb|AAM52877.1| transcription activator [Arabidopsis thaliana]
 dbj|BAD44135.1| transcription activator (GRL2) [Arabidopsis thaliana]
 dbj|BAD44195.1| transcription activator (GRL2) [Arabidopsis thaliana]
 dbj|BAH30564.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86833.1| growth-regulating factor 2 [Arabidopsis thaliana]
Length=535

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 89/131 (68%), Gaps = 6/131 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  164  PFTLTQWAELEQQALIYKYITANVPVPSSLLISIKKSFYPYGSLP-----PSSFGWGTFH  218

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSP  600
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS +N  
Sbjct  219  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQSGQNQT  278

Query  601  NHNNNYPVTVP  633
                +  VT P
Sbjct  279  AAAASKAVTTP  289



>ref|XP_004307837.1| PREDICTED: growth-regulating factor 5-like [Fragaria vesca subsp. 
vesca]
Length=334

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 92/141 (65%), Gaps = 14/141 (10%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALI+KYM++GMPVPPDL+  I++S DS            H    Y
Sbjct  28   RSPFTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQKSFDSISQRFF------HPSMGY  81

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
                +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  82   CSF-YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQS  140

Query  598  PNHNNNYPVTVPSFQFPATAS  660
             +       TV S     T+S
Sbjct  141  SS-------TVTSLIVSGTSS  154



>ref|XP_004506550.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Cicer 
arietinum]
Length=330

 Score =   137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 98/154 (64%), Gaps = 12/154 (8%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KYMV+G+PVPPDL+  I+RS DS        H   H+    + 
Sbjct  21   PFTVSQWQELEHQALIFKYMVAGLPVPPDLVLPIQRSFDSIS------HNFFHHPTLSYC  74

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
              +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+   S +
Sbjct  75   SFYGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMAQSSS  134

Query  604  HNNNYPVTVPSFQFPATASCDQNRFLLIPKS*AL  705
               +   T        ++S     F ++P + A 
Sbjct  135  TVTSLTAT------GGSSSSRAGDFQILPANNAF  162



>ref|XP_004246199.2| PREDICTED: growth-regulating factor 4-like [Solanum lycopersicum]
Length=361

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 86/116 (74%), Gaps = 6/116 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  26   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  83

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE QS
Sbjct  84   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQS  135



>ref|XP_002301140.2| hypothetical protein POPTR_0002s11590g [Populus trichocarpa]
 gb|EEE80413.2| hypothetical protein POPTR_0002s11590g [Populus trichocarpa]
Length=464

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslssklllHQPQHYG  408
            +R PFT +QW ELEHQALIYKYM + +P+P +LL             S    L +P    
Sbjct  145  TRWPFTQLQWMELEHQALIYKYMTANVPIPSNLLIPIRKALDSAGFSSFSGGLFKPSALQ  204

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSH  588
            W  F MGF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE QS 
Sbjct  205  WGTFHMGFSSNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQSG  264

Query  589  KNSPNHNNNYPVTVPSFQFPATA  657
             ++       P+   +  F + +
Sbjct  265  HSAAATTTLKPMANGTSSFASAS  287



>ref|XP_010255823.1| PREDICTED: growth-regulating factor 4-like [Nelumbo nucifera]
Length=349

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 96/141 (68%), Gaps = 13/141 (9%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQALI+KY+++G+PVPP+L++ IR+S +S  +     H P   G+  
Sbjct  13   RPPFTALQWQELEHQALIFKYLMAGLPVPPELVHPIRKSFESMSARFF--HHPS-MGYCS  69

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F   +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  70   F---YGKKADPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVETQTISQS  126

Query  598  PNHNNNYPVTVPSFQFPATAS  660
             +       TV S    AT S
Sbjct  127  SS-------TVTSLTATATGS  140



>gb|KGN63355.1| hypothetical protein Csa_2G432230 [Cucumis sativus]
Length=337

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 90/125 (72%), Gaps = 6/125 (5%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYG  408
            G +R PFTV+QWQELE QALI+K+M++G PVPP+L+  I++S +S        HQP    
Sbjct  26   GMNRSPFTVLQWQELELQALIFKFMMAGQPVPPELVLLIQKSFESISHRFF--HQPTMAY  83

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSH  588
             +++    GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+ 
Sbjct  84   CSFY----GKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTM  139

Query  589  KNSPN  603
              S +
Sbjct  140  TQSSS  144



>ref|XP_007157086.1| hypothetical protein PHAVU_002G041800g [Phaseolus vulgaris]
 gb|ESW29080.1| hypothetical protein PHAVU_002G041800g [Phaseolus vulgaris]
Length=317

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 86/117 (74%), Gaps = 4/117 (3%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHY  405
            G  S+ PFTV QWQELEHQALIYKYMV+G+PVPPDL+  I+ S  S   + L  H P   
Sbjct  7    GEMSKWPFTVSQWQELEHQALIYKYMVAGLPVPPDLVIPIQNSFHSISQTFL--HHPSS-  63

Query  406  GWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
              +Y    +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE
Sbjct  64   AMSYCSF-YGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE  119



>ref|XP_003539001.1| PREDICTED: growth-regulating factor 5-like [Glycine max]
Length=341

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  LV*MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklll  387
            L+ + +G   R PFTV QWQELEHQALI+KYM++G+PVP DL++ I+ S  S++S     
Sbjct  13   LMGLSNGYCGRSPFTVSQWQELEHQALIFKYMLAGLPVPLDLVFPIQNSFHSTISLS---  69

Query  388  HQPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
            H   H+    +   +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  70   HAFFHHPTLSYCSFYGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  129

Query  568  PVEIQSHKNSPNHNNNYPVTVPS  636
            PVE Q+  +S +   +  VT  S
Sbjct  130  PVESQTMTHSSSTVTSLTVTGGS  152



>gb|KHN39845.1| hypothetical protein glysoja_020585 [Glycine soja]
Length=328

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFTV QWQELEHQALI+KYM++G+PVP DL++ I+ S  S++S     H   H+    
Sbjct  10   RSPFTVSQWQELEHQALIFKYMLAGLPVPLDLVFPIQNSFHSTISLS---HAFFHHPTLS  66

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +   +GKK+DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRKPVE Q+  +S
Sbjct  67   YCSFYGKKVDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVESQTMTHS  126

Query  598  PNHNNNYPVT  627
             +   +  VT
Sbjct  127  SSTVTSLTVT  136



>ref|XP_004238069.1| PREDICTED: growth-regulating factor 1-like [Solanum lycopersicum]
Length=595

 Score =   140 bits (353),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QW ELEHQALIYKY+ + +P+PP LL  IR++L+S+  S     +P   GW  F 
Sbjct  137  PFTPSQWMELEHQALIYKYITANIPIPPYLLNPIRKALESAGFSTFAGLRPNALGWGAFH  196

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
            +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q+  ++  
Sbjct  197  LGFSNSNDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQTGNSAS-  255

Query  604  HNNNYPVTVPSFQF  645
              NN  VT  S + 
Sbjct  256  -GNNTGVTTTSAKL  268



>ref|XP_006356839.1| PREDICTED: growth-regulating factor 6-like [Solanum tuberosum]
Length=597

 Score =   140 bits (353),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QW ELEHQALIYKY+ + +P+PP LL  IR++L+S+  +     +P   GW  F 
Sbjct  139  PFTPSQWMELEHQALIYKYITANVPIPPYLLNPIRKALESAGFTTFAGLRPNALGWGAFH  198

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSPN  603
            +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q+  NS +
Sbjct  199  LGFSNSNDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQT-GNSAS  257

Query  604  HNNNYPVTVPS  636
             NN    T  +
Sbjct  258  GNNTGATTTSA  268



>gb|EYU28340.1| hypothetical protein MIMGU_mgv1a008605mg [Erythranthe guttata]
Length=368

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 8/123 (7%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP--QHY  405
            ++  PFT  QWQELEHQAL++KYM+SG+ +P DLL++I  S  SSLSSKLL H P  QH 
Sbjct  40   KNMFPFTTSQWQELEHQALVFKYMISGLQIPQDLLFTITTSFHSSLSSKLLHHPPPPQHM  99

Query  406  -GWNYFQ----MGFG-KKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRK  567
             GWN +Q    MG+G +KIDPEPGRCRRTDGKKWRCS++  PD KYCERH H+ R RSRK
Sbjct  100  IGWNGYQYEQQMGYGHRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRK  159

Query  568  PVE  576
            PVE
Sbjct  160  PVE  162



>emb|CDY66422.1| BnaA08g30080D [Brassica napus]
Length=313

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            MM   + + PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P
Sbjct  28   MMMSMQGKGPFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----P  82

Query  397  QHYGWNYFQMGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
              +GW  F +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK V
Sbjct  83   SSFGWGTFHLGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLV  142

Query  574  EIQSHKNS  597
            E+QS++ +
Sbjct  143  EVQSNQTA  150



>ref|XP_010324484.1| PREDICTED: growth-regulating factor 4-like isoform X2 [Solanum 
lycopersicum]
Length=352

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 97/151 (64%), Gaps = 6/151 (4%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS D+  +         H    Y
Sbjct  29   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFDAISARFF-----SHPSLGY  83

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
                +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  84   CSY-YGKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVESQTTSQS  142

Query  598  PNHNNNYPVTVPSFQFPATASCDQNRFLLIP  690
             + + ++  T  S +  +  S     F  +P
Sbjct  143  LSTSKSHTATGSSNRSGSFQSNSSGSFQNMP  173



>emb|CDP01011.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   140 bits (352),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 89/139 (64%), Gaps = 0/139 (0%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QW ELEHQALIYKY+ + MP+P  LL  IR++LDS+  S     +P  +GW  
Sbjct  163  RGPFTPSQWMELEHQALIYKYINANMPIPSYLLSPIRKALDSAGFSSFAGLRPSAFGWGA  222

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q   + 
Sbjct  223  FHIGFSNSTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQPGHSV  282

Query  598  PNHNNNYPVTVPSFQFPAT  654
                NN     P+    A 
Sbjct  283  AGTTNNAAKLTPTSSASAA  301



>ref|XP_010324483.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Solanum 
lycopersicum]
Length=356

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 97/151 (64%), Gaps = 6/151 (4%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS D+  +         H    Y
Sbjct  29   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFDAISARFF-----SHPSLGY  83

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
                +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   S
Sbjct  84   CSY-YGKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVESQTTSQS  142

Query  598  PNHNNNYPVTVPSFQFPATASCDQNRFLLIP  690
             + + ++  T  S +  +  S     F  +P
Sbjct  143  LSTSKSHTATGSSNRSGSFQSNSSGSFQNMP  173



>ref|XP_008462790.1| PREDICTED: growth-regulating factor 4-like [Cucumis melo]
Length=337

 Score =   135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 6/125 (5%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYG  408
            G +R PFTV+QWQELE QALI+K+M++G PVPP+L+  I++S +S        H+  H+ 
Sbjct  26   GMNRSPFTVLQWQELELQALIFKFMMAGQPVPPELVLLIQKSFESIS------HRFFHHP  79

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSH  588
               +   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+ 
Sbjct  80   TMAYCSFYGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTM  139

Query  589  KNSPN  603
              S +
Sbjct  140  TQSSS  144



>ref|XP_006846580.1| hypothetical protein AMTR_s00018p00250840 [Amborella trichopoda]
 gb|ERN08255.1| hypothetical protein AMTR_s00018p00250840 [Amborella trichopoda]
Length=560

 Score =   139 bits (349),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELE QALI+KYM++ +PVP DL+  IR+SL  S           + GW  
Sbjct  106  RFPFTPSQWQELEQQALIFKYMMASVPVPQDLVNPIRKSLPLSHP---------NLGWGP  156

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F + F    DPEPGRCRRTDGKKWRCSRDV PDQKYCERH H+ RPRSRKPVE+Q   N 
Sbjct  157  FSLRFANATDPEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVELQIQNNQ  216

Query  598  PNHNN  612
               N+
Sbjct  217  TQPND  221



>gb|EMT04093.1| hypothetical protein F775_24390 [Aegilops tauschii]
Length=202

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk---lllHQPQH-YGW  411
            PFT  QWQELEHQALIYKYM SG+P+P DLL  +RRS     +      L   PQ   GW
Sbjct  21   PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRRSFLLDSALAPSPSLAFPPQAALGW  80

Query  412  NYFQMGFGKKI-DPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              F MGFG+K  DPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKPVE+
Sbjct  81   GCFGMGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEM  137



>ref|XP_004151910.1| PREDICTED: growth-regulating factor 3-like [Cucumis sativus]
 ref|XP_004156783.1| PREDICTED: growth-regulating factor 3-like [Cucumis sativus]
Length=336

 Score =   135 bits (341),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 6/125 (5%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYG  408
            G +R PFTV+QWQELE QALI+K+M++G PVPP+L+  I++S +S        H+  H+ 
Sbjct  26   GMNRSPFTVLQWQELELQALIFKFMMAGQPVPPELVLLIQKSFESIS------HRFFHHP  79

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSH  588
               +   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+ 
Sbjct  80   TMAYCSFYGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTM  139

Query  589  KNSPN  603
              S +
Sbjct  140  TQSSS  144



>ref|XP_004976689.1| PREDICTED: growth-regulating factor 3-like isoform X1 [Setaria 
italica]
 ref|XP_004976690.1| PREDICTED: growth-regulating factor 3-like isoform X2 [Setaria 
italica]
Length=373

 Score =   136 bits (342),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 93/144 (65%), Gaps = 15/144 (10%)
 Frame = +1

Query  217  MMSG--GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH  390
            MMSG      +PFT  Q++ELEHQALIYKY+V+G+PVPPDLL  IRR            H
Sbjct  41   MMSGRWAARPVPFTAAQYEELEHQALIYKYLVAGVPVPPDLLLPIRRGFVY--------H  92

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            QP   G+  +   FGKK+DPEPGRCRRTDGKKWRC+++  PD KYCERH H+ R RSRKP
Sbjct  93   QPA-LGYGPY---FGKKVDPEPGRCRRTDGKKWRCAKEAAPDSKYCERHMHRGRNRSRKP  148

Query  571  VEIQSHKNSPNHNNNYPVTVPSFQ  642
            VE Q     P+     PV    FQ
Sbjct  149  VEAQ-LVTPPHAQQQPPVAAAGFQ  171



>emb|CDY55116.1| BnaA03g54950D [Brassica napus]
Length=282

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  6    PFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----PSSFGWGTFH  60

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK VE+QS++ +
Sbjct  61   LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLVEVQSNQTA  119



>ref|XP_004976691.1| PREDICTED: growth-regulating factor 3-like isoform X3 [Setaria 
italica]
Length=363

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 93/144 (65%), Gaps = 15/144 (10%)
 Frame = +1

Query  217  MMSG--GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH  390
            MMSG      +PFT  Q++ELEHQALIYKY+V+G+PVPPDLL  IRR            H
Sbjct  31   MMSGRWAARPVPFTAAQYEELEHQALIYKYLVAGVPVPPDLLLPIRRGFVY--------H  82

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            QP   G+  +   FGKK+DPEPGRCRRTDGKKWRC+++  PD KYCERH H+ R RSRKP
Sbjct  83   QPA-LGYGPY---FGKKVDPEPGRCRRTDGKKWRCAKEAAPDSKYCERHMHRGRNRSRKP  138

Query  571  VEIQSHKNSPNHNNNYPVTVPSFQ  642
            VE Q     P+     PV    FQ
Sbjct  139  VEAQ-LVTPPHAQQQPPVAAAGFQ  161



>ref|XP_008786732.1| PREDICTED: growth-regulating factor 1-like, partial [Phoenix 
dactylifera]
Length=150

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 91/135 (67%), Gaps = 9/135 (7%)
 Frame = +1

Query  217  MMSGGRS-RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllH-  390
            MMSG  S R PFT  QWQELEHQALI+KYM SG+P+P DL+  +RRS     +       
Sbjct  1    MMSGRSSCRYPFTPSQWQELEHQALIFKYMASGIPIPSDLILPLRRSYLLDSTITSPTLG  60

Query  391  ---QPQ-HYGWNYFQMGFGKKID-PEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRP  555
               QP   +GWN  Q+GFG+K D PEPGRCRRTDGKKWRC+++  PD KYCERH H+ + 
Sbjct  61   FPPQPSMSWGWN--QVGFGRKADDPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGKN  118

Query  556  RSRKPVEIQSHKNSP  600
            RSRKPVE+      P
Sbjct  119  RSRKPVEMSLATTLP  133



>ref|XP_006361251.1| PREDICTED: growth-regulating factor 4-like [Solanum tuberosum]
Length=352

 Score =   135 bits (340),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 100/155 (65%), Gaps = 14/155 (9%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS D+  +            +N+
Sbjct  29   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFDAISARF----------FNH  78

Query  418  FQMGF----GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
              +G+    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+
Sbjct  79   PSLGYCSYYGKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVESQT  138

Query  586  HKNSPNHNNNYPVTVPSFQFPATASCDQNRFLLIP  690
               S + + ++  T  S +  +  S     F  +P
Sbjct  139  TSQSLSTSISHTATGSSNRSGSFQSNSSGSFQNMP  173



>gb|AFQ22738.1| growth-regulating factor 2J, partial [Brassica rapa subsp. pekinensis]
Length=451

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP     S                 P  +GW  F 
Sbjct  146  PFTLTQWAELEQQALIYKYITANVPVP-----SSLLISIQKSFYPYRSFPPSSFGWGTFH  200

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GF G KIDPEPGRCRRTDGKKWRCS+D +PDQKYCERH ++ R RSRKPVE+Q
Sbjct  201  LGFAGGKIDPEPGRCRRTDGKKWRCSKDAVPDQKYCERHINRGRHRSRKPVEVQ  254



>ref|XP_006854210.1| hypothetical protein AMTR_s00048p00216350 [Amborella trichopoda]
 gb|ERN15677.1| hypothetical protein AMTR_s00048p00216350 [Amborella trichopoda]
Length=338

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 90/126 (71%), Gaps = 6/126 (5%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
            M+    R PFT  QWQELEHQALI+K++++G+PVPPDLL  IRRSL++  +      Q Q
Sbjct  1    MNSSGCRPPFTPSQWQELEHQALIFKHLMAGIPVPPDLLVPIRRSLEAMSARF---FQQQ  57

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              GW  F   +G K DPEPGRCRRTDGKKWRCSRD  PD KYCERH H+ R RSRKPVE 
Sbjct  58   TMGWGSF---YGNKSDPEPGRCRRTDGKKWRCSRDAYPDSKYCERHMHRGRNRSRKPVEP  114

Query  580  QSHKNS  597
            Q+  +S
Sbjct  115  QTVSHS  120



>emb|CBI19365.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 85/143 (59%), Gaps = 7/143 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslssklllHQPQHYGW  411
            R PFT  QW ELEHQALIYKY+ + +P+P +LL             +      +P   GW
Sbjct  57   RGPFTQSQWMELEHQALIYKYITANVPIPSNLLMPIRKALDSVGFSTFSAGALRPNTLGW  116

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK  591
              F +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q+  
Sbjct  117  GSFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQTGH  176

Query  592  NSPNHNNNYPVTVPSFQFPATAS  660
            + P      P T  +   P T+S
Sbjct  177  SVPG-----PTTTATKLMPITSS  194



>ref|XP_010940818.1| PREDICTED: growth-regulating factor 5-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            + G  R PFT  QWQELEHQALIYKY+++G+PVPPDLL  IRRS +++ +         H
Sbjct  5    AAGGCRPPFTASQWQELEHQALIYKYLIAGVPVPPDLLIPIRRSFEAAHARFY-----HH  59

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
                Y+   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  60   PALGYYSF-YGKKLDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_008812758.1| PREDICTED: growth-regulating factor 4-like [Phoenix dactylifera]
Length=348

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ  399
             + G  R PFT  QWQELEHQALIYKY+++G+PVPPDLL  IRRS ++  +         
Sbjct  4    TAAGGCRPPFTASQWQELEHQALIYKYLIAGVPVPPDLLIPIRRSFEAVHARFY-----H  58

Query  400  HYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            H    Y+   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  59   HPALGYYSF-YGKKLDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_010940817.1| PREDICTED: growth-regulating factor 5-like isoform X1 [Elaeis 
guineensis]
Length=348

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = +1

Query  223  SGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH  402
            + G  R PFT  QWQELEHQALIYKY+++G+PVPPDLL  IRRS +++ +         H
Sbjct  5    AAGGCRPPFTASQWQELEHQALIYKYLIAGVPVPPDLLIPIRRSFEAAHARFY-----HH  59

Query  403  YGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
                Y+   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  60   PALGYYSF-YGKKLDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  116



>ref|XP_009138528.1| PREDICTED: growth-regulating factor 2-like [Brassica rapa]
Length=447

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            +M   + + PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P
Sbjct  123  VMKSMQGKGPFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----P  177

Query  397  QHYGWNYFQMGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
              +GW  F +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK V
Sbjct  178  SSFGWGTFHLGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLV  237

Query  574  EIQSHKNSPNHNNNYPVTVPSFQFPATASCDQNRFL  681
            E+QS++ +              Q  A    ++NR L
Sbjct  238  EVQSNQTAAAAAAASKAVTAQQQSVAAGGINRNRSL  273



>gb|KHG11416.1| hypothetical protein F383_00237 [Gossypium arboreum]
Length=613

 Score =   138 bits (348),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 82/125 (66%), Gaps = 4/125 (3%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslssklllH  390
            +++GGR   PFT  QW ELEHQALIYKY+ S +P+P +LL          +       L 
Sbjct  157  VLAGGRG--PFTPSQWMELEHQALIYKYITSNVPIPSNLLIPIRKSLDSANFSLFSGGLL  214

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            +P   GW  F +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKP
Sbjct  215  RPNTLGWGAFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKP  274

Query  571  VEIQS  585
            VE QS
Sbjct  275  VEGQS  279



>ref|XP_010664482.1| PREDICTED: growth-regulating factor 6-like isoform X2 [Vitis 
vinifera]
Length=487

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 9/150 (6%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslssklllH  390
            +M+G R   PFT  QW ELEHQALIYKY+ + +P+P +LL             +      
Sbjct  26   VMAGVRG--PFTQSQWMELEHQALIYKYITANVPIPSNLLMPIRKALDSVGFSTFSAGAL  83

Query  391  QPQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            +P   GW  F +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKP
Sbjct  84   RPNTLGWGSFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKP  143

Query  571  VEIQSHKNSPNHNNNYPVTVPSFQFPATAS  660
            VE Q+  + P      P T  +   P T+S
Sbjct  144  VEGQTGHSVPG-----PTTTATKLMPITSS  168



>ref|XP_003572853.1| PREDICTED: growth-regulating factor 4-like [Brachypodium distachyon]
Length=391

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 5/118 (4%)
 Frame = +1

Query  229  GRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYG  408
            GR  LPFT  Q++EL+HQALIYKY+V+G+PVPPDL+  IRR +DS  +     H P   G
Sbjct  58   GRGPLPFTSAQYEELQHQALIYKYLVAGVPVPPDLVLPIRRGIDSLAARFY--HNPISIG  115

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +  +    GKK+DPEPGRCRRTDGKKWRC+++  PD KYCERH H+ R RSRKPVE Q
Sbjct  116  YGTY---LGKKVDPEPGRCRRTDGKKWRCAKEAAPDSKYCERHMHRGRNRSRKPVETQ  170



>gb|AFQ22739.1| growth-regulating factor 2P, partial [Brassica rapa subsp. pekinensis]
Length=446

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 92/147 (63%), Gaps = 6/147 (4%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  132  PFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----PSSFGWGTFH  186

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSP  600
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK VE+QS++ + 
Sbjct  187  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLVEVQSNQTAA  246

Query  601  NHNNNYPVTVPSFQFPATASCDQNRFL  681
                         Q  A    ++NR L
Sbjct  247  AAAAASKAVTAQQQSVAAGGINRNRSL  273



>gb|AFB74092.1| growth-regulating factor 2 [Brassica napus]
Length=463

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 6/128 (5%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            MM   + + PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P
Sbjct  123  MMMSMQGKGPFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----P  177

Query  397  QHYGWNYFQMGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
              +GW  F +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK V
Sbjct  178  SSFGWGTFHLGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLV  237

Query  574  EIQSHKNS  597
            E+QS++ +
Sbjct  238  EVQSNQTA  245



>ref|XP_011017086.1| PREDICTED: growth-regulating factor 1-like isoform X3 [Populus 
euphratica]
Length=588

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly-sirrsldsslssklllHQPQHYGW  411
            +R PFT +QW ELEHQALIYKY+ + +P+P +LL    +    +  SS   L +P    W
Sbjct  144  TRWPFTQLQWMELEHQALIYKYITANVPIPSNLLIPIRKALDSAGFSSFSGLFKPSALQW  203

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
              F MGF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE QS
Sbjct  204  GTFHMGFSSNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQS  261



>ref|XP_011017085.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Populus 
euphratica]
Length=589

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly-sirrsldsslssklllHQPQHYGW  411
            +R PFT +QW ELEHQALIYKY+ + +P+P +LL    +    +  SS   L +P    W
Sbjct  144  TRWPFTQLQWMELEHQALIYKYITANVPIPSNLLIPIRKALDSAGFSSFSGLFKPSALQW  203

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
              F MGF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE QS
Sbjct  204  GTFHMGFSSNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQS  261



>emb|CDX75672.1| BnaA01g00300D [Brassica napus]
Length=451

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP     S                 P  +GW  F 
Sbjct  146  PFTLTQWAELEQQALIYKYITANVPVP-----SSLLISIQKSFYPYRSFPPSSFGWGTFH  200

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GF G K+DPEPGRCRRTDGKKWRCS+D +PDQKYCERH ++ R RSRKPVE+Q
Sbjct  201  LGFAGGKMDPEPGRCRRTDGKKWRCSKDAVPDQKYCERHINRGRHRSRKPVEVQ  254



>ref|XP_009626682.1| PREDICTED: growth-regulating factor 1-like [Nicotiana tomentosiformis]
Length=605

 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QW ELEHQALIYKY+ + +P+PP LL  IR++L+S+  +     +P   GW  F 
Sbjct  156  PFTPSQWMELEHQALIYKYITANVPIPPYLLNPIRKALESTGFTTFAGLRPNALGWGAFH  215

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q+   S
Sbjct  216  LGFSNSNDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQTGATS  273



>ref|XP_006647996.1| PREDICTED: growth-regulating factor 1-like [Oryza brachyantha]
Length=390

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +1

Query  226  GGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDl---lysirrsldsslssklllHQP  396
            G   R PFT  QWQELEHQALIYKYM SG P+P DL   L        +  +S  L   P
Sbjct  11   GAGGRYPFTASQWQELEHQALIYKYMASGTPIPSDLIIPLRRSFLLDSALATSPSLAFPP  70

Query  397  Q-HYGWNYFQMGFGKKI-DPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKP  570
            Q   GW  F MGFG+K  DPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKP
Sbjct  71   QPSLGWGCFGMGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKP  130

Query  571  VEIQ  582
            VE+ 
Sbjct  131  VEMS  134



>ref|XP_002283504.2| PREDICTED: growth-regulating factor 1-like isoform X1 [Vitis 
vinifera]
Length=604

 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 85/144 (59%), Gaps = 7/144 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslssklllHQPQHYGW  411
            R PFT  QW ELEHQALIYKY+ + +P+P +LL             +      +P   GW
Sbjct  148  RGPFTQSQWMELEHQALIYKYITANVPIPSNLLMPIRKALDSVGFSTFSAGALRPNTLGW  207

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK  591
              F +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q+  
Sbjct  208  GSFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQTGH  267

Query  592  NSPNHNNNYPVTVPSFQFPATASC  663
            + P      P T  +   P T+S 
Sbjct  268  SVPG-----PTTTATKLMPITSSS  286



>ref|XP_002270427.2| PREDICTED: growth-regulating factor 4-like isoform X2 [Vitis 
vinifera]
Length=330

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KY+++G+PVPPDL+  I++S +S  S     H P   G+  F 
Sbjct  23   PFTVSQWQELEHQALIFKYLMAGLPVPPDLVLPIQKSFESMSSRFF--HHPT-MGYCSF-  78

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  79   --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  127



>ref|XP_010662088.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Vitis 
vinifera]
Length=332

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KY+++G+PVPPDL+  I++S +S  S     H P   G+  F 
Sbjct  23   PFTVSQWQELEHQALIFKYLMAGLPVPPDLVLPIQKSFESMSSRFF--HHPT-MGYCSF-  78

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  79   --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  127



>emb|CBI26466.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFTV QWQELEHQALI+KY+++G+PVPPDL+  I++S +S  S     H P   G+  F 
Sbjct  66   PFTVSQWQELEHQALIFKYLMAGLPVPPDLVLPIQKSFESMSSRFF--HHPT-MGYCSF-  121

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
              +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  122  --YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  170



>ref|XP_008780324.1| PREDICTED: growth-regulating factor 1-like, partial [Phoenix 
dactylifera]
Length=125

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 82/118 (69%), Gaps = 4/118 (3%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslss---klllHQPQHY  405
            SR PFT  QWQELEHQALI+KYM SG+P+P DL+  +RRS     +     L  H     
Sbjct  8    SRYPFTPSQWQELEHQALIFKYMASGIPIPSDLVLPLRRSFLLDSTIPSPTLAFHPQPSM  67

Query  406  GWNYFQMGFGKKI-DPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
             W + Q GFG+K  DPEPGRCRRTDGKKWRCS++  PD KYCERH H+ + RSRKPVE
Sbjct  68   SWGWNQKGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE  125



>ref|XP_009133704.1| PREDICTED: growth-regulating factor 2 [Brassica rapa]
Length=451

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP     S                 P  +GW  F 
Sbjct  146  PFTLTQWAELEQQALIYKYITANVPVP-----SSLLISIQKSFYPYRSFPPSSFGWGTFH  200

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GF G K+DPEPGRCRRTDGKKWRCS+D +PDQKYCERH ++ R RSRKPVE+Q
Sbjct  201  LGFAGGKMDPEPGRCRRTDGKKWRCSKDAVPDQKYCERHINRGRHRSRKPVEVQ  254



>ref|XP_010685314.1| PREDICTED: growth-regulating factor 5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=223

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH-YG  408
            RS  PFT  QW+ELE Q L +KY++SG+PVPP L  ++  +  +S SS L  +Q    +G
Sbjct  11   RSPFPFTASQWKELEQQLLTFKYLISGVPVPPQLFSNVITNPFASSSSTLFPYQQSLPFG  70

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            W  FQ+G+G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + +++K +++ S
Sbjct  71   WGCFQVGYGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCEKHMHRGKNKTKKHIQVFS  129



>ref|XP_009784651.1| PREDICTED: growth-regulating factor 1-like [Nicotiana sylvestris]
Length=607

 Score =   137 bits (344),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QW ELEHQALIYKY+ + +P+PP LL  IR++L+S+  +     +P   GW  F 
Sbjct  157  PFTPSQWMELEHQALIYKYITANVPIPPYLLNPIRKALESAGFTTFAGLRPNALGWGAFH  216

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE Q+   S
Sbjct  217  LGFSNSNDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQTGATS  274



>gb|AFB74090.1| growth-regulating factor 2 [Brassica napus]
Length=453

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP     S                 P  +GW  F 
Sbjct  146  PFTLTQWAELEQQALIYKYITANVPVP-----SSLLISIQKSFYPYRSFPPSSFGWGTFH  200

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GF G K+DPEPGRCRRTDGKKWRCS+D +PDQKYCERH ++ R RSRKPVE+Q
Sbjct  201  LGFAGGKMDPEPGRCRRTDGKKWRCSKDAVPDQKYCERHINRGRHRSRKPVEVQ  254



>emb|CDY29584.1| BnaA03g54290D [Brassica napus]
Length=408

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  132  PFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----PSSFGWGTFH  186

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK VE+QS++ +
Sbjct  187  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLVEVQSNQTA  245



>gb|EYU23268.1| hypothetical protein MIMGU_mgv1a009029mg [Erythranthe guttata]
Length=355

 Score =   133 bits (335),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 6/111 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS D+  +     H P     +Y+ 
Sbjct  15   PFTAVQWQELEHQAMIYKYLVAGLPVPPDLVMPIRRSFDALSARFF--HHPSLGYCSYY-  71

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  72   ---GKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  119



>ref|XP_006283492.1| hypothetical protein CARUB_v10004544mg [Capsella rubella]
 gb|EOA16390.1| hypothetical protein CARUB_v10004544mg [Capsella rubella]
Length=540

 Score =   135 bits (341),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 6/115 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  163  PFTLTQWAELEQQALIYKYITANVPVPSSLLISIKKSFYPYGSLP-----PSSFGWGTFH  217

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS
Sbjct  218  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQS  272



>ref|XP_001778905.1| predicted protein [Physcomitrella patens]
 gb|EDQ56355.1| predicted protein [Physcomitrella patens]
Length=112

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = +1

Query  250  TVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQMG  429
            T  QW ELEHQALI+KYM++G+ VP +LL  IR+S+ +        H   + GW  F +G
Sbjct  1    TTSQWAELEHQALIFKYMMAGVNVPQELLNPIRKSVATMNGLAS--HHTANLGWGAFHLG  58

Query  430  FGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
                 DPEPGRCRRTDGKKWRC+RDV+PDQKYCERH H+ R RSR+P E Q+
Sbjct  59   VPNNTDPEPGRCRRTDGKKWRCARDVVPDQKYCERHMHRGRHRSRRPAEGQT  110



>ref|XP_010446629.1| PREDICTED: growth-regulating factor 2 [Camelina sativa]
Length=555

 Score =   135 bits (341),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 83/115 (72%), Gaps = 6/115 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL S+++S     S       P  +GW  F 
Sbjct  171  PFTLTQWAELEQQALIYKYITANVPVPSSLLISLKKSFYPFGSLP-----PSSFGWGSFH  225

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS
Sbjct  226  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQS  280



>gb|KFK30384.1| hypothetical protein AALP_AA7G254100 [Arabis alpina]
Length=515

 Score =   135 bits (339),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 6/115 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  149  PFTLTQWAELELQALIYKYITANVPVPSSLLISIKKSFYPYGSLP-----PSAFGWGAFH  203

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS
Sbjct  204  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQS  258



>emb|CDX72654.1| BnaC07g46760D [Brassica napus]
Length=442

 Score =   134 bits (336),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  132  PFTLTQWAELEQQALIYKYITANVPVPSSLLISIQKSFFPYGSLP-----PSSFGWGTFH  186

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRK VE+QS++ +
Sbjct  187  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKLVEVQSNQTA  245



>ref|XP_010526698.1| PREDICTED: growth-regulating factor 1-like isoform X1 [Tarenaya 
hassleriana]
Length=508

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 10/145 (7%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT++QW ELE QALIYKY+ + + VPP LL S+++S        L    P  +GW  F 
Sbjct  142  PFTLMQWAELEQQALIYKYITANIHVPPSLLLSLKKSFYPYAPGSLP---PNSFGWGSFH  198

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSP  600
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE  S   + 
Sbjct  199  LGFSGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVESHSGHTAA  258

Query  601  NHNNNYPVTVPSFQFPATASCDQNR  675
                +  VT      P++ + D+ R
Sbjct  259  GSTTSKAVT------PSSVAVDRGR  277



>ref|XP_010526699.1| PREDICTED: growth-regulating factor 1-like isoform X2 [Tarenaya 
hassleriana]
Length=507

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 10/145 (7%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT++QW ELE QALIYKY+ + + VPP LL S+++S        L    P  +GW  F 
Sbjct  141  PFTLMQWAELEQQALIYKYITANIHVPPSLLLSLKKSFYPYAPGSLP---PNSFGWGSFH  197

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSP  600
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE  S   + 
Sbjct  198  LGFSGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVESHSGHTAA  257

Query  601  NHNNNYPVTVPSFQFPATASCDQNR  675
                +  VT      P++ + D+ R
Sbjct  258  GSTTSKAVT------PSSVAVDRGR  276



>gb|AAP45157.2| hypothetical protein SBB1_21t00001 [Solanum bulbocastanum]
Length=445

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  28   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  85

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  86   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  134



>ref|XP_010432035.1| PREDICTED: growth-regulating factor 2-like [Camelina sativa]
Length=553

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 6/115 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL SI++S     S       P  +GW  F 
Sbjct  169  PFTLTQWAELEQQALIYKYITANVPVPSSLLISIKKSFYPFGSLP-----PSSFGWGTFH  223

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS
Sbjct  224  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQS  278



>ref|XP_009794508.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794509.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794510.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
Length=329

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 83/113 (73%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS D+  +         H   +Y
Sbjct  29   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFDAISARFF-----NHPSLSY  83

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
                +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  84   CSY-YGKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  135



>ref|XP_010548469.1| PREDICTED: growth-regulating factor 1-like [Tarenaya hassleriana]
Length=518

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 91/146 (62%), Gaps = 12/146 (8%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT+ QW ELE QALIYKY+ + +P+P  LL S+++S        L    P  +GW  
Sbjct  145  RGPFTLTQWAELEQQALIYKYITANVPIPSSLLLSLKKSFYPYAHGSLP---PNSFGWGS  201

Query  418  FQMGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKN  594
            F +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE  S   
Sbjct  202  FHLGFSGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEGHS---  258

Query  595  SPNHNNNYPVTVPSFQFPATASCDQN  672
               HN      +PS   P  AS   N
Sbjct  259  --GHNAASKAAIPS---PLKASAASN  279



>ref|XP_007029701.1| Growth-regulating factor 5 [Theobroma cacao]
 gb|EOY10203.1| Growth-regulating factor 5 [Theobroma cacao]
Length=348

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 88/130 (68%), Gaps = 6/130 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQ---HYGWN  414
            PFTV QWQELEHQALI+KYM++G+PVP DL+  I++S +S        H P     +   
Sbjct  37   PFTVSQWQELEHQALIFKYMMAGLPVPHDLVLPIQKSFESISHRFF--HHPTIECDFAVG  94

Query  415  YFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKN  594
            Y    +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE Q+   
Sbjct  95   YCSF-YGKKVDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVESQTMTQ  153

Query  595  SPNHNNNYPV  624
            S +   +  V
Sbjct  154  SSSTVTSLTV  163



>dbj|BAJ85032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDlly---sirrsldsslssklllHQPQH-YGW  411
            PFT  QWQELEHQALIYKYM SG+P+P DLL           +  +S  L   PQ   GW
Sbjct  21   PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRRSFLLDSALATSPSLAFPPQAALGW  80

Query  412  NYFQMGFGKK-IDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              F MGFG+K  DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ + RSRKPVE+
Sbjct  81   GCFGMGFGRKPEDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGKNRSRKPVEM  137



>dbj|BAJ87627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDlly---sirrsldsslssklllHQPQH-YGW  411
            PFT  QWQELEHQALIYKYM SG+P+P DLL           +  +S  L   PQ   GW
Sbjct  21   PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRRSFLLDSALATSPSLAFPPQATLGW  80

Query  412  NYFQMGFGKK-IDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI  579
              F MGFG+K  DPEPGRCRRTDGKKWRCSR+  PD KYCE+H H+ + RSRKPVE+
Sbjct  81   GCFGMGFGRKPEDPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGKNRSRKPVEM  137



>ref|XP_006411855.1| hypothetical protein EUTSA_v10024915mg [Eutrema salsugineum]
 gb|ESQ53308.1| hypothetical protein EUTSA_v10024915mg [Eutrema salsugineum]
Length=524

 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 82/115 (71%), Gaps = 6/115 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP  LL  I++S     S       P  +GW  F 
Sbjct  154  PFTLTQWAELEQQALIYKYITANVPVPSSLLIPIKKSFYPYGSLP-----PSSFGWGTFH  208

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            +GF G  +DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE+QS
Sbjct  209  LGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQS  263



>ref|XP_009420425.1| PREDICTED: growth-regulating factor 5-like [Musa acuminata subsp. 
malaccensis]
Length=348

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +1

Query  217  MMSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQP  396
            M  GGR+  PFT  QWQELEHQALIYKY+++G+PVPP+L+  I+RS ++        H P
Sbjct  10   MGMGGRA--PFTAAQWQELEHQALIYKYLMAGVPVPPELVIPIQRSFEALAGRYY--HHP  65

Query  397  QHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
                 +Y+    GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  66   ALAYCSYY----GKKLDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  121



>gb|AAP45172.2| hypothetical protein SBB1_14t00021 [Solanum bulbocastanum]
Length=552

 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +     H P     +Y
Sbjct  28   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFEAISARFF--HHPSLGYCSY  85

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            +    GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  86   Y----GKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  134



>ref|XP_010685313.1| PREDICTED: growth-regulating factor 5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=277

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = +1

Query  232  RSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQH-YG  408
            RS  PFT  QW+ELE Q L +KY++SG+PVPP L  ++  +  +S SS L  +Q    +G
Sbjct  11   RSPFPFTASQWKELEQQLLTFKYLISGVPVPPQLFSNVITNPFASSSSTLFPYQQSLPFG  70

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            W  FQ+G+G+KIDPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + +++K +++ S
Sbjct  71   WGCFQVGYGRKIDPEPGRCRRTDGKKWRCSKEAFPDSKYCEKHMHRGKNKTKKHIQVFS  129



>ref|XP_010267408.1| PREDICTED: growth-regulating factor 7-like isoform X1 [Nelumbo 
nucifera]
Length=550

 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELE QALIYKYM+  + VPPDLL  I  +L   + S    H     G   
Sbjct  136  RFPFTSAQWQELERQALIYKYMMGSVAVPPDLLMPITINLSDPVVS----HSTGGRG-PC  190

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F + F    DPEPGRCRRTDGKKWRCSRDV PDQKYCERH H+ RPRSRKPVE Q   N 
Sbjct  191  FNLRFSNSTDPEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVEQQPESN-  249

Query  598  PNHNNNYPVTVPSFQFPATASCDQNRFLLIPK  693
             N N   P +       A  + +    L + K
Sbjct  250  -NLNTRSPASACLSNLTANTNNNPESSLFLSK  280



>ref|XP_010267409.1| PREDICTED: growth-regulating factor 7-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010267410.1| PREDICTED: growth-regulating factor 7-like isoform X2 [Nelumbo 
nucifera]
Length=535

 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 89/152 (59%), Gaps = 7/152 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELE QALIYKYM+  + VPPDLL  I  +L   + S    H     G   
Sbjct  121  RFPFTSAQWQELERQALIYKYMMGSVAVPPDLLMPITINLSDPVVS----HSTGGRG-PC  175

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            F + F    DPEPGRCRRTDGKKWRCSRDV PDQKYCERH H+ RPRSRKPVE Q   N 
Sbjct  176  FNLRFSNSTDPEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVEQQPESN-  234

Query  598  PNHNNNYPVTVPSFQFPATASCDQNRFLLIPK  693
             N N   P +       A  + +    L + K
Sbjct  235  -NLNTRSPASACLSNLTANTNNNPESSLFLSK  265



>ref|XP_011075906.1| PREDICTED: growth-regulating factor 2-like [Sesamum indicum]
Length=507

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 12/152 (8%)
 Frame = +1

Query  241  LPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYF  420
             PFT  QW+ELE QA+IYKYM+S +PVPPDLL+ + RS  ++ ++        ++G    
Sbjct  118  FPFTSAQWKELERQAMIYKYMMSSVPVPPDLLFPLSRSFPTAAAAVDSSASSLYHGR---  174

Query  421  QMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEI----QSH  588
               + K  DPEPGRC+RTDGKKWRCSRDV P QKYCERH H+ RPRSRKPVE+    +SH
Sbjct  175  ---YSKNGDPEPGRCKRTDGKKWRCSRDVAPHQKYCERHLHRGRPRSRKPVEVKNNGESH  231

Query  589  KNSPNHNNNYPVTVPSFQFPATASCDQNRFLL  684
            K +    ++ P + PS QF   A+ DQ   L 
Sbjct  232  KKTRLEQSSLPNSTPSQQF--VAANDQPLMLF  261



>ref|XP_010919180.1| PREDICTED: growth-regulating factor 10-like [Elaeis guineensis]
Length=275

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            SR  FT +Q QELEHQALIYKYMV+G+PVP  L   +      + +S    H P   G+ 
Sbjct  64   SRPAFTFLQLQELEHQALIYKYMVAGVPVP--LHLVLPIWKSVAAASYGPHHYPSFMGYG  121

Query  415  YFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
               + +   ++PEPGRCRRTDGKKWRCSRDV+PDQKYCERH H+ R RSRKPVE  S
Sbjct  122  SLCLDYRNSMEPEPGRCRRTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVEAGS  178



>ref|XP_010679671.1| PREDICTED: growth-regulating factor 2-like [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 83/115 (72%), Gaps = 2/115 (2%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldssl--ssklllHQPQHYGW  411
            R PFT  QW ELEHQA+IYKY+ + +PVP +LL  IR++L SS      +  + P  YGW
Sbjct  152  RGPFTPAQWIELEHQAMIYKYLTANVPVPANLLIPIRKALSSSGFPGFSIGSYPPHSYGW  211

Query  412  NYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
              F +GF    DPEPGRCRRTDGKKWRCSRD +PDQKYCERH ++ R RSRKPVE
Sbjct  212  GAFHLGFSGSTDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVE  266



>ref|XP_007018432.1| Growth-regulating factor 1 [Theobroma cacao]
 gb|EOY15657.1| Growth-regulating factor 1 [Theobroma cacao]
Length=614

 Score =   135 bits (339),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslssklllHQPQHYG  408
            +R PFT  QW ELEHQALIYKY+ + +P+P +LL             S    L +P   G
Sbjct  149  ARGPFTPSQWMELEHQALIYKYITANVPIPSNLLIPIRKALDSADFSSFSGGLLRPNTLG  208

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            W  F +GF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE QS
Sbjct  209  WGTFHLGFSNNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQS  267



>emb|CDX69322.1| BnaC01g01310D [Brassica napus]
Length=461

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP     S                 P  +GW  F 
Sbjct  145  PFTLTQWAELEQQALIYKYITANVPVP-----SSLLISIQKSFYPYRSFPPSSFGWGTFH  199

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GF G K+DPEPGRCRRTDGKKWRCS+D +P+QKYCERH ++ R RSRKPVE+Q
Sbjct  200  LGFAGGKMDPEPGRCRRTDGKKWRCSKDAVPEQKYCERHINRGRHRSRKPVEVQ  253



>ref|XP_011074968.1| PREDICTED: growth-regulating factor 4-like [Sesamum indicum]
Length=357

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELE QA+IYKY+V+G+PVPPDL+  IRR  +S  +     H P   G+  
Sbjct  24   RAPFTAVQWQELEQQAMIYKYLVAGLPVPPDLVMPIRRGFESLSARFG--HHPS-LGYGS  80

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +   +GKK DPEPGRCRRTDGKKWRCS+D   D KYCERH H+ R RSRKPVE  S   S
Sbjct  81   Y---YGKKFDPEPGRCRRTDGKKWRCSKDAHTDSKYCERHMHRGRNRSRKPVESHSTSQS  137



>ref|XP_009606791.1| PREDICTED: growth-regulating factor 4-like, partial [Nicotiana 
tomentosiformis]
Length=337

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 83/113 (73%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS D+  S         H   +Y
Sbjct  14   RPPFTAVQWQELEHQAMIYKYLVAGLPVPPDLVVPIRRSFDAISSRFF-----NHPSLSY  68

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
                +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  69   CSY-YGKKFDPEPGRCRRTDGKKWRCSKDAHPDSKYCERHMHRGRNRSRKPVE  120



>gb|AFB74089.1| growth-regulating factor 2 [Brassica napus]
Length=461

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT+ QW ELE QALIYKY+ + +PVP     S                 P  +GW  F 
Sbjct  145  PFTLTQWAELEQQALIYKYITANVPVP-----SSLLISIQKSFYPYRSFPPSSFGWGTFH  199

Query  424  MGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
            +GF G K+DPEPGRCRRTDGKKWRCS+D +P+QKYCERH ++ R RSRKPVE+Q
Sbjct  200  LGFAGGKMDPEPGRCRRTDGKKWRCSKDAVPEQKYCERHINRGRHRSRKPVEVQ  253



>ref|XP_007039372.1| Growth-regulating factor 8, putative isoform 3 [Theobroma cacao]
 gb|EOY23873.1| Growth-regulating factor 8, putative isoform 3 [Theobroma cacao]
Length=487

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 86/132 (65%), Gaps = 16/132 (12%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            +R PFT  QWQELE Q +IYKYM +  PVPPDL   +                P +    
Sbjct  131  ARAPFTAAQWQELERQTMIYKYMTASEPVPPDLPIPLT-------------RNPSNVIKG  177

Query  415  YFQMGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK  591
              ++GF G   DPEP RCRRTDGKKWRCSRDV PDQKYCERH+HK+RPRSRKPVE+ +H 
Sbjct  178  SLELGFSGNSSDPEPWRCRRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVELPNH-  236

Query  592  NSPNHNNNYPVT  627
             S N+N++ P T
Sbjct  237  -SVNNNDHKPHT  247



>ref|XP_007039370.1| Growth-regulating factor 8, putative isoform 1 [Theobroma cacao]
 ref|XP_007039371.1| Growth-regulating factor 8, putative isoform 1 [Theobroma cacao]
 ref|XP_007039373.1| Growth-regulating factor 8, putative isoform 1 [Theobroma cacao]
 gb|EOY23871.1| Growth-regulating factor 8, putative isoform 1 [Theobroma cacao]
 gb|EOY23872.1| Growth-regulating factor 8, putative isoform 1 [Theobroma cacao]
 gb|EOY23874.1| Growth-regulating factor 8, putative isoform 1 [Theobroma cacao]
Length=491

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 86/132 (65%), Gaps = 16/132 (12%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            +R PFT  QWQELE Q +IYKYM +  PVPPDL   +                P +    
Sbjct  135  ARAPFTAAQWQELERQTMIYKYMTASEPVPPDLPIPLT-------------RNPSNVIKG  181

Query  415  YFQMGF-GKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK  591
              ++GF G   DPEP RCRRTDGKKWRCSRDV PDQKYCERH+HK+RPRSRKPVE+ +H 
Sbjct  182  SLELGFSGNSSDPEPWRCRRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVELPNH-  240

Query  592  NSPNHNNNYPVT  627
             S N+N++ P T
Sbjct  241  -SVNNNDHKPHT  251



>gb|EAZ24805.1| hypothetical protein OsJ_08584 [Oryza sativa Japonica Group]
Length=360

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 80/118 (68%), Gaps = 5/118 (4%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDlly---sirrsldsslssklllHQPQ-HYGW  411
            PFT  QWQELEHQALIYKYM SG P+P DL+           +  +S  L   PQ   GW
Sbjct  18   PFTASQWQELEHQALIYKYMASGTPIPSDLILPLRRSFLLDSALATSPSLAFPPQPSLGW  77

Query  412  NYFQMGFGKKI-DPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
              F MGFG+K  DPEPGRCRRTDGKKWRCS++  PD KYCE+H H+ + RSRKPVE+ 
Sbjct  78   GCFGMGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVEMS  135



>ref|XP_010314819.1| PREDICTED: growth-regulating factor 4-like isoform X3 [Solanum 
lycopersicum]
Length=296

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 89/137 (65%), Gaps = 10/137 (7%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVP DL+  IRRS +   +     H P     +Y
Sbjct  10   RPPFTAVQWQELEHQAMIYKYLVAGIPVPADLVVPIRRSFEPISARFF--HHPSLGYCSY  67

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHK--  591
            +    GKK DPEPGRCRRTDGKKWRC++D  PD KYCERH H+ R RSRK VE QS    
Sbjct  68   Y----GKKFDPEPGRCRRTDGKKWRCAKDAYPDSKYCERHMHRGRNRSRKHVESQSTAQS  123

Query  592  --NSPNHNNNYPVTVPS  636
               S +HN     T  S
Sbjct  124  LLTSMSHNTTGSTTGSS  140



>ref|XP_010314820.1| PREDICTED: growth-regulating factor 4-like isoform X4 [Solanum 
lycopersicum]
Length=294

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVP DL+  IRRS +   +     H P     +Y
Sbjct  10   RPPFTAVQWQELEHQAMIYKYLVAGIPVPADLVVPIRRSFEPISARFF--HHPSLGYCSY  67

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
            +    GKK DPEPGRCRRTDGKKWRC++D  PD KYCERH H+ R RSRK VE QS   S
Sbjct  68   Y----GKKFDPEPGRCRRTDGKKWRCAKDAYPDSKYCERHMHRGRNRSRKHVESQSTAQS  123



>ref|XP_009790531.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009790532.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
sylvestris]
Length=349

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 93/146 (64%), Gaps = 11/146 (8%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  IRRS ++  +         H    Y
Sbjct  15   RPPFTAVQWQELEHQAMIYKYLVAGIPVPPDLVVPIRRSFEAISARFF-----HHTSLGY  69

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
                +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH ++ R RSRK VE QS   S
Sbjct  70   CSY-YGKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMNRGRNRSRKHVESQSTSQS  128

Query  598  -----PNHNNNYPVTVPSFQFPATAS  660
                  N+      T  +FQ  ++ S
Sbjct  129  LLTSMSNNATGSSKTSGNFQSSSSGS  154



>ref|XP_009588672.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=348

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT +QWQELEHQA+IYKY+V+G+PVPPDL+  I+RS ++  +         H    Y
Sbjct  15   RPPFTAVQWQELEHQAMIYKYLVAGIPVPPDLVLPIQRSFETISARFF-----HHTSLGY  69

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
                +GKK DPEPGRCRRTDGKKWRCS+D  PD KYCERH ++ R RSRK VE QS   S
Sbjct  70   CSY-YGKKFDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMNRGRNRSRKHVESQSTSQS  128



>ref|XP_003580449.1| PREDICTED: growth-regulating factor 3-like [Brachypodium distachyon]
Length=393

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = +1

Query  247  FTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQM  426
            FT  Q++ELE QALIYKY+V+G+PVPPDLL  IRR  DS  S   L H    YG +YF  
Sbjct  64   FTAAQYEELEQQALIYKYLVAGVPVPPDLLLPIRRGFDSLASRFYLHHAALGYGSSYF--  121

Query  427  GFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQ  582
              GKK+DPEPGRCRRTDGKKWRCS++   D KYCERH H+ R RSRKPVE Q
Sbjct  122  --GKKLDPEPGRCRRTDGKKWRCSKEAAQDSKYCERHMHRGRNRSRKPVETQ  171



>ref|XP_007136458.1| hypothetical protein PHAVU_009G047000g [Phaseolus vulgaris]
 gb|ESW08452.1| hypothetical protein PHAVU_009G047000g [Phaseolus vulgaris]
Length=594

 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 80/125 (64%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  LPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYF  420
             PFT  QW+ELE QA+IYKYM++ +PVPPDLL     +  S     +  + P       F
Sbjct  137  FPFTSAQWRELERQAMIYKYMMASVPVPPDLLIHTSLTSSSRSVCSM--NDPLLSLDGGF  194

Query  421  QMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNSP  600
             +      DPEPGRCRRTDGKKWRCSRDV P+ KYCERH H+ RPRSRKPVE+ +   +P
Sbjct  195  NLRLASSTDPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVEVNTKTTTP  254

Query  601  NHNNN  615
               NN
Sbjct  255  TSINN  259



>ref|XP_008803299.1| PREDICTED: growth-regulating factor 10-like isoform X2 [Phoenix 
dactylifera]
Length=224

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            SR  FT +Q QELEHQALIYKYMV+G+PVP  L   +      + SS    H P   G+ 
Sbjct  20   SRPAFTFMQLQELEHQALIYKYMVAGVPVP--LHLVLPIWKSVAASSYGPHHCPSFMGYG  77

Query  415  YFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               + +   ++PEPGRCRRTDGKKWRCSRDV+PDQKYCERH H+ R RSRKPVE
Sbjct  78   SLCLDYRNSMEPEPGRCRRTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  131



>gb|KDO40072.1| hypothetical protein CISIN_1g0182081mg, partial [Citrus sinensis]
 gb|KDO40073.1| hypothetical protein CISIN_1g0182081mg, partial [Citrus sinensis]
Length=190

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 86/118 (73%), Gaps = 6/118 (5%)
 Frame = +1

Query  244  PFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNYFQ  423
            PFT  QW ELEHQALI+KY+ +G+PVPPDLL  IR SL    SS    H P  +G+  + 
Sbjct  13   PFTASQWHELEHQALIFKYLKAGLPVPPDLLVPIRTSLKFLSSSLF--HHPT-FGYCSY-  68

Query  424  MGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQSHKNS  597
              FGKKIDPEPGRCRRTDGKKWRCS+D  P+ KYCERH +++R RSRKPVE Q+   S
Sbjct  69   --FGKKIDPEPGRCRRTDGKKWRCSKDAHPNSKYCERHMNRSRYRSRKPVESQNTSQS  124



>ref|XP_002320016.2| hypothetical protein POPTR_0014s01320g [Populus trichocarpa]
 gb|EEE98331.2| hypothetical protein POPTR_0014s01320g [Populus trichocarpa]
Length=517

 Score =   133 bits (334),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldssl--ssklllHQPQHYG  408
            +R PFT  QW ELEHQALIYKY+ + +P+P +LL  IR++LDS+   S      +P    
Sbjct  55   TRWPFTQSQWMELEHQALIYKYIAANVPIPSNLLLPIRKALDSAGFPSFSAGFFRPNTLP  114

Query  409  WNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVEIQS  585
            W  F MGF    DPEPGRCRRTDGKKWRCSRD + DQKYCERH ++ R RSRKPVE QS
Sbjct  115  WGAFHMGFSSNTDPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEGQS  173



>ref|XP_010917179.1| PREDICTED: growth-regulating factor 1-like [Elaeis guineensis]
Length=349

 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 10/129 (8%)
 Frame = +1

Query  217  MMSGGRS--RLPFTVIQWQELEHQALIYKYMVSGMPVPPDlly--sirrsldsslsskll  384
            MMSG  S  R PFT  QWQELEHQALI+KYM SG+P+P DL+        LDS+++S  L
Sbjct  1    MMSGRSSSCRHPFTPSQWQELEHQALIFKYMASGIPIPSDLILPLRRSYLLDSTITSPTL  60

Query  385  lHQPQ---HYGWNYFQMGFGKKID-PEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNR  552
               PQ   ++GWN  Q+GFG+K D PEPGRCRRTDGKKWRC+++  PD KYCERH H+ +
Sbjct  61   AFPPQPSMNWGWN--QVGFGRKADDPEPGRCRRTDGKKWRCAKEAYPDSKYCERHMHRGK  118

Query  553  PRSRKPVEI  579
             RSRKPVE+
Sbjct  119  NRSRKPVEM  127



>ref|XP_010943629.1| PREDICTED: growth-regulating factor 4-like isoform X1 [Elaeis 
guineensis]
Length=355

 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 86/113 (76%), Gaps = 6/113 (5%)
 Frame = +1

Query  238  RLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWNY  417
            R PFT  QWQELEHQALI+KY+++G+PVPPDLL  IRRS +++ +     H P   G+  
Sbjct  11   RPPFTASQWQELEHQALIFKYIMAGVPVPPDLLIPIRRSFEAAPARFY--HHPA-LGYCS  67

Query  418  FQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
            F   +GKK+DPEPGRCRRTDGKKWRCS+D  PD KYCERH H+ R RSRKPVE
Sbjct  68   F---YGKKLDPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVE  117



>ref|XP_008803298.1| PREDICTED: growth-regulating factor 10-like isoform X1 [Phoenix 
dactylifera]
Length=267

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  235  SRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssklllHQPQHYGWN  414
            SR  FT +Q QELEHQALIYKYMV+G+PVP  L   +      + SS    H P   G+ 
Sbjct  63   SRPAFTFMQLQELEHQALIYKYMVAGVPVP--LHLVLPIWKSVAASSYGPHHCPSFMGYG  120

Query  415  YFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPVE  576
               + +   ++PEPGRCRRTDGKKWRCSRDV+PDQKYCERH H+ R RSRKPVE
Sbjct  121  SLCLDYRNSMEPEPGRCRRTDGKKWRCSRDVVPDQKYCERHMHRGRNRSRKPVE  174



>ref|XP_008337024.1| PREDICTED: growth-regulating factor 1-like [Malus domestica]
Length=311

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = +1

Query  220  MSGGRSRLPFTVIQWQELEHQALIYKYMVSGMPVPPDllysirrsldsslssk--lllHQ  393
            ++GG+   PFT  QW ELEHQALIYKY+ + MP+P  LL  I+++LDS+  S     L +
Sbjct  131  IAGGKG--PFTPSQWMELEHQALIYKYITANMPIPSTLLVPIKKALDSAGFSTFPNGLLR  188

Query  394  PQHYGWNYFQMGFGKKIDPEPGRCRRTDGKKWRCSRDVLPDQKYCERHAHKNRPRSRKPV  573
            P   GW    +GF    DPEPGRCRRTDGKKWRC RD +PDQKYCERH ++ R RSRKPV
Sbjct  189  PNSLGWGSIHLGFSNNTDPEPGRCRRTDGKKWRCWRDAVPDQKYCERHMNRGRHRSRKPV  248

Query  574  EIQS  585
            E Q+
Sbjct  249  EGQT  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4885834314610