BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23481_g1_i5 len=1406 path=[1498:0-223 1722:224-233 3747:234-249
1748:250-1021 2520:1022-1179 2792:1180-1405]

Length=1406
                                                                      Score     E

ref|XP_009589062.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    579   0.0      
ref|XP_009589060.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    575   0.0      
ref|XP_009803600.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    574   0.0      
ref|XP_010317225.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    568   0.0      
ref|XP_010317224.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    568   0.0      
ref|XP_004233537.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    568   0.0      
ref|XP_009803599.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    567   0.0      
ref|XP_006346977.1|  PREDICTED: RNA pseudouridine synthase 5-like...    565   0.0      
ref|XP_006346975.1|  PREDICTED: RNA pseudouridine synthase 5-like...    561   0.0      
ref|XP_009589057.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    561   0.0      
ref|XP_009589056.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    557   0.0      
ref|XP_009589063.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    553   0.0      
ref|XP_010099639.1|  RNA pseudourine synthase 5                         543   0.0      
gb|KHG01532.1|  hypothetical protein F383_21699                         541   0.0      
gb|AES62203.2|  pseudouridine synthase Rlu family protein               538   0.0      
ref|XP_007009784.1|  Pseudouridine synthase family protein              535   0.0      
ref|XP_010067287.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    534   0.0      
ref|XP_003591952.1|  RNA pseudourine synthase                           533   0.0      
ref|XP_006485880.1|  PREDICTED: RNA pseudouridine synthase 5-like...    533   0.0      
ref|XP_008233344.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    533   0.0      
ref|XP_010658419.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    530   0.0      
ref|XP_009333717.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    529   0.0      
ref|XP_004307403.1|  PREDICTED: RNA pseudourine synthase 5-like         528   0.0      
ref|XP_006485879.1|  PREDICTED: RNA pseudouridine synthase 5-like...    528   0.0      
ref|XP_011031774.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    526   0.0      
ref|XP_010067286.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    527   0.0      
ref|XP_007143685.1|  hypothetical protein PHAVU_007G093000g             526   0.0      
ref|XP_004496322.1|  PREDICTED: RNA pseudourine synthase 5-like         525   0.0      
ref|XP_002312025.1|  hypothetical protein POPTR_0008s04160g             524   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009333716.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    525   0.0      
gb|EYU39826.1|  hypothetical protein MIMGU_mgv1a008941mg                523   0.0      
ref|XP_008381972.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    524   0.0      
ref|XP_011031773.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    522   2e-180   
emb|CDO99732.1|  unnamed protein product                                521   1e-179   
gb|KDP25730.1|  hypothetical protein JCGZ_23951                         520   2e-179   
emb|CBI31488.3|  unnamed protein product                                514   7e-178   
ref|XP_003556222.1|  PREDICTED: RNA pseudouridine synthase 5-like       515   8e-178   
ref|XP_006346978.1|  PREDICTED: RNA pseudouridine synthase 5-like...    514   1e-177   
ref|XP_011084348.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    513   9e-177   
ref|XP_010669646.1|  PREDICTED: RNA pseudouridine synthase 5            509   1e-175   
ref|XP_010524607.1|  PREDICTED: RNA pseudouridine synthase 5            506   6e-174   
ref|XP_010253582.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    503   9e-173   
ref|XP_010253580.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    499   7e-171   
ref|XP_004143830.1|  PREDICTED: RNA pseudourine synthase 5-like         491   3e-168   
ref|XP_004157313.1|  PREDICTED: RNA pseudourine synthase 5-like         490   5e-168   
ref|XP_006291291.1|  hypothetical protein CARUB_v10017427mg             487   1e-166   
ref|XP_006403820.1|  hypothetical protein EUTSA_v10010446mg             486   5e-166   
ref|XP_010253584.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    484   1e-165   
ref|XP_008465672.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    484   2e-165   
ref|NP_974416.1|  RNA pseudourine synthase 5                            482   7e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515681.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    482   1e-164   
ref|XP_010426837.1|  PREDICTED: RNA pseudouridine synthase 5-like...    481   4e-164   
ref|XP_002877851.1|  pseudouridine synthase family protein              480   1e-163   
ref|XP_008465671.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    476   2e-162   
ref|XP_009384912.1|  PREDICTED: RNA pseudouridine synthase 5            476   3e-162   
emb|CAC07917.1|  putative protein                                       475   4e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136663.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    475   4e-162   
gb|KEH43531.1|  pseudouridine synthase Rlu family protein               471   9e-161   
ref|XP_010503961.1|  PREDICTED: RNA pseudouridine synthase 5-like...    472   9e-161   
ref|XP_008789068.1|  PREDICTED: RNA pseudouridine synthase 5            471   1e-159   
gb|KEH43532.1|  pseudouridine synthase Rlu family protein               466   1e-159   
gb|KFK34479.1|  hypothetical protein AALP_AA5G150800                    468   3e-159   
emb|CDY29071.1|  BnaC07g32770D                                          473   4e-159   
gb|KGN51212.1|  hypothetical protein Csa_5G492340                       471   7e-159   
ref|XP_009589059.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    468   8e-159   
ref|XP_011031775.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    462   9e-158   
ref|XP_008233345.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    464   1e-157   
ref|XP_006651272.1|  PREDICTED: RNA pseudouridine synthase 5-like       464   1e-157   
ref|XP_009136664.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    462   3e-157   
ref|XP_009589058.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    463   6e-157   
ref|XP_004984840.1|  PREDICTED: RNA pseudouridine synthase 5-like       462   2e-156   
emb|CDX90612.1|  BnaA03g41690D                                          462   4e-155   
sp|Q0DST9.2|PUS5_ORYSJ  RecName: Full=RNA pseudouridine synthase ...    458   4e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008666437.1|  PREDICTED: uncharacterized protein LOC100272...    458   1e-154   
ref|XP_008381973.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    454   4e-154   
ref|XP_010253583.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    454   7e-154   
ref|XP_010253585.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    452   6e-153   
gb|ADE76199.1|  unknown                                                 450   5e-152   
dbj|BAJ90823.1|  predicted protein                                      449   8e-152   
ref|XP_008666433.1|  PREDICTED: uncharacterized protein LOC100272...    450   3e-151   
ref|XP_011031776.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    442   5e-150   
ref|XP_010067288.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    439   8e-149   
ref|XP_006850660.1|  hypothetical protein AMTR_s00034p00221180          441   1e-148   
ref|XP_003561739.1|  PREDICTED: RNA pseudouridine synthase 5            440   5e-148   
ref|NP_001190071.1|  RNA pseudourine synthase 5                         441   7e-148   
gb|ACG32783.1|  RNA binding protein                                     439   8e-148   Zea mays [maize]
ref|XP_009589064.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    437   2e-147   
ref|XP_008666447.1|  PREDICTED: uncharacterized protein LOC100272...    439   2e-147   
gb|EEE58845.1|  hypothetical protein OsJ_10432                          441   3e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010503958.1|  PREDICTED: RNA pseudouridine synthase 5-like...    436   7e-147   
gb|EEC75014.1|  hypothetical protein OsI_11092                          437   5e-146   Oryza sativa Indica Group [Indian rice]
ref|XP_010658421.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    429   2e-145   
ref|XP_006436267.1|  hypothetical protein CICLE_v10033672mg             426   7e-144   
gb|KCW65383.1|  hypothetical protein EUGRSUZ_G02814                     425   9e-143   
ref|XP_008666441.1|  PREDICTED: uncharacterized protein LOC100272...    420   5e-140   
ref|XP_010503959.1|  PREDICTED: RNA pseudouridine synthase 5-like...    411   1e-137   
ref|XP_010253587.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    410   2e-137   
ref|XP_011084349.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    405   1e-135   
ref|XP_011084350.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    405   1e-135   
ref|XP_010503960.1|  PREDICTED: RNA pseudouridine synthase 5-like...    386   3e-128   
ref|XP_010658420.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    387   4e-128   
ref|NP_190794.2|  RNA pseudourine synthase 5                            385   8e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426838.1|  PREDICTED: RNA pseudouridine synthase 5-like...    385   8e-128   
ref|XP_010515682.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    384   3e-127   
gb|AAL47436.1|  AT3g52260/T25B15_30                                     381   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966274.1|  hypothetical protein SELMODRAFT_168290             369   1e-120   
ref|XP_008348838.1|  PREDICTED: RNA pseudouridine synthase 5-like       348   1e-113   
gb|KCW65384.1|  hypothetical protein EUGRSUZ_G02814                     345   4e-113   
ref|XP_001782556.1|  predicted protein                                  349   6e-113   
gb|EPS61385.1|  hypothetical protein M569_13411                         324   1e-104   
gb|ACF82287.1|  unknown                                                 280   7e-88    Zea mays [maize]
ref|XP_007218491.1|  hypothetical protein PRUPE_ppa012152mg             273   4e-86    
tpg|DAA44821.1|  TPA: RNA binding protein                               272   1e-84    
ref|XP_010937816.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    269   2e-83    
gb|KDO48453.1|  hypothetical protein CISIN_1g0371672mg                  261   4e-81    
ref|WP_012161585.1|  RNA pseudouridine synthase                         260   3e-79    
ref|WP_010479722.1|  RNA pseudouridine synthase                         254   8e-77    
ref|WP_019505772.1|  hypothetical protein                               252   4e-76    
ref|WP_015957119.1|  RNA pseudouridine synthase                         252   5e-76    
gb|KDO48454.1|  hypothetical protein CISIN_1g0371671mg                  244   5e-75    
ref|WP_021834593.1|  Ribosomal large subunit pseudouridine syntha...    245   2e-73    
ref|WP_007312027.1|  RNA pseudouridine synthase                         243   8e-73    
ref|XP_002952009.1|  pseudouridine synthase                             244   2e-72    
ref|WP_021830810.1|  Ribosomal large subunit pseudouridine syntha...    242   2e-72    
ref|WP_013324343.1|  RNA pseudouridine synthase                         242   3e-72    
gb|EMT21167.1|  RNA pseudourine synthase 5                              239   6e-72    
ref|WP_007306953.1|  RNA pseudouridine synthase                         239   5e-71    
ref|WP_006512461.1|  pseudouridine synthase, RluA family                238   1e-70    
ref|WP_008275394.1|  RNA pseudouridine synthase                         238   1e-70    
ref|WP_017287903.1|  hypothetical protein                               237   2e-70    
ref|WP_012628632.1|  RNA pseudouridine synthase                         235   1e-69    
ref|WP_039730479.1|  pseudouridine synthase                             233   5e-69    
ref|WP_017298821.1|  hypothetical protein                               233   1e-68    
ref|WP_023172359.1|  ribosomal large subunit pseudouridine syntha...    233   1e-68    
ref|WP_012597171.1|  RNA pseudouridine synthase                         232   2e-68    
ref|WP_015785023.1|  RNA pseudouridine synthase                         231   4e-68    
ref|WP_035987890.1|  pseudouridine synthase                             231   5e-68    
ref|XP_001699192.1|  pseudouridine synthase                             229   2e-67    Chlamydomonas reinhardtii
ref|WP_002748287.1|  pseudouridine synthase, RluA family protein        229   3e-67    
ref|WP_036486096.1|  pseudouridine synthase                             228   5e-67    
ref|WP_002781323.1|  putative enzyme                                    227   2e-66    
ref|WP_008318400.1|  pseudouridine synthase, RluA family                227   2e-66    
ref|WP_015171825.1|  RluA family pseudouridine synthase                 226   4e-66    
ref|WP_002790931.1|  RNA pseudouridine synthase                         226   5e-66    
ref|WP_017711187.1|  hypothetical protein                               226   7e-66    
ref|WP_002751629.1|  RNA pseudouridine synthase                         225   8e-66    
ref|WP_017324732.1|  hypothetical protein                               225   1e-65    
ref|WP_009545186.1|  RNA pseudouridine synthase                         224   1e-65    
ref|WP_016514714.1|  Ribosomal large subunit pseudouridine syntha...    224   1e-65    
ref|WP_012362224.1|  RNA pseudouridine synthase                         224   2e-65    
ref|WP_002786331.1|  RNA pseudouridine synthase                         224   2e-65    
ref|WP_006618102.1|  RNA pseudouridine synthase                         224   3e-65    
ref|WP_008203075.1|  RNA pseudouridine synthase                         224   3e-65    
ref|WP_013613801.1|  RNA pseudouridine synthase                         223   4e-65    
ref|WP_002738905.1|  pseudouridine synthase, RluA family protein        223   5e-65    
ref|WP_036533621.1|  pseudouridine synthase                             223   8e-65    
ref|WP_024970894.1|  pseudouridine synthase                             222   1e-64    
ref|WP_002778900.1|  RNA pseudouridine synthase                         222   2e-64    
ref|WP_012264949.1|  RNA pseudouridine synthase                         220   6e-64    
ref|XP_010937818.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    217   6e-64    
ref|WP_002759126.1|  RNA pseudouridine synthase                         222   7e-64    
gb|ADC36159.1|  RluA family pseudouridine synthase                      221   7e-64    
ref|WP_019586506.1|  hypothetical protein                               220   9e-64    
ref|WP_031499912.1|  pseudouridine synthase                             219   1e-63    
ref|WP_034339682.1|  pseudouridine synthase                             219   1e-63    
ref|WP_002800981.1|  RNA pseudouridine synthase                         219   1e-63    
ref|WP_008052599.1|  RNA pseudouridine synthase                         219   1e-63    
ref|WP_012694389.1|  RNA pseudouridine synthase                         219   2e-63    
ref|WP_006624308.1|  MULTISPECIES: RNA pseudouridine synthase           219   2e-63    
dbj|GAL95412.1|  ribosomal large subunit pseudouridine synthase D       219   2e-63    
ref|WP_002772370.1|  RNA pseudouridine synthase                         218   4e-63    
ref|WP_031293173.1|  pseudouridine synthase                             217   1e-62    
gb|ESA35471.1|  rna pseudouridine synthase                              217   1e-62    
gb|EKV01348.1|  pseudouridine synthase, RluA family                     218   1e-62    
ref|WP_002798703.1|  RNA pseudouridine synthase                         216   2e-62    
ref|WP_015234542.1|  RluA family pseudouridine synthase                 215   7e-62    
ref|WP_014266545.1|  RNA pseudouridine synthase                         214   1e-61    
ref|WP_034418839.1|  pseudouridine synthase                             214   1e-61    
ref|WP_034386068.1|  pseudouridine synthase                             213   4e-61    
ref|WP_011687503.1|  RNA pseudouridine synthase                         210   4e-60    
ref|WP_027479905.1|  pseudouridine synthase                             210   6e-60    
gb|AIE75346.1|  Ribosomal large subunit pseudouridine synthase D        210   7e-60    
ref|WP_015133700.1|  RluA family pseudouridine synthase                 209   1e-59    
ref|XP_010937817.1|  PREDICTED: RNA pseudouridine synthase 5 isof...    207   1e-59    
ref|WP_030006609.1|  pseudouridine synthase                             209   1e-59    
ref|WP_010888319.1|  RNA pseudouridine synthase                         209   2e-59    
ref|WP_036020494.1|  pseudouridine synthase                             208   2e-59    
ref|WP_039686325.1|  pseudouridine synthase                             208   3e-59    
ref|WP_011699724.1|  RNA pseudouridine synthase                         207   4e-59    
dbj|BAM50701.1|  hypothetical protein BEST7613_1770                     206   2e-58    
ref|WP_013555281.1|  RNA pseudouridine synthase                         206   2e-58    
ref|WP_006455298.1|  RNA pseudouridine synthase                         206   3e-58    
ref|WP_029482221.1|  pseudouridine synthase                             205   3e-58    
ref|XP_010910995.1|  PREDICTED: RNA pseudouridine synthase 5-like       197   3e-57    
ref|WP_015896040.1|  RNA pseudouridine synthase                         200   3e-56    
ref|WP_013570615.1|  RNA pseudouridine synthase                         200   4e-56    
ref|WP_038531674.1|  pseudouridine synthase                             199   5e-56    
gb|KDO36326.1|  hypothetical protein CISIN_1g041166mg                   194   6e-56    
ref|WP_017869581.1|  MULTISPECIES: hypothetical protein                 198   1e-55    
ref|WP_014398758.1|  RNA pseudouridine synthase                         199   1e-55    
ref|WP_017304633.1|  hypothetical protein                               198   1e-55    
ref|WP_026853933.1|  pseudouridine synthase                             198   2e-55    
ref|WP_011555199.1|  RNA pseudouridine synthase                         198   2e-55    
ref|WP_026114309.1|  pseudouridine synthase                             197   2e-55    
ref|WP_013941775.1|  RNA pseudouridine synthase                         197   3e-55    
ref|WP_027463159.1|  pseudouridine synthase                             196   1e-54    
ref|WP_002637447.1|  RNA pseudouridine synthase                         196   1e-54    
ref|WP_022801230.1|  RNA pseudouridine synthase                         195   3e-54    
ref|WP_005031786.1|  RNA pseudouridine synthase                         194   4e-54    
ref|WP_024545511.1|  pseudouridine synthase                             194   4e-54    
ref|WP_011131407.1|  pseudouridine synthase                             195   5e-54    
ref|WP_013580605.1|  RNA pseudouridine synthase                         194   5e-54    
ref|WP_011531341.1|  RNA pseudouridine synthase                         194   7e-54    
ref|WP_011140187.1|  RNA pseudouridine synthase                         194   7e-54    
ref|WP_027892639.1|  pseudouridine synthase                             192   4e-53    
ref|XP_007220366.1|  hypothetical protein PRUPE_ppa016984mg             186   4e-53    
ref|WP_011827290.1|  pseudouridine synthase                             193   4e-53    
ref|WP_012307762.1|  RNA pseudouridine synthase                         190   9e-53    
ref|WP_010871616.1|  RNA pseudouridine synthase                         190   2e-52    
gb|KGG27122.1|  Pseudouridine synthase                                  190   4e-52    
ref|WP_036912972.1|  MULTISPECIES: pseudouridine synthase               190   4e-52    
gb|KFA86731.1|  pseudouridine synthase                                  189   4e-52    
gb|ABF95377.1|  pseudouridine synthase family protein, putative, ...    186   4e-52    Oryza sativa Japonica Group [Japonica rice]
ref|WP_034404242.1|  pseudouridine synthase                             189   4e-52    
ref|WP_027460263.1|  pseudouridine synthase                             189   6e-52    
ref|WP_019010972.1|  hypothetical protein                               188   2e-51    
gb|EAQ76692.1|  Pseudouridine synthase                                  184   4e-50    Synechococcus sp. WH 5701
ref|WP_037981177.1|  pseudouridine synthase                             184   5e-50    
ref|WP_002614167.1|  RNA pseudouridine synthase                         183   5e-50    
ref|WP_010313395.1|  pseudouridine synthase                             181   5e-49    
ref|WP_002627459.1|  Ribosomal large subunit pseudouridine syntha...    180   1e-48    
ref|XP_005767427.1|  hypothetical protein EMIHUDRAFT_43988              179   1e-48    
ref|XP_005780575.1|  hypothetical protein EMIHUDRAFT_44091              179   1e-48    
ref|WP_006910140.1|  pseudouridine synthase                             181   2e-48    
gb|EMS51962.1|  RNA pseudourine synthase 5                              179   7e-48    
ref|WP_034358669.1|  pseudouridine synthase                             176   5e-47    
ref|WP_014785626.1|  RNA pseudouridine synthase                         174   1e-46    
ref|WP_014685701.1|  RNA pseudouridine synthase                         169   1e-44    
gb|KEF42526.1|  pseudouridine synthase                                  170   2e-44    
ref|WP_010305171.1|  pseudouridine synthase                             168   7e-44    
ref|NP_001049785.1|  Os03g0288500                                       160   4e-43    Oryza sativa Japonica Group [Japonica rice]
ref|WP_038001808.1|  pseudouridine synthase                             165   7e-43    
ref|WP_035830602.1|  pseudouridine synthase                             164   1e-42    
ref|WP_015110385.1|  23S RNA-specific pseudouridylate synthase          165   2e-42    
ref|WP_007099135.1|  pseudouridine synthase                             157   7e-40    
gb|EAQ70555.1|  probable pseudouridine synthase                         153   1e-38    Synechococcus sp. RS9917
ref|WP_037991475.1|  pseudouridine synthase                             149   2e-37    
ref|WP_038004644.1|  pseudouridine synthase                             146   4e-36    
ref|WP_011934195.1|  pseudouridine synthase                             143   4e-35    
tpg|DAA44823.1|  TPA: hypothetical protein ZEAMMB73_153874              136   9e-35    
gb|AHF64844.1|  putative pseudouridine synthase                         142   1e-34    
ref|WP_011129141.1|  pseudouridine synthase                             141   2e-34    
gb|ABF95376.1|  pseudouridine synthase family protein, putative, ...    133   1e-33    Oryza sativa Japonica Group [Japonica rice]
ref|WP_013908463.1|  pseudouridine synthase                             138   2e-33    
ref|NP_001140345.1|  uncharacterized protein LOC100272393               132   3e-33    Zea mays [maize]
ref|WP_008214646.1|  RNA pseudouridine synthase                         137   6e-33    
ref|WP_011360848.1|  pseudouridine synthase                             137   6e-33    
ref|WP_013275817.1|  pseudouridine synthase                             135   2e-32    
ref|WP_015587383.1|  Ribosomal large subunit pseudouridylate synt...    135   2e-32    
ref|WP_009757019.1|  RNA pseudouridine synthase                         134   6e-32    
emb|CCY33292.1|  pseudouridine synthase                                 134   8e-32    
ref|WP_026515876.1|  pseudouridine synthase                             134   9e-32    
ref|WP_022434972.1|  pseudouridine synthase                             133   1e-31    
ref|WP_014035213.1|  pseudouridine synthase                             133   1e-31    
ref|WP_035167159.1|  pseudouridine synthase                             132   2e-31    
ref|WP_022226276.1|  pseudouridine synthase                             132   2e-31    
ref|WP_022238323.1|  pseudouridine synthase                             132   3e-31    
ref|WP_028128843.1|  pseudouridine synthase                             132   3e-31    
ref|WP_025578430.1|  pseudouridine synthase                             131   5e-31    
ref|WP_022493147.1|  pseudouridine synthase                             131   5e-31    
ref|WP_026648680.1|  pseudouridine synthase                             131   6e-31    
ref|WP_008703141.1|  MULTISPECIES: RNA pseudouridine synthase           131   6e-31    
ref|WP_009788779.1|  pseudouridine synthase                             130   1e-30    
ref|WP_011703012.1|  ribosomal large subunit pseudouridine syntha...    130   1e-30    
ref|WP_016413369.1|  pseudouridine synthase                             130   1e-30    
ref|WP_039701803.1|  hypothetical protein                               130   1e-30    
gb|EFR86933.1|  ribosomal large subunit pseudouridine synthase D        129   2e-30    
ref|WP_015825569.1|  RNA pseudouridine synthase                         130   2e-30    
ref|WP_014093559.1|  ribosomal large subunit pseudouridine syntha...    129   2e-30    
ref|WP_033609829.1|  pseudouridine synthase                             129   2e-30    
ref|WP_005842483.1|  pseudouridine synthase                             129   2e-30    
ref|WP_003644387.1|  RNA pseudouridine synthase                         129   2e-30    
ref|WP_011101547.1|  RNA pseudouridine synthase                         129   2e-30    
gb|EPD23608.1|  Pseudouridine synthase                                  129   3e-30    
ref|WP_022297080.1|  pseudouridine synthase                             129   3e-30    
ref|WP_039651637.1|  pseudouridine synthase                             129   3e-30    
ref|WP_017750788.1|  hypothetical protein                               129   3e-30    
gb|EMP45198.1|  Pseudouridine synthase                                  129   3e-30    
ref|WP_038547157.1|  pseudouridine synthase                             129   3e-30    
ref|WP_015640389.1|  Pseudouridine synthase                             129   3e-30    
ref|WP_012986290.1|  ribosomal large subunit pseudouridine syntha...    128   4e-30    
ref|WP_017895564.1|  hypothetical protein                               128   4e-30    
ref|WP_024971772.1|  pseudouridine synthase                             128   5e-30    
ref|WP_013852005.1|  RNA pseudouridine synthase                         128   6e-30    
gb|EFS02383.1|  ribosomal large subunit pseudouridine synthase, R...    128   6e-30    
ref|WP_026957646.1|  MULTISPECIES: 23S rRNA pseudouridylate synthase    129   6e-30    
ref|WP_022338927.1|  pseudouridine synthase                             128   6e-30    
ref|WP_006675655.1|  RNA pseudouridine synthase                         129   6e-30    
ref|WP_003554019.1|  RNA pseudouridine synthase                         128   6e-30    
ref|WP_003749201.1|  ribosomal large subunit pseudouridine syntha...    127   6e-30    
ref|WP_003730863.1|  ribosomal large subunit pseudouridine syntha...    127   8e-30    
ref|WP_033142443.1|  pseudouridine synthase                             128   8e-30    
ref|WP_034688198.1|  pseudouridine synthase                             127   8e-30    
gb|EFK30374.1|  pseudouridine synthase, RluA family                     128   8e-30    
ref|WP_022112978.1|  ribosomal large subunit pseudouridine syntha...    128   8e-30    
ref|WP_033395925.1|  pseudouridine synthase                             128   9e-30    
ref|WP_024624987.1|  pseudouridine synthase                             128   9e-30    
ref|WP_034550138.1|  pseudouridine synthase                             127   9e-30    
ref|WP_013778546.1|  pseudouridine synthase                             128   9e-30    
ref|WP_002573097.1|  RluA family pseudouridine synthase [               127   9e-30    
ref|WP_029607196.1|  pseudouridine synthase                             127   9e-30    
ref|WP_015560546.1|  ribosomal large subunit pseudouridine syntha...    127   1e-29    
gb|ACU78595.1|  ribosomal large subunit pseudouridine synthase D        127   1e-29    
ref|WP_013729669.1|  pseudouridine synthase                             127   1e-29    
ref|WP_006858335.1|  RNA pseudouridine synthase                         127   1e-29    
ref|WP_038329867.1|  pseudouridine synthase                             127   1e-29    
ref|WP_035028141.1|  pseudouridine synthase                             127   1e-29    
ref|WP_007063845.1|  RNA pseudouridine synthase                         127   1e-29    
gb|EFR96044.1|  ribosomal large subunit pseudouridine synthase, R...    127   1e-29    
ref|WP_021895076.1|  pseudouridine synthase                             127   1e-29    
ref|WP_002574666.1|  RluA family pseudouridine synthase [               127   2e-29    
ref|WP_002591814.1|  RluA family pseudouridine synthase [               127   2e-29    
ref|WP_034452174.1|  pseudouridine synthase                             127   2e-29    
ref|WP_002567718.1|  RluA family pseudouridine synthase [               127   2e-29    
ref|WP_010739187.1|  RluA family pseudouridine synthase                 127   2e-29    
ref|WP_011166761.1|  pseudouridine synthase                             127   2e-29    
ref|WP_020280259.1|  pseudouridine synthase D                           127   2e-29    
ref|WP_003560449.1|  MULTISPECIES: RNA pseudouridine synthase           127   2e-29    
ref|WP_013120698.1|  pseudouridine synthase                             127   2e-29    
ref|WP_021731509.1|  MULTISPECIES: pseudouridylate synthase             127   2e-29    
ref|WP_007037171.1|  RNA pseudouridine synthase [                       126   2e-29    
ref|WP_003723376.1|  ribosomal large subunit pseudouridine syntha...    126   2e-29    
ref|WP_022358646.1|  pseudouridine synthase                             127   2e-29    
ref|WP_003693968.1|  RNA pseudouridine synthase                         126   2e-29    
ref|WP_028544994.1|  pseudouridine synthase                             127   2e-29    
ref|WP_032089341.1|  pseudouridine synthase                             126   2e-29    
ref|WP_003725923.1|  ribosomal large subunit pseudouridine syntha...    126   2e-29    
ref|WP_013447709.1|  pseudouridine synthase                             126   2e-29    
ref|WP_012951916.1|  ribosomal large subunit pseudouridine syntha...    126   2e-29    
gb|EGJ25827.1|  Ribosomal large subunit pseudouridine synthase          126   2e-29    
ref|WP_003731874.1|  ribosomal large subunit pseudouridine syntha...    126   3e-29    
ref|WP_016407687.1|  pseudouridine synthase                             126   3e-29    
ref|WP_010744825.1|  RluA family pseudouridine synthase                 126   3e-29    
ref|WP_006504803.1|  RNA pseudouridine synthase                         126   3e-29    
ref|WP_020435557.1|  pseudouridine synthase                             126   3e-29    
ref|WP_032076615.1|  pseudouridine synthase                             126   3e-29    
ref|WP_011234434.1|  23S rRNA pseudouridine synthase D                  127   3e-29    
ref|WP_038152097.1|  pseudouridine synthase                             127   3e-29    
ref|WP_028414321.1|  pseudouridine synthase                             126   3e-29    
ref|WP_002583174.1|  RNA pseudouridine synthase [                       126   3e-29    
ref|WP_013110844.1|  pseudouridine synthase                             126   3e-29    
ref|WP_027624705.1|  pseudouridine synthase                             126   3e-29    
ref|WP_003763612.1|  ribosomal large subunit pseudouridine syntha...    125   3e-29    
ref|WP_024746335.1|  pseudouridine synthase                             126   4e-29    
ref|WP_022424986.1|  pseudouridine synthase                             125   4e-29    
ref|WP_009854440.1|  RNA pseudouridine synthase                         125   4e-29    
ref|WP_022201854.1|  pseudouridine synthase                             125   4e-29    
ref|WP_017697736.1|  pseudouridine synthase                             126   4e-29    
ref|WP_022774457.1|  RNA pseudouridine synthase                         125   4e-29    
ref|XP_004352927.1|  pseudouridine synthase, RluD, putative             124   4e-29    
ref|WP_003739599.1|  ribosomal large subunit pseudouridine syntha...    125   5e-29    
ref|WP_011099817.1|  RNA pseudouridine synthase                         125   5e-29    
ref|WP_035109592.1|  pseudouridine synthase                             125   5e-29    
gb|EFR83739.1|  ribosomal large subunit pseudouridine synthase D        125   5e-29    
ref|WP_021966587.1|  pseudouridine synthase                             125   5e-29    
ref|WP_014073412.1|  RNA pseudouridine synthase                         125   6e-29    
ref|WP_004696468.1|  pseudouridine synthase                             125   6e-29    
ref|WP_022280928.1|  pseudouridine synthase                             125   6e-29    
ref|WP_006941886.1|  pseudouridine synthase                             125   6e-29    
ref|WP_012963348.1|  RNA pseudouridine synthase                         125   7e-29    
ref|WP_006916109.1|  RNA pseudouridine synthase                         125   7e-29    
ref|WP_015639172.1|  Ribosomal large subunit pseudouridine syntha...    125   8e-29    
ref|WP_003065357.1|  RNA pseudouridine synthase                         125   8e-29    
ref|WP_022777129.1|  RNA pseudouridine synthase                         125   8e-29    
ref|WP_014462581.1|  RNA pseudouridine synthase                         125   8e-29    
ref|WP_023519621.1|  pseudouridylate synthase                           125   8e-29    
ref|WP_003768052.1|  ribosomal large subunit pseudouridine syntha...    124   8e-29    
ref|WP_004563208.1|  RNA pseudouridine synthase                         125   8e-29    
ref|WP_014291468.1|  23S rRNA pseudouridine synthase D                  125   9e-29    
ref|WP_036431725.1|  pseudouridine synthase                             125   1e-28    
ref|WP_022346166.1|  pseudouridine synthase                             124   1e-28    
ref|WP_014294754.1|  RNA pseudouridine synthase                         124   1e-28    
ref|WP_036722717.1|  pseudouridine synthase                             124   1e-28    
ref|WP_008398206.1|  RNA pseudouridine synthase                         124   1e-28    
ref|WP_036376983.1|  pseudouridine synthase                             124   1e-28    
emb|CDI68893.1|  Pseudouridine synthase                                 124   1e-28    
ref|WP_035154447.1|  pseudouridine synthase                             125   1e-28    
ref|WP_026666774.1|  MULTISPECIES: pseudouridine synthase               124   1e-28    
ref|WP_026651192.1|  pseudouridine synthase                             124   1e-28    
ref|WP_021656342.1|  pseudouridine synthase, RluA family                124   1e-28    
ref|WP_033580671.1|  pseudouridine synthase                             124   1e-28    
ref|WP_014939971.1|  RNA pseudouridine synthase                         124   1e-28    
ref|WP_021336558.1|  RNA pseudouridine synthase                         124   1e-28    
ref|WP_031580763.1|  pseudouridine synthase                             124   1e-28    
ref|WP_027414518.1|  pseudouridine synthase                             124   1e-28    
ref|WP_019223390.1|  ribosomal large subunit pseudouridine syntha...    125   1e-28    
ref|WP_019420621.1|  RNA pseudouridine synthase                         124   1e-28    
ref|WP_037289864.1|  pseudouridine synthase                             124   1e-28    
ref|WP_004429829.1|  Ribosomal large subunit pseudouridylate synt...    124   2e-28    
ref|WP_021350106.1|  RNA pseudouridine synthase                         124   2e-28    
ref|WP_022172511.1|  pseudouridine synthase                             124   2e-28    
ref|WP_035951869.1|  pseudouridine synthase                             124   2e-28    
ref|WP_022398644.1|  pseudouridine synthase                             124   2e-28    
ref|WP_013727895.1|  RNA pseudouridine synthase                         124   2e-28    
ref|WP_012991172.1|  RNA pseudouridine synthase                         124   2e-28    
gb|EEI22036.1|  pseudouridine synthase, RluA family                     124   2e-28    
ref|WP_003698359.1|  RNA pseudouridine synthase                         124   2e-28    
ref|WP_031566174.1|  23S rRNA pseudouridylate synthase                  124   2e-28    
ref|WP_035431064.1|  pseudouridine synthase                             124   2e-28    
ref|WP_012864598.1|  pseudouridine synthase                             124   2e-28    
ref|WP_039655699.1|  pseudouridine synthase                             124   2e-28    
ref|WP_031588571.1|  pseudouridine synthase                             124   2e-28    
gb|KHJ56858.1|  pseudouridine synthase                                  124   2e-28    
ref|WP_012754758.1|  ribosomal large subunit pseudouridine syntha...    124   2e-28    
ref|WP_034654563.1|  pseudouridine synthase                             124   2e-28    
ref|WP_007002830.1|  ribosomal large subunit pseudouridine syntha...    124   2e-28    
gb|AHV98358.1|  RluA family pseudouridine synthase                      124   2e-28    
ref|WP_022344398.1|  pseudouridine synthase                             124   2e-28    
ref|WP_038136905.1|  pseudouridine synthase                             124   2e-28    
ref|WP_018593921.1|  RNA pseudouridine synthase                         124   2e-28    
ref|WP_005386023.1|  pseudouridine synthase                             124   2e-28    
ref|WP_006531208.1|  RNA pseudouridine synthase                         123   2e-28    
ref|WP_006589151.1|  ribosomal large subunit pseudouridine syntha...    124   2e-28    
ref|WP_016762937.1|  RNA pseudouridine synthase                         123   2e-28    
ref|WP_003729943.1|  ribosomal large subunit pseudouridine syntha...    123   2e-28    
ref|WP_005689385.1|  RNA pseudouridine synthase                         123   2e-28    
ref|WP_004047734.1|  RluA family pseudouridine synthase                 123   3e-28    
ref|WP_008982379.1|  RNA pseudouridine synthase                         123   3e-28    
ref|WP_039696716.1|  pseudouridine synthase                             123   3e-28    
ref|WP_035800413.1|  pseudouridine synthase                             123   3e-28    
ref|WP_021170581.1|  pseudouridine synthase, RluA family                124   3e-28    
ref|WP_017196291.1|  ribosomal large subunit pseudouridine syntha...    124   3e-28    
ref|WP_027642442.1|  pseudouridine synthase [                           123   3e-28    
ref|WP_035452642.1|  pseudouridine synthase                             124   3e-28    
ref|WP_008908669.1|  RNA pseudouridine synthase                         123   3e-28    
ref|WP_004101521.1|  RNA pseudouridine synthase                         122   3e-28    
ref|WP_019936027.1|  23S rRNA pseudouridine synthase D                  124   3e-28    
ref|WP_011025786.1|  RNA pseudouridine synthase                         123   3e-28    
ref|WP_039261331.1|  pseudouridine synthase                             123   3e-28    
ref|WP_026512953.1|  pseudouridine synthase                             123   3e-28    
ref|WP_013030164.1|  ribosomal large subunit pseudouridine syntha...    124   3e-28    
ref|WP_021871522.1|  pseudouridine synthase                             123   4e-28    
ref|WP_021256736.1|  MULTISPECIES: RluA family pseudouridine synt...    123   4e-28    
ref|WP_028971621.1|  pseudouridine synthase                             123   4e-28    
ref|WP_021258082.1|  RluA family pseudouridine synthase                 123   4e-28    
ref|WP_010494239.1|  RNA pseudouridine synthase                         123   4e-28    
ref|WP_004698573.1|  pseudouridine synthase                             123   4e-28    
ref|WP_029071189.1|  pseudouridine synthase                             123   4e-28    
ref|WP_015948117.1|  RluA family pseudouridine synthase                 123   4e-28    
ref|WP_036106970.1|  RNA pseudouridine synthase                         122   4e-28    
ref|WP_004860600.1|  ribosomal large subunit pseudouridine syntha...    123   4e-28    
ref|WP_034697864.1|  pseudouridine synthase                             123   4e-28    
ref|WP_035310957.1|  pseudouridine synthase                             123   4e-28    
ref|WP_002832308.1|  pseudouridine synthase                             122   4e-28    
ref|WP_026586177.1|  RNA pseudouridine synthase                         122   4e-28    
ref|WP_022035716.1|  putative uncharacterized protein                   123   4e-28    
gb|AHD12769.1|  23S rRNA pseudouridine synthase D                       123   4e-28    
ref|WP_024864282.1|  pseudouridine synthase                             123   5e-28    
ref|WP_028314571.1|  hypothetical protein                               123   5e-28    
ref|WP_010719218.1|  RluA family pseudouridine synthase                 122   5e-28    
ref|WP_004221872.1|  RNA pseudouridine synthase                         122   5e-28    
ref|WP_009609540.1|  RNA pseudouridine synthase                         123   5e-28    
ref|WP_029934991.1|  pseudouridine synthase                             123   5e-28    
ref|WP_004854206.1|  ribosomal large subunit pseudouridine syntha...    123   5e-28    
gb|EUJ27042.1|  hypothetical protein LMUR_11087                         122   5e-28    
ref|WP_003541631.1|  MULTISPECIES: pseudouridine synthase               122   5e-28    
ref|WP_013081629.1|  RNA pseudouridine synthase                         122   5e-28    
ref|WP_022462863.1|  pseudouridine synthase                             122   5e-28    
ref|WP_033571331.1|  pseudouridine synthase                             122   5e-28    
ref|WP_006925641.1|  ribosomal large subunit pseudouridine syntha...    123   6e-28    
ref|WP_022304327.1|  pseudouridine synthase                             122   6e-28    
ref|WP_010753754.1|  RluA family pseudouridine synthase                 122   6e-28    
ref|WP_025753001.1|  pseudouridine synthase                             122   6e-28    
ref|WP_003666200.1|  RNA pseudouridine synthase                         122   6e-28    
ref|WP_022182784.1|  putative uncharacterized protein                   122   6e-28    
ref|WP_013055256.1|  RNA pseudouridine synthase                         122   6e-28    
ref|WP_022268731.1|  pseudouridine synthase                             122   6e-28    
ref|WP_032963480.1|  pseudouridine synthase                             122   7e-28    
ref|WP_006922947.1|  ribosomal large subunit pseudouridine syntha...    123   7e-28    
ref|WP_026033024.1|  MULTISPECIES: pseudouridine synthase               122   7e-28    
ref|WP_009353690.1|  pseudouridine synthase                             122   7e-28    
ref|WP_012391393.1|  RNA pseudouridine synthase                         122   7e-28    
ref|WP_029320717.1|  pseudouridine synthase                             122   7e-28    
ref|WP_006956161.1|  23S rRNA pseudouridine synthase D                  122   7e-28    
ref|WP_019253618.1|  RNA pseudouridine synthase                         122   7e-28    
ref|WP_034489832.1|  pseudouridine synthase                             122   7e-28    
ref|WP_003758558.1|  RNA pseudouridine synthase                         122   7e-28    
ref|WP_023438529.1|  ribosomal large subunit pseudouridine synthaseD    122   7e-28    
ref|WP_005718723.1|  ribosomal large subunit pseudouridine syntha...    122   7e-28    
ref|WP_022452088.1|  pseudouridine synthase                             122   7e-28    
ref|WP_021630309.1|  pseudouridine synthase, RluA family                121   7e-28    
ref|WP_020089294.1|  RNA pseudouridine synthase                         122   8e-28    
ref|WP_034483637.1|  pseudouridine synthase                             122   8e-28    
ref|WP_008609818.1|  23S rRNA pseudouridine synthase D                  122   8e-28    
ref|WP_022588765.1|  RNA pseudouridine synthase                         122   8e-28    
ref|WP_027217434.1|  pseudouridine synthase                             122   8e-28    
ref|WP_021816256.1|  RNA pseudouridine synthase                         122   8e-28    
ref|WP_028126378.1|  pseudouridine synthase                             122   8e-28    
ref|WP_009610096.1|  RNA pseudouridine synthase                         122   8e-28    
ref|WP_035455226.1|  pseudouridine synthase                             122   9e-28    



>ref|XP_009589062.1| PREDICTED: RNA pseudouridine synthase 5 isoform X6 [Nicotiana 
tomentosiformis]
Length=381

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/358 (78%), Positives = 322/358 (90%), Gaps = 2/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWPEFNDGLTYHD+VRP DAGLTLIEFYSRKYK+SAPLQGWLQRIQNKQIT+D +VV
Sbjct  16    FGEPWPEFNDGLTYHDMVRPIDAGLTLIEFYSRKYKSSAPLQGWLQRIQNKQITVDSKVV  75

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             + PD  L  G +LVYHRLPW+EP+APY+L+VLFEDD +IALNKPSGLQVLPGGLFQQRTV
Sbjct  76    TIPDTELRAGTELVYHRLPWREPDAPYLLQVLFEDDYLIALNKPSGLQVLPGGLFQQRTV  135

Query  458   LTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+GTS+V
Sbjct  136   LTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAEGTSVV  195

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             ++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  196   EDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIKYPGVAKGLYVASPSGKP  254

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP CFDP+
Sbjct  255   ALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPKCFDPE  314

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLPSIL+  +E
Sbjct  315   LMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNELIKITAPLPSILQTREE  372



>ref|XP_009589060.1| PREDICTED: RNA pseudouridine synthase 5 isoform X5 [Nicotiana 
tomentosiformis]
Length=386

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/363 (77%), Positives = 323/363 (89%), Gaps = 7/363 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWPEFNDGLTYHD+VRP DAGLTLIEFYSRKYK+SAPLQGWLQRIQNKQIT+D +VV
Sbjct  16    FGEPWPEFNDGLTYHDMVRPIDAGLTLIEFYSRKYKSSAPLQGWLQRIQNKQITVDSKVV  75

Query  278   SNPDASLS-----PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLF  442
             + PD  LS      G +LVYHRLPW+EP+APY+L+VLFEDD +IALNKPSGLQVLPGGLF
Sbjct  76    TIPDTELSFWMSRAGTELVYHRLPWREPDAPYLLQVLFEDDYLIALNKPSGLQVLPGGLF  135

Query  443   QQRTVLTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             QQRTVLTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+
Sbjct  136   QQRTVLTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAE  195

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             GTS+V++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QPIG ++YPGVAKGLYVAS
Sbjct  196   GTSVVEDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIKYPGVAKGLYVAS  254

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
             PSGKPALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP 
Sbjct  255   PSGKPALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPK  314

Query  980   CFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
             CFDP+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLPSIL+ 
Sbjct  315   CFDPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNELIKITAPLPSILQT  374

Query  1160  SQE  1168
              +E
Sbjct  375   REE  377



>ref|XP_009803600.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Nicotiana 
sylvestris]
Length=384

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/358 (78%), Positives = 321/358 (90%), Gaps = 2/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGE W EFNDGLTYHD+VR  DAGLTLIEFYSRKYK+SAPLQGWLQRIQNKQIT+DG+VV
Sbjct  19    FGETWREFNDGLTYHDIVRRIDAGLTLIEFYSRKYKSSAPLQGWLQRIQNKQITVDGKVV  78

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             + PD  L  G +LVYHRLPW+EP+APY+L+VLFED+ +IALNKPSGLQVLPGGLFQQRTV
Sbjct  79    TIPDTELRAGTELVYHRLPWREPDAPYLLQVLFEDNYLIALNKPSGLQVLPGGLFQQRTV  138

Query  458   LTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+GTS+V
Sbjct  139   LTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAEGTSVV  198

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             ++K Y+N E  ++RKI KIYRALVSGVI+ DE+VI+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  199   EDK-YTNSECKKMRKISKIYRALVSGVIDMDEVVIKQPIGTIKYPGVAKGLYVASPSGKP  257

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+VRVLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP CFDP+
Sbjct  258   ALSSVRVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPKCFDPE  317

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLPSIL+  +E
Sbjct  318   LMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNELIQITAPLPSILQTREE  375



>ref|XP_010317225.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Solanum lycopersicum]
 ref|XP_010317226.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Solanum lycopersicum]
 ref|XP_010317227.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Solanum lycopersicum]
Length=379

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/368 (76%), Positives = 320/368 (87%), Gaps = 6/368 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ N+GL+YHD+VRP+DAGLTLIEFY RKYKNSAPLQGWLQRIQNKQITIDG+VV
Sbjct  14    FGVPWPQRNEGLSYHDIVRPTDAGLTLIEFYFRKYKNSAPLQGWLQRIQNKQITIDGKVV  73

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
               PD  L  GA+LVYHRLPW+EP+APY+LEVLFEDD +I +NKPSGLQVLPGGL+QQRTV
Sbjct  74    ILPDTELRAGAELVYHRLPWREPDAPYLLEVLFEDDYLIVVNKPSGLQVLPGGLYQQRTV  133

Query  458   LTQLQWRAsklsslsssGE-SHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW A KL++ SS  + +HPVPVHRLGRGTSGILLCAKTKL KSRL+AYFA+GTS+V
Sbjct  134   LTQLQWHACKLTTTSSGCQKTHPVPVHRLGRGTSGILLCAKTKLCKSRLAAYFAEGTSVV  193

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             +EK  +N E   +RKI KIYRALVSGV++ DE VI+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  194   EEK-CTNSECNTMRKICKIYRALVSGVMDMDEAVIKQPIGTIKYPGVAKGLYVASPSGKP  252

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+VRVLER  E NCTLV+VEIQSGRPHQIRIHLSFIG+PLIGDPLY+ GGQP CF P+
Sbjct  253   ALSSVRVLERDSESNCTLVQVEIQSGRPHQIRIHLSFIGYPLIGDPLYVSGGQPKCFHPE  312

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC*  1174
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLP+IL+   E  
Sbjct  313   LLDESFEKDGGYQRPENPVPGDCGYNLHAHQIGLIHPITNELIKITAPLPAILQTRDE--  370

Query  1175  K*REGSNP  1198
               RE + P
Sbjct  371   --REANQP  376



>ref|XP_010317224.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Solanum lycopersicum]
Length=393

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/368 (76%), Positives = 320/368 (87%), Gaps = 6/368 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ N+GL+YHD+VRP+DAGLTLIEFY RKYKNSAPLQGWLQRIQNKQITIDG+VV
Sbjct  28    FGVPWPQRNEGLSYHDIVRPTDAGLTLIEFYFRKYKNSAPLQGWLQRIQNKQITIDGKVV  87

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
               PD  L  GA+LVYHRLPW+EP+APY+LEVLFEDD +I +NKPSGLQVLPGGL+QQRTV
Sbjct  88    ILPDTELRAGAELVYHRLPWREPDAPYLLEVLFEDDYLIVVNKPSGLQVLPGGLYQQRTV  147

Query  458   LTQLQWRAsklsslsssGE-SHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW A KL++ SS  + +HPVPVHRLGRGTSGILLCAKTKL KSRL+AYFA+GTS+V
Sbjct  148   LTQLQWHACKLTTTSSGCQKTHPVPVHRLGRGTSGILLCAKTKLCKSRLAAYFAEGTSVV  207

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             +EK  +N E   +RKI KIYRALVSGV++ DE VI+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  208   EEK-CTNSECNTMRKICKIYRALVSGVMDMDEAVIKQPIGTIKYPGVAKGLYVASPSGKP  266

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+VRVLER  E NCTLV+VEIQSGRPHQIRIHLSFIG+PLIGDPLY+ GGQP CF P+
Sbjct  267   ALSSVRVLERDSESNCTLVQVEIQSGRPHQIRIHLSFIGYPLIGDPLYVSGGQPKCFHPE  326

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC*  1174
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLP+IL+   E  
Sbjct  327   LLDESFEKDGGYQRPENPVPGDCGYNLHAHQIGLIHPITNELIKITAPLPAILQTRDE--  384

Query  1175  K*REGSNP  1198
               RE + P
Sbjct  385   --REANQP  390



>ref|XP_004233537.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Solanum lycopersicum]
Length=402

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/368 (76%), Positives = 320/368 (87%), Gaps = 6/368 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ N+GL+YHD+VRP+DAGLTLIEFY RKYKNSAPLQGWLQRIQNKQITIDG+VV
Sbjct  37    FGVPWPQRNEGLSYHDIVRPTDAGLTLIEFYFRKYKNSAPLQGWLQRIQNKQITIDGKVV  96

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
               PD  L  GA+LVYHRLPW+EP+APY+LEVLFEDD +I +NKPSGLQVLPGGL+QQRTV
Sbjct  97    ILPDTELRAGAELVYHRLPWREPDAPYLLEVLFEDDYLIVVNKPSGLQVLPGGLYQQRTV  156

Query  458   LTQLQWRAsklsslsssGE-SHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW A KL++ SS  + +HPVPVHRLGRGTSGILLCAKTKL KSRL+AYFA+GTS+V
Sbjct  157   LTQLQWHACKLTTTSSGCQKTHPVPVHRLGRGTSGILLCAKTKLCKSRLAAYFAEGTSVV  216

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             +EK  +N E   +RKI KIYRALVSGV++ DE VI+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  217   EEK-CTNSECNTMRKICKIYRALVSGVMDMDEAVIKQPIGTIKYPGVAKGLYVASPSGKP  275

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+VRVLER  E NCTLV+VEIQSGRPHQIRIHLSFIG+PLIGDPLY+ GGQP CF P+
Sbjct  276   ALSSVRVLERDSESNCTLVQVEIQSGRPHQIRIHLSFIGYPLIGDPLYVSGGQPKCFHPE  335

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC*  1174
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLP+IL+   E  
Sbjct  336   LLDESFEKDGGYQRPENPVPGDCGYNLHAHQIGLIHPITNELIKITAPLPAILQTRDE--  393

Query  1175  K*REGSNP  1198
               RE + P
Sbjct  394   --REANQP  399



>ref|XP_009803599.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Nicotiana 
sylvestris]
Length=393

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/367 (76%), Positives = 321/367 (87%), Gaps = 11/367 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG---------LTLIEFYSRKYKNSAPLQGWLQRIQNK  250
             FGE W EFNDGLTYHD+VR  DAG         LTLIEFYSRKYK+SAPLQGWLQRIQNK
Sbjct  19    FGETWREFNDGLTYHDIVRRIDAGFLFCAKSTGLTLIEFYSRKYKSSAPLQGWLQRIQNK  78

Query  251   QITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLP  430
             QIT+DG+VV+ PD  L  G +LVYHRLPW+EP+APY+L+VLFED+ +IALNKPSGLQVLP
Sbjct  79    QITVDGKVVTIPDTELRAGTELVYHRLPWREPDAPYLLQVLFEDNYLIALNKPSGLQVLP  138

Query  431   GGLFQQRTVLTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSA  607
             GGLFQQRTVLTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+A
Sbjct  139   GGLFQQRTVLTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAA  198

Query  608   YFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGL  787
             YFA+GTS+V++K Y+N E  ++RKI KIYRALVSGVI+ DE+VI+QPIG ++YPGVAKGL
Sbjct  199   YFAEGTSVVEDK-YTNSECKKMRKISKIYRALVSGVIDMDEVVIKQPIGTIKYPGVAKGL  257

Query  788   YVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
             YVASPSGKPALS+VRVLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ G
Sbjct  258   YVASPSGKPALSSVRVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSG  317

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             GQP CFDP+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLPS
Sbjct  318   GQPKCFDPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNELIQITAPLPS  377

Query  1148  ILKASQE  1168
             IL+  +E
Sbjct  378   ILQTREE  384



>ref|XP_006346977.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X3 [Solanum 
tuberosum]
Length=374

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/358 (76%), Positives = 315/358 (88%), Gaps = 2/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG  WPE N+GLTYHD+VRP+DAGL LIEFY RKYKNSAPLQGWLQRIQNKQITIDG+VV
Sbjct  14    FGVSWPELNEGLTYHDIVRPTDAGLMLIEFYFRKYKNSAPLQGWLQRIQNKQITIDGKVV  73

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
               PD  L  GA+LVYHRLPW+EP+APY+LEVLF+DD +I +NKPSGLQVLPGGL+QQRTV
Sbjct  74    ILPDTELRAGAELVYHRLPWREPDAPYLLEVLFQDDYLIVVNKPSGLQVLPGGLYQQRTV  133

Query  458   LTQLQWRAsklsslsssGE-SHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW A K ++ SS  + +HPVPVHRLGRGTSGILLCAKTKL KSRL+AYFA+GTS+V
Sbjct  134   LTQLQWHACKPTTTSSGCQKTHPVPVHRLGRGTSGILLCAKTKLCKSRLAAYFAEGTSVV  193

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             ++K  +N E   +RKI KIYRALVSGV++ DE+VI+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  194   EDK-CTNSECNTMRKICKIYRALVSGVMDMDEVVIKQPIGTIKYPGVAKGLYVASPSGKP  252

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+VRVLER  E NCTLV+VEIQSGRPHQIRIHLSFIG+PLIGDPLY+ GGQP CF P+
Sbjct  253   ALSSVRVLERDSENNCTLVQVEIQSGRPHQIRIHLSFIGYPLIGDPLYVSGGQPKCFHPE  312

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLP+IL+  +E
Sbjct  313   LMDESFEKDGGYQRPENPVPGDCGYNLHAHQIGLIHPITNELIKITAPLPAILQTREE  370



>ref|XP_006346975.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346976.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X2 [Solanum 
tuberosum]
Length=379

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/363 (75%), Positives = 316/363 (87%), Gaps = 7/363 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG  WPE N+GLTYHD+VRP+DAGL LIEFY RKYKNSAPLQGWLQRIQNKQITIDG+VV
Sbjct  14    FGVSWPELNEGLTYHDIVRPTDAGLMLIEFYFRKYKNSAPLQGWLQRIQNKQITIDGKVV  73

Query  278   SNPDASLS-----PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLF  442
               PD  LS      GA+LVYHRLPW+EP+APY+LEVLF+DD +I +NKPSGLQVLPGGL+
Sbjct  74    ILPDTELSFWMCRAGAELVYHRLPWREPDAPYLLEVLFQDDYLIVVNKPSGLQVLPGGLY  133

Query  443   QQRTVLTQLQWRAsklsslsssGE-SHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             QQRTVLTQLQW A K ++ SS  + +HPVPVHRLGRGTSGILLCAKTKL KSRL+AYFA+
Sbjct  134   QQRTVLTQLQWHACKPTTTSSGCQKTHPVPVHRLGRGTSGILLCAKTKLCKSRLAAYFAE  193

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             GTS+V++K  +N E   +RKI KIYRALVSGV++ DE+VI+QPIG ++YPGVAKGLYVAS
Sbjct  194   GTSVVEDK-CTNSECNTMRKICKIYRALVSGVMDMDEVVIKQPIGTIKYPGVAKGLYVAS  252

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
             PSGKPALS+VRVLER  E NCTLV+VEIQSGRPHQIRIHLSFIG+PLIGDPLY+ GGQP 
Sbjct  253   PSGKPALSSVRVLERDSENNCTLVQVEIQSGRPHQIRIHLSFIGYPLIGDPLYVSGGQPK  312

Query  980   CFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
             CF P+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLP+IL+ 
Sbjct  313   CFHPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIGLIHPITNELIKITAPLPAILQT  372

Query  1160  SQE  1168
              +E
Sbjct  373   REE  375



>ref|XP_009589057.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=436

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/346 (78%), Positives = 311/346 (90%), Gaps = 2/346 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWPEFNDGLTYHD+VRP DAGLTLIEFYSRKYK+SAPLQGWLQRIQNKQIT+D +VV
Sbjct  16    FGEPWPEFNDGLTYHDMVRPIDAGLTLIEFYSRKYKSSAPLQGWLQRIQNKQITVDSKVV  75

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             + PD  L  G +LVYHRLPW+EP+APY+L+VLFEDD +IALNKPSGLQVLPGGLFQQRTV
Sbjct  76    TIPDTELRAGTELVYHRLPWREPDAPYLLQVLFEDDYLIALNKPSGLQVLPGGLFQQRTV  135

Query  458   LTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+GTS+V
Sbjct  136   LTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAEGTSVV  195

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             ++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  196   EDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIKYPGVAKGLYVASPSGKP  254

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP CFDP+
Sbjct  255   ALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPKCFDPE  314

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAIN  1132
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+E   +N
Sbjct  315   LMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNENRCVN  360



>ref|XP_009589056.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=441

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/351 (77%), Positives = 312/351 (89%), Gaps = 7/351 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWPEFNDGLTYHD+VRP DAGLTLIEFYSRKYK+SAPLQGWLQRIQNKQIT+D +VV
Sbjct  16    FGEPWPEFNDGLTYHDMVRPIDAGLTLIEFYSRKYKSSAPLQGWLQRIQNKQITVDSKVV  75

Query  278   SNPDASLS-----PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLF  442
             + PD  LS      G +LVYHRLPW+EP+APY+L+VLFEDD +IALNKPSGLQVLPGGLF
Sbjct  76    TIPDTELSFWMSRAGTELVYHRLPWREPDAPYLLQVLFEDDYLIALNKPSGLQVLPGGLF  135

Query  443   QQRTVLTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             QQRTVLTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+
Sbjct  136   QQRTVLTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAE  195

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             GTS+V++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QPIG ++YPGVAKGLYVAS
Sbjct  196   GTSVVEDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIKYPGVAKGLYVAS  254

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
             PSGKPALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP 
Sbjct  255   PSGKPALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPK  314

Query  980   CFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAIN  1132
             CFDP+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+E   +N
Sbjct  315   CFDPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNENRCVN  365



>ref|XP_009589063.1| PREDICTED: RNA pseudouridine synthase 5 isoform X7 [Nicotiana 
tomentosiformis]
Length=367

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/348 (78%), Positives = 312/348 (90%), Gaps = 7/348 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWPEFNDGLTYHD+VRP DAGLTLIEFYSRKYK+SAPLQGWLQRIQNKQIT+D +VV
Sbjct  16    FGEPWPEFNDGLTYHDMVRPIDAGLTLIEFYSRKYKSSAPLQGWLQRIQNKQITVDSKVV  75

Query  278   SNPDASLS-----PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLF  442
             + PD  LS      G +LVYHRLPW+EP+APY+L+VLFEDD +IALNKPSGLQVLPGGLF
Sbjct  76    TIPDTELSFWMSRAGTELVYHRLPWREPDAPYLLQVLFEDDYLIALNKPSGLQVLPGGLF  135

Query  443   QQRTVLTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             QQRTVLTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+
Sbjct  136   QQRTVLTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAE  195

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             GTS+V++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QPIG ++YPGVAKGLYVAS
Sbjct  196   GTSVVEDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIKYPGVAKGLYVAS  254

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
             PSGKPALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP 
Sbjct  255   PSGKPALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPK  314

Query  980   CFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELI  1123
             CFDP+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+E++
Sbjct  315   CFDPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNEIL  362



>ref|XP_010099639.1| RNA pseudourine synthase 5 [Morus notabilis]
 gb|EXB80105.1| RNA pseudourine synthase 5 [Morus notabilis]
Length=377

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/357 (73%), Positives = 302/357 (85%), Gaps = 0/357 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG  WPE NDGL Y D+VR SD+  TLI+FYSRKYKNSAPLQGWLQRI+N QIT++GRVV
Sbjct  14    FGFSWPELNDGLFYSDVVRTSDSESTLIQFYSRKYKNSAPLQGWLQRIRNGQITVNGRVV  73

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +PD  LS G++LVYHRLPWKEP APY+LE+L+ED DMIAL+KPS LQVLPGGLFQQRTV
Sbjct  74    RDPDTILSIGSELVYHRLPWKEPGAPYILEILYEDGDMIALDKPSELQVLPGGLFQQRTV  133

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQWRA+K SS     E +PVPVHRLGRGTSGILLCAKTK AK++L+AYFADGTS V 
Sbjct  134   LTQLQWRATKQSSSLVCCEPNPVPVHRLGRGTSGILLCAKTKFAKTQLAAYFADGTSYVG  193

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
                 +NLE+   RKI+KIYRALV+G++ ED++++EQPIG V+YPGVAKGLYVASPSGKPA
Sbjct  194   GNSKNNLELNARRKILKIYRALVTGIVCEDKVIVEQPIGTVQYPGVAKGLYVASPSGKPA  253

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER VEKNCTLV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG+P CFDP+ 
Sbjct  254   LSKVEVLERDVEKNCTLVKVEIQSGRPHQIRIHLSFIGHPLLGDPLYVVGGRPRCFDPEF  313

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +D SFAQDGG+ RP  PVPGDCGY LHAH ++L HP T+E+I I APLP +L   QE
Sbjct  314   VDGSFAQDGGFPRPAKPVPGDCGYTLHAHHVSLSHPTTNEVIEITAPLPPVLWTRQE  370



>gb|KHG01532.1| hypothetical protein F383_21699 [Gossypium arboreum]
Length=382

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/358 (72%), Positives = 304/358 (85%), Gaps = 0/358 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPE N+GL Y D+V  SD+ LTLI+FYSRKYKNSAP+QGWLQRIQN QI++DGRVV
Sbjct  12    FGIPWPELNEGLFYSDVVPHSDSELTLIDFYSRKYKNSAPIQGWLQRIQNGQISVDGRVV  71

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P+  LS  + LVYHRLPWKEP+ P++LEVL+EDDDM+ALNKPSGLQVLPGGLFQQRTV
Sbjct  72    KDPNTILSGDSVLVYHRLPWKEPDVPHLLEVLYEDDDMVALNKPSGLQVLPGGLFQQRTV  131

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL W   K +S  +S E+HPVPVHRLGRGTSGILLCAKTK+AK+RL+AYFADGTS V 
Sbjct  132   LTQLCWSVKKQNSTLNSQETHPVPVHRLGRGTSGILLCAKTKVAKTRLAAYFADGTSRVG  191

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
                    E    RKI KIYRALV+G++ +D+++I+QPIG+VRYPGVA+GLYVASPSGKPA
Sbjct  192   ATSNRKAERSGTRKISKIYRALVTGILVDDKVIIDQPIGIVRYPGVARGLYVASPSGKPA  251

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER  ++NCTLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLYI GGQP CFDP+L
Sbjct  252   LSKVEVLERDEKQNCTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYIAGGQPRCFDPEL  311

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +DESFAQDGGY+RP NPVPGDCGY LHA++L L HP T+E+I+I APL SIL+ S E 
Sbjct  312   VDESFAQDGGYQRPTNPVPGDCGYYLHAYQLVLSHPTTNEMISITAPLSSILQTSDEA  369



>gb|AES62203.2| pseudouridine synthase Rlu family protein [Medicago truncatula]
Length=370

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/358 (72%), Positives = 306/358 (85%), Gaps = 3/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWPEFNDGL+Y D+VRPSDAGLTLIEFYS KYK+SAPLQGWLQRI++ QIT+D RVV
Sbjct  7     IGIPWPEFNDGLSYDDVVRPSDAGLTLIEFYSTKYKSSAPLQGWLQRIKSDQITLDARVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVYHR+PWKEP+AP+ +EVL+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  67    TDPNTILRVGSKLVYHRIPWKEPDAPHTIEVLYEDDDIIALNKPSGLQVLPGGLFQQRTV  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW  +  S++ +  + HPVPVHRLGRGTSGILLCAKTKLA++RL++YFADGTS ++
Sbjct  127   LTQLQWETNNKSTIEAHQKPHPVPVHRLGRGTSGILLCAKTKLARARLASYFADGTSRIE  186

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              K ++N E   + KI KIYRALVSG+IN D++ I QPIGMV+YPGVAKGLYVAS SGKPA
Sbjct  187   GKGHTNQE---LGKIAKIYRALVSGIINNDQVTINQPIGMVKYPGVAKGLYVASQSGKPA  243

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER V++N TLV+V+IQSGRPHQIRIHLSFIGHPL+GDPLY  GGQP C D D 
Sbjct  244   LSVVHVLERNVKENSTLVQVKIQSGRPHQIRIHLSFIGHPLLGDPLYAVGGQPKCLDCDF  303

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +DESFA+DGGY RP  PVPGDCGY+LHAH+L L HPIT+E+I + APLPSIL+  +E 
Sbjct  304   LDESFAEDGGYTRPSKPVPGDCGYHLHAHRLFLSHPITNEIIEMIAPLPSILQTHEEA  361



>ref|XP_007009784.1| Pseudouridine synthase family protein [Theobroma cacao]
 gb|EOY18594.1| Pseudouridine synthase family protein [Theobroma cacao]
Length=378

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/366 (70%), Positives = 303/366 (83%), Gaps = 0/366 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPE NDGL Y D+++PSD+ LTLIEFYS KYKNSAP QGWLQRIQN QI++DGRVV
Sbjct  12    FGLPWPELNDGLFYDDVIKPSDSELTLIEFYSSKYKNSAPSQGWLQRIQNGQISVDGRVV  71

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P+  L   ++LVYHRLPWKEP+AP+ LEVL+EDDDMIALNKPSGLQVLPGGLFQQRTV
Sbjct  72    RDPNTILRGSSELVYHRLPWKEPDAPHALEVLYEDDDMIALNKPSGLQVLPGGLFQQRTV  131

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL WR  K +S  +S ESHPVPVHRLGRGTSGILLCAKTK AK+ L+AYFADGTS++ 
Sbjct  132   LTQLSWRMRKQTSSLASQESHPVPVHRLGRGTSGILLCAKTKAAKTCLAAYFADGTSLIG  191

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
                   ++    RKI KIYRALV+G++ ED++VI QPIG+V+YPGVAKGLYVASPSGKPA
Sbjct  192   ANSNRKMQPSCTRKISKIYRALVTGILGEDKVVINQPIGIVQYPGVAKGLYVASPSGKPA  251

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLE+  ++N TLV+V+I+SGRPHQIRIHLSFIGHPL+GDPLYI GGQP CFD + 
Sbjct  252   LSKVEVLEKDEQQNHTLVQVQIESGRPHQIRIHLSFIGHPLLGDPLYIAGGQPRCFDSEF  311

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC*K  1177
             +DE++AQDGGY+RP NPVPGDCGY LHAH+L L HP TDE+I I APLP +L+   E  +
Sbjct  312   VDENYAQDGGYQRPVNPVPGDCGYYLHAHRLLLSHPTTDEIINITAPLPPVLQTQDEVRR  371

Query  1178  *REGSN  1195
              RE  +
Sbjct  372   SRESQS  377



>ref|XP_010067287.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Eucalyptus 
grandis]
 gb|KCW65382.1| hypothetical protein EUGRSUZ_G02814 [Eucalyptus grandis]
Length=377

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/358 (72%), Positives = 304/358 (85%), Gaps = 0/358 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPE NDG+ Y D+V  SD   TLI+FYS KY NSAP+QGWLQRIQN QI IDGRVV
Sbjct  9     FGVPWPELNDGIFYKDVVPSSDHETTLIQFYSSKYGNSAPVQGWLQRIQNGQIKIDGRVV  68

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+ S+S G ++VYHRLPWKEP+APY L +L+EDD+MIALNKPSGLQVLPGGLFQQRTV
Sbjct  69    TDPNESVSAGLEVVYHRLPWKEPDAPYFLGILYEDDNMIALNKPSGLQVLPGGLFQQRTV  128

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             L+QLQW+ SK S+L SS E  PVPVHRLGRGTSGILLCAKTK+AKSRLS YFADGTS+V 
Sbjct  129   LSQLQWQDSKQSTLLSSQEPQPVPVHRLGRGTSGILLCAKTKIAKSRLSIYFADGTSLVG  188

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              KR +  E   VRKI KIYRALV+G+++EDE++I +PIG+++YPGVAKGLYVASPSGKPA
Sbjct  189   GKRNTTKEPSSVRKISKIYRALVNGLVDEDEVIITEPIGVIKYPGVAKGLYVASPSGKPA  248

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V+VLER V+ NC+LV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG+P CFD   
Sbjct  249   LSKVKVLERNVQGNCSLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVSGGKPGCFDSQS  308

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +DE FAQDGGY RP++ VPGDCGY LHAH+L L HP+TDE+I I APLPSIL++  E 
Sbjct  309   VDEGFAQDGGYCRPQHAVPGDCGYFLHAHQLLLSHPVTDEVIKITAPLPSILQSQGEA  366



>ref|XP_003591952.1| RNA pseudourine synthase [Medicago truncatula]
 ref|XP_003638558.1| RNA pseudourine synthase [Medicago truncatula]
Length=371

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 306/359 (85%), Gaps = 4/359 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWPEFNDGL+Y D+VRPSDAGLTLIEFYS KYK+SAPLQGWLQRI++ QIT+D RVV
Sbjct  7     IGIPWPEFNDGLSYDDVVRPSDAGLTLIEFYSTKYKSSAPLQGWLQRIKSDQITLDARVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVYHR+PWKEP+AP+ +EVL+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  67    TDPNTILRVGSKLVYHRIPWKEPDAPHTIEVLYEDDDIIALNKPSGLQVLPGGLFQQRTV  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW  +  S++ +  + HPVPVHRLGRGTSGILLCAKTKLA++RL++YFADGTS ++
Sbjct  127   LTQLQWETNNKSTIEAHQKPHPVPVHRLGRGTSGILLCAKTKLARARLASYFADGTSRIE  186

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              K ++N E   + KI KIYRALVSG+IN D++ I QPIGMV+YPGVAKGLYVAS SGKPA
Sbjct  187   GKGHTNQE---LGKIAKIYRALVSGIINNDQVTINQPIGMVKYPGVAKGLYVASQSGKPA  243

Query  818   LSNVRVLERQVEKNCTLVE-VEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             LS V VLER V++N TLV+ V+IQSGRPHQIRIHLSFIGHPL+GDPLY  GGQP C D D
Sbjct  244   LSVVHVLERNVKENSTLVQVVKIQSGRPHQIRIHLSFIGHPLLGDPLYAVGGQPKCLDCD  303

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
              +DESFA+DGGY RP  PVPGDCGY+LHAH+L L HPIT+E+I + APLPSIL+  +E 
Sbjct  304   FLDESFAEDGGYTRPSKPVPGDCGYHLHAHRLFLSHPITNEIIEMIAPLPSILQTHEEA  362



>ref|XP_006485880.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X2 [Citrus 
sinensis]
 ref|XP_006485881.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X3 [Citrus 
sinensis]
Length=389

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/357 (73%), Positives = 306/357 (86%), Gaps = 2/357 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWP+ N+GL Y+D+V PSD+ LTLIEFYS K+KNSAPLQGWLQRIQN QIT+DGRVV
Sbjct  13    FGEPWPQLNEGLLYNDVVSPSDSKLTLIEFYSTKHKNSAPLQGWLQRIQNGQITVDGRVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  LS G++LVYHRLPWKEP+ PY+LEV +EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  73    NDPNIILSAGSELVYHRLPWKEPDVPYLLEVFYEDDDLIALNKPSGLQVLPGGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             L QLQWRASK SS  SS  SHPVPVHRLGRGTSGILLCAKTKLAK+ ++AYFAD TS+V 
Sbjct  133   LKQLQWRASKQSSSLSSQASHPVPVHRLGRGTSGILLCAKTKLAKTCIAAYFADKTSVVD  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
                 + +  +  RKI KIYRALV G+++ED+++I+QPIG+VRYPGVAKGLYVASPSGKPA
Sbjct  193   AD--NTVMELSQRKITKIYRALVHGIVDEDKVIIKQPIGIVRYPGVAKGLYVASPSGKPA  250

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER V++NCTLV+VEIQSGRPHQIRIHL+F+GHPL+GDPLY+ GGQP  FD + 
Sbjct  251   LSKVDVLERDVQRNCTLVQVEIQSGRPHQIRIHLAFLGHPLLGDPLYVAGGQPKSFDSEF  310

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
              D +FAQDGGY RP NPVPGDCGY LHA++L L HP T+E+I I APLPS+LK  +E
Sbjct  311   ADGTFAQDGGYERPVNPVPGDCGYYLHAYQLFLSHPTTNEVIKITAPLPSVLKTREE  367



>ref|XP_008233344.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Prunus mume]
Length=393

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/357 (71%), Positives = 301/357 (84%), Gaps = 0/357 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ N GL Y+D+VR SD+ LTLIEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  13    FGLPWPDLNHGLLYNDVVRASDSELTLIEFYSSKYKNSAPLQGWLQRIRNGQITVDGEVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G +LVYHRLPW+EP+APY+LEVL+EDDDMIALNKPSGLQVLPGGLFQQRTV
Sbjct  73    KDPSTILRVGLELVYHRLPWREPDAPYLLEVLYEDDDMIALNKPSGLQVLPGGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL W+A+K  S  S  E HPVPVHRLGRGTSGILLCAKTK AK++L+AYFADGTS + 
Sbjct  133   LTQLLWQATKKISPLSCQEPHPVPVHRLGRGTSGILLCAKTKHAKTQLAAYFADGTSNIG  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             +   +++E   VRKI KIYRALV+G++ ED+++++QPIG+VRYPGVAKGLYVAS +GKPA
Sbjct  193   DDSNTSMEAHAVRKISKIYRALVTGILCEDKVIVKQPIGVVRYPGVAKGLYVASATGKPA  252

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+GDPLY+ GGQP C D D 
Sbjct  253   LSKVEVLEREIHKNRTLVQVEIQSGRPHQIRIHLSYIGHPLLGDPLYVLGGQPKCLDSDF  312

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA DGG+ RP  PVPGDCGYNLHAH++ L HP ++E+I + APLP+IL+  QE
Sbjct  313   VDESFAVDGGFLRPTKPVPGDCGYNLHAHQVILSHPSSNEVIKVTAPLPAILRTQQE  369



>ref|XP_010658419.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Vitis vinifera]
Length=393

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/354 (71%), Positives = 304/354 (86%), Gaps = 0/354 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+FNDGLTY+D+V  SD+ LTLI++YS K+KNSAPLQGWLQRI   QIT+DG VV
Sbjct  5     FGVPWPDFNDGLTYNDVVSASDSELTLIDYYSSKHKNSAPLQGWLQRINKGQITVDGTVV  64

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             + P   L  G++LVYHRLPW+EP+APY+LE+L+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  65    TEPKTILRAGSKLVYHRLPWQEPDAPYLLEILYEDDDVIALNKPSGLQVLPGGLFQQRTV  124

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQWRA+K +SL +  ESH VPVHRLGRGTSGILLCAKTKLAK+RL+AYFADGTS+V 
Sbjct  125   LTQLQWRANKQNSLPACQESHSVPVHRLGRGTSGILLCAKTKLAKTRLAAYFADGTSVVG  184

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R ++++   +RKI KIYRALV+G++++DE+VIEQPIGMV+YPGVAKGLYVASPSGKPA
Sbjct  185   GNRDADMKSRTMRKISKIYRALVNGILDKDEIVIEQPIGMVQYPGVAKGLYVASPSGKPA  244

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V +LER V+ +  +V+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GGQP C D + 
Sbjct  245   LSKVSILERDVQGDHMIVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVPGGQPKCCDAEF  304

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
              +ES+A DGGY+RP  PVPGDCGY+LHAH+L L HP T+E+I I APLP +L+ 
Sbjct  305   TNESYALDGGYQRPVKPVPGDCGYHLHAHQLVLSHPTTNEVIKITAPLPPVLRT  358



>ref|XP_009333717.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Pyrus x bretschneideri]
Length=386

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/357 (71%), Positives = 302/357 (85%), Gaps = 0/357 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGL Y+D+VR SD+ LTLIEFYS KYKNSAPLQGWLQRI++ QIT+D  VV
Sbjct  13    FGLPWPDLNDGLFYNDVVRASDSELTLIEFYSSKYKNSAPLQGWLQRIRSGQITVDREVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +PD  L  G++L YHRLPW+EP+APY+LEVL+EDDDMIALNKPSGLQVLP GLFQQRTV
Sbjct  73    RDPDTILRVGSKLTYHRLPWREPDAPYLLEVLYEDDDMIALNKPSGLQVLPQGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL WRA++  S  S  + HPVPVHRLGRGTSGILLCAKTK AK++L+AYFADGTS + 
Sbjct  133   LTQLLWRATQKISHLSCQQPHPVPVHRLGRGTSGILLCAKTKHAKTQLAAYFADGTSNIG  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             +   +++E    RKI KIYRALV+G++ ED+++++QPIGMVRYPGVAKGLYVASP+GKPA
Sbjct  193   DGSNADVEPRTERKISKIYRALVTGIVCEDKVIVKQPIGMVRYPGVAKGLYVASPTGKPA  252

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+GDPLY+ GGQP C D DL
Sbjct  253   LSKVEVLEREIHKNQTLVQVEIQSGRPHQIRIHLSYIGHPLLGDPLYVPGGQPKCSDFDL  312

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA DGG+RRP NPVPGDCGYNLHAH++ L HP ++E+I + APLP  L+  QE
Sbjct  313   VDESFADDGGFRRPTNPVPGDCGYNLHAHQVILSHPASNEVIKVIAPLPPFLRKQQE  369



>ref|XP_004307403.1| PREDICTED: RNA pseudourine synthase 5-like [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 299/357 (84%), Gaps = 0/357 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGL+Y+D+V+ SD+ LTLIEFYS KYK+SAPLQGWLQRI+N QIT+DG VV
Sbjct  13    FGLPWPDLNDGLSYNDVVKSSDSELTLIEFYSSKYKSSAPLQGWLQRIRNGQITVDGEVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              + D  L  G++LVYHRLPW EP+APY+LEVL+EDDDMIALNKP GLQVLPGGLFQQRTV
Sbjct  73    RDSDTILRVGSELVYHRLPWGEPDAPYLLEVLYEDDDMIALNKPGGLQVLPGGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL WR S+     +  +SH VPVHRLGRGTSGILLCAKTK AK++L+AYFADGTS + 
Sbjct  133   LTQLLWRESQKFDHLACQKSHLVPVHRLGRGTSGILLCAKTKHAKTQLAAYFADGTSHIG  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             +   +N ++   RKI KIYRALV+G+I EDE++++QPIG VRYPGVAKGLY+ASP+GKPA
Sbjct  193   DDSTTNTKLHTTRKITKIYRALVTGIICEDEVIVKQPIGTVRYPGVAKGLYIASPAGKPA  252

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VL+R ++KN T+V+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GGQP C   DL
Sbjct  253   LSKVEVLDRDIQKNHTIVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVAGGQPKCLGSDL  312

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA DGG++RP  PVPGDCGYNLHAH++ L HP ++E+I I APLP +L+  +E
Sbjct  313   VDESFADDGGFKRPTKPVPGDCGYNLHAHQVVLSHPSSNEVIKITAPLPLVLRTREE  369



>ref|XP_006485879.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X1 [Citrus 
sinensis]
Length=390

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/358 (73%), Positives = 306/358 (85%), Gaps = 3/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWP+ N+GL Y+D+V PSD+ LTLIEFYS K+KNSAPLQGWLQRIQN QIT+DGRVV
Sbjct  13    FGEPWPQLNEGLLYNDVVSPSDSKLTLIEFYSTKHKNSAPLQGWLQRIQNGQITVDGRVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  LS G++LVYHRLPWKEP+ PY+LEV +EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  73    NDPNIILSAGSELVYHRLPWKEPDVPYLLEVFYEDDDLIALNKPSGLQVLPGGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             L QLQWRASK SS  SS  SHPVPVHRLGRGTSGILLCAKTKLAK+ ++AYFAD TS+V 
Sbjct  133   LKQLQWRASKQSSSLSSQASHPVPVHRLGRGTSGILLCAKTKLAKTCIAAYFADKTSVVD  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
                 + +  +  RKI KIYRALV G+++ED+++I+QPIG+VRYPGVAKGLYVASPSGKPA
Sbjct  193   AD--NTVMELSQRKITKIYRALVHGIVDEDKVIIKQPIGIVRYPGVAKGLYVASPSGKPA  250

Query  818   LSNVRVLERQVEKNCTLV-EVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             LS V VLER V++NCTLV +VEIQSGRPHQIRIHL+F+GHPL+GDPLY+ GGQP  FD +
Sbjct  251   LSKVDVLERDVQRNCTLVQQVEIQSGRPHQIRIHLAFLGHPLLGDPLYVAGGQPKSFDSE  310

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
               D +FAQDGGY RP NPVPGDCGY LHA++L L HP T+E+I I APLPS+LK  +E
Sbjct  311   FADGTFAQDGGYERPVNPVPGDCGYYLHAYQLFLSHPTTNEVIKITAPLPSVLKTREE  368



>ref|XP_011031774.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Populus euphratica]
Length=378

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/361 (71%), Positives = 298/361 (83%), Gaps = 3/361 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR-PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             FG PWP+ NDGL Y+D+V   SD+GLTLI FYS KYKNSAPLQGWLQRI N QITIDG V
Sbjct  14    FGSPWPDLNDGLFYNDVVSTSSDSGLTLIHFYSSKYKNSAPLQGWLQRIHNGQITIDGEV  73

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V  P A L  G +LVYHRLPW+EP+APY+L+VL+EDDDMIALNKP GLQVLPGGLFQQRT
Sbjct  74    VKEPKAILRDGMELVYHRLPWREPDAPYLLQVLYEDDDMIALNKPPGLQVLPGGLFQQRT  133

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VL QLQWRASK SS  +   SHPVPVHRLGRGTSGILLCAKTK+AK+ L+AYFADGTS++
Sbjct  134   VLMQLQWRASKGSSSLAIQGSHPVPVHRLGRGTSGILLCAKTKVAKTSLAAYFADGTSLI  193

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
              +   +N+E  + RKI K+YRALV+G++N+D+++I+QPIG +RYPGVAKGLYVASPSGKP
Sbjct  194   GDSSNANMEKSKTRKISKVYRALVNGILNQDKIIIKQPIGTMRYPGVAKGLYVASPSGKP  253

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS V VLER  + N TLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLY  GGQP CFD +
Sbjct  254   ALSKVEVLERDSQLNQTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYDVGGQPRCFDSE  313

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLAL--PHPITDELIAINAPLPSILKASQE  1168
               DESFA+DGGY RP  PVPGDCGY LHAH+L L  PHP  +E+I I APLPSIL+   E
Sbjct  314   HEDESFAEDGGYERPAKPVPGDCGYYLHAHQLVLSHPHPSKNEVIKITAPLPSILRTQAE  373

Query  1169  C  1171
              
Sbjct  374   T  374



>ref|XP_010067286.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Eucalyptus 
grandis]
Length=387

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/368 (70%), Positives = 304/368 (83%), Gaps = 10/368 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQ--------  253
             FG PWPE NDG+ Y D+V  SD   TLI+FYS KY NSAP+QGWLQRIQN Q        
Sbjct  9     FGVPWPELNDGIFYKDVVPSSDHETTLIQFYSSKYGNSAPVQGWLQRIQNGQVPLLQKNR  68

Query  254   --ITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVL  427
               I IDGRVV++P+ S+S G ++VYHRLPWKEP+APY L +L+EDD+MIALNKPSGLQVL
Sbjct  69    TSIKIDGRVVTDPNESVSAGLEVVYHRLPWKEPDAPYFLGILYEDDNMIALNKPSGLQVL  128

Query  428   PGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSA  607
             PGGLFQQRTVL+QLQW+ SK S+L SS E  PVPVHRLGRGTSGILLCAKTK+AKSRLS 
Sbjct  129   PGGLFQQRTVLSQLQWQDSKQSTLLSSQEPQPVPVHRLGRGTSGILLCAKTKIAKSRLSI  188

Query  608   YFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGL  787
             YFADGTS+V  KR +  E   VRKI KIYRALV+G+++EDE++I +PIG+++YPGVAKGL
Sbjct  189   YFADGTSLVGGKRNTTKEPSSVRKISKIYRALVNGLVDEDEVIITEPIGVIKYPGVAKGL  248

Query  788   YVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
             YVASPSGKPALS V+VLER V+ NC+LV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ G
Sbjct  249   YVASPSGKPALSKVKVLERNVQGNCSLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVSG  308

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             G+P CFD   +DE FAQDGGY RP++ VPGDCGY LHAH+L L HP+TDE+I I APLPS
Sbjct  309   GKPGCFDSQSVDEGFAQDGGYCRPQHAVPGDCGYFLHAHQLLLSHPVTDEVIKITAPLPS  368

Query  1148  ILKASQEC  1171
             IL++  E 
Sbjct  369   ILQSQGEA  376



>ref|XP_007143685.1| hypothetical protein PHAVU_007G093000g [Phaseolus vulgaris]
 gb|ESW15679.1| hypothetical protein PHAVU_007G093000g [Phaseolus vulgaris]
Length=365

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/357 (71%), Positives = 298/357 (83%), Gaps = 9/357 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPE NDGL+Y D+VR SD+GLTLIEFY  KYK+SAPLQGWLQRI++ QIT DGRVV
Sbjct  7     FGIPWPECNDGLSYDDVVRSSDSGLTLIEFYFTKYKSSAPLQGWLQRIKSGQITFDGRVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++    L  G++LVYHRLPWKEP+AP+++EVL+EDD+MIALNKPSGLQVLPGGLFQQRTV
Sbjct  67    TDSSTVLRVGSKLVYHRLPWKEPDAPHMIEVLYEDDEMIALNKPSGLQVLPGGLFQQRTV  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW A+         + HPVPVHRLGRGTSGILLCAKTKLA++RL++YFADGTS + 
Sbjct  127   LTQLQWEANLHK------KPHPVPVHRLGRGTSGILLCAKTKLARARLASYFADGTSHIG  180

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              KR +N E+    KI KIYR L SG++  DE+ I QPIG+V+YPGVAKGLYVAS SGKPA
Sbjct  181   GKRDTNGEI---GKIAKIYRGLASGIVENDEVTINQPIGVVKYPGVAKGLYVASQSGKPA  237

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V +LER V++N TLV+V+IQSGRPHQIRIHLSFIGHPL+GDPLY DGGQP C D D 
Sbjct  238   LSVVGILERNVQENSTLVQVKIQSGRPHQIRIHLSFIGHPLLGDPLYGDGGQPKCLDCDS  297

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             IDESFA+DGGY+RP  PVPGDCGYNLHAHKL L HP+T+ELI I APLPS+L+  +E
Sbjct  298   IDESFAEDGGYQRPTKPVPGDCGYNLHAHKLVLSHPLTNELIEITAPLPSVLQTPEE  354



>ref|XP_004496322.1| PREDICTED: RNA pseudourine synthase 5-like [Cicer arietinum]
Length=368

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/358 (71%), Positives = 301/358 (84%), Gaps = 3/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWPE NDGL+Y+D+VRPSDAGLTLIEFYS KYK+SAPLQGWLQRI++ QIT+D +VV
Sbjct  7     IGVPWPELNDGLSYNDVVRPSDAGLTLIEFYSTKYKSSAPLQGWLQRIKSDQITVDAKVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVYHRLPWKEP+AP+ ++VL+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  67    TDPNTLLRAGSKLVYHRLPWKEPDAPHTIQVLYEDDDIIALNKPSGLQVLPGGLFQQRTV  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW  +   +  +  + HPVPVHRLGRGTSGILLCAKTKLA+  L++YFADGTS + 
Sbjct  127   LTQLQWETNNKCTFEAHQKPHPVPVHRLGRGTSGILLCAKTKLARVHLASYFADGTSRIG  186

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              KR +N E   + KI KIYRALVSG+I+ D++ I+QPIGMV+YPGVAKGLYVAS SGKPA
Sbjct  187   GKRDTNQE---LGKIAKIYRALVSGIIDNDKVTIDQPIGMVKYPGVAKGLYVASQSGKPA  243

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V +LER V++N TLV+V+IQSGRPHQIRIHLSFIGHPLIGDPLY  GGQP C D D 
Sbjct  244   LSVVDILERNVKENSTLVQVKIQSGRPHQIRIHLSFIGHPLIGDPLYAVGGQPKCLDYDF  303

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +D+SFA+DGGY RP  PVPGDCGY LHAH+L L HPIT+E+I I APLPSIL+  +E 
Sbjct  304   LDDSFAEDGGYPRPPKPVPGDCGYYLHAHELLLTHPITNEIIEIIAPLPSILQTHEEA  361



>ref|XP_002312025.1| hypothetical protein POPTR_0008s04160g [Populus trichocarpa]
 gb|EEE89392.1| hypothetical protein POPTR_0008s04160g [Populus trichocarpa]
Length=377

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/359 (72%), Positives = 298/359 (83%), Gaps = 2/359 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR-PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             FG PWP+ N+GL Y+D+V   SD+GLTLI FYS KYKNSAPLQGWLQRI N QITIDG V
Sbjct  14    FGSPWPDLNEGLFYNDVVSTSSDSGLTLIHFYSSKYKNSAPLQGWLQRIHNGQITIDGEV  73

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V  P A L  G +LVYHRLPW+EP+APY+L+VL+EDDDM+ALNKP GLQVLPGGLFQQRT
Sbjct  74    VKEPKAILRDGMELVYHRLPWREPDAPYLLQVLYEDDDMVALNKPPGLQVLPGGLFQQRT  133

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VL QLQWRASK SS  +   SHPVPVHRLGRGTSGILLCAKTK+AK+ L+AYFADGTS++
Sbjct  134   VLMQLQWRASKGSSSLAIQGSHPVPVHRLGRGTSGILLCAKTKVAKTSLAAYFADGTSLI  193

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
              +   +N+E  + RKI KIYRALV+G++N+D+++I+QPIG +RYPGVAKGLYVASPSGKP
Sbjct  194   GDSSNANMEQSKRRKISKIYRALVNGILNQDKIIIKQPIGTMRYPGVAKGLYVASPSGKP  253

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS V VLER  + N TLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLY  GGQPMCFD +
Sbjct  254   ALSKVEVLERDSQLNQTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYDVGGQPMCFDSE  313

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDE-LIAINAPLPSILKASQE  1168
               DESFA+DGGY RP  PVPGDCGY LHAH+L L HP  +E +I I APLPSIL+   E
Sbjct  314   HEDESFAEDGGYERPAKPVPGDCGYYLHAHQLVLSHPTKNEQVIKITAPLPSILRTQAE  372



>ref|XP_009333716.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Pyrus x bretschneideri]
Length=389

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/360 (71%), Positives = 303/360 (84%), Gaps = 3/360 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGL Y+D+VR SD+ LTLIEFYS KYKNSAPLQGWLQRI++ QIT+D  VV
Sbjct  13    FGLPWPDLNDGLFYNDVVRASDSELTLIEFYSSKYKNSAPLQGWLQRIRSGQITVDREVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +PD  L  G++L YHRLPW+EP+APY+LEVL+EDDDMIALNKPSGLQVLP GLFQQRTV
Sbjct  73    RDPDTILRVGSKLTYHRLPWREPDAPYLLEVLYEDDDMIALNKPSGLQVLPQGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL WRA++  S  S  + HPVPVHRLGRGTSGILLCAKTK AK++L+AYFADGTS + 
Sbjct  133   LTQLLWRATQKISHLSCQQPHPVPVHRLGRGTSGILLCAKTKHAKTQLAAYFADGTSNIG  192

Query  638   EKR-YSNLEV--MRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSG  808
             +   +SN +V     RKI KIYRALV+G++ ED+++++QPIGMVRYPGVAKGLYVASP+G
Sbjct  193   DGSIHSNADVEPRTERKISKIYRALVTGIVCEDKVIVKQPIGMVRYPGVAKGLYVASPTG  252

Query  809   KPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFD  988
             KPALS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+GDPLY+ GGQP C D
Sbjct  253   KPALSKVEVLEREIHKNQTLVQVEIQSGRPHQIRIHLSYIGHPLLGDPLYVPGGQPKCSD  312

Query  989   PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
              DL+DESFA DGG+RRP NPVPGDCGYNLHAH++ L HP ++E+I + APLP  L+  QE
Sbjct  313   FDLVDESFADDGGFRRPTNPVPGDCGYNLHAHQVILSHPASNEVIKVIAPLPPFLRKQQE  372



>gb|EYU39826.1| hypothetical protein MIMGU_mgv1a008941mg [Erythranthe guttata]
Length=357

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/355 (71%), Positives = 297/355 (84%), Gaps = 6/355 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG+PWPEFNDG+ Y DL+RPSD G TLIEFYSRKY++SAPL GWLQRI NKQIT++G VV
Sbjct  4     FGDPWPEFNDGIYYRDLLRPSDDGATLIEFYSRKYQSSAPLHGWLQRIHNKQITVNGGVV  63

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  GA+LVYHRLPWKEP+AP+++E+L+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  64    TDPNTILRGGAELVYHRLPWKEPDAPHLVEILYEDDDVIALNKPSGLQVLPGGLFQQRTV  123

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQ  A          E HPVPVHRLGRGTSGILLCAKTKLAKSRL+A+FADGTS+V 
Sbjct  124   LTQLQRHAGGCQ------EPHPVPVHRLGRGTSGILLCAKTKLAKSRLAAFFADGTSVVG  177

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R ++ +    R I K+YRAL SG+I EDE+VI+QPIG+V+YPGVA GLYVASPSGKPA
Sbjct  178   VCRENDQQQKSTRNITKLYRALASGIIIEDEVVIDQPIGLVKYPGVANGLYVASPSGKPA  237

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
              S V VLER +  N TLV+VEIQSGRPHQIRIHLSFIGHPLIGDPLY  GGQP C D +L
Sbjct  238   WSKVVVLERNMLNNSTLVQVEIQSGRPHQIRIHLSFIGHPLIGDPLYSTGGQPKCSDHEL  297

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKAS  1162
             +D+SFA+DGGY RPE PVPGDCGY+LHAH++   HP+++E+I I APLPSIL+ +
Sbjct  298   VDQSFAEDGGYERPEKPVPGDCGYHLHAHRVLFTHPVSNEIIEITAPLPSILRRT  352



>ref|XP_008381972.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Malus domestica]
Length=386

 Score =   524 bits (1349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/357 (70%), Positives = 299/357 (84%), Gaps = 0/357 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGL Y+D+VR  D+ LTLIEFYS KY NSAPLQGWLQRI++ QIT+DG VV
Sbjct  13    FGLPWPDLNDGLFYNDVVRTPDSELTLIEFYSSKYNNSAPLQGWLQRIRSGQITVDGEVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +PD  L  G++L YHRLPW+EP+APY+LEVL+EDDDMIALNKPSGLQVLP GLFQQRTV
Sbjct  73    RDPDTILRVGSKLAYHRLPWREPDAPYLLEVLYEDDDMIALNKPSGLQVLPQGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL WRA++  S  S  + HPVP HRLGRGTSGILLCAKTK AK++L+AY ADGTS + 
Sbjct  133   LTQLLWRATQKISPLSCQQPHPVPXHRLGRGTSGILLCAKTKHAKTQLAAYLADGTSXIG  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             +   +++E    RKI KIYRALV+G++ ED+++++QPIGMVRYPGVAKGLYVASP+GKPA
Sbjct  193   DGSNADMEPRTERKISKIYRALVTGIVCEDKVIVKQPIGMVRYPGVAKGLYVASPTGKPA  252

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+GDPLY+ GGQP C D DL
Sbjct  253   LSKVEVLEREIHKNQTLVQVEIQSGRPHQIRIHLSYIGHPLLGDPLYVPGGQPKCSDFDL  312

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA DGG++RP NPVPGDCGYNLHAH++ L HP ++E+I + APLP  L+  QE
Sbjct  313   VDESFADDGGFKRPTNPVPGDCGYNLHAHQVTLSHPASNEVIKVIAPLPPXLRTQQE  369



>ref|XP_011031773.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Populus euphratica]
Length=379

 Score =   522 bits (1345),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 297/362 (82%), Gaps = 4/362 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR-PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             FG PWP+ NDGL Y+D+V   SD+GLTLI FYS KYKNSAPLQGWLQRI N QITIDG V
Sbjct  14    FGSPWPDLNDGLFYNDVVSTSSDSGLTLIHFYSSKYKNSAPLQGWLQRIHNGQITIDGEV  73

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V  P A L  G +LVYHRLPW+EP+APY+L+VL+EDDDMIALNKP GLQVLPGGLFQQRT
Sbjct  74    VKEPKAILRDGMELVYHRLPWREPDAPYLLQVLYEDDDMIALNKPPGLQVLPGGLFQQRT  133

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VL QLQWRASK SS  +   SHPVPVHRLGRGTSGILLCAKTK+AK+ L+AYFADGTS++
Sbjct  134   VLMQLQWRASKGSSSLAIQGSHPVPVHRLGRGTSGILLCAKTKVAKTSLAAYFADGTSLI  193

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
              +   +N+E  + RKI K+YRALV+G++N+D+++I+QPIG +RYPGVAKGLYVASPSGKP
Sbjct  194   GDSSNANMEKSKTRKISKVYRALVNGILNQDKIIIKQPIGTMRYPGVAKGLYVASPSGKP  253

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS V VLER  + N TLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLY  GGQP CFD +
Sbjct  254   ALSKVEVLERDSQLNQTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYDVGGQPRCFDSE  313

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHP---ITDELIAINAPLPSILKASQ  1165
               DESFA+DGGY RP  PVPGDCGY LHAH+L L HP     +++I I APLPSIL+   
Sbjct  314   HEDESFAEDGGYERPAKPVPGDCGYYLHAHQLVLSHPHPSKNEQVIKITAPLPSILRTQA  373

Query  1166  EC  1171
             E 
Sbjct  374   ET  375



>emb|CDO99732.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   521 bits (1343),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 304/396 (77%), Gaps = 40/396 (10%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG------------------------------------  169
             FGEPWP+ NDGLTY DL+ P  AG                                    
Sbjct  21    FGEPWPDLNDGLTYRDLIPPPHAGPYQPSQSFTYMRLIMFLALLTIFRSLFFIFWLPNNL  80

Query  170   --LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKE  343
               LT+IE+YS+KYKNSAP+QGWLQRI+NKQI +DG V+++P+  L  G++LVYHRLPWKE
Sbjct  81    TGLTVIEYYSKKYKNSAPVQGWLQRIKNKQIKVDGAVITDPNTILRAGSELVYHRLPWKE  140

Query  344   PNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHP  523
             P+APY+LEVLFED+D+IALNKPSGLQVLPGGLFQQRTVL+QL+WR +K +S     + H 
Sbjct  141   PHAPYLLEVLFEDNDLIALNKPSGLQVLPGGLFQQRTVLSQLEWRTNKGTSSCK--QPHA  198

Query  524   VPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRAL  703
             VPVHRLGRGTSG+LLCAKTKLAKS L+AYFADGTS V  +  +N      RKI K YRAL
Sbjct  199   VPVHRLGRGTSGVLLCAKTKLAKSCLAAYFADGTSAVGNESCNNARFNSTRKISKFYRAL  258

Query  704   VSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEI  883
             VSG+I++D++VI+QPIG+V+YPGVAKGLYVAS SGKPALS V +LER V+ + TLV+VEI
Sbjct  259   VSGIIHQDQVVIDQPIGLVKYPGVAKGLYVASASGKPALSKVSILERNVKNSSTLVQVEI  318

Query  884   QSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDC  1063
             QSGRPHQIRIHLSFIGHPL+GDPLY+ GGQP CFDP+ IDE FAQDGGY+RPENPVPGDC
Sbjct  319   QSGRPHQIRIHLSFIGHPLLGDPLYVAGGQPSCFDPEFIDEGFAQDGGYQRPENPVPGDC  378

Query  1064  GYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             GY+LHAH+L L HP T E I I APLPSIL   +EC
Sbjct  379   GYHLHAHQLFLAHPTTHEPIKIVAPLPSILATEEEC  414



>gb|KDP25730.1| hypothetical protein JCGZ_23951 [Jatropha curcas]
Length=389

 Score =   520 bits (1339),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 298/368 (81%), Gaps = 10/368 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQ--------  253
             FG PWP+ NDGL Y D+   SD+ LTLI+FYS KY NSAPLQGWLQRIQN Q        
Sbjct  17    FGLPWPDLNDGLFYSDVASSSDSELTLIDFYSGKYNNSAPLQGWLQRIQNGQVVFSVFLV  76

Query  254   --ITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVL  427
               I+IDG VV   +  L  G++LVYHRLPW+EP+APY+L++L+EDDDMIALNKPS LQVL
Sbjct  77    LQISIDGIVVKESNTKLRSGSELVYHRLPWREPDAPYMLQILYEDDDMIALNKPSCLQVL  136

Query  428   PGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSA  607
             PGGLFQQRTVLTQLQW A K +S  +S ESHPVPVHRLGRGTSGILLCAK+KLAK+R++A
Sbjct  137   PGGLFQQRTVLTQLQWWARKQTSSLASQESHPVPVHRLGRGTSGILLCAKSKLAKTRIAA  196

Query  608   YFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGL  787
             YFADGTS+V +   +   +++ RKI KIYRALV G+I ED+++I+QPIG VRYPGVAKGL
Sbjct  197   YFADGTSLVGDNSDTGTLLVKRRKISKIYRALVVGIIVEDKVIIKQPIGTVRYPGVAKGL  256

Query  788   YVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
             YVASPSGKPALS V VLER V+ N TLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLY  G
Sbjct  257   YVASPSGKPALSKVEVLERDVQGNHTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYDVG  316

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             GQP CFD + +DESFAQDGGY+RP  PVPGDCGY LHAH+L+L HP T+E+I + APLPS
Sbjct  317   GQPKCFDSEFVDESFAQDGGYQRPTKPVPGDCGYYLHAHQLSLLHPTTNEVIKVTAPLPS  376

Query  1148  ILKASQEC  1171
              L+   E 
Sbjct  377   NLQTRAEA  384



>emb|CBI31488.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   514 bits (1325),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 245/340 (72%), Positives = 294/340 (86%), Gaps = 0/340 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+FNDGLTY+D+V  SD+ LTLI++YS K+KNSAPLQGWLQRI   QIT+DG VV
Sbjct  5     FGVPWPDFNDGLTYNDVVSASDSELTLIDYYSSKHKNSAPLQGWLQRINKGQITVDGTVV  64

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             + P   L  G++LVYHRLPW+EP+APY+LE+L+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  65    TEPKTILRAGSKLVYHRLPWQEPDAPYLLEILYEDDDVIALNKPSGLQVLPGGLFQQRTV  124

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQWRA+K +SL +  ESH VPVHRLGRGTSGILLCAKTKLAK+RL+AYFADGTS+V 
Sbjct  125   LTQLQWRANKQNSLPACQESHSVPVHRLGRGTSGILLCAKTKLAKTRLAAYFADGTSVVG  184

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R ++++   +RKI KIYRALV+G++++DE+VIEQPIGMV+YPGVAKGLYVASPSGKPA
Sbjct  185   GNRDADMKSRTMRKISKIYRALVNGILDKDEIVIEQPIGMVQYPGVAKGLYVASPSGKPA  244

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V +LER V+ +  +V+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GGQP C D + 
Sbjct  245   LSKVSILERDVQGDHMIVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVPGGQPKCCDAEF  304

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDE  1117
              +ES+A DGGY+RP  PVPGDCGY+LHAH+L L HP T+E
Sbjct  305   TNESYALDGGYQRPVKPVPGDCGYHLHAHQLVLSHPTTNE  344



>ref|XP_003556222.1| PREDICTED: RNA pseudouridine synthase 5-like [Glycine max]
 gb|KHN00828.1| RNA pseudourine synthase 5 [Glycine soja]
Length=371

 Score =   515 bits (1327),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 246/357 (69%), Positives = 295/357 (83%), Gaps = 3/357 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPE NDGL+Y D+VR SDAG TLIEFYS KYK+SAPLQGWLQRI++ QIT+DG VV
Sbjct  7     FGIPWPECNDGLSYDDVVRASDAGATLIEFYSTKYKSSAPLQGWLQRIKSGQITVDGGVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++ +  L  G++L+YHRLPWKEP+AP++++VL+EDDDMIALNKPSGLQVLPGGL+QQRT+
Sbjct  67    TDSNTVLRVGSKLIYHRLPWKEPDAPHMIDVLYEDDDMIALNKPSGLQVLPGGLYQQRTI  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW A+   +       HPVPVHRLGRGTSGILLCAKTKLA++RL+++FADGTS V 
Sbjct  127   LTQLQWEANNQGTCEMHKRLHPVPVHRLGRGTSGILLCAKTKLARARLASHFADGTSHVG  186

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              KR +  E   + KI K+YRALVSG++  D++ I QPIG+V+YPGVAKGLYVAS SGKPA
Sbjct  187   GKRDTKQE---LGKIAKMYRALVSGIVENDKVTINQPIGIVKYPGVAKGLYVASESGKPA  243

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V +LE  +++N TLV+V+IQSGRPHQIRIHLSFIGHPL+GDPLY  GGQP C D D 
Sbjct  244   LSVVDILETNIQENSTLVQVKIQSGRPHQIRIHLSFIGHPLLGDPLYGVGGQPKCLDCDF  303

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA+DGGY+RP  PVPGDCGY LHAHKL L HP T+ELI I APLPS L  ++E
Sbjct  304   VDESFAEDGGYQRPTKPVPGDCGYYLHAHKLVLSHPTTNELIEIIAPLPSALHTAEE  360



>ref|XP_006346978.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X4 [Solanum 
tuberosum]
Length=349

 Score =   514 bits (1323),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 253/358 (71%), Positives = 295/358 (82%), Gaps = 27/358 (8%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG  WPE N+GLTYHD+VRP+DAGL LIEFY RKYKNSAPLQG                 
Sbjct  14    FGVSWPELNEGLTYHDIVRPTDAGLMLIEFYFRKYKNSAPLQG-----------------  56

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
                      GA+LVYHRLPW+EP+APY+LEVLF+DD +I +NKPSGLQVLPGGL+QQRTV
Sbjct  57    --------AGAELVYHRLPWREPDAPYLLEVLFQDDYLIVVNKPSGLQVLPGGLYQQRTV  108

Query  458   LTQLQWRAsklsslsssGE-SHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             LTQLQW A K ++ SS  + +HPVPVHRLGRGTSGILLCAKTKL KSRL+AYFA+GTS+V
Sbjct  109   LTQLQWHACKPTTTSSGCQKTHPVPVHRLGRGTSGILLCAKTKLCKSRLAAYFAEGTSVV  168

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
             ++K  +N E   +RKI KIYRALVSGV++ DE+VI+QPIG ++YPGVAKGLYVASPSGKP
Sbjct  169   EDK-CTNSECNTMRKICKIYRALVSGVMDMDEVVIKQPIGTIKYPGVAKGLYVASPSGKP  227

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS+VRVLER  E NCTLV+VEIQSGRPHQIRIHLSFIG+PLIGDPLY+ GGQP CF P+
Sbjct  228   ALSSVRVLERDSENNCTLVQVEIQSGRPHQIRIHLSFIGYPLIGDPLYVSGGQPKCFHPE  287

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+ELI I APLP+IL+  +E
Sbjct  288   LMDESFEKDGGYQRPENPVPGDCGYNLHAHQIGLIHPITNELIKITAPLPAILQTREE  345



>ref|XP_011084348.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Sesamum indicum]
Length=380

 Score =   513 bits (1320),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 256/357 (72%), Positives = 303/357 (85%), Gaps = 1/357 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FGEPWPEFNDG+ Y DLVR S +G TLIEFYSRKY++SAPL GWLQRI NKQITIDG + 
Sbjct  4     FGEPWPEFNDGIYYRDLVRASGSGATLIEFYSRKYESSAPLHGWLQRIHNKQITIDGCLA  63

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  GA+LVYHRLPWKEP+APY+LE+L+ED+D+IALNKPSGLQVLPGGLFQQRTV
Sbjct  64    TDPNTILREGAELVYHRLPWKEPDAPYLLEILYEDNDVIALNKPSGLQVLPGGLFQQRTV  123

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQ RA  L++     E+HPVPVHRLGRGTSGILLCAKTKLAKSRL+A+FADGTS V 
Sbjct  124   LTQLQLRAGNLTTSGCQ-EAHPVPVHRLGRGTSGILLCAKTKLAKSRLAAFFADGTSNVG  182

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R ++ +    R I KIYRALVSG+I EDE++IEQPIG+VRYPGVAKGLYVASPSGKPA
Sbjct  183   IYRRNDPQQKAGRSITKIYRALVSGIIIEDEIIIEQPIGLVRYPGVAKGLYVASPSGKPA  242

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER + +  TLV+VEIQSGRPHQIRIH+SFIGHPL+GDPLY  GGQP C + ++
Sbjct  243   LSKVVVLERDMLRKSTLVQVEIQSGRPHQIRIHVSFIGHPLVGDPLYGTGGQPKCSNHEV  302

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +++SFA+DGGY RP  PVPGDCGY+LHAH+L  PHP+T+E+I I +PLPSIL  ++E
Sbjct  303   VNQSFAEDGGYERPGKPVPGDCGYHLHAHRLVFPHPVTNEIIKITSPLPSILLTTEE  359



>ref|XP_010669646.1| PREDICTED: RNA pseudouridine synthase 5 [Beta vulgaris subsp. 
vulgaris]
Length=362

 Score =   509 bits (1311),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 245/358 (68%), Positives = 296/358 (83%), Gaps = 0/358 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWPE NDGLTY+D+V PS +GLTLI+FYS  + +SAPLQGW+QRI N QITIDG  V
Sbjct  4     IGIPWPELNDGLTYNDVVSPSHSGLTLIQFYSSNHTSSAPLQGWVQRIHNGQITIDGSTV  63

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P   L   ++LVYHRLPW+EP+ P++LEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV
Sbjct  64    TDPVTILRADSKLVYHRLPWREPDTPFLLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  123

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQL+W   K  + + S   +PVPVHRLGRGTSG+LLCAKTK+AK+ L+AYFADGTS+V+
Sbjct  124   LTQLKWHTQKNGNSTLSQVLNPVPVHRLGRGTSGVLLCAKTKIAKTCLAAYFADGTSLVR  183

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              KR  N ++   R+I KIYRALV G+I+ +E++I++PIG++RYPGVAKGLYVA PSGKPA
Sbjct  184   GKRDVNSKMEVERRITKIYRALVRGIIDSNEVLIDKPIGVMRYPGVAKGLYVALPSGKPA  243

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER VE++ TLV+VEIQSGRPHQIRIHLS IG PL+GDPLY+ GGQP CFDP+L
Sbjct  244   LSKVGVLERDVERDQTLVQVEIQSGRPHQIRIHLSLIGCPLLGDPLYVAGGQPECFDPEL  303

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             I E FA+DGGY+RP  PVPGDCGY+LHAH++ L HP T+E I I APLPS+LK  +E 
Sbjct  304   IQEDFAEDGGYQRPAKPVPGDCGYHLHAHEVTLSHPSTNEAIKIIAPLPSMLKTVEEA  361



>ref|XP_010524607.1| PREDICTED: RNA pseudouridine synthase 5 [Tarenaya hassleriana]
Length=385

 Score =   506 bits (1302),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 239/358 (67%), Positives = 290/358 (81%), Gaps = 1/358 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G  WPEFNDGLTY D V PSD+  T++EFYS KY+NSAPLQGW+QRIQN QI IDG VV
Sbjct  13    IGVRWPEFNDGLTYKDGVSPSDSEATVLEFYSTKYRNSAPLQGWIQRIQNGQIKIDGEVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P+A L  G++LVYHRLPW+EP+ PY LE+L+EDDD+IA NKPSGLQVLPGGLFQQRTV
Sbjct  73    RDPNAILRFGSKLVYHRLPWREPDTPYSLEILYEDDDLIAFNKPSGLQVLPGGLFQQRTV  132

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW     +      ESHPVPVHRLGRGTSG+LLCAKTKLAK++L+AYFA+GTS+V 
Sbjct  133   LTQLQWCFDGKNISMGRRESHPVPVHRLGRGTSGVLLCAKTKLAKTKLAAYFAEGTSLVD  192

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
                  + E+   RKI+KIYRAL  GVI ED++++ QPIG+V+YPGVA+GLYVASP+G+PA
Sbjct  193   ADSNVDQELGTGRKILKIYRALADGVIEEDKVIVRQPIGIVQYPGVARGLYVASPTGRPA  252

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
              S V VLER  E+NCTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLYI GGQP CF  D+
Sbjct  253   FSKVDVLERDRERNCTLVQVEIQSGRPHQIRIHLAYIGHPLVGDPLYIAGGQPKCFGSDV  312

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPIT-DELIAINAPLPSILKASQE  1168
             +D +FA+DGGY RP   VPGDCGY+LHAH++ L H +T ++++ I APLP IL+   E
Sbjct  313   MDGTFAEDGGYERPTQAVPGDCGYHLHAHQVELSHLMTSNKILKICAPLPQILQTQAE  370



>ref|XP_010253582.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Nelumbo nucifera]
Length=398

 Score =   503 bits (1296),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 248/365 (68%), Positives = 298/365 (82%), Gaps = 7/365 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGLTY D VRPS+A  T+IEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  19    FGVPWPDLNDGLTYTDTVRPSNAASTMIEFYSTKYKNSAPLQGWLQRIRNGQITVDGEVV  78

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G++L+YHRLPWKEP+APY+LE+L+EDDD++A NKPSGLQVLPGGLFQQRTV
Sbjct  79    KDPHTILRAGSELMYHRLPWKEPDAPYLLEILYEDDDLVAFNKPSGLQVLPGGLFQQRTV  138

Query  458   LTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFA  616
             LTQLQWR       +  LS+   + + HPVPVHRLGRGTSGILLCAK+KLAKSRL+AYFA
Sbjct  139   LTQLQWRECQGISTSLGLSTNPGAQQQHPVPVHRLGRGTSGILLCAKSKLAKSRLAAYFA  198

Query  617   DGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVA  796
             +GTS+V + R SN+++  VR+I K+YRAL SG+I++DE++I+QPIG++RY GVA GLYVA
Sbjct  199   EGTSVVGDNRKSNMDLGGVRRISKVYRALASGIIDKDEVIIKQPIGIMRYQGVANGLYVA  258

Query  797   SPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
             S SGKPALS V VLER +  NCTLV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG P
Sbjct  259   SSSGKPALSKVDVLERDIPGNCTLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVTGGHP  318

Query  977   MCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
              CF+ +  +  FAQDGGY+RP NPVPGDCGY LHAH L L HP   ++I I APLP +L+
Sbjct  319   KCFNSESGENDFAQDGGYQRPINPVPGDCGYYLHAHHLVLHHPTMKKVIEIIAPLPHVLQ  378

Query  1157  ASQEC  1171
               +E 
Sbjct  379   TQKEA  383



>ref|XP_010253580.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Nelumbo nucifera]
 ref|XP_010253581.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Nelumbo nucifera]
Length=399

 Score =   499 bits (1284),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 248/366 (68%), Positives = 298/366 (81%), Gaps = 8/366 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGLTY D VRPS+A  T+IEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  19    FGVPWPDLNDGLTYTDTVRPSNAASTMIEFYSTKYKNSAPLQGWLQRIRNGQITVDGEVV  78

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G++L+YHRLPWKEP+APY+LE+L+EDDD++A NKPSGLQVLPGGLFQQRTV
Sbjct  79    KDPHTILRAGSELMYHRLPWKEPDAPYLLEILYEDDDLVAFNKPSGLQVLPGGLFQQRTV  138

Query  458   LTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFA  616
             LTQLQWR       +  LS+   + + HPVPVHRLGRGTSGILLCAK+KLAKSRL+AYFA
Sbjct  139   LTQLQWRECQGISTSLGLSTNPGAQQQHPVPVHRLGRGTSGILLCAKSKLAKSRLAAYFA  198

Query  617   DGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVA  796
             +GTS+V + R SN+++  VR+I K+YRAL SG+I++DE++I+QPIG++RY GVA GLYVA
Sbjct  199   EGTSVVGDNRKSNMDLGGVRRISKVYRALASGIIDKDEVIIKQPIGIMRYQGVANGLYVA  258

Query  797   SPS-GKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             S S GKPALS V VLER +  NCTLV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG 
Sbjct  259   SSSVGKPALSKVDVLERDIPGNCTLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVTGGH  318

Query  974   PMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
             P CF+ +  +  FAQDGGY+RP NPVPGDCGY LHAH L L HP   ++I I APLP +L
Sbjct  319   PKCFNSESGENDFAQDGGYQRPINPVPGDCGYYLHAHHLVLHHPTMKKVIEIIAPLPHVL  378

Query  1154  KASQEC  1171
             +  +E 
Sbjct  379   QTQKEA  384



>ref|XP_004143830.1| PREDICTED: RNA pseudourine synthase 5-like [Cucumis sativus]
Length=371

 Score =   491 bits (1264),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 237/358 (66%), Positives = 293/358 (82%), Gaps = 1/358 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWP+ NDGL Y+D+V+P D+G +LI FYS KYK+SAPL+GWLQRI+N+QITIDG V+
Sbjct  10    IGIPWPDLNDGLFYNDVVKPPDSGKSLIHFYSWKYKSSAPLEGWLQRIKNEQITIDGEVI  69

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G+ LVY RLPWKEP+ PY+LE+L+ED++MIALNKPSGLQVLPGG+FQQRTV
Sbjct  70    TDPETILRIGSDLVYRRLPWKEPDTPYLLEILYEDNEMIALNKPSGLQVLPGGVFQQRTV  129

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW +SK S   S  E HPVPVHRLGRGTSGILLCAKTKLA+++ +AYFA+GTS V+
Sbjct  130   LTQLQWWSSKQSFSVSE-ELHPVPVHRLGRGTSGILLCAKTKLARTQFAAYFAEGTSSVR  188

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R S +E    RKI KIYRALV+G+I++DE+ ++QPIG ++YPGVA+GLYVA+PSGKPA
Sbjct  189   RNRNSTMEEGTKRKISKIYRALVTGIIHDDEVSVDQPIGRMQYPGVAQGLYVATPSGKPA  248

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
              S V VLER  +   TLV+VEIQSGRPHQIRIHLS IGHPL+GDPLY+ GGQP C   ++
Sbjct  249   CSKVNVLERDEQSKHTLVQVEIQSGRPHQIRIHLSSIGHPLVGDPLYVAGGQPNCLHSEV  308

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +++SFA+DGGY RP  PVPGDCGY LHAH+L L HP T+E++ I APLP IL+   E 
Sbjct  309   VNQSFAEDGGYERPTKPVPGDCGYYLHAHQLILYHPKTNEVVKIIAPLPPILRTRIEA  366



>ref|XP_004157313.1| PREDICTED: RNA pseudourine synthase 5-like [Cucumis sativus]
Length=371

 Score =   490 bits (1262),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 237/358 (66%), Positives = 293/358 (82%), Gaps = 1/358 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWP+ NDGL Y+D+V+P D+G +LI FYS KYK+SAPL+GWLQRI+N+QITIDG V+
Sbjct  10    IGIPWPDLNDGLFYNDVVKPPDSGKSLIHFYSWKYKSSAPLEGWLQRIKNEQITIDGEVI  69

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G+ LVY RLPWKEP+ PY+LE+L+ED++MIALNKPSGLQVLPGG+FQQRTV
Sbjct  70    TDPETILRIGSDLVYRRLPWKEPDTPYLLEILYEDNEMIALNKPSGLQVLPGGVFQQRTV  129

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW +SK S   S  E HPVPVHRLGRGTSGILLCAKTKLA+++ +AYFA+GTS V+
Sbjct  130   LTQLQWWSSKQSFSVSE-ELHPVPVHRLGRGTSGILLCAKTKLARTQFAAYFAEGTSSVR  188

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R S +E    RKI KIYRALV+G+I++DE+ ++QPIG ++YPGVA+GLYVA+PSGKPA
Sbjct  189   RNRNSTMEEGTKRKISKIYRALVTGIIHDDEVSVDQPIGRMQYPGVAQGLYVATPSGKPA  248

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
              S V VLER  +   TLV+VEIQSGRPHQIRIHLS IGHPL+GDPLY+ GGQP C   ++
Sbjct  249   CSKVNVLERDEQSKHTLVQVEIQSGRPHQIRIHLSSIGHPLLGDPLYVAGGQPNCLHSEV  308

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +++SFA+DGGY RP  PVPGDCGY LHAH+L L HP T+E++ I APLP IL+   E 
Sbjct  309   VNQSFAEDGGYERPTKPVPGDCGYYLHAHQLILYHPKTNEVVKIIAPLPPILRTRIEA  366



>ref|XP_006291291.1| hypothetical protein CARUB_v10017427mg [Capsella rubella]
 gb|EOA24189.1| hypothetical protein CARUB_v10017427mg [Capsella rubella]
Length=382

 Score =   487 bits (1254),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 243/362 (67%), Positives = 287/362 (79%), Gaps = 5/362 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D+V  S++ LT + +FY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  11    IGLPWPEHNDGLEYKDVVSSSESELTTVSDFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  70

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P   L  G++LVYHRLPWKEP+ PY LE+L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  71    VKDPKTVLRSGSKLVYHRLPWKEPDTPYSLEILYEDDDLIALNKPSGLQVLPGGLFQQRT  130

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             +LTQLQW   K    + S ESHPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  131   LLTQLQWWFGKKDFSTGSPESHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  190

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                     +    RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVAKGLYVASP GKP
Sbjct  191   GSGNLDQ-DCGTGRKLSKIYRALADGIVEEDEVVIQQPIGVVRYPGVAKGLYVASPEGKP  249

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             A S V VLER  EK+CTLV+VEIQSGRPHQIRIHL++IGHPLIGDPLY+ GGQP CFD D
Sbjct  250   AFSKVVVLERDREKSCTLVKVEIQSGRPHQIRIHLAYIGHPLIGDPLYVAGGQPKCFDTD  309

Query  995   LI--DESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKASQ  1165
             L+  D +FA+DGGYRRP  PVPGDCGY LHAH++ L + + T +++ I APLP IL+ S 
Sbjct  310   LVADDAAFAEDGGYRRPNQPVPGDCGYYLHAHQVDLLNLLNTHQVVKIVAPLPPILQTSS  369

Query  1166  EC  1171
             E 
Sbjct  370   EA  371



>ref|XP_006403820.1| hypothetical protein EUTSA_v10010446mg [Eutrema salsugineum]
 gb|ESQ45273.1| hypothetical protein EUTSA_v10010446mg [Eutrema salsugineum]
Length=382

 Score =   486 bits (1250),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 239/363 (66%), Positives = 292/363 (80%), Gaps = 9/363 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG---LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDG  268
              G PWPE NDGL Y D+V    +     T+ +FYS KYK+SAPL GW+QRIQN QI IDG
Sbjct  11    IGLPWPELNDGLAYKDVVSSFSSSSELTTVSDFYSTKYKSSAPLLGWIQRIQNGQIQIDG  70

Query  269   RVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQ  448
              VV + +  L  G++LVYHRLPWKEP+ PY LEVL+ED+D+IALNKPSGLQVLPGGLFQQ
Sbjct  71    EVVKDHNTLLRRGSKLVYHRLPWKEPDTPYSLEVLYEDNDLIALNKPSGLQVLPGGLFQQ  130

Query  449   RTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTS  628
             RT+LTQLQW  SK  S + + ESHPVPVHRLGRGTSGILLCAKTKLAK++L++YFA+GTS
Sbjct  131   RTLLTQLQWCFSKKDSSTGARESHPVPVHRLGRGTSGILLCAKTKLAKTKLASYFAEGTS  190

Query  629   IVQEKRYSNL--EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASP  802
             +V    + NL  E    RKI KIYRAL  G++ EDE+VI+QPIG+VRYPGVAKGLYVAS 
Sbjct  191   LVG---FGNLDQECGTGRKISKIYRALADGIVEEDEVVIKQPIGVVRYPGVAKGLYVASS  247

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
              GKPALS V VLER +++NCTLV+VEIQSGRPHQIRIHL+++GHPL+GDPLY+ GG+P C
Sbjct  248   EGKPALSKVAVLERNMQRNCTLVKVEIQSGRPHQIRIHLAYMGHPLVGDPLYVAGGKPKC  307

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPIT-DELIAINAPLPSILKA  1159
             FDPD +D +FA+DGGYRRP   VPGDCGY+LHAH++ LP+ +  ++++ + APLP IL+ 
Sbjct  308   FDPDAVDSAFAEDGGYRRPNQAVPGDCGYHLHAHQVELPNLLNLNKVVKVVAPLPPILQT  367

Query  1160  SQE  1168
             S E
Sbjct  368   SSE  370



>ref|XP_010253584.1| PREDICTED: RNA pseudouridine synthase 5 isoform X4 [Nelumbo nucifera]
Length=380

 Score =   484 bits (1247),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/332 (70%), Positives = 277/332 (83%), Gaps = 8/332 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGLTY D VRPS+A  T+IEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  19    FGVPWPDLNDGLTYTDTVRPSNAASTMIEFYSTKYKNSAPLQGWLQRIRNGQITVDGEVV  78

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G++L+YHRLPWKEP+APY+LE+L+EDDD++A NKPSGLQVLPGGLFQQRTV
Sbjct  79    KDPHTILRAGSELMYHRLPWKEPDAPYLLEILYEDDDLVAFNKPSGLQVLPGGLFQQRTV  138

Query  458   LTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFA  616
             LTQLQWR       +  LS+   + + HPVPVHRLGRGTSGILLCAK+KLAKSRL+AYFA
Sbjct  139   LTQLQWRECQGISTSLGLSTNPGAQQQHPVPVHRLGRGTSGILLCAKSKLAKSRLAAYFA  198

Query  617   DGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVA  796
             +GTS+V + R SN+++  VR+I K+YRAL SG+I++DE++I+QPIG++RY GVA GLYVA
Sbjct  199   EGTSVVGDNRKSNMDLGGVRRISKVYRALASGIIDKDEVIIKQPIGIMRYQGVANGLYVA  258

Query  797   SPS-GKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             S S GKPALS V VLER +  NCTLV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG 
Sbjct  259   SSSVGKPALSKVDVLERDIPGNCTLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVTGGH  318

Query  974   PMCFDPDLIDESFAQDGGYRRPENPVPGDCGY  1069
             P CF+ +  +  FAQDGGY+RP NPVPGDCGY
Sbjct  319   PKCFNSESGENDFAQDGGYQRPINPVPGDCGY  350



>ref|XP_008465672.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Cucumis melo]
Length=369

 Score =   484 bits (1245),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 237/358 (66%), Positives = 290/358 (81%), Gaps = 3/358 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWP+ NDGL Y+D+V+P D+G +LI FYS KYK+SAPL+GWLQRI+N+QITIDG V+
Sbjct  10    IGIPWPDLNDGLFYNDVVKPPDSGKSLIHFYSCKYKSSAPLEGWLQRIKNEQITIDGEVI  69

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVY RLPWKEP+ P+ LE+L+EDD+MIALNKPSGLQVLPGG+FQQRTV
Sbjct  70    TDPETILRIGSELVYRRLPWKEPDTPFSLEILYEDDEMIALNKPSGLQVLPGGVFQQRTV  129

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW +S  S   S  E HPVPVHRLGRGTSGILLCAKTKLA+++ +AYFADGTS V 
Sbjct  130   LTQLQWWSSDQSFSISE-ELHPVPVHRLGRGTSGILLCAKTKLARTQFAAYFADGTSSV-  187

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R S  E    RKI KIYRALV+G+I++DE+ ++QPIG ++YPGVA+GLYVA+PSGKPA
Sbjct  188   -IRNSTSEEGTKRKISKIYRALVTGIIHDDEVSVDQPIGRMQYPGVAQGLYVATPSGKPA  246

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
              S V VLER  +   TLV+VEIQSGRPHQIRIHLS IGHPL+GDPLY+ GGQP C   ++
Sbjct  247   CSKVNVLERDEQGEHTLVQVEIQSGRPHQIRIHLSSIGHPLLGDPLYVAGGQPNCLHSEV  306

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +++SFA+DGGY RP  PVPGDCGY LHAH+L L HP T+E++ I APLP IL+   E 
Sbjct  307   VNQSFAEDGGYERPMKPVPGDCGYYLHAHQLILYHPKTNEVVKIVAPLPPILRTRSEA  364



>ref|NP_974416.1| RNA pseudourine synthase 5 [Arabidopsis thaliana]
 sp|Q5M721.2|PUS5_ARATH RecName: Full=RNA pseudouridine synthase 5; AltName: Full=RNA 
pseudouridylate synthase 5; AltName: Full=RNA-uridine isomerase 
5 [Arabidopsis thaliana]
 gb|AEE78921.1| RNA pseudourine synthase 5 [Arabidopsis thaliana]
Length=369

 Score =   482 bits (1241),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 243/362 (67%), Positives = 288/362 (80%), Gaps = 6/362 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D +  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  8     IGLPWPELNDGLAYKDAISSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  67

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVY RLPWKEP+ PY LEVL+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  68    VKDPNTLLRSGSKLVYSRLPWKEPDTPYSLEVLYEDDDLIALNKPSGLQVLPGGLFQQRT  127

Query  455   VLTQLQWRAsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSI  631
             VLTQLQW   K  S   S ES HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+
Sbjct  128   VLTQLQWCFGKNDSYIGSRESPHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSL  187

Query  632   VQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGK  811
             V        E    RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVA+GLYVASP GK
Sbjct  188   VGSGNLDQ-ECGTGRKLSKIYRALADGIVEEDEVVIKQPIGVVRYPGVAQGLYVASPEGK  246

Query  812   PALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDP  991
             PA S V VLER  EKNC+LV+VEIQSGRPHQIRIHL+++GHPL+GDPLY+ GGQP CFDP
Sbjct  247   PAFSKVFVLERDREKNCSLVKVEIQSGRPHQIRIHLAYMGHPLVGDPLYVAGGQPKCFDP  306

Query  992   DLIDE--SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKAS  1162
             DL+D+  +FA+DGGYRRP   VPGDCGY+LHAH++ LP+ + T +++ I APLP IL+  
Sbjct  307   DLVDDAAAFAEDGGYRRPNQAVPGDCGYHLHAHQVELPNLLNTHKVVKIVAPLPPILQTR  366

Query  1163  QE  1168
              E
Sbjct  367   CE  368



>ref|XP_010515681.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Camelina 
sativa]
Length=381

 Score =   482 bits (1241),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 236/362 (65%), Positives = 288/362 (80%), Gaps = 5/362 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGL-TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D+V  S++ L T+ EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  12    IGLPWPELNDGLEYKDIVSSSESELMTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  71

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72    VKDPNTVLRSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             +LTQL W   K  S + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132   LLTQLHWWFGKKDSSTGARELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                     +    RK+ KIYRAL  G+I EDE+VI+QPIG+VRYPGVAKGLYVASP GKP
Sbjct  192   GSGNLDQ-DCGTGRKLTKIYRALADGIIEEDEVVIQQPIGVVRYPGVAKGLYVASPEGKP  250

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             A S + VL R  + NCTLV+V+IQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP CFD D
Sbjct  251   AFSKLAVLARDRQNNCTLVKVDIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKCFDTD  310

Query  995   LIDE--SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPIT-DELIAINAPLPSILKASQ  1165
             L+D+  +FA+DGGYRRP  PVPGDCGY+LHAH++ L + +  ++++ I APLP+IL+ S 
Sbjct  311   LVDDAAAFAEDGGYRRPNQPVPGDCGYHLHAHQVELLNLLNINKVVKIVAPLPTILQTSS  370

Query  1166  EC  1171
             E 
Sbjct  371   EA  372



>ref|XP_010426837.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X1 [Camelina 
sativa]
Length=381

 Score =   481 bits (1237),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 288/362 (80%), Gaps = 5/362 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D+V  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  12    IGLPWPELNDGLEYKDIVSSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  71

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72    VKDPNTVLKSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             +LTQLQW   +  S + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132   LLTQLQWWFGQKDSSTGACELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                          RK+ KIYRAL  G+I EDE+VI+QPIG+VRYPGVAKGLYVA P GKP
Sbjct  192   GSGNLDQ-NCGTGRKLTKIYRALADGIIEEDEVVIQQPIGVVRYPGVAKGLYVAFPEGKP  250

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             A S + VL R  + NCTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GG+P CF+ D
Sbjct  251   AFSKLAVLARDRQNNCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGRPKCFETD  310

Query  995   LIDES--FAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKASQ  1165
             L+D++  FA+DGGYRRP  PVPGDCGY+LHAH++ L + + T++++ + APLP+IL+ S 
Sbjct  311   LVDDAAGFAEDGGYRRPNQPVPGDCGYHLHAHQVELLNLLNTNKVVKLVAPLPTILRTSS  370

Query  1166  EC  1171
             E 
Sbjct  371   EA  372



>ref|XP_002877851.1| pseudouridine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54110.1| pseudouridine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   480 bits (1235),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 291/368 (79%), Gaps = 12/368 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE N GL Y D++  SD+ LT + +FY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  11    IGLPWPELNVGLAYKDVISSSDSELTTVSDFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  70

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ PY L+VL+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  71    VKDPNTLLRSGSKLVYHRLPWKEPDTPYSLQVLYEDDDLIALNKPSGLQVLPGGLFQQRT  130

Query  455   VLTQLQWRAsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSI  631
             VLTQLQW   K  S + S ES HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+
Sbjct  131   VLTQLQWCFRKNDSYTGSRESPHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSL  190

Query  632   VQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGK  811
             V        E  + RK+ KIYRAL  G++ EDE+VI+QP+G+VRYPGVAKGLYVASP GK
Sbjct  191   VGSGNLEQ-ECGKGRKLSKIYRALADGIVEEDEVVIKQPLGVVRYPGVAKGLYVASPEGK  249

Query  812   PALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIG------DPLYIDGGQ  973
             PA S V VLER  +KNCTLV+VEIQSGRPHQIRIHL+++GHPL+       DPLY+ GGQ
Sbjct  250   PAFSKVAVLERDKQKNCTLVKVEIQSGRPHQIRIHLAYMGHPLLASYNCMRDPLYVAGGQ  309

Query  974   PMCFDPDLIDE--SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLP  1144
             P CFDPDL+D+  +FA+DGGYRRP   VPGDCGY+LHAH++ LP+ + T +++ I APLP
Sbjct  310   PKCFDPDLVDDDAAFAEDGGYRRPNQAVPGDCGYHLHAHQVELPNLLNTHKVVKIVAPLP  369

Query  1145  SILKASQE  1168
              IL+ S E
Sbjct  370   PILQTSSE  377



>ref|XP_008465671.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Cucumis melo]
Length=377

 Score =   476 bits (1225),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/366 (65%), Positives = 290/366 (79%), Gaps = 11/366 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWP+ NDGL Y+D+V+P D+G +LI FYS KYK+SAPL+GWLQRI+N+QITIDG V+
Sbjct  10    IGIPWPDLNDGLFYNDVVKPPDSGKSLIHFYSCKYKSSAPLEGWLQRIKNEQITIDGEVI  69

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVY RLPWKEP+ P+ LE+L+EDD+MIALNKPSGLQVLPGG+FQQRTV
Sbjct  70    TDPETILRIGSELVYRRLPWKEPDTPFSLEILYEDDEMIALNKPSGLQVLPGGVFQQRTV  129

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW +S  S   S  E HPVPVHRLGRGTSGILLCAKTKLA+++ +AYFADGTS V 
Sbjct  130   LTQLQWWSSDQSFSISE-ELHPVPVHRLGRGTSGILLCAKTKLARTQFAAYFADGTSSV-  187

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
               R S  E    RKI KIYRALV+G+I++DE+ ++QPIG ++YPGVA+GLYVA+PSGKPA
Sbjct  188   -IRNSTSEEGTKRKISKIYRALVTGIIHDDEVSVDQPIGRMQYPGVAQGLYVATPSGKPA  246

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
              S V VLER  +   TLV+VEIQSGRPHQIRIHLS IGHPL+GDPLY+ GGQP C   ++
Sbjct  247   CSKVNVLERDEQGEHTLVQVEIQSGRPHQIRIHLSSIGHPLLGDPLYVAGGQPNCLHSEV  306

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDE--------LIAINAPLPSIL  1153
             +++SFA+DGGY RP  PVPGDCGY LHAH+L L HP T+E        ++ I APLP IL
Sbjct  307   VNQSFAEDGGYERPMKPVPGDCGYYLHAHQLILYHPKTNEKGFLVLLKVVKIVAPLPPIL  366

Query  1154  KASQEC  1171
             +   E 
Sbjct  367   RTRSEA  372



>ref|XP_009384912.1| PREDICTED: RNA pseudouridine synthase 5 [Musa acuminata subsp. 
malaccensis]
Length=385

 Score =   476 bits (1225),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 283/362 (78%), Gaps = 12/362 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ N+GL Y DLVR +    TLIEFYS KYKNSAPLQGWLQRI+N+QIT+DG +V
Sbjct  23    FGVPWPDLNEGLLYTDLVRSTGNATTLIEFYSSKYKNSAPLQGWLQRIRNRQITVDGGLV  82

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P  +L  GA++VYHRLPWKEP APY+LEVL+ED+DM+A+NKPSGLQVLPGGLFQQRTV
Sbjct  83    TDPCFALRDGAEVVYHRLPWKEPFAPYLLEVLYEDNDMVAINKPSGLQVLPGGLFQQRTV  142

Query  458   LTQLQWR-----AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADG  622
             L QLQW+     +S  S    + E+HPVPVHRLGRGTSGILLCAKTKLAK+RLSAYFA+G
Sbjct  143   LMQLQWKEWNKVSSDCSKRQMTQETHPVPVHRLGRGTSGILLCAKTKLAKTRLSAYFANG  202

Query  623   TSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASP  802
             T+   +         + R+I K+YRALV+GVI  DE VI+QPIG + YPGVAKGLYVAS 
Sbjct  203   TAFAGDDG-------KARRISKVYRALVAGVIARDEFVIKQPIGTMHYPGVAKGLYVASS  255

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
             SGKPALS V+VLER  ++N  +V+VEI SGRPHQIRIHL+F GHPLIGDPLY  GGQP  
Sbjct  256   SGKPALSKVQVLERDAQRNQAVVQVEIHSGRPHQIRIHLAFAGHPLIGDPLYDIGGQPKA  315

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKAS  1162
             F+P+   +  A DGGY++P   VPGDCGY LHA++L L HP+T++ I I A LP IL+  
Sbjct  316   FEPESSCDCAADDGGYQKPVQAVPGDCGYYLHAYQLFLSHPVTNKRIEITASLPPILQTQ  375

Query  1163  QE  1168
             +E
Sbjct  376   EE  377



>emb|CAC07917.1| putative protein [Arabidopsis thaliana]
Length=376

 Score =   475 bits (1223),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 243/369 (66%), Positives = 288/369 (78%), Gaps = 13/369 (4%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D +  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  8     IGLPWPELNDGLAYKDAISSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  67

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVY RLPWKEP+ PY LEVL+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  68    VKDPNTLLRSGSKLVYSRLPWKEPDTPYSLEVLYEDDDLIALNKPSGLQVLPGGLFQQRT  127

Query  455   VLTQLQWRAsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSI  631
             VLTQLQW   K  S   S ES HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+
Sbjct  128   VLTQLQWCFGKNDSYIGSRESPHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSL  187

Query  632   VQEKRYSNLEVMRVRKIIKIYRALVSGVINEDE-------LVIEQPIGMVRYPGVAKGLY  790
             V        E    RK+ KIYRAL  G++ EDE       +VI+QPIG+VRYPGVA+GLY
Sbjct  188   VGSGNLDQ-ECGTGRKLSKIYRALADGIVEEDEARPFLLFVVIKQPIGVVRYPGVAQGLY  246

Query  791   VASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGG  970
             VASP GKPA S V VLER  EKNC+LV+VEIQSGRPHQIRIHL+++GHPL+GDPLY+ GG
Sbjct  247   VASPEGKPAFSKVFVLERDREKNCSLVKVEIQSGRPHQIRIHLAYMGHPLVGDPLYVAGG  306

Query  971   QPMCFDPDLIDE--SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPL  1141
             QP CFDPDL+D+  +FA+DGGYRRP   VPGDCGY+LHAH++ LP+ + T +++ I APL
Sbjct  307   QPKCFDPDLVDDAAAFAEDGGYRRPNQAVPGDCGYHLHAHQVELPNLLNTHKVVKIVAPL  366

Query  1142  PSILKASQE  1168
             P IL+   E
Sbjct  367   PPILQTRCE  375



>ref|XP_009136663.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Brassica 
rapa]
Length=372

 Score =   475 bits (1223),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 285/360 (79%), Gaps = 15/360 (4%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGL-TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGLTY D+V  SD+ L T+ +FY  KYK+SAPL GW+QRIQN QI +DG V
Sbjct  9     IGLPWPELNDGLTYKDVVSSSDSELRTVSDFYYSKYKSSAPLLGWIQRIQNGQIQVDGEV  68

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ P+ L++L++DD +IALNKPSGLQVLPGGLFQQRT
Sbjct  69    VKDPNTLLRSGSKLVYHRLPWKEPDTPHSLDILYQDDHLIALNKPSGLQVLPGGLFQQRT  128

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VLTQLQW           GE HPVPVHRLGRGTSGILLCAKTKLAK++LSAYFA+GTS+V
Sbjct  129   VLTQLQW---------CFGELHPVPVHRLGRGTSGILLCAKTKLAKTKLSAYFAEGTSLV  179

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                     E   VRKI KIYRAL SG++ EDE+VI+QPIG+VRYPGVAKGLYVAS  GKP
Sbjct  180   GSGNMGQ-ECGAVRKISKIYRALASGIVEEDEVVIKQPIGVVRYPGVAKGLYVASSEGKP  238

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             + S V VLER  +++CTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP   DPD
Sbjct  239   SFSKVIVLERDRQRDCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKGVDPD  298

Query  995   LID---ESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKAS  1162
             L+D    SFA+DGGY+RP   VPGDCGY+LHAH++ +P+ + T +++ + APLP IL+ S
Sbjct  299   LVDATTTSFAEDGGYQRPNQAVPGDCGYHLHAHEVEIPNLLNTRKVVKVMAPLPPILQTS  358



>gb|KEH43531.1| pseudouridine synthase Rlu family protein [Medicago truncatula]
Length=340

 Score =   471 bits (1211),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 271/317 (85%), Gaps = 3/317 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWPEFNDGL+Y D+VRPSDAGLTLIEFYS KYK+SAPLQGWLQRI++ QIT+D RVV
Sbjct  7     IGIPWPEFNDGLSYDDVVRPSDAGLTLIEFYSTKYKSSAPLQGWLQRIKSDQITLDARVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVYHR+PWKEP+AP+ +EVL+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  67    TDPNTILRVGSKLVYHRIPWKEPDAPHTIEVLYEDDDIIALNKPSGLQVLPGGLFQQRTV  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW  +  S++ +  + HPVPVHRLGRGTSGILLCAKTKLA++RL++YFADGTS ++
Sbjct  127   LTQLQWETNNKSTIEAHQKPHPVPVHRLGRGTSGILLCAKTKLARARLASYFADGTSRIE  186

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              K ++N E   + KI KIYRALVSG+IN D++ I QPIGMV+YPGVAKGLYVAS SGKPA
Sbjct  187   GKGHTNQE---LGKIAKIYRALVSGIINNDQVTINQPIGMVKYPGVAKGLYVASQSGKPA  243

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER V++N TLV+V+IQSGRPHQIRIHLSFIGHPL+GDPLY  GGQP C D D 
Sbjct  244   LSVVHVLERNVKENSTLVQVKIQSGRPHQIRIHLSFIGHPLLGDPLYAVGGQPKCLDCDF  303

Query  998   IDESFAQDGGYRRPENP  1048
             +DESFA+DG  R  +NP
Sbjct  304   LDESFAEDGKLREIDNP  320



>ref|XP_010503961.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X4 [Camelina 
sativa]
Length=384

 Score =   472 bits (1215),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 237/367 (65%), Positives = 290/367 (79%), Gaps = 12/367 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D+V  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG  
Sbjct  12    IGLPWPELNDGLQYKDVVSSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEA  71

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72    VKDPNTVLRSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             +LTQLQW   K  + + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132   LLTQLQWWFGKKDTSTGARELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635   QEKRYSNLE--VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSG  808
                  SNL+      RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVAKGLYVASP G
Sbjct  192   GS---SNLDQDCGTGRKLSKIYRALADGLVEEDEVVIQQPIGVVRYPGVAKGLYVASPEG  248

Query  809   KPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFD  988
             K A S V VLER  +KNCTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP CFD
Sbjct  249   KSAFSKVVVLERDRKKNCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKCFD  308

Query  989   PDLIDE--SFAQDG---GYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSI  1150
              DL+D+  +FA+DG   G ++P   VPGDCGY+LHAH++ L + + T +++ I APLP+I
Sbjct  309   TDLVDDAAAFAEDGILQGVQKPNQSVPGDCGYHLHAHQVELLNLLNTRKVVKIVAPLPTI  368

Query  1151  LKASQEC  1171
             L+ S E 
Sbjct  369   LQTSSEA  375



>ref|XP_008789068.1| PREDICTED: RNA pseudouridine synthase 5 [Phoenix dactylifera]
Length=442

 Score =   471 bits (1213),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 234/371 (63%), Positives = 288/371 (78%), Gaps = 7/371 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPEFN+GL+Y D+VR   + LTLI+FYS KYK+SAPL+GWL RI+N QIT+DG ++
Sbjct  69    FGVPWPEFNEGLSYTDVVRSPSSALTLIDFYSSKYKHSAPLEGWLHRIKNGQITVDGEMI  128

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P   L  G+++VY+RLPWKEP+APY+LEVL+EDDDM+ALNKPSGLQVLPGGLFQQRTV
Sbjct  129   TDPSMVLRDGSKVVYYRLPWKEPSAPYLLEVLYEDDDMVALNKPSGLQVLPGGLFQQRTV  188

Query  458   LTQLQWR-----AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADG  622
             L QLQW+         S   S+ E+HPVPVHRLGRGTSGILLCAKTKLAKS L+AYFA G
Sbjct  189   LMQLQWKEWRKNTLGYSKQDSTQEAHPVPVHRLGRGTSGILLCAKTKLAKSCLAAYFAKG  248

Query  623   TSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASP  802
             T  + E R      MR  +I K YR+LV+GVI  +E++I+QPIG++ YPGVA GLYVAS 
Sbjct  249   TENIGENRCEGKPGMR--RISKFYRSLVTGVIVNNEVLIKQPIGVMHYPGVANGLYVASS  306

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
             SGKPA+S V VLER +++N TLV+VEI SGRPHQIRIHL+ IGHPL+GDPLY  GG P  
Sbjct  307   SGKPAMSKVYVLERDLQRNQTLVQVEIHSGRPHQIRIHLASIGHPLLGDPLYGIGGCPKP  366

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKAS  1162
             F+PD ID+ FA+DGGY++P + VPGDCGY LHAH+L L HP    ++ I APLP IL+  
Sbjct  367   FEPDPIDDGFAEDGGYQKPVHSVPGDCGYFLHAHQLVLHHPTIHVMVGITAPLPPILQTR  426

Query  1163  QEC*K*REGSN  1195
             +E  + R   N
Sbjct  427   EELDRTRPAEN  437



>gb|KEH43532.1| pseudouridine synthase Rlu family protein [Medicago truncatula]
Length=312

 Score =   466 bits (1200),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 225/309 (73%), Positives = 267/309 (86%), Gaps = 3/309 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWPEFNDGL+Y D+VRPSDAGLTLIEFYS KYK+SAPLQGWLQRI++ QIT+D RVV
Sbjct  7     IGIPWPEFNDGLSYDDVVRPSDAGLTLIEFYSTKYKSSAPLQGWLQRIKSDQITLDARVV  66

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G++LVYHR+PWKEP+AP+ +EVL+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  67    TDPNTILRVGSKLVYHRIPWKEPDAPHTIEVLYEDDDIIALNKPSGLQVLPGGLFQQRTV  126

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW  +  S++ +  + HPVPVHRLGRGTSGILLCAKTKLA++RL++YFADGTS ++
Sbjct  127   LTQLQWETNNKSTIEAHQKPHPVPVHRLGRGTSGILLCAKTKLARARLASYFADGTSRIE  186

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              K ++N E   + KI KIYRALVSG+IN D++ I QPIGMV+YPGVAKGLYVAS SGKPA
Sbjct  187   GKGHTNQE---LGKIAKIYRALVSGIINNDQVTINQPIGMVKYPGVAKGLYVASQSGKPA  243

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER V++N TLV+V+IQSGRPHQIRIHLSFIGHPL+GDPLY  GGQP C D D 
Sbjct  244   LSVVHVLERNVKENSTLVQVKIQSGRPHQIRIHLSFIGHPLLGDPLYAVGGQPKCLDCDF  303

Query  998   IDESFAQDG  1024
             +DESFA+DG
Sbjct  304   LDESFAEDG  312



>gb|KFK34479.1| hypothetical protein AALP_AA5G150800 [Arabis alpina]
Length=377

 Score =   468 bits (1205),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 231/360 (64%), Positives = 285/360 (79%), Gaps = 4/360 (1%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D+V  S++ LT + +FYS KYK+SAPL GW+QRIQN QI IDG V
Sbjct  9     IGLPWPELNDGLVYKDIVSSSESELTTVSDFYSTKYKSSAPLLGWIQRIQNGQIQIDGEV  68

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L   ++LVYHRLPWKEP+ PY +++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  69    VKDPNTLLRSDSKLVYHRLPWKEPDTPYSIDILYEDDDLIALNKPSGLQVLPGGLFQQRT  128

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             +LTQLQW   K  S + + ESHPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS V
Sbjct  129   LLTQLQWCFGKKDSSTKAHESHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSRV  188

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                     E    RKI KIYRAL  G++ EDE+VI+QPIG+++YPGVAKGLYVASP GKP
Sbjct  189   GSGNLDQ-EGGTGRKISKIYRALADGIVEEDEVVIKQPIGVIQYPGVAKGLYVASPEGKP  247

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
              LS + VLER  ++NCTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP C   D
Sbjct  248   TLSKLYVLERDRQRNCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKCCGLD  307

Query  995   LIDE-SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKASQE  1168
             ++D  +FA+DGGY+RP   VPGDCGY+LHAH++ L + + + +++ I A LP IL+ S E
Sbjct  308   VVDAGAFAKDGGYQRPNQAVPGDCGYHLHAHQVELQNLLNSHKVVKIVALLPPILQTSSE  367



>emb|CDY29071.1| BnaC07g32770D [Brassica napus]
Length=515

 Score =   473 bits (1217),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 238/371 (64%), Positives = 287/371 (77%), Gaps = 26/371 (7%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGLTY D+V  SD+ LT + +FY  KYK+SAPL GW+QRIQN QI +DG V
Sbjct  141   IGLPWPELNDGLTYKDVVSSSDSELTTVSDFYYTKYKSSAPLLGWIQRIQNGQIQVDGEV  200

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ P++L++L++DDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  201   VKDPNTLLRSGSKLVYHRLPWKEPDTPHLLDILYQDDDLIALNKPSGLQVLPGGLFQQRT  260

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VLTQLQW           GESHPVPVHRLGRGTSGILLCAKTKLAK++LSAYFA+GTS+V
Sbjct  261   VLTQLQW---------CFGESHPVPVHRLGRGTSGILLCAKTKLAKTKLSAYFAEGTSLV  311

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDE----------LVIEQPIGMVRYPGVAKG  784
                     E   VRKI KIYRAL SG++ EDE          + I+QPIG+VRYPGVAKG
Sbjct  312   GSGNMGQ-ECGTVRKISKIYRALASGIVEEDEARPLYYFAMIIFIKQPIGVVRYPGVAKG  370

Query  785   LYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYID  964
             LYVAS  GKP+ S V VLER  +++CTLV+VEIQSGRPHQIRIHL+FIGHPL+GDPLY+ 
Sbjct  371   LYVASSEGKPSFSKVIVLERDRQRDCTLVKVEIQSGRPHQIRIHLAFIGHPLVGDPLYVA  430

Query  965   GGQPMCFDPDLIDE----SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAI  1129
             GGQP   DPDL+D     SFA+DGGYRRP   VPGDCGY+LHAH++ +P+ + T +++ +
Sbjct  431   GGQPKGVDPDLVDAASTPSFAEDGGYRRPNQAVPGDCGYHLHAHEVEIPNLLNTRKVLKV  490

Query  1130  NAPLPSILKAS  1162
              APLP IL+ S
Sbjct  491   VAPLPPILQTS  501



>gb|KGN51212.1| hypothetical protein Csa_5G492340 [Cucumis sativus]
Length=480

 Score =   471 bits (1212),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 230/358 (64%), Positives = 285/358 (80%), Gaps = 17/358 (5%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
              G PWP+ NDGL Y+D+V+P D+G +LI FYS KYK+SAPL+GWLQRI+N+QITIDG V+
Sbjct  135   IGIPWPDLNDGLFYNDVVKPPDSGKSLIHFYSWKYKSSAPLEGWLQRIKNEQITIDGEVI  194

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             ++P+  L  G+ LVY RLPWKEP+ PY+LE+L+ED++MIALNKPSGLQVLPGG+FQQRTV
Sbjct  195   TDPETILRIGSDLVYRRLPWKEPDTPYLLEILYEDNEMIALNKPSGLQVLPGGVFQQRTV  254

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
             LTQLQW +SK S   S  E HPVPVHRLGRGTSGILLCAKTKLA+++ +AYFA+GTS V 
Sbjct  255   LTQLQWWSSKQSFSVSE-ELHPVPVHRLGRGTSGILLCAKTKLARTQFAAYFAEGTSSV-  312

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              +R S +E    RKI KIYRALV+G+I++DE+ ++QPIG ++YPGVA+GLYVA+PSGKPA
Sbjct  313   -RRNSTMEEGTKRKISKIYRALVTGIIHDDEVSVDQPIGRMQYPGVAQGLYVATPSGKPA  371

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
                           C+ V VEIQSGRPHQIRIHLS IGHPL+GDPLY+ GGQP C   ++
Sbjct  372   --------------CSKVNVEIQSGRPHQIRIHLSSIGHPLLGDPLYVAGGQPNCLHSEV  417

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             +++SFA+DGGY RP  PVPGDCGY LHAH+L L HP T+E++ I APLP IL+   E 
Sbjct  418   VNQSFAEDGGYERPTKPVPGDCGYYLHAHQLILYHPKTNEVVKIIAPLPPILRTRIEA  475



>ref|XP_009589059.1| PREDICTED: RNA pseudouridine synthase 5 isoform X4 [Nicotiana 
tomentosiformis]
Length=397

 Score =   468 bits (1203),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 227/303 (75%), Positives = 268/303 (88%), Gaps = 2/303 (1%)
 Frame = +2

Query  227   WLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNK  406
             + +RIQNKQIT+D +VV+ PD  L  G +LVYHRLPW+EP+APY+L+VLFEDD +IALNK
Sbjct  20    FTRRIQNKQITVDSKVVTIPDTELRAGTELVYHRLPWREPDAPYLLQVLFEDDYLIALNK  79

Query  407   PSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTK  583
             PSGLQVLPGGLFQQRTVLTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILLCAKTK
Sbjct  80    PSGLQVLPGGLFQQRTVLTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTK  139

Query  584   LAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVR  763
             LAKSRL+AYFA+GTS+V++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QPIG ++
Sbjct  140   LAKSRLAAYFAEGTSVVEDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIK  198

Query  764   YPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLI  943
             YPGVAKGLYVASPSGKPALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFIG PLI
Sbjct  199   YPGVAKGLYVASPSGKPALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLI  258

Query  944   GDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELI  1123
             GDPLY+ GGQP CFDP+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPIT+E  
Sbjct  259   GDPLYVSGGQPKCFDPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPITNENR  318

Query  1124  AIN  1132
              +N
Sbjct  319   CVN  321



>ref|XP_011031775.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Populus euphratica]
Length=323

 Score =   462 bits (1189),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 226/310 (73%), Positives = 262/310 (85%), Gaps = 1/310 (0%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR-PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             FG PWP+ NDGL Y+D+V   SD+GLTLI FYS KYKNSAPLQGWLQRI N QITIDG V
Sbjct  14    FGSPWPDLNDGLFYNDVVSTSSDSGLTLIHFYSSKYKNSAPLQGWLQRIHNGQITIDGEV  73

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V  P A L  G +LVYHRLPW+EP+APY+L+VL+EDDDMIALNKP GLQVLPGGLFQQRT
Sbjct  74    VKEPKAILRDGMELVYHRLPWREPDAPYLLQVLYEDDDMIALNKPPGLQVLPGGLFQQRT  133

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VL QLQWRASK SS  +   SHPVPVHRLGRGTSGILLCAKTK+AK+ L+AYFADGTS++
Sbjct  134   VLMQLQWRASKGSSSLAIQGSHPVPVHRLGRGTSGILLCAKTKVAKTSLAAYFADGTSLI  193

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
              +   +N+E  + RKI K+YRALV+G++N+D+++I+QPIG +RYPGVAKGLYVASPSGKP
Sbjct  194   GDSSNANMEKSKTRKISKVYRALVNGILNQDKIIIKQPIGTMRYPGVAKGLYVASPSGKP  253

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             ALS V VLER  + N TLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLY  GGQP CFD +
Sbjct  254   ALSKVEVLERDSQLNQTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYDVGGQPRCFDSE  313

Query  995   LIDESFAQDG  1024
               DESFA+DG
Sbjct  314   HEDESFAEDG  323



>ref|XP_008233345.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Prunus mume]
Length=364

 Score =   464 bits (1193),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 226/357 (63%), Positives = 272/357 (76%), Gaps = 29/357 (8%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ N GL Y+D+VR SD+ LTLIEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  13    FGLPWPDLNHGLLYNDVVRASDSELTLIEFYSSKYKNSAPLQGWLQRIRNGQITVDGEVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G +LVYHRLPW+EP+APY+LEVL+EDDDM A  K S L             
Sbjct  73    KDPSTILRVGLELVYHRLPWREPDAPYLLEVLYEDDDM-ATKKISPLSC-----------  120

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
                               E HPVPVHRLGRGTSGILLCAKTK AK++L+AYFADGTS + 
Sbjct  121   -----------------QEPHPVPVHRLGRGTSGILLCAKTKHAKTQLAAYFADGTSNIG  163

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             +   +++E   VRKI KIYRALV+G++ ED+++++QPIG+VRYPGVAKGLYVAS +GKPA
Sbjct  164   DDSNTSMEAHAVRKISKIYRALVTGILCEDKVIVKQPIGVVRYPGVAKGLYVASATGKPA  223

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+GDPLY+ GGQP C D D 
Sbjct  224   LSKVEVLEREIHKNRTLVQVEIQSGRPHQIRIHLSYIGHPLLGDPLYVLGGQPKCLDSDF  283

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA DGG+ RP  PVPGDCGYNLHAH++ L HP ++E+I + APLP+IL+  QE
Sbjct  284   VDESFAVDGGFLRPTKPVPGDCGYNLHAHQVILSHPSSNEVIKVTAPLPAILRTQQE  340



>ref|XP_006651272.1| PREDICTED: RNA pseudouridine synthase 5-like [Oryza brachyantha]
Length=396

 Score =   464 bits (1195),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 232/366 (63%), Positives = 281/366 (77%), Gaps = 11/366 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG--LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPEFN+G++Y D  R +DAG  +TLIEFYS  YK+SAPL GW++RI+N QIT+DG 
Sbjct  23    FGRPWPEFNEGISYTDTFRCADAGATMTLIEFYSTTYKSSAPLPGWIKRIRNGQITVDGE  82

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD +L  G++L+YHRLPW+EP AP++L VL+EDDDMIALNKPSGLQVLP GLFQQR
Sbjct  83    VVTDPDMTLRQGSKLIYHRLPWQEPFAPHLLGVLYEDDDMIALNKPSGLQVLPKGLFQQR  142

Query  452   TVLTQLQ---WRAsklsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+            +SHPVPVHRLGRGTSG+LLCAKTKLAK+RL+AYFA+
Sbjct  143   TVLAQLQMKDWKIPSSFCSKQKDVQSHPVPVHRLGRGTSGLLLCAKTKLAKARLAAYFAE  202

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             GT+   + R    ++ +VRKI K YRALV+G++  DE++I QPIG+V YPGVA+GLY A 
Sbjct  203   GTTNAGKSR-DETDMCKVRKISKFYRALVTGILENDEVMITQPIGLVHYPGVAEGLYAAC  261

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL+ IGHPL+ DPLY  GGQP 
Sbjct  262   SSGKPAMSKVSVLERLEHRNQTLVQVEIHSGRPHQIRIHLACIGHPLVDDPLYGIGGQPK  321

Query  980   CFD---PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSI  1150
              FD       D+SFA DGGY RP  PVPGDCGY+LHAH L L HP T+E+I I APLP I
Sbjct  322   -FDELESSSTDDSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNEMIKITAPLPQI  380

Query  1151  LKASQE  1168
             L+  +E
Sbjct  381   LQTREE  386



>ref|XP_009136664.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Brassica 
rapa]
Length=351

 Score =   462 bits (1189),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 271/339 (80%), Gaps = 14/339 (4%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGL-TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGLTY D+V  SD+ L T+ +FY  KYK+SAPL GW+QRIQN QI +DG V
Sbjct  9     IGLPWPELNDGLTYKDVVSSSDSELRTVSDFYYSKYKSSAPLLGWIQRIQNGQIQVDGEV  68

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ P+ L++L++DD +IALNKPSGLQVLPGGLFQQRT
Sbjct  69    VKDPNTLLRSGSKLVYHRLPWKEPDTPHSLDILYQDDHLIALNKPSGLQVLPGGLFQQRT  128

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VLTQLQW           GE HPVPVHRLGRGTSGILLCAKTKLAK++LSAYFA+GTS+V
Sbjct  129   VLTQLQW---------CFGELHPVPVHRLGRGTSGILLCAKTKLAKTKLSAYFAEGTSLV  179

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                     E   VRKI KIYRAL SG++ EDE+VI+QPIG+VRYPGVAKGLYVAS  GKP
Sbjct  180   GSGNMGQ-ECGAVRKISKIYRALASGIVEEDEVVIKQPIGVVRYPGVAKGLYVASSEGKP  238

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             + S V VLER  +++CTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP   DPD
Sbjct  239   SFSKVIVLERDRQRDCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKGVDPD  298

Query  995   LID---ESFAQDGGYRRPENPVPGDCGYNLHAHKLALPH  1102
             L+D    SFA+DGGY+RP   VPGDCGY+LHAH++ +P+
Sbjct  299   LVDATTTSFAEDGGYQRPNQAVPGDCGYHLHAHEVEIPN  337



>ref|XP_009589058.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Nicotiana 
tomentosiformis]
Length=402

 Score =   463 bits (1192),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 228/308 (74%), Positives = 269/308 (87%), Gaps = 7/308 (2%)
 Frame = +2

Query  227   WLQRIQNKQITIDGRVVSNPDASLS-----PGAQLVYHRLPWKEPNAPYVLEVLFEDDDM  391
             + +RIQNKQIT+D +VV+ PD  LS      G +LVYHRLPW+EP+APY+L+VLFEDD +
Sbjct  20    FTRRIQNKQITVDSKVVTIPDTELSFWMSRAGTELVYHRLPWREPDAPYLLQVLFEDDYL  79

Query  392   IALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssG-ESHPVPVHRLGRGTSGILL  568
             IALNKPSGLQVLPGGLFQQRTVLTQLQW  SKL++ SS   ++HPVPVHRLGRGTSGILL
Sbjct  80    IALNKPSGLQVLPGGLFQQRTVLTQLQWHVSKLTTSSSGCRKTHPVPVHRLGRGTSGILL  139

Query  569   CAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQP  748
             CAKTKLAKSRL+AYFA+GTS+V++K Y+N E  ++RKI KIYRALVSGVI+ DE++I+QP
Sbjct  140   CAKTKLAKSRLAAYFAEGTSVVEDK-YTNSECKKMRKISKIYRALVSGVIDMDEVLIKQP  198

Query  749   IGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFI  928
             IG ++YPGVAKGLYVASPSGKPALS+V VLER +E N TLV+VEIQSGRPHQIRIHLSFI
Sbjct  199   IGTIKYPGVAKGLYVASPSGKPALSSVHVLERDLENNSTLVQVEIQSGRPHQIRIHLSFI  258

Query  929   GHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI  1108
             G PLIGDPLY+ GGQP CFDP+L+DESF +DGGY+RPENPVPGDCGYNLHAH++ L HPI
Sbjct  259   GLPLIGDPLYVSGGQPKCFDPELMDESFEKDGGYQRPENPVPGDCGYNLHAHQIVLIHPI  318

Query  1109  TDELIAIN  1132
             T+E   +N
Sbjct  319   TNENRCVN  326



>ref|XP_004984840.1| PREDICTED: RNA pseudouridine synthase 5-like [Setaria italica]
Length=395

 Score =   462 bits (1188),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 228/364 (63%), Positives = 276/364 (76%), Gaps = 8/364 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPE N+GL+Y D  R   +DA  TLIEFYS  YK+SAPL GW++RI+N QIT+DG+
Sbjct  23    FGTPWPELNEGLSYSDEFRCADADAATTLIEFYSSNYKSSAPLLGWIKRIRNGQITVDGQ  82

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             V+++PD +L  G++LVYHRLPW EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  83    VITDPDMTLRDGSKLVYHRLPWPEPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  142

Query  452   TVLTQLQ---WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADG  622
             TVL Q+Q   W+ +   S     +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+G
Sbjct  143   TVLAQVQMKDWKMTSCCSKRKDAQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAEG  202

Query  623   TSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASP  802
                   KR    E    RKI K YRALVSG+++ DE+V+ QPIG+V YPGVA+GLY A  
Sbjct  203   AINAGNKR-DKSEFQEERKISKFYRALVSGILDNDEVVVTQPIGLVHYPGVAEGLYAACS  261

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
             SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P  
Sbjct  262   SGKPAMSKVCVLERLAHQNHTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPKF  321

Query  983   FDPDL--IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
              +P+    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T+E++ I APLP IL+
Sbjct  322   VEPESAGTDSSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNEMVKITAPLPHILQ  381

Query  1157  ASQE  1168
               +E
Sbjct  382   TQEE  385



>emb|CDX90612.1| BnaA03g41690D [Brassica napus]
Length=495

 Score =   462 bits (1189),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/360 (65%), Positives = 282/360 (78%), Gaps = 20/360 (6%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGL-TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGLTY D+V  SD+ L T+ +FY  KYK+SAPL GW+QRIQN QI +DG V
Sbjct  141   IGLPWPELNDGLTYKDVVSSSDSELRTVSDFYYSKYKSSAPLLGWIQRIQNGQIQVDGEV  200

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ P+ L++L++DD +IALNKPSGLQVLPGGLFQQRT
Sbjct  201   VKDPNTLLRSGSKLVYHRLPWKEPDTPHSLDILYQDDHLIALNKPSGLQVLPGGLFQQRT  260

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             VLTQLQW           GESHPVPVHRLGRGTSGILLCAKTKLAK++LSAYFA+GTS+V
Sbjct  261   VLTQLQW---------CFGESHPVPVHRLGRGTSGILLCAKTKLAKTKLSAYFAEGTSLV  311

Query  635   QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                     E   VRKI KIYRAL SG++     VI+QPIG+VRYPGVAKGLYVAS  GKP
Sbjct  312   GSGNMGQ-ECGAVRKISKIYRALASGIV-----VIKQPIGVVRYPGVAKGLYVASSEGKP  365

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             + S V VLER  +++CTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP   DPD
Sbjct  366   SFSKVIVLERDRQRDCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKGVDPD  425

Query  995   LID---ESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKAS  1162
             L+D    SFA+DGGY+RP   VPGDCGY+LHAH++ +P+ + T +++ + APLP IL+ S
Sbjct  426   LVDATTTSFAEDGGYQRPNQAVPGDCGYHLHAHEVEIPNLLNTRKVVKVVAPLPPILQTS  485



>sp|Q0DST9.2|PUS5_ORYSJ RecName: Full=RNA pseudouridine synthase 5; AltName: Full=RNA 
pseudouridylate synthase 5; AltName: Full=RNA-uridine isomerase 
5 [Oryza sativa Japonica Group]
Length=397

 Score =   458 bits (1179),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 281/366 (77%), Gaps = 11/366 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG--LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPEFN+G++Y D  R +DAG   TLIEFYS  YK+SAPL GW++RI++ QIT+DG 
Sbjct  24    FGTPWPEFNEGISYIDTFRCADAGATTTLIEFYSTSYKSSAPLPGWIKRIRDGQITVDGE  83

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             V ++PD  L  G++LVYHRLPW+EP AP++L+VL+EDDDMIALNKPSGLQVLP GLFQQR
Sbjct  84    VATDPDMILREGSKLVYHRLPWQEPFAPHLLDVLYEDDDMIALNKPSGLQVLPKGLFQQR  143

Query  452   TVLTQLQ---WRA-sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+  S   S     +SHPVPVHRLGRGTSG+LLCAKTKLAK++L+AYFA+
Sbjct  144   TVLAQLQLKDWKMPSSFCSKRKDAQSHPVPVHRLGRGTSGLLLCAKTKLAKAQLAAYFAE  203

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +   + R    ++ + RKI K YRALV+G++  DE++I QPIG+VRYPGVA+GLY A 
Sbjct  204   GATNAGKSR-DETDICKARKISKFYRALVTGILENDEVMITQPIGLVRYPGVAEGLYAAC  262

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S VRVLER    N TL++VEI SGRPHQIRIHL++IGHPL+ DPLY  GGQP 
Sbjct  263   SSGKPAMSKVRVLERLKIHNHTLIQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGQPK  322

Query  980   CFD---PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSI  1150
              FD   P    +SFA DGGY RP  PVPGDCGY+LHAH L L HP T+E+I I APLP I
Sbjct  323   -FDEPEPTSTADSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNEMIKITAPLPHI  381

Query  1151  LKASQE  1168
             L+  +E
Sbjct  382   LQTREE  387



>ref|XP_008666437.1| PREDICTED: uncharacterized protein LOC100272393 isoform X2 [Zea 
mays]
Length=415

 Score =   458 bits (1178),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/365 (62%), Positives = 277/365 (76%), Gaps = 9/365 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPE N GLTY D  R   +DA  TLIEFYS  +K+SAPL GW++RI+N QIT+DG 
Sbjct  42    FGTPWPELNQGLTYTDTFRCADADAATTLIEFYSTNHKSSAPLPGWIKRIRNGQITVDGE  101

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD +L  G++LVYHR PW+EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  102   VVTDPDMTLVDGSKLVYHRFPWQEPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  161

Query  452   TVLTQLQ---WR-AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+ AS         +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+
Sbjct  162   TVLAQLQLKDWKMASSCRFKRKDVQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAE  221

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +I   K+    E    RKI K YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A 
Sbjct  222   G-AINAAKKRDKSEFSEERKISKFYRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAAC  280

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P 
Sbjct  281   SSGKPAMSKVCVLERLAHQNHTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPN  340

Query  980   CFDPDL--IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
               +P+    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T++++ I APLP IL
Sbjct  341   FVEPESTGTDSSFASDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNKMVKITAPLPQIL  400

Query  1154  KASQE  1168
             +  +E
Sbjct  401   QTREE  405



>ref|XP_008381973.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Malus domestica]
Length=354

 Score =   454 bits (1169),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 221/357 (62%), Positives = 270/357 (76%), Gaps = 32/357 (9%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGL Y+D+VR  D+ LTLIEFYS KY NSAPLQGWLQRI++ QIT+DG VV
Sbjct  13    FGLPWPDLNDGLFYNDVVRTPDSELTLIEFYSSKYNNSAPLQGWLQRIRSGQITVDGEVV  72

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +PD  L  G++L YHRLPW+EP+APY+LEVL+EDDDM         ++ P    Q    
Sbjct  73    RDPDTILRVGSKLAYHRLPWREPDAPYLLEVLYEDDDM---------KISPLSCQQ----  119

Query  458   LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
                                 HPVP HRLGRGTSGILLCAKTK AK++L+AY ADGTS + 
Sbjct  120   -------------------PHPVPXHRLGRGTSGILLCAKTKHAKTQLAAYLADGTSXIG  160

Query  638   EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             +   +++E    RKI KIYRALV+G++ ED+++++QPIGMVRYPGVAKGLYVASP+GKPA
Sbjct  161   DGSNADMEPRTERKISKIYRALVTGIVCEDKVIVKQPIGMVRYPGVAKGLYVASPTGKPA  220

Query  818   LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
             LS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+GDPLY+ GGQP C D DL
Sbjct  221   LSKVEVLEREIHKNQTLVQVEIQSGRPHQIRIHLSYIGHPLLGDPLYVPGGQPKCSDFDL  280

Query  998   IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             +DESFA DGG++RP NPVPGDCGYNLHAH++ L HP ++E+I + APLP  L+  QE
Sbjct  281   VDESFADDGGFKRPTNPVPGDCGYNLHAHQVTLSHPASNEVIKVIAPLPPXLRTQQE  337



>ref|XP_010253583.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Nelumbo nucifera]
Length=381

 Score =   454 bits (1169),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/365 (64%), Positives = 281/365 (77%), Gaps = 26/365 (7%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGLTY D VRPS+A  T+IEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  19    FGVPWPDLNDGLTYTDTVRPSNAASTMIEFYSTKYKNSAPLQGWLQRIRNGQITVDGEVV  78

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G++L+YHRLPWKEP+APY+LE+L+EDDD+                  QRTV
Sbjct  79    KDPHTILRAGSELMYHRLPWKEPDAPYLLEILYEDDDL------------------QRTV  120

Query  458   LTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFA  616
             LTQLQWR       +  LS+   + + HPVPVHRLGRGTSGILLCAK+KLAKSRL+AYFA
Sbjct  121   LTQLQWRECQGISTSLGLSTNPGAQQQHPVPVHRLGRGTSGILLCAKSKLAKSRLAAYFA  180

Query  617   DGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVA  796
             +GTS+V + R SN+++  VR+I K+YRAL SG+I++DE++I+QPIG++RY GVA GLYVA
Sbjct  181   EGTSVVGDNRKSNMDLGGVRRISKVYRALASGIIDKDEVIIKQPIGIMRYQGVANGLYVA  240

Query  797   SPS-GKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             S S GKPALS V VLER +  NCTLV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG 
Sbjct  241   SSSVGKPALSKVDVLERDIPGNCTLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVTGGH  300

Query  974   PMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
             P CF+ +  +  FAQDGGY+RP NPVPGDCGY LHAH L L HP   ++I I APLP +L
Sbjct  301   PKCFNSESGENDFAQDGGYQRPINPVPGDCGYYLHAHHLVLHHPTMKKVIEIIAPLPHVL  360

Query  1154  KASQE  1168
             +  +E
Sbjct  361   QTQKE  365



>ref|XP_010253585.1| PREDICTED: RNA pseudouridine synthase 5 isoform X5 [Nelumbo nucifera]
Length=380

 Score =   452 bits (1163),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 231/365 (63%), Positives = 280/365 (77%), Gaps = 27/365 (7%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWP+ NDGLTY D VRPS+A  T+IEFYS KYKNSAPLQGWLQRI+N QIT+DG VV
Sbjct  19    FGVPWPDLNDGLTYTDTVRPSNAASTMIEFYSTKYKNSAPLQGWLQRIRNGQITVDGEVV  78

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
              +P   L  G++L+YHRLPWKEP+APY+LE+L+EDDD+                   RTV
Sbjct  79    KDPHTILRAGSELMYHRLPWKEPDAPYLLEILYEDDDL-------------------RTV  119

Query  458   LTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFA  616
             LTQLQWR       +  LS+   + + HPVPVHRLGRGTSGILLCAK+KLAKSRL+AYFA
Sbjct  120   LTQLQWRECQGISTSLGLSTNPGAQQQHPVPVHRLGRGTSGILLCAKSKLAKSRLAAYFA  179

Query  617   DGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVA  796
             +GTS+V + R SN+++  VR+I K+YRAL SG+I++DE++I+QPIG++RY GVA GLYVA
Sbjct  180   EGTSVVGDNRKSNMDLGGVRRISKVYRALASGIIDKDEVIIKQPIGIMRYQGVANGLYVA  239

Query  797   SPS-GKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             S S GKPALS V VLER +  NCTLV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG 
Sbjct  240   SSSVGKPALSKVDVLERDIPGNCTLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVTGGH  299

Query  974   PMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
             P CF+ +  +  FAQDGGY+RP NPVPGDCGY LHAH L L HP   ++I I APLP +L
Sbjct  300   PKCFNSESGENDFAQDGGYQRPINPVPGDCGYYLHAHHLVLHHPTMKKVIEIIAPLPHVL  359

Query  1154  KASQE  1168
             +  +E
Sbjct  360   QTQKE  364



>gb|ADE76199.1| unknown [Picea sitchensis]
Length=386

 Score =   450 bits (1157),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 224/371 (60%), Positives = 277/371 (75%), Gaps = 14/371 (4%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
             FG PWPEFNDGL+Y D V+ +    TLI+FYS +Y++SAP +GWLQRI N QIT+DG+ V
Sbjct  3     FGIPWPEFNDGLSYTDTVKSTSTPPTLIDFYSSRYESSAPRKGWLQRIHNGQITVDGKTV  62

Query  278   SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             + PD  L  G +LVYHRL W+EP AP  L VLFEDD ++A+NKPSGLQVLPGGLFQQRTV
Sbjct  63    NEPDTVLRIGPKLVYHRLSWREPIAPCKLYVLFEDDHLLAVNKPSGLQVLPGGLFQQRTV  122

Query  458   LTQLQWRAsklsslsssG--------ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF  613
             LTQL+W+AS+ S   S          ES PVPVHRLGRGTSGILLCAK+++AKS+L+A F
Sbjct  123   LTQLKWKASQSSKYRSVAGKAVADFQESQPVPVHRLGRGTSGILLCAKSEIAKSQLAADF  182

Query  614   ADGTSIVQEKRYSNLEVMRV-RKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLY  790
             ADGTS +     S+++   + R+I K YRAL  G+I ++++ I+QPIG +RYPGV  GLY
Sbjct  183   ADGTSFISRNSSSDIDAGEIKRRIYKTYRALADGIIEQNKIAIKQPIGKMRYPGVRSGLY  242

Query  791   VASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGG  970
             VASP+GK A S + VL R   +NCTLVEVEI SGRPHQIRIHLSFIGHPL+GDPLY+ GG
Sbjct  243   VASPTGKQAESRITVLSRDKNRNCTLVEVEIYSGRPHQIRIHLSFIGHPLLGDPLYVAGG  302

Query  971   QPMCFDPDLIDES-----FAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINA  1135
             +P     D   ES     FA+DGGY++P NPVPGDCGY LHA++LA  HP++DE++ I A
Sbjct  303   RPSITVSDSYSESREGDNFAEDGGYQKPLNPVPGDCGYYLHAYRLAFHHPVSDEVVEIVA  362

Query  1136  PLPSILKASQE  1168
             P P +L A  E
Sbjct  363   PPPPMLSACNE  373



>dbj|BAJ90823.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02832.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   449 bits (1156),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 277/365 (76%), Gaps = 9/365 (2%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDA--GLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWP+ N GL+Y D  R +DA    TLI+FYS  YK+SAPL GW+ RI+N QIT+DG+
Sbjct  18    FGRPWPDLNAGLSYTDTFRGADAETTTTLIDFYSENYKSSAPLPGWIHRIRNGQITVDGQ  77

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD  LS G++LVYHRL WKEP APY+L+VL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  78    VVTDPDIILSEGSKLVYHRLSWKEPFAPYLLQVLYEDDDMLALNKPSGLQVLPKGLFQQR  137

Query  452   TVLTQLQWRAsklsslsssGES----HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQW+  K+   S S +     HPVPVHRLGRGTSG+LLCAKTKLAK +L++YFA+
Sbjct  138   TVLAQLQWKEWKMPPSSCSKKKNVQLHPVPVHRLGRGTSGLLLCAKTKLAKVQLASYFAE  197

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +  ++KR    EV +  KI K YRALV+G++  DE VI QPIG+V YPGVA+GLYVA 
Sbjct  198   GAANAEKKR-DGTEVGKEWKISKFYRALVTGILEHDEDVITQPIGLVHYPGVAEGLYVAC  256

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GGQP 
Sbjct  257   SSGKPAMSKVCVLERLAHQNQTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGQPK  316

Query  980   CFD--PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
               D  P   D SFA DGGY RP  PVPGDCGY+LHAH L L HP T++++ I A LP IL
Sbjct  317   FHDLEPTSTDISFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNKMLKITAHLPRIL  376

Query  1154  KASQE  1168
             +  +E
Sbjct  377   QTQEE  381



>ref|XP_008666433.1| PREDICTED: uncharacterized protein LOC100272393 isoform X1 [Zea 
mays]
Length=425

 Score =   450 bits (1157),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 228/375 (61%), Positives = 277/375 (74%), Gaps = 19/375 (5%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPE N GLTY D  R   +DA  TLIEFYS  +K+SAPL GW++RI+N QIT+DG 
Sbjct  42    FGTPWPELNQGLTYTDTFRCADADAATTLIEFYSTNHKSSAPLPGWIKRIRNGQITVDGE  101

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD +L  G++LVYHR PW+EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  102   VVTDPDMTLVDGSKLVYHRFPWQEPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  161

Query  452   TVLTQLQ---WR-AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+ AS         +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+
Sbjct  162   TVLAQLQLKDWKMASSCRFKRKDVQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAE  221

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +I   K+    E    RKI K YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A 
Sbjct  222   G-AINAAKKRDKSEFSEERKISKFYRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAAC  280

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P 
Sbjct  281   SSGKPAMSKVCVLERLAHQNHTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPN  340

Query  980   CFDPDL--IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITD----------ELI  1123
               +P+    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T+          +++
Sbjct  341   FVEPESTGTDSSFASDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNKVIKHIYNLGQMV  400

Query  1124  AINAPLPSILKASQE  1168
              I APLP IL+  +E
Sbjct  401   KITAPLPQILQTREE  415



>ref|XP_011031776.1| PREDICTED: RNA pseudouridine synthase 5 isoform X4 [Populus euphratica]
Length=314

 Score =   442 bits (1137),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 254/309 (82%), Gaps = 3/309 (1%)
 Frame = +2

Query  254   ITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPG  433
             ITIDG VV  P A L  G +LVYHRLPW+EP+APY+L+VL+EDDDMIALNKP GLQVLPG
Sbjct  2     ITIDGEVVKEPKAILRDGMELVYHRLPWREPDAPYLLQVLYEDDDMIALNKPPGLQVLPG  61

Query  434   GLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF  613
             GLFQQRTVL QLQWRASK SS  +   SHPVPVHRLGRGTSGILLCAKTK+AK+ L+AYF
Sbjct  62    GLFQQRTVLMQLQWRASKGSSSLAIQGSHPVPVHRLGRGTSGILLCAKTKVAKTSLAAYF  121

Query  614   ADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYV  793
             ADGTS++ +   +N+E  + RKI K+YRALV+G++N+D+++I+QPIG +RYPGVAKGLYV
Sbjct  122   ADGTSLIGDSSNANMEKSKTRKISKVYRALVNGILNQDKIIIKQPIGTMRYPGVAKGLYV  181

Query  794   ASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             ASPSGKPALS V VLER  + N TLV+VEI+SGRPHQIRIHLSFIGHPL+GDPLY  GGQ
Sbjct  182   ASPSGKPALSKVEVLERDSQLNQTLVQVEIESGRPHQIRIHLSFIGHPLLGDPLYDVGGQ  241

Query  974   PMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHP---ITDELIAINAPLP  1144
             P CFD +  DESFA+DGGY RP  PVPGDCGY LHAH+L L HP     +++I I APLP
Sbjct  242   PRCFDSEHEDESFAEDGGYERPAKPVPGDCGYYLHAHQLVLSHPHPSKNEQVIKITAPLP  301

Query  1145  SILKASQEC  1171
             SIL+   E 
Sbjct  302   SILRTQAET  310



>ref|XP_010067288.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Eucalyptus 
grandis]
Length=318

 Score =   439 bits (1129),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 213/290 (73%), Positives = 251/290 (87%), Gaps = 0/290 (0%)
 Frame = +2

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G ++VYHRLPWKEP+APY L +L+EDD+MIALNKPSGLQVLPGGLFQQRTVL+QLQW+
Sbjct  17    AAGLEVVYHRLPWKEPDAPYFLGILYEDDNMIALNKPSGLQVLPGGLFQQRTVLSQLQWQ  76

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
              SK S+L SS E  PVPVHRLGRGTSGILLCAKTK+AKSRLS YFADGTS+V  KR +  
Sbjct  77    DSKQSTLLSSQEPQPVPVHRLGRGTSGILLCAKTKIAKSRLSIYFADGTSLVGGKRNTTK  136

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             E   VRKI KIYRALV+G+++EDE++I +PIG+++YPGVAKGLYVASPSGKPALS V+VL
Sbjct  137   EPSSVRKISKIYRALVNGLVDEDEVIITEPIGVIKYPGVAKGLYVASPSGKPALSKVKVL  196

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER V+ NC+LV+VEIQSGRPHQIRIHLSFIGHPL+GDPLY+ GG+P CFD   +DE FAQ
Sbjct  197   ERNVQGNCSLVQVEIQSGRPHQIRIHLSFIGHPLLGDPLYVSGGKPGCFDSQSVDEGFAQ  256

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             DGGY RP++ VPGDCGY LHAH+L L HP+TDE+I I APLPSIL++  E
Sbjct  257   DGGYCRPQHAVPGDCGYFLHAHQLLLSHPVTDEVIKITAPLPSILQSQGE  306



>ref|XP_006850660.1| hypothetical protein AMTR_s00034p00221180 [Amborella trichopoda]
 gb|ERN12241.1| hypothetical protein AMTR_s00034p00221180 [Amborella trichopoda]
Length=378

 Score =   441 bits (1134),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 269/344 (78%), Gaps = 14/344 (4%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSD-AGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             FG PWPE NDG+ Y D ++ ++ A LTLI FYS KY +SAPL+GWLQRI+N+QI ID +V
Sbjct  13    FGHPWPELNDGIVYSDTIKSNNPAALTLIGFYSSKYIDSAPLEGWLQRIRNEQIKIDNKV  72

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V+NPD  LS G+ L+YHR+PWKE +APY+L+VLFED DM+A+NKPSGLQVLPGGLFQQRT
Sbjct  73    VTNPDTLLSIGSNLLYHRIPWKELDAPYMLDVLFEDSDMVAVNKPSGLQVLPGGLFQQRT  132

Query  455   VLTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF  613
             VL+QLQWR       +  L   SSS  +HP+PVHRLGRGTSGILLCAKT  AK  L+A F
Sbjct  133   VLSQLQWRTYGPYCSSQTLRLTSSSQVTHPIPVHRLGRGTSGILLCAKTVHAKVHLAACF  192

Query  614   ADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYV  793
             AD TS+  + R S+ E + +R+I K YRAL +G++ +DE++++QPIG++RY GVA G+YV
Sbjct  193   ADATSLATKNRQSS-EELHIRRISKTYRALATGILEKDEVLVKQPIGLMRYSGVASGIYV  251

Query  794   ASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             AS SGKPA S V+VL+R    NCTLV+VEI +GRPHQIRIHLSFIGHPL+GDPLYI  G 
Sbjct  252   ASSSGKPAESRVKVLQRDFRMNCTLVQVEIYTGRPHQIRIHLSFIGHPLLGDPLYISSGG  311

Query  974   PMCFDP----DLID-ESFAQDGGYRRPENPVPGDCGYNLHAHKL  1090
             P CF+     D+I  + FAQDGG+ RP  PVPGDCGY+LHAH+L
Sbjct  312   PKCFESESSVDIIGFKGFAQDGGHLRPSKPVPGDCGYHLHAHQL  355



>ref|XP_003561739.1| PREDICTED: RNA pseudouridine synthase 5 [Brachypodium distachyon]
Length=390

 Score =   440 bits (1132),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 224/367 (61%), Positives = 272/367 (74%), Gaps = 11/367 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR----PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITID  265
             FG+PWPE N+GL+Y D  R     +D   TLIEFYS  YK+SAPL GW+ RI+N QIT+D
Sbjct  17    FGKPWPELNEGLSYTDTFRCAGPAADTSTTLIEFYSDNYKSSAPLPGWIHRIRNGQITVD  76

Query  266   GRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQ  445
             G+VV +P+  L  G++LVYHRL W+EP AP++L+VL+EDDD++ALNKPSGLQVLP GLFQ
Sbjct  77    GQVVIDPEMILREGSKLVYHRLAWQEPLAPHMLQVLYEDDDIVALNKPSGLQVLPKGLFQ  136

Query  446   QRTVLTQLQWRA----sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF  613
             QRTVL QLQW+         S   + +SHPVPVHRLGRGTSG+LLCAKTKLAK RL++YF
Sbjct  137   QRTVLAQLQWKEWKMPLSSCSKRKNVQSHPVPVHRLGRGTSGLLLCAKTKLAKVRLASYF  196

Query  614   ADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYV  793
             A+GT     KR    E  R RK+ K YRALV+G++  DE V+ QPIG+V YPGV++GLYV
Sbjct  197   AEGTINAGNKR-DETEDSRERKVSKFYRALVTGILENDEDVVTQPIGLVHYPGVSEGLYV  255

Query  794   ASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             A  SGK A+S V VLER   +N TLV+VEI SGRPHQIRIHL +IGHPL+ DPLY  GGQ
Sbjct  256   ACSSGKQAVSKVCVLERLAHENQTLVQVEIHSGRPHQIRIHLGYIGHPLVDDPLYGIGGQ  315

Query  974   PMCFDPD--LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             P   D +    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T++++ I APLP 
Sbjct  316   PKFADLEHSCPDVSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPSTEKMVKITAPLPR  375

Query  1148  ILKASQE  1168
             IL+  +E
Sbjct  376   ILQTREE  382



>ref|NP_001190071.1| RNA pseudourine synthase 5 [Arabidopsis thaliana]
 gb|AEE78923.1| RNA pseudourine synthase 5 [Arabidopsis thaliana]
Length=416

 Score =   441 bits (1133),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 236/409 (58%), Positives = 284/409 (69%), Gaps = 53/409 (13%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAP-------------------  217
              G PWPE NDGL Y D +  S++ LT + EFY  KYK+SAP                   
Sbjct  8     IGLPWPELNDGLAYKDAISSSESELTTVSEFYFTKYKSSAPLLGFLLFFFLYSSSTIISF  67

Query  218   -----------LQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVL  364
                        L G+ +   ++ I IDG VV +P+  L  G++LVY RLPWKEP+ PY L
Sbjct  68    LLSILFNHLSFLGGFNESKTDRFIQIDGEVVKDPNTLLRSGSKLVYSRLPWKEPDTPYSL  127

Query  365   EVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGES-HPVPVHRL  541
             EVL+EDDD+IALNKPSGLQVLPGGLFQQRTVLTQLQW   K  S   S ES HPVPVHRL
Sbjct  128   EVLYEDDDLIALNKPSGLQVLPGGLFQQRTVLTQLQWCFGKNDSYIGSRESPHPVPVHRL  187

Query  542   GRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVIN  721
             GRGTSGILLCAKTKLAK++L+AYFA+GTS+V        E    RK+ KIYRAL  G++ 
Sbjct  188   GRGTSGILLCAKTKLAKTKLAAYFAEGTSLVGSGNLDQ-ECGTGRKLSKIYRALADGIVE  246

Query  722   EDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPH  901
             EDE+VI+QPIG+VRYPGVA+GLYVASP GKPA S V VLER  EKNC+LV+VEIQSGRPH
Sbjct  247   EDEVVIKQPIGVVRYPGVAQGLYVASPEGKPAFSKVFVLERDREKNCSLVKVEIQSGRPH  306

Query  902   QIRIHLSFIGHPLI-----------------GDPLYIDGGQPMCFDPDLIDE--SFAQDG  1024
             QIRIHL+++GHPL+                 GDPLY+ GGQP CFDPDL+D+  +FA+DG
Sbjct  307   QIRIHLAYMGHPLVEMTMFTGSECLRADQSAGDPLYVAGGQPKCFDPDLVDDAAAFAEDG  366

Query  1025  GYRRPENPVPGDCGYNLHAHKLALPHPI-TDELIAINAPLPSILKASQE  1168
             GYRRP   VPGDCGY+LHAH++ LP+ + T +++ I APLP IL+   E
Sbjct  367   GYRRPNQAVPGDCGYHLHAHQVELPNLLNTHKVVKIVAPLPPILQTRCE  415



>gb|ACG32783.1| RNA binding protein [Zea mays]
Length=379

 Score =   439 bits (1129),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 268/356 (75%), Gaps = 9/356 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPE N GLTY D  R   +DA  TLIEFYS  +K+SAPL GW++RI+N QIT+DG 
Sbjct  14    FGTPWPELNQGLTYTDTFRCADADAATTLIEFYSTNHKSSAPLPGWIKRIRNGQITVDGE  73

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD +L  G++LVYHR PW+EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  74    VVTDPDMTLVDGSKLVYHRFPWQEPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  133

Query  452   TVLTQLQ---WR-AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+ AS         +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+
Sbjct  134   TVLAQLQLKDWKMASSCRFKRKDVQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAE  193

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +I   K+    E    RKI K YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A 
Sbjct  194   G-AINAAKKRDKSEFSEERKISKFYRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAAC  252

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P 
Sbjct  253   SSGKPAMSKVCVLERLAHQNHTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPN  312

Query  980   CFDPDL--IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPL  1141
               +P+    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T++   +  PL
Sbjct  313   FVEPESTGTDSSFASDGGYERPLQPVPGDCGYHLHAHCLVLCHPTTNKDERLLTPL  368



>ref|XP_009589064.1| PREDICTED: RNA pseudouridine synthase 5 isoform X8 [Nicotiana 
tomentosiformis]
Length=356

 Score =   437 bits (1124),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/277 (77%), Positives = 249/277 (90%), Gaps = 2/277 (1%)
 Frame = +2

Query  305   GAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAs  484
             G +LVYHRLPW+EP+APY+L+VLFEDD +IALNKPSGLQVLPGGLFQQRTVLTQLQW  S
Sbjct  5     GTELVYHRLPWREPDAPYLLQVLFEDDYLIALNKPSGLQVLPGGLFQQRTVLTQLQWHVS  64

Query  485   klsslsssG-ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
             KL++ SS   ++HPVPVHRLGRGTSGILLCAKTKLAKSRL+AYFA+GTS+V++K Y+N E
Sbjct  65    KLTTSSSGCRKTHPVPVHRLGRGTSGILLCAKTKLAKSRLAAYFAEGTSVVEDK-YTNSE  123

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
               ++RKI KIYRALVSGVI+ DE++I+QPIG ++YPGVAKGLYVASPSGKPALS+V VLE
Sbjct  124   CKKMRKISKIYRALVSGVIDMDEVLIKQPIGTIKYPGVAKGLYVASPSGKPALSSVHVLE  183

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R +E N TLV+VEIQSGRPHQIRIHLSFIG PLIGDPLY+ GGQP CFDP+L+DESF +D
Sbjct  184   RDLENNSTLVQVEIQSGRPHQIRIHLSFIGLPLIGDPLYVSGGQPKCFDPELMDESFEKD  243

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAIN  1132
             GGY+RPENPVPGDCGYNLHAH++ L HPIT+E   +N
Sbjct  244   GGYQRPENPVPGDCGYNLHAHQIVLIHPITNENRCVN  280



>ref|XP_008666447.1| PREDICTED: uncharacterized protein LOC100272393 isoform X4 [Zea 
mays]
Length=407

 Score =   439 bits (1129),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 268/356 (75%), Gaps = 9/356 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPE N GLTY D  R   +DA  TLIEFYS  +K+SAPL GW++RI+N QIT+DG 
Sbjct  42    FGTPWPELNQGLTYTDTFRCADADAATTLIEFYSTNHKSSAPLPGWIKRIRNGQITVDGE  101

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD +L  G++LVYHR PW+EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  102   VVTDPDMTLVDGSKLVYHRFPWQEPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  161

Query  452   TVLTQLQ---WR-AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+ AS         +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+
Sbjct  162   TVLAQLQLKDWKMASSCRFKRKDVQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAE  221

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +I   K+    E    RKI K YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A 
Sbjct  222   G-AINAAKKRDKSEFSEERKISKFYRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAAC  280

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P 
Sbjct  281   SSGKPAMSKVCVLERLAHQNHTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPN  340

Query  980   CFDPDL--IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPL  1141
               +P+    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T++   +  PL
Sbjct  341   FVEPESTGTDSSFASDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNKDERLLTPL  396



>gb|EEE58845.1| hypothetical protein OsJ_10432 [Oryza sativa Japonica Group]
Length=458

 Score =   441 bits (1133),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/352 (63%), Positives = 271/352 (77%), Gaps = 11/352 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG--LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPEFN+G++Y D  R +DAG   TLIEFYS  YK+SAPL GW++RI++ QIT+DG 
Sbjct  24    FGTPWPEFNEGISYIDTFRCADAGATTTLIEFYSTSYKSSAPLPGWIKRIRDGQITVDGE  83

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             V ++PD  L  G++LVYHRLPW+EP AP++L+VL+EDDDMIALNKPSGLQVLP GLFQQR
Sbjct  84    VATDPDMILREGSKLVYHRLPWQEPFAPHLLDVLYEDDDMIALNKPSGLQVLPKGLFQQR  143

Query  452   TVLTQLQ---WRA-sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+  S   S     +SHPVPVHRLGRGTSG+LLCAKTKLAK++L+AYFA+
Sbjct  144   TVLAQLQLKDWKMPSSFCSKRKDAQSHPVPVHRLGRGTSGLLLCAKTKLAKAQLAAYFAE  203

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +   + R    ++ + RKI K YRALV+G++  DE++I QPIG+VRYPGVA+GLY A 
Sbjct  204   GATNAGKSR-DETDICKARKISKFYRALVTGILENDEVMITQPIGLVRYPGVAEGLYAAC  262

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S VRVLER    N TL++VEI SGRPHQIRIHL++IGHPL+ DPLY  GGQP 
Sbjct  263   SSGKPAMSKVRVLERLKIHNHTLIQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGQPK  322

Query  980   CFD---PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIA  1126
              FD   P    +SFA DGGY RP  PVPGDCGY+LHAH L L HP T+EL+ 
Sbjct  323   -FDEPEPTSTADSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNELLC  373



>ref|XP_010503958.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X1 [Camelina 
sativa]
Length=349

 Score =   436 bits (1120),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 257/317 (81%), Gaps = 8/317 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
              G PWPE NDGL Y D+V  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG  
Sbjct  12    IGLPWPELNDGLQYKDVVSSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEA  71

Query  275   VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
             V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72    VKDPNTVLRSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455   VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
             +LTQLQW   K  + + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132   LLTQLQWWFGKKDTSTGARELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635   QEKRYSNLE--VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSG  808
                  SNL+      RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVAKGLYVASP G
Sbjct  192   GS---SNLDQDCGTGRKLSKIYRALADGLVEEDEVVIQQPIGVVRYPGVAKGLYVASPEG  248

Query  809   KPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFD  988
             K A S V VLER  +KNCTLV+VEIQSGRPHQIRIHL++IGHPL+GDPLY+ GGQP CFD
Sbjct  249   KSAFSKVVVLERDRKKNCTLVKVEIQSGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKCFD  308

Query  989   PDLIDE--SFAQDGGYR  1033
              DL+D+  +FA+DGGYR
Sbjct  309   TDLVDDAAAFAEDGGYR  325



>gb|EEC75014.1| hypothetical protein OsI_11092 [Oryza sativa Indica Group]
Length=461

 Score =   437 bits (1125),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 222/352 (63%), Positives = 270/352 (77%), Gaps = 11/352 (3%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVRPSDAG--LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPEFN+G++Y D  R +DAG   TLIEFYS  YK+SAPL GW++RI++ QIT+ G 
Sbjct  27    FGTPWPEFNEGISYIDTFRCADAGATTTLIEFYSTSYKSSAPLPGWIKRIRDGQITVCGE  86

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             V ++PD  L  G++LVYHRLPW+EP AP++L+VL+EDDDMIALNKPSGLQVLP GLFQQR
Sbjct  87    VATDPDIILREGSKLVYHRLPWQEPCAPHLLDVLYEDDDMIALNKPSGLQVLPKGLFQQR  146

Query  452   TVLTQLQ---WRA-sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+  S   S     +SHPVPVHRLGRGTSG+LLCAKTKLAK++L+AYFA+
Sbjct  147   TVLAQLQLKDWKMPSSFCSKRKDAQSHPVPVHRLGRGTSGLLLCAKTKLAKAQLAAYFAE  206

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +   + R    ++ + RKI K YRALV+G++  DE++I QPIG+VRYPGVA+GLY A 
Sbjct  207   GATNAGKSR-DETDICKARKISKFYRALVTGILENDEVMITQPIGLVRYPGVAEGLYAAC  265

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S VRVLER    N TL++VEI SGRPHQIRIHL++IGHPL+ DPLY  GGQP 
Sbjct  266   SSGKPAMSKVRVLERLKIHNHTLIQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGQPK  325

Query  980   CFD---PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIA  1126
              FD   P    +SFA DGGY RP  PVPGDCGY+LHAH L L HP T+EL+ 
Sbjct  326   -FDEPEPTSTADSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNELLC  376



>ref|XP_010658421.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Vitis vinifera]
Length=298

 Score =   429 bits (1104),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/282 (73%), Positives = 248/282 (88%), Gaps = 0/282 (0%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FG PWP+FNDGLTY+D+V  SD+ LTLI++YS K+KNSAPLQGWLQRI   QIT+DG VV
Sbjct  5    FGVPWPDFNDGLTYNDVVSASDSELTLIDYYSSKHKNSAPLQGWLQRINKGQITVDGTVV  64

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            + P   L  G++LVYHRLPW+EP+APY+LE+L+EDDD+IALNKPSGLQVLPGGLFQQRTV
Sbjct  65   TEPKTILRAGSKLVYHRLPWQEPDAPYLLEILYEDDDVIALNKPSGLQVLPGGLFQQRTV  124

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
            LTQLQWRA+K +SL +  ESH VPVHRLGRGTSGILLCAKTKLAK+RL+AYFADGTS+V 
Sbjct  125  LTQLQWRANKQNSLPACQESHSVPVHRLGRGTSGILLCAKTKLAKTRLAAYFADGTSVVG  184

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              R ++++   +RKI KIYRALV+G++++DE+VIEQPIGMV+YPGVAKGLYVASPSGKPA
Sbjct  185  GNRDADMKSRTMRKISKIYRALVNGILDKDEIVIEQPIGMVQYPGVAKGLYVASPSGKPA  244

Query  818  LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLI  943
            LS V +LER V+ +  +V+VEIQSGRPHQIRIHLSFIGHPL+
Sbjct  245  LSKVSILERDVQGDHMIVQVEIQSGRPHQIRIHLSFIGHPLL  286



>ref|XP_006436267.1| hypothetical protein CICLE_v10033672mg [Citrus clementina]
 gb|ESR49507.1| hypothetical protein CICLE_v10033672mg [Citrus clementina]
Length=312

 Score =   426 bits (1096),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 211/290 (73%), Positives = 247/290 (85%), Gaps = 2/290 (1%)
 Frame = +2

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             S G++LVYHRLPWKEP+ PY+LEV +EDDD+IALNKPSGLQVLPGGLFQQRTVL QLQWR
Sbjct  3     SAGSELVYHRLPWKEPDVPYLLEVFYEDDDLIALNKPSGLQVLPGGLFQQRTVLKQLQWR  62

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             ASK SS  SS  SHPVPVHRLGRGTSGILLCAKTKLAK+ ++AYFAD TS+V     + +
Sbjct  63    ASKQSSSLSSQASHPVPVHRLGRGTSGILLCAKTKLAKTCIAAYFADKTSVVDAD--NTV  120

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               +  RKI KIYRALV G+++ED+++I+QPIG+VRYPGVAKGLYVASPSGKPALS V VL
Sbjct  121   MELSQRKITKIYRALVHGIVDEDKVIIKQPIGIVRYPGVAKGLYVASPSGKPALSKVDVL  180

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER V++NCTLV+VEIQSGRPHQIRIHL+F+GHPL+GDPLY+ GGQP  FD +  D +FAQ
Sbjct  181   ERDVQRNCTLVQVEIQSGRPHQIRIHLAFLGHPLLGDPLYVAGGQPKSFDSEFADGTFAQ  240

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             DGGY RP NPVPGDCGY LHA++L L HP T+E+I I APLPS+LK  +E
Sbjct  241   DGGYERPVNPVPGDCGYYLHAYQLFLSHPTTNEVIKITAPLPSVLKTREE  290



>gb|KCW65383.1| hypothetical protein EUGRSUZ_G02814 [Eucalyptus grandis]
Length=339

 Score =   425 bits (1092),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 210/283 (74%), Positives = 245/283 (87%), Gaps = 0/283 (0%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FG PWPE NDG+ Y D+V  SD   TLI+FYS KY NSAP+QGWLQRIQN QI IDGRVV
Sbjct  9    FGVPWPELNDGIFYKDVVPSSDHETTLIQFYSSKYGNSAPVQGWLQRIQNGQIKIDGRVV  68

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            ++P+ S+S G ++VYHRLPWKEP+APY L +L+EDD+MIALNKPSGLQVLPGGLFQQRTV
Sbjct  69   TDPNESVSAGLEVVYHRLPWKEPDAPYFLGILYEDDNMIALNKPSGLQVLPGGLFQQRTV  128

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
            L+QLQW+ SK S+L SS E  PVPVHRLGRGTSGILLCAKTK+AKSRLS YFADGTS+V 
Sbjct  129  LSQLQWQDSKQSTLLSSQEPQPVPVHRLGRGTSGILLCAKTKIAKSRLSIYFADGTSLVG  188

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             KR +  E   VRKI KIYRALV+G+++EDE++I +PIG+++YPGVAKGLYVASPSGKPA
Sbjct  189  GKRNTTKEPSSVRKISKIYRALVNGLVDEDEVIITEPIGVIKYPGVAKGLYVASPSGKPA  248

Query  818  LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIG  946
            LS V+VLER V+ NC+LV+VEIQSGRPHQIRIHLSFIGHPL+G
Sbjct  249  LSKVKVLERNVQGNCSLVQVEIQSGRPHQIRIHLSFIGHPLLG  291



>ref|XP_008666441.1| PREDICTED: uncharacterized protein LOC100272393 isoform X3 [Zea 
mays]
Length=411

 Score =   420 bits (1080),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 220/375 (59%), Positives = 266/375 (71%), Gaps = 33/375 (9%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
             FG PWPE N GLTY D  R   +DA  TLIEFYS  +K+SAPL GW++RI+N QIT+DG 
Sbjct  42    FGTPWPELNQGLTYTDTFRCADADAATTLIEFYSTNHKSSAPLPGWIKRIRNGQITVDGE  101

Query  272   VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
             VV++PD +L              EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  102   VVTDPDMTL--------------EPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  147

Query  452   TVLTQLQ---WR-AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
             TVL QLQ   W+ AS         +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+
Sbjct  148   TVLAQLQLKDWKMASSCRFKRKDVQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAE  207

Query  620   GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVAS  799
             G +I   K+    E    RKI K YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A 
Sbjct  208   G-AINAAKKRDKSEFSEERKISKFYRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAAC  266

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM  979
              SGKPA+S V VLER   +N TLV+VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P 
Sbjct  267   SSGKPAMSKVCVLERLAHQNHTLVQVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPN  326

Query  980   CFDPDL--IDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITD----------ELI  1123
               +P+    D SFA DGGY RP  PVPGDCGY+LHAH L L HP T+          +++
Sbjct  327   FVEPESTGTDSSFASDGGYERPLQPVPGDCGYHLHAHWLVLCHPTTNKVIKHIYNLGQMV  386

Query  1124  AINAPLPSILKASQE  1168
              I APLP IL+  +E
Sbjct  387   KITAPLPQILQTREE  401



>ref|XP_010503959.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X2 [Camelina 
sativa]
Length=327

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/291 (69%), Positives = 240/291 (82%), Gaps = 7/291 (2%)
 Frame = +2

Query  173   TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNA  352
             T+ EFY  KYK+SAPL GW+QRIQN QI IDG  V +P+  L  G++LVYHRLPWKEP+ 
Sbjct  16    TVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEAVKDPNTVLRSGSKLVYHRLPWKEPDT  75

Query  353   PYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPV  532
             PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT+LTQLQW   K  + + + E HPVPV
Sbjct  76    PYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRTLLTQLQWWFGKKDTSTGARELHPVPV  135

Query  533   HRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE--VMRVRKIIKIYRALV  706
             HRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V     SNL+      RK+ KIYRAL 
Sbjct  136   HRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLVGS---SNLDQDCGTGRKLSKIYRALA  192

Query  707   SGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQ  886
              G++ EDE+VI+QPIG+VRYPGVAKGLYVASP GK A S V VLER  +KNCTLV+VEIQ
Sbjct  193   DGLVEEDEVVIQQPIGVVRYPGVAKGLYVASPEGKSAFSKVVVLERDRKKNCTLVKVEIQ  252

Query  887   SGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDE--SFAQDGGYR  1033
             SGRPHQIRIHL++IGHPL+GDPLY+ GGQP CFD DL+D+  +FA+DGGYR
Sbjct  253   SGRPHQIRIHLAYIGHPLVGDPLYVAGGQPKCFDTDLVDDAAAFAEDGGYR  303



>ref|XP_010253587.1| PREDICTED: RNA pseudouridine synthase 5 isoform X6 [Nelumbo nucifera]
 ref|XP_010253588.1| PREDICTED: RNA pseudouridine synthase 5 isoform X6 [Nelumbo nucifera]
Length=330

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 254/313 (81%), Gaps = 8/313 (3%)
 Frame = +2

Query  254   ITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPG  433
             IT+DG VV +P   L  G++L+YHRLPWKEP+APY+LE+L+EDDD++A NKPSGLQVLPG
Sbjct  2     ITVDGEVVKDPHTILRAGSELMYHRLPWKEPDAPYLLEILYEDDDLVAFNKPSGLQVLPG  61

Query  434   GLFQQRTVLTQLQWR-------AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAK  592
             GLFQQRTVLTQLQWR       +  LS+   + + HPVPVHRLGRGTSGILLCAK+KLAK
Sbjct  62    GLFQQRTVLTQLQWRECQGISTSLGLSTNPGAQQQHPVPVHRLGRGTSGILLCAKSKLAK  121

Query  593   SRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPG  772
             SRL+AYFA+GTS+V + R SN+++  VR+I K+YRAL SG+I++DE++I+QPIG++RY G
Sbjct  122   SRLAAYFAEGTSVVGDNRKSNMDLGGVRRISKVYRALASGIIDKDEVIIKQPIGIMRYQG  181

Query  773   VAKGLYVASPS-GKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGD  949
             VA GLYVAS S GKPALS V VLER +  NCTLV+VEIQSGRPHQIRIHLSFIGHPL+GD
Sbjct  182   VANGLYVASSSVGKPALSKVDVLERDIPGNCTLVQVEIQSGRPHQIRIHLSFIGHPLLGD  241

Query  950   PLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAI  1129
             PLY+ GG P CF+ +  +  FAQDGGY+RP NPVPGDCGY LHAH L L HP   ++I I
Sbjct  242   PLYVTGGHPKCFNSESGENDFAQDGGYQRPINPVPGDCGYYLHAHHLVLHHPTMKKVIEI  301

Query  1130  NAPLPSILKASQE  1168
              APLP +L+  +E
Sbjct  302   IAPLPHVLQTQKE  314



>ref|XP_011084349.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Sesamum indicum]
Length=301

 Score =   405 bits (1041),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 242/282 (86%), Gaps = 1/282 (0%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FGEPWPEFNDG+ Y DLVR S +G TLIEFYSRKY++SAPL GWLQRI NKQITIDG + 
Sbjct  4    FGEPWPEFNDGIYYRDLVRASGSGATLIEFYSRKYESSAPLHGWLQRIHNKQITIDGCLA  63

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            ++P+  L  GA+LVYHRLPWKEP+APY+LE+L+ED+D+IALNKPSGLQVLPGGLFQQRTV
Sbjct  64   TDPNTILREGAELVYHRLPWKEPDAPYLLEILYEDNDVIALNKPSGLQVLPGGLFQQRTV  123

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
            LTQLQ RA  L++     E+HPVPVHRLGRGTSGILLCAKTKLAKSRL+A+FADGTS V 
Sbjct  124  LTQLQLRAGNLTTSGCQ-EAHPVPVHRLGRGTSGILLCAKTKLAKSRLAAFFADGTSNVG  182

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              R ++ +    R I KIYRALVSG+I EDE++IEQPIG+VRYPGVAKGLYVASPSGKPA
Sbjct  183  IYRRNDPQQKAGRSITKIYRALVSGIIIEDEIIIEQPIGLVRYPGVAKGLYVASPSGKPA  242

Query  818  LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLI  943
            LS V VLER + +  TLV+VEIQSGRPHQIRIH+SFIGHPL+
Sbjct  243  LSKVVVLERDMLRKSTLVQVEIQSGRPHQIRIHVSFIGHPLV  284



>ref|XP_011084350.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Sesamum indicum]
Length=288

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 242/282 (86%), Gaps = 1/282 (0%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FGEPWPEFNDG+ Y DLVR S +G TLIEFYSRKY++SAPL GWLQRI NKQITIDG + 
Sbjct  4    FGEPWPEFNDGIYYRDLVRASGSGATLIEFYSRKYESSAPLHGWLQRIHNKQITIDGCLA  63

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            ++P+  L  GA+LVYHRLPWKEP+APY+LE+L+ED+D+IALNKPSGLQVLPGGLFQQRTV
Sbjct  64   TDPNTILREGAELVYHRLPWKEPDAPYLLEILYEDNDVIALNKPSGLQVLPGGLFQQRTV  123

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
            LTQLQ RA  L++     E+HPVPVHRLGRGTSGILLCAKTKLAKSRL+A+FADGTS V 
Sbjct  124  LTQLQLRAGNLTTSGCQ-EAHPVPVHRLGRGTSGILLCAKTKLAKSRLAAFFADGTSNVG  182

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              R ++ +    R I KIYRALVSG+I EDE++IEQPIG+VRYPGVAKGLYVASPSGKPA
Sbjct  183  IYRRNDPQQKAGRSITKIYRALVSGIIIEDEIIIEQPIGLVRYPGVAKGLYVASPSGKPA  242

Query  818  LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLI  943
            LS V VLER + +  TLV+VEIQSGRPHQIRIH+SFIGHPL+
Sbjct  243  LSKVVVLERDMLRKSTLVQVEIQSGRPHQIRIHVSFIGHPLV  284



>ref|XP_010503960.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X3 [Camelina 
sativa]
Length=310

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 229/284 (81%), Gaps = 6/284 (2%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             G PWPE NDGL Y D+V  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG  
Sbjct  12   IGLPWPELNDGLQYKDVVSSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEA  71

Query  275  VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
            V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72   VKDPNTVLRSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455  VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
            +LTQLQW   K  + + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132  LLTQLQWWFGKKDTSTGARELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635  QEKRYSNL--EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSG  808
                 SNL  +    RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVAKGLYVASP G
Sbjct  192  GS---SNLDQDCGTGRKLSKIYRALADGLVEEDEVVIQQPIGVVRYPGVAKGLYVASPEG  248

Query  809  KPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPL  940
            K A S V VLER  +KNCTLV+VEIQSGRPHQIRIHL++IGHPL
Sbjct  249  KSAFSKVVVLERDRKKNCTLVKVEIQSGRPHQIRIHLAYIGHPL  292



>ref|XP_010658420.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Vitis vinifera]
Length=316

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/261 (72%), Positives = 224/261 (86%), Gaps = 0/261 (0%)
 Frame = +2

Query  377   EDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTS  556
             +D+  IALNKPSGLQVLPGGLFQQRTVLTQLQWRA+K +SL +  ESH VPVHRLGRGTS
Sbjct  21    QDNSQIALNKPSGLQVLPGGLFQQRTVLTQLQWRANKQNSLPACQESHSVPVHRLGRGTS  80

Query  557   GILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELV  736
             GILLCAKTKLAK+RL+AYFADGTS+V   R ++++   +RKI KIYRALV+G++++DE+V
Sbjct  81    GILLCAKTKLAKTRLAAYFADGTSVVGGNRDADMKSRTMRKISKIYRALVNGILDKDEIV  140

Query  737   IEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIH  916
             IEQPIGMV+YPGVAKGLYVASPSGKPALS V +LER V+ +  +V+VEIQSGRPHQIRIH
Sbjct  141   IEQPIGMVQYPGVAKGLYVASPSGKPALSKVSILERDVQGDHMIVQVEIQSGRPHQIRIH  200

Query  917   LSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLAL  1096
             LSFIGHPL+GDPLY+ GGQP C D +  +ES+A DGGY+RP  PVPGDCGY+LHAH+L L
Sbjct  201   LSFIGHPLLGDPLYVPGGQPKCCDAEFTNESYALDGGYQRPVKPVPGDCGYHLHAHQLVL  260

Query  1097  PHPITDELIAINAPLPSILKA  1159
              HP T+E+I I APLP +L+ 
Sbjct  261   SHPTTNEVIKITAPLPPVLRT  281



>ref|NP_190794.2| RNA pseudourine synthase 5 [Arabidopsis thaliana]
 gb|AAW28554.1| At3g52260 [Arabidopsis thaliana]
 gb|AEE78922.1| RNA pseudourine synthase 5 [Arabidopsis thaliana]
Length=294

 Score =   385 bits (988),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 196/283 (69%), Positives = 226/283 (80%), Gaps = 3/283 (1%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             G PWPE NDGL Y D +  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  8    IGLPWPELNDGLAYKDAISSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  67

Query  275  VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
            V +P+  L  G++LVY RLPWKEP+ PY LEVL+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  68   VKDPNTLLRSGSKLVYSRLPWKEPDTPYSLEVLYEDDDLIALNKPSGLQVLPGGLFQQRT  127

Query  455  VLTQLQWRAsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSI  631
            VLTQLQW   K  S   S ES HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+
Sbjct  128  VLTQLQWCFGKNDSYIGSRESPHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSL  187

Query  632  VQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGK  811
            V        E    RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVA+GLYVASP GK
Sbjct  188  VGSGNLDQ-ECGTGRKLSKIYRALADGIVEEDEVVIKQPIGVVRYPGVAQGLYVASPEGK  246

Query  812  PALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPL  940
            PA S V VLER  EKNC+LV+VEIQSGRPHQIRIHL+++GHPL
Sbjct  247  PAFSKVFVLERDREKNCSLVKVEIQSGRPHQIRIHLAYMGHPL  289



>ref|XP_010426838.1| PREDICTED: RNA pseudouridine synthase 5-like isoform X2 [Camelina 
sativa]
Length=310

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/282 (67%), Positives = 224/282 (79%), Gaps = 2/282 (1%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             G PWPE NDGL Y D+V  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  12   IGLPWPELNDGLEYKDIVSSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  71

Query  275  VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
            V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72   VKDPNTVLKSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455  VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
            +LTQLQW   +  S + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132  LLTQLQWWFGQKDSSTGACELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635  QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                         RK+ KIYRAL  G+I EDE+VI+QPIG+VRYPGVAKGLYVA P GKP
Sbjct  192  GSGNLDQ-NCGTGRKLTKIYRALADGIIEEDEVVIQQPIGVVRYPGVAKGLYVAFPEGKP  250

Query  815  ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPL  940
            A S + VL R  + NCTLV+VEIQSGRPHQIRIHL++IGHPL
Sbjct  251  AFSKLAVLARDRQNNCTLVKVEIQSGRPHQIRIHLAYIGHPL  292



>ref|XP_010515682.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Camelina 
sativa]
Length=310

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 190/282 (67%), Positives = 225/282 (80%), Gaps = 2/282 (1%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGL-TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             G PWPE NDGL Y D+V  S++ L T+ EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  12   IGLPWPELNDGLEYKDIVSSSESELMTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  71

Query  275  VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
            V +P+  L  G++LVYHRLPWKEP+ PY L++L+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  72   VKDPNTVLRSGSKLVYHRLPWKEPDTPYSLDILYEDDDLIALNKPSGLQVLPGGLFQQRT  131

Query  455  VLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
            +LTQL W   K  S + + E HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+V
Sbjct  132  LLTQLHWWFGKKDSSTGARELHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSLV  191

Query  635  QEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKP  814
                    +    RK+ KIYRAL  G+I EDE+VI+QPIG+VRYPGVAKGLYVASP GKP
Sbjct  192  GSGNLDQ-DCGTGRKLTKIYRALADGIIEEDEVVIQQPIGVVRYPGVAKGLYVASPEGKP  250

Query  815  ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPL  940
            A S + VL R  + NCTLV+V+IQSGRPHQIRIHL++IGHPL
Sbjct  251  AFSKLAVLARDRQNNCTLVKVDIQSGRPHQIRIHLAYIGHPL  292



>gb|AAL47436.1| AT3g52260/T25B15_30 [Arabidopsis thaliana]
Length=294

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/283 (69%), Positives = 225/283 (80%), Gaps = 3/283 (1%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLI-EFYSRKYKNSAPLQGWLQRIQNKQITIDGRV  274
             G PWPE NDGL Y D +  S++ LT + EFY  KYK+SAPL GW+QRIQN QI IDG V
Sbjct  8    IGLPWPELNDGLAYKDAISSSESELTTVSEFYFTKYKSSAPLLGWIQRIQNGQIQIDGEV  67

Query  275  VSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRT  454
            V +P+  L  G++LVY RLPWKEP+ PY LEVL+EDDD+IALNKPSGLQVLPGGLFQQRT
Sbjct  68   VKDPNTLLRSGSKLVYSRLPWKEPDTPYSLEVLYEDDDLIALNKPSGLQVLPGGLFQQRT  127

Query  455  VLTQLQWRAsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSI  631
            VLTQLQW   K  S   S ES HPVPVHRLGRGTSGILLCAKTKLAK++L+AYFA+GTS+
Sbjct  128  VLTQLQWCFGKNDSYIGSRESPHPVPVHRLGRGTSGILLCAKTKLAKTKLAAYFAEGTSL  187

Query  632  VQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGK  811
            V        E    RK+ KIYRAL  G++ EDE+VI+QPIG+VRYPGVA+GLYVASP  K
Sbjct  188  VGSGNLDQ-ECGTGRKLSKIYRALADGIVEEDEVVIKQPIGVVRYPGVAQGLYVASPEWK  246

Query  812  PALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPL  940
            PA S V VLER  EKNC+LV+VEIQSGRPHQIRIHL+++GHPL
Sbjct  247  PAFSKVFVLERDREKNCSLVKVEIQSGRPHQIRIHLAYMGHPL  289



>ref|XP_002966274.1| hypothetical protein SELMODRAFT_168290 [Selaginella moellendorffii]
 gb|EFJ32301.1| hypothetical protein SELMODRAFT_168290 [Selaginella moellendorffii]
Length=359

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 251/361 (70%), Gaps = 14/361 (4%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR-PSDAGLTL---IEFYSRKYKNSAPLQGWLQRIQNKQITID  265
             FG PWPE NDG+ Y ++ R PS     L   +E+Y+ +Y++SA  +GWL+RI   QI I+
Sbjct  2     FGVPWPEMNDGVRYAEISRLPSSQQGKLADVLEYYASRYQSSASREGWLRRILKGQIEIN  61

Query  266   GRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQ  445
             G VV++PDA +   A LVYHR PW+EP+AP++LE+L+ED+ ++A+NKPSGLQVLPGGLFQ
Sbjct  62    GEVVTSPDALIRNNASLVYHRFPWEEPSAPFMLEILYEDEHLLAINKPSGLQVLPGGLFQ  121

Query  446   QRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGT  625
             QRTVL+QLQWR +          +HP PVHRLGRGTSG+ +C  T L K+ +   +   +
Sbjct  122   QRTVLSQLQWRVTDQVE-----RNHPTPVHRLGRGTSGVYVCG-TSLTKTFVYFKYLHFS  175

Query  626   SIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELV--IEQPIGMVRYPGVAKGLYVAS  799
              ++   + S+    R   + K+YRALV G++ +D+++  I+Q IG   YPGV  GLY+A 
Sbjct  176   GVLLCAK-SDQARYRFEMLSKVYRALVCGIVQDDKVIISIDQAIGRAHYPGVRGGLYMAV  234

Query  800   PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP-  976
               GKP+ S V  L+R  E+N T+VEVEI SGR HQIRIHL+ IGHPL+GDPLY+ GGQP 
Sbjct  235   AKGKPSHSKVTTLKRNTEENSTVVEVEIFSGRAHQIRIHLASIGHPLVGDPLYVRGGQPS  294

Query  977   MCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
             M     L   S A+DGGY RPENP+PGDCGY+LHAH+L   HP+T++ + I APLP  L+
Sbjct  295   MQVVSTLERASVAEDGGYERPENPLPGDCGYHLHAHRLTFHHPVTNQRLEIVAPLPPELE  354

Query  1157  A  1159
              
Sbjct  355   T  355



>ref|XP_008348838.1| PREDICTED: RNA pseudouridine synthase 5-like [Malus domestica]
Length=284

 Score =   348 bits (893),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 217/300 (72%), Gaps = 33/300 (11%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FG PWP+ NDGL Y+D+VR  D+ LTLIEFYS KY NSAPLQGWLQRI++ QIT+DG VV
Sbjct  13   FGLPWPDLNDGLFYNDVVRTPDSELTLIEFYSSKYNNSAPLQGWLQRIRSGQITVDGEVV  72

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
             +PD  L  G++L YHRLPW+EP+APY+LEVL+EDDDM         ++ P    Q    
Sbjct  73   RDPDTILRVGSKLAYHRLPWREPDAPYLLEVLYEDDDM---------KISPLSCQQ----  119

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
                                HPVP HRLGRGTSGILLCAKTK AK++L+AY ADGTS + 
Sbjct  120  -------------------PHPVPXHRLGRGTSGILLCAKTKHAKTQLAAYLADGTSXIG  160

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
            +   +++E    RKI KIYRALV+G++ ED+++++QPIGMVRYPGVAKGLYVASP+GKPA
Sbjct  161  DGSNADMEPRTERKISKIYRALVTGIVCEDKVIVKQPIGMVRYPGVAKGLYVASPTGKPA  220

Query  818  LSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL  997
            LS V VLER++ KN TLV+VEIQSGRPHQIRIHLS+IGHPL+G   +I+     C  P L
Sbjct  221  LSKVEVLEREIHKNQTLVQVEIQSGRPHQIRIHLSYIGHPLLGKS-FIEANHSPCGPPSL  279



>gb|KCW65384.1| hypothetical protein EUGRSUZ_G02814 [Eucalyptus grandis]
Length=256

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/241 (72%), Positives = 203/241 (84%), Gaps = 0/241 (0%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FG PWPE NDG+ Y D+V  SD   TLI+FYS KY NSAP+QGWLQRIQN QI IDGRVV
Sbjct  9    FGVPWPELNDGIFYKDVVPSSDHETTLIQFYSSKYGNSAPVQGWLQRIQNGQIKIDGRVV  68

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            ++P+ S+S G ++VYHRLPWKEP+APY L +L+EDD+MIALNKPSGLQVLPGGLFQQRTV
Sbjct  69   TDPNESVSAGLEVVYHRLPWKEPDAPYFLGILYEDDNMIALNKPSGLQVLPGGLFQQRTV  128

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
            L+QLQW+ SK S+L SS E  PVPVHRLGRGTSGILLCAKTK+AKSRLS YFADGTS+V 
Sbjct  129  LSQLQWQDSKQSTLLSSQEPQPVPVHRLGRGTSGILLCAKTKIAKSRLSIYFADGTSLVG  188

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
             KR +  E   VRKI KIYRALV+G+++EDE++I +PIG+++YPGVAKGLYVASPSG   
Sbjct  189  GKRNTTKEPSSVRKISKIYRALVNGLVDEDEVIITEPIGVIKYPGVAKGLYVASPSGSMI  248

Query  818  L  820
            L
Sbjct  249  L  249



>ref|XP_001782556.1| predicted protein [Physcomitrella patens]
 gb|EDQ52631.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   349 bits (896),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 252/363 (69%), Gaps = 27/363 (7%)
 Frame = +2

Query  98    FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQN-KQITIDG  268
              G+PWPEFN+G+ Y +     PS A  +L+++YS KYK SA  +GWLQRIQN +QI +DG
Sbjct  7     IGKPWPEFNEGIQYINAFECSPSSAVPSLLDYYSAKYKESASEKGWLQRIQNGQQIRVDG  66

Query  269   RVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQ  448
              V+++P   L  G  LVY RLPW+EP  PY L VL+EDD ++A+NKPSGLQVLPGGLFQQ
Sbjct  67    NVITDPGFLLRDGVTLVYQRLPWREPEVPYRLGVLYEDDHLVAINKPSGLQVLPGGLFQQ  126

Query  449   RTVLTQLQWR--------AsklsslsssGESH---PVPVHRLGRGTSGILLCAKTKLAKS  595
             RTVL QL+W          + L+S+SSS E+    P PVHRLGRGTSGILLCAK+  AKS
Sbjct  127   RTVLKQLEWDNEEKEKHLQACLASVSSSDETRLWKPAPVHRLGRGTSGILLCAKSPAAKS  186

Query  596   RLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGV  775
             +L+A  A GTS+  ++       +  RKI K YRAL SG+I EDE+  + PIG V+Y GV
Sbjct  187   KLAADLAAGTSVSIDR-----SALIDRKITKTYRALASGIIMEDEVFADIPIGKVKYSGV  241

Query  776   AKGLYVASP-SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDP  952
             A GL +A+   GKP+ S V VL R + +N TLVEV+I +GRPHQIRIHL+ +GHPL+GDP
Sbjct  242   AGGLNMATEIGGKPSQSKVTVLWRDIVENQTLVEVQIYTGRPHQIRIHLAALGHPLVGDP  301

Query  953   LYIDGGQP-----MCFDPDLIDESF--AQDGGYRRPENPVPGDCGYNLHAHKLALPHPIT  1111
             LY+ GG+P          +  D+S   A DGGY+RP++ +PGDCGY LHA +L+  HP+T
Sbjct  302   LYVAGGRPREDLNTVNAENCEDKSMDPADDGGYQRPKSVLPGDCGYLLHAWRLSFFHPVT  361

Query  1112  DEL  1120
              ++
Sbjct  362   SQV  364



>gb|EPS61385.1| hypothetical protein M569_13411, partial [Genlisea aurea]
Length=256

 Score =   324 bits (830),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 193/260 (74%), Gaps = 6/260 (2%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FGEPWPEFNDG+ Y D    SDAG  LIEFY+  + +SAP  GWLQRI NKQIT+DG VV
Sbjct  3    FGEPWPEFNDGVYYRDRCAASDAGRMLIEFYAENHGSSAPFHGWLQRIHNKQITVDGNVV  62

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            ++P   L    +LVYHRLPWKEP AP+ + +L+EDDDMIALNKPSGLQVLPGG FQQRT+
Sbjct  63   TDPHTVLKGVEELVYHRLPWKEPEAPHSIGILYEDDDMIALNKPSGLQVLPGGSFQQRTI  122

Query  458  LTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ  637
            LTQL+ R       +        PVHRLGRGTSG+LLCAKT  AKS L+A FA  TS+V+
Sbjct  123  LTQLRRRT-----ENRVSRCRATPVHRLGRGTSGVLLCAKTTRAKSHLAALFARETSVVE  177

Query  638  EKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPA  817
              R+ N      R+I K+YRALVSG+I +DE+VI+QPIG+V YPGV+ GLYVA+PSGKPA
Sbjct  178  TSRH-NPAPKETRRITKLYRALVSGIILDDEVVIDQPIGVVEYPGVSHGLYVATPSGKPA  236

Query  818  LSNVRVLERQVEKNCTLVEV  877
            LS V +LER +  N TLV+V
Sbjct  237  LSGVMILERNIRSNSTLVQV  256



>gb|ACF82287.1| unknown [Zea mays]
Length=242

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 169/221 (76%), Gaps = 3/221 (1%)
 Frame = +2

Query  512   ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKI  691
             +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+G +I   K+    E    RKI K 
Sbjct  13    QSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAEG-AINAAKKRDKSEFSEERKISKF  71

Query  692   YRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLV  871
             YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A  SGKPA+S V VLER   +N TLV
Sbjct  72    YRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAACSSGKPAMSKVCVLERLAHQNHTLV  131

Query  872   EVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDL--IDESFAQDGGYRRPEN  1045
             +VEI SGRPHQIRIHL++IGHPL+ DPLY  GG P   +P+    D SFA DGGY RP  
Sbjct  132   QVEIHSGRPHQIRIHLAYIGHPLVDDPLYGIGGHPNFVEPESTGTDSSFASDGGYERPLQ  191

Query  1046  PVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             PVPGDCGY+LHAH L L HP T++++ I APLP IL+  +E
Sbjct  192   PVPGDCGYHLHAHWLVLCHPTTNKMVKITAPLPQILQTREE  232



>ref|XP_007218491.1| hypothetical protein PRUPE_ppa012152mg [Prunus persica]
 gb|EMJ19690.1| hypothetical protein PRUPE_ppa012152mg [Prunus persica]
Length=181

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +2

Query  557   GILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELV  736
             GILLCAKTK AK++L+AYFADGTS + +   +++E   VRKI KIYRALV+G++ ED+++
Sbjct  4     GILLCAKTKHAKTQLAAYFADGTSNIGDNSNTSMEAHAVRKISKIYRALVTGILCEDKVI  63

Query  737   IEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIH  916
             ++QPIG+VRYPGVAKGLYVASP+GKPALS V VLER + KN TLV+VEIQSGRPHQIRIH
Sbjct  64    VKQPIGVVRYPGVAKGLYVASPTGKPALSKVEVLERGIHKNQTLVQVEIQSGRPHQIRIH  123

Query  917   LSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKL  1090
             LS+IGHPL+GDPLY+ GGQP C D D +DESFA DGG+ RP  PVPGDCGYNLHAH++
Sbjct  124   LSYIGHPLLGDPLYVLGGQPKCLDSDFVDESFADDGGFLRPTKPVPGDCGYNLHAHQV  181



>tpg|DAA44821.1| TPA: RNA binding protein [Zea mays]
Length=243

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 168/219 (77%), Gaps = 7/219 (3%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVR--PSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
            FG PWPE N GLTY D  R   +DA  TLIEFYS  +K+SAPL GW++RI+N QIT+DG 
Sbjct  23   FGTPWPELNQGLTYTDTFRCADADAATTLIEFYSTNHKSSAPLPGWIKRIRNGQITVDGE  82

Query  272  VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
            VV++PD +L  G++LVYHR PW+EP APY+LEVL+EDDDM+ALNKPSGLQVLP GLFQQR
Sbjct  83   VVTDPDMTLVDGSKLVYHRFPWQEPFAPYLLEVLYEDDDMVALNKPSGLQVLPKGLFQQR  142

Query  452  TVLTQLQ---WR-AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
            TVL QLQ   W+ AS         +SHPVPVHRLGRGTSG+LLCAKTK+AK RL++YFA+
Sbjct  143  TVLAQLQLKDWKMASSCRFKRKDVQSHPVPVHRLGRGTSGLLLCAKTKVAKVRLASYFAE  202

Query  620  GTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELV  736
            G +I   K+    E    RKI K YRALV+G++++DE++
Sbjct  203  G-AINAAKKRDKSEFSEERKISKFYRALVTGILDDDEVL  240



>ref|XP_010937816.1| PREDICTED: RNA pseudouridine synthase 5 isoform X1 [Elaeis guineensis]
Length=253

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = +2

Query  512   ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKI  691
             ++HPVPVHRLGRGTSGILLCAKTK AKS L+AYFA GT  + E R      MR  +I K 
Sbjct  23    QAHPVPVHRLGRGTSGILLCAKTKRAKSCLAAYFAKGTENIVENRCEGESGMR--RISKF  80

Query  692   YRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLV  871
             YR LV+G+I  +E+VI+QPIG++ YPGVA GLYVAS SGKPA+S V VL+R +++N TLV
Sbjct  81    YRTLVTGLIENNEVVIKQPIGVMHYPGVANGLYVASSSGKPAMSKVYVLKRDLQRNQTLV  140

Query  872   EVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPV  1051
             +VEI SGRPHQIRIHL+ I HPL+GDPLY  GG P  F+PD  D+ FA+DGGY +P   V
Sbjct  141   QVEIHSGRPHQIRIHLASIDHPLLGDPLYGIGGCPKPFEPDPRDDDFAEDGGYLKPVQSV  200

Query  1052  PGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             PGD GY LHAH+L L H  T E++ I APLP IL+  +E
Sbjct  201   PGDSGYFLHAHQLVLHHLTTHEMVEITAPLPLILQTQEE  239



>gb|KDO48453.1| hypothetical protein CISIN_1g0371672mg, partial [Citrus sinensis]
Length=194

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +2

Query  674   RKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVE  853
             RKI KIYRALV G+++ED+++I+QPIG+VRYPGVAKGLYVASPSGKPALS V VLER V+
Sbjct  8     RKITKIYRALVHGIVDEDKVIIKQPIGIVRYPGVAKGLYVASPSGKPALSKVDVLERDVQ  67

Query  854   KNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYR  1033
             +NCTLV+VEIQSGRPHQIRIHL+F+GHPL+GDPLY+ GGQP  FD +  D +FAQDGGY 
Sbjct  68    RNCTLVQVEIQSGRPHQIRIHLAFLGHPLLGDPLYVAGGQPKSFDSEFADGTFAQDGGYE  127

Query  1034  RPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
             RP NPVPGDCGY LHA++L L HP T+E+I I APLPS+LK  +E
Sbjct  128   RPVNPVPGDCGYYLHAYQLFLSHPTTNEVIKITAPLPSVLKTREE  172



>ref|WP_012161585.1| RNA pseudouridine synthase [Acaryochloris marina]
 ref|YP_001515337.1| RluA family pseudouridine synthase [Acaryochloris marina MBIC11017]
 gb|ABW26023.1| pseudouridine synthase, RluA family [Acaryochloris marina MBIC11017]
Length=306

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 206/351 (59%), Gaps = 49/351 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TYH+ V    AGLTL+EFY+++Y++S+  + W  RI+  Q+TIDGR  + PD  L
Sbjct  1     MNQGWTYHNQVNQVGAGLTLLEFYAQRYRHSSGTE-WQVRIETGQVTIDGRQ-ATPDTVL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PW+EP  P   +VL+ED D++A++KPSGLQVLPGG F + T+L Q+Q R
Sbjct  59    KQGQNLAYHRPPWQEPTVPLTFDVLYEDADVLAIHKPSGLQVLPGGGFLEHTLLHQVQQR  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P P+HRLGRGTSG++L A+++ A++ LS                  
Sbjct  119   FP---------QGTPFPIHRLGRGTSGVVLMARSQQARAALS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVIN----EDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSN  826
             + MR R+I K+YRAL+         E++  I Q IG V YP +   +Y A+P G+PA S 
Sbjct  152   QQMRNRQIQKVYRALIGPEQTTHPLEEQFEITQAIGKVPYPELGY-IYAATPKGRPAHSA  210

Query  827   VRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDE  1006
               +L+R+ E   TL+ V I +GRPHQIRIHL+ IG+PL+GDPLY+ GGQP         E
Sbjct  211   CTILQRRPE--ATLLAVTITTGRPHQIRIHLATIGYPLLGDPLYVAGGQPQSIS----SE  264

Query  1007  SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
               +Q         PVPGDCGY LHA  L   HP + E + + +  P  LK 
Sbjct  265   ERSQ---------PVPGDCGYWLHAFSLQFIHPTSQERVKVVSEPPQPLKC  306



>ref|WP_010479722.1| RNA pseudouridine synthase [Acaryochloris sp. CCMEE 5410]
Length=306

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 201/351 (57%), Gaps = 49/351 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TYH+ V  + AGLTL+EFY+++Y++S+  + W  RI+  Q+TIDGR  + PD  L
Sbjct  1     MNQGWTYHNQVNQAGAGLTLLEFYAQRYRHSSGTE-WQARIETGQVTIDGRQ-ATPDTVL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PW+EP  P   +VL+ED D++A++KPSGL VLPGG F + T+L Q+Q  
Sbjct  59    KQGQNLAYHRPPWQEPTVPLTFDVLYEDADVLAIHKPSGLPVLPGGGFLEHTLLHQVQ--  116

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P P+HRLGRGTSG++L A+++ A++ LS                  
Sbjct  117   -------QCFPQGTPFPIHRLGRGTSGVVLMARSQQARAALS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVIN----EDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSN  826
             + MR R+I K+YRAL+         E +  I Q IG V YP +   +Y A+  G+PA S 
Sbjct  152   QQMRTRQIQKVYRALIGPEQTTHPLEKQFEITQAIGKVPYPELGY-IYAATQKGRPAHSA  210

Query  827   VRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDE  1006
               +L+R+ E   TL+ V I +GRPHQIRIHL+ IG+PL+GDPLY+ GGQP     +    
Sbjct  211   CTILQRRPE--ATLLAVTITTGRPHQIRIHLATIGYPLLGDPLYVAGGQPQSISSE----  264

Query  1007  SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
                          PVPGDCGY LHA  L   HP + E + + +  P  LK 
Sbjct  265   ---------ERSQPVPGDCGYWLHAFSLQFIHPTSQERVKVVSEPPQPLKC  306



>ref|WP_019505772.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=312

 Score =   252 bits (644),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 209/342 (61%), Gaps = 37/342 (11%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V+ SDAG T++E+Y++KY +S+  + W  RI++ QI ++ + V++    L
Sbjct  1     MNRGWIYQEQVKISDAGQTVLEYYTKKYNHSSQDE-WQARIKSGQILLNNQTVTD-TIIL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G QL YHR PW EP  P   +VL+ED D++ +NKPSGL V+PGG F + T+L QL+  
Sbjct  59    QTGDQLAYHRPPWIEPEVPLEFDVLYEDRDLLLINKPSGLPVMPGGGFLEHTLLWQLK--  116

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                    ++  ++ PVP+HRLGRGTSG++L A++ LAKS L+    D T   QE      
Sbjct  117   -------ANYPQNTPVPIHRLGRGTSGLMLLARSPLAKSSLAQQMRDSTIHQQED-----  164

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                  R + K+YR LV+G    D LVIEQPIG + +P V   LY A+P GK A S   V+
Sbjct  165   -----RPLKKVYRVLVTGNSIRDRLVIEQPIGKIFHP-VLGYLYGATPQGKYARSECNVI  218

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER   +NCTL+EV I +GRPHQIRIHL+ +G+PL+GDPLY+ GG       +LI     Q
Sbjct  219   ER--YRNCTLLEVRIFTGRPHQIRIHLAAVGYPLLGDPLYVAGGT----FANLIQN---Q  269

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
             D      +  VPGDCGY LHA++L+  HP T + +     LP
Sbjct  270   D------QITVPGDCGYYLHAYRLSFLHPQTMQNMNFKCSLP  305



>ref|WP_015957119.1| RNA pseudouridine synthase [Cyanothece sp. PCC 7424]
 ref|YP_002380408.1| pseudouridine synthase [Cyanothece sp. PCC 7424]
 gb|ACK73540.1| pseudouridine synthase, RluA family [Cyanothece sp. PCC 7424]
Length=308

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 201/348 (58%), Gaps = 46/348 (13%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDAS  295
               N+G  Y + V PSDAGLT++++YS+KY +S P Q W +RI + Q+ +DG    NP   
Sbjct  5     RLNNGWIYREQVNPSDAGLTVLDYYSQKYPHSTPCQ-WFERITSGQVLLDGHSC-NPHTR  62

Query  296   LSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQW  475
             L  G +L YHR PW+EP+AP   ++L+ D D++ + KP+GL +LPGG F + T+L QL+ 
Sbjct  63    LITGQKLAYHRPPWEEPSAPLNFDLLYSDSDVLVVAKPAGLPILPGGGFVEHTLLGQLKQ  122

Query  476   RAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSN  655
                         E  P P+HRLGRGTSG++L A++  A+  LS                 
Sbjct  123   HYP---------EDTPFPIHRLGRGTSGLVLLARSSFARGFLS-----------------  156

Query  656   LEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRV  835
              E MR R+I KIYRAL+      D   I QPIG + +P V   ++ A+P+GK ALS  RV
Sbjct  157   -EQMRSRQISKIYRALIPKSDLTDHFTINQPIGKIPHP-VLGYIFGATPNGKDALSECRV  214

Query  836   LERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFA  1015
             L+R  E   TLVEV+I +GRPHQIRIHL+ IG+PLIGDPLY  GG P    P        
Sbjct  215   LKRTSET--TLVEVKILTGRPHQIRIHLAAIGYPLIGDPLYTMGGIPKIQTPI-------  265

Query  1016  QDGGYRRPEN-PVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                    PE  PVPGDCGY LHA++L    P  +  + +  P P  L+
Sbjct  266   ------TPEKLPVPGDCGYYLHAYQLTFNLPHRESPLTVTCPPPRELE  307



>gb|KDO48454.1| hypothetical protein CISIN_1g0371671mg, partial [Citrus sinensis]
Length=158

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  170  LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPN  349
            LTLIEFYS K+KNSAPLQGWLQRIQN QIT+DGRVV++P+  LS G++LVYHRLPWKEP+
Sbjct  1    LTLIEFYSTKHKNSAPLQGWLQRIQNGQITVDGRVVNDPNIILSAGSELVYHRLPWKEPD  60

Query  350  APYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVP  529
             PY+LEVL+EDDD+IALNKPSGLQVLPGGLFQQRTVL QLQWRASK SS  SS  SHPVP
Sbjct  61   VPYLLEVLYEDDDLIALNKPSGLQVLPGGLFQQRTVLNQLQWRASKQSSSLSSQASHPVP  120

Query  530  VHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
            VHRLGRGTSGILLCAKTKLAK+ ++ YFAD TS++
Sbjct  121  VHRLGRGTSGILLCAKTKLAKTCIAGYFADKTSVI  155



>ref|WP_021834593.1| Ribosomal large subunit pseudouridine synthase D [Crocosphaera 
watsonii]
 emb|CCQ60134.1| Ribosomal large subunit pseudouridine synthase D [Crocosphaera 
watsonii WH 0401]
Length=302

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 202/342 (59%), Gaps = 44/342 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + ++P+ AGLTLIE+Y++ Y +S   Q WL+RI + Q+ +D + V +P   L
Sbjct  1     MNKGWIYREKIKPNHAGLTLIEYYTKHYHHSN-YQQWLERIISGQVLVDEQTV-DPQTVL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G +L YHR PW+EP  P   E+++EDD+++ +NKPSGL VLPGG F + T+L QL+ +
Sbjct  59    KTGQRLSYHRPPWQEPEVPLSFEIIYEDDNLLIVNKPSGLPVLPGGGFLEHTLLWQLKKQ  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ P+P+HRLGRGTSG++L  K+ +A+S L+                  
Sbjct  119   YP---------QNEPIPIHRLGRGTSGLMLMGKSAIARSHLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR +KI K+Y+ L+      D+  I+ PIG +  P V   +Y A   GK A S  RVL
Sbjct  152   QQMREQKISKVYQGLIGKNNLPDKFSIDHPIGKIPDP-VLGYIYGAKVDGKYAYSECRVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER V+K  TL+EV I +GRPHQIRIHL+ IG+PL+GDPLY+ GG P           F +
Sbjct  211   ERYVDK--TLLEVTILTGRPHQIRIHLATIGYPLLGDPLYVVGGIP--------KTGFKE  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
             D         VPGDCGY LHA++L+  HP+T++ +      P
Sbjct  261   DNDTIN----VPGDCGYFLHAYQLSFVHPVTNQCLTFTCERP  298



>ref|WP_007312027.1| RNA pseudouridine synthase [Crocosphaera watsonii]
 gb|EHJ11175.1| putative pseudouridine synthase [Crocosphaera watsonii WH 0003]
 emb|CCQ55420.1| Ribosomal large subunit pseudouridine synthase D [Crocosphaera 
watsonii WH 0005]
 emb|CCQ65460.1| Ribosomal large subunit pseudouridine synthase D [Crocosphaera 
watsonii WH 0402]
Length=302

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 202/344 (59%), Gaps = 44/344 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + ++P+ AGLTLIE+Y++ Y +S   Q WL+RI + Q+ +D + V +P   L
Sbjct  1     MNKGWIYREKIKPNHAGLTLIEYYTKHYHHSN-YQQWLERIISGQVLVDEQTV-DPQTVL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G +L YHR PW+EP  P   E+++EDD+++ +NKPSGL VLPGG F + T+L QL+ +
Sbjct  59    KTGQRLSYHRPPWQEPEVPLSFEIIYEDDNLLIVNKPSGLPVLPGGGFLEHTLLWQLKKQ  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ P+P+HRLGRGTSG++L  K+ +A+S L+                  
Sbjct  119   YP---------QNEPIPIHRLGRGTSGLMLMGKSAIARSHLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR +KI K+Y+ L+      D+  I+ PIG +  P V   +Y A   GK A S  RVL
Sbjct  152   QQMREQKISKVYQGLIGKNNLPDKFSIDHPIGKIPDP-VLGYIYGAKVDGKYAYSECRVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER  +K  TL+EV I +GRPHQIRIHL+ IG+PL+GDPLY+ GG P           F +
Sbjct  211   ERYADK--TLLEVTILTGRPHQIRIHLATIGYPLLGDPLYVVGGIP--------KTGFKE  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSI  1150
             D         VPGDCGY LHA++L+  HP+T++ +      P +
Sbjct  261   DNDTIN----VPGDCGYFLHAYQLSFVHPVTNQCLTFTCERPFL  300



>ref|XP_002952009.1| pseudouridine synthase [Volvox carteri f. nagariensis]
 gb|EFJ46800.1| pseudouridine synthase [Volvox carteri f. nagariensis]
Length=367

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/289 (46%), Positives = 176/289 (61%), Gaps = 4/289 (1%)
 Frame = +2

Query  110  WPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPD  289
            WPE N+G T+ D ++   AGL L++FY   +  S   + W  RI   Q+ I+G  V  PD
Sbjct  12   WPEVNNGFTFRDFIKSKHAGLALLQFYITLHPASGNCEEWTSRIVGGQVAINGSTVLEPD  71

Query  290  ASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQL  469
              L  G  + Y R PW+EP +P  ++VL+EDDD++AL KP+GLQVLP  +  QRTVLT L
Sbjct  72   HVLRVGDVVSYTRRPWREPPSPSYVDVLYEDDDVVALCKPAGLQVLPAAMLHQRTVLTLL  131

Query  470  QWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRY  649
            Q          +       PVHRLGRGTSG+LLCA+T  A+ RL+   +  T+       
Sbjct  132  QHHYGNPPGTRACVAV--APVHRLGRGTSGLLLCARTTHARQRLTELMSGKTAAAAAAAA  189

Query  650  SNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNV  829
            +       R +  IYR+LV G++ EDE  ++ PIG V+YPGV  GL+ A+P GKPA S  
Sbjct  190  AATAGTEARGL--IYRSLVQGIVAEDEGRVDVPIGPVQYPGVDGGLFAATPGGKPAASIW  247

Query  830  RVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
            RVLER+     +   VEI +GRPHQIRIH++ +GHPL+GDPLY  GG P
Sbjct  248  RVLERRPGGGRSRQAVEILTGRPHQIRIHMAAMGHPLVGDPLYGIGGLP  296



>ref|WP_021830810.1| Ribosomal large subunit pseudouridine synthase D [Crocosphaera 
watsonii]
 emb|CCQ51551.1| Ribosomal large subunit pseudouridine synthase D [Crocosphaera 
watsonii WH 8502]
Length=302

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 202/344 (59%), Gaps = 44/344 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + ++P+ AGLTLIE+Y++ Y +S   Q WL+ I + Q+ +D + V +P   L
Sbjct  1     MNKGWIYREKIKPNHAGLTLIEYYTKHYHHSN-YQQWLEMIISGQVLVDEQTV-DPQTVL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G +L YHR PW+EP  P   E+++EDD+++ +NKPSGL VLPGG F + T+L QL+ +
Sbjct  59    KTGQRLSYHRPPWQEPEVPLSFEIIYEDDNLLIVNKPSGLPVLPGGGFLEHTLLWQLKKQ  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ P+P+HRLGRGTSG++L  K+ +A+S L+                  
Sbjct  119   YP---------QNEPIPIHRLGRGTSGLMLMGKSAIARSHLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR +KI K+Y+ L+      D+  I+ PIG +  P V   +Y A   GK A S  RVL
Sbjct  152   QQMREQKISKVYQGLIGKNNLPDKFSIDHPIGKIPDP-VLGYIYGAKVDGKYAYSECRVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER V+K  TL+EV I +GRPHQIRIHL+ IG+PL+GDPLY+ GG P           F +
Sbjct  211   ERYVDK--TLLEVTILTGRPHQIRIHLATIGYPLLGDPLYVVGGIP--------KTGFKE  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSI  1150
             D         VPGDCGY LHA++L+  HP+T++ +      P +
Sbjct  261   DNDTIN----VPGDCGYFLHAYQLSFVHPVTNQCLTFTCERPFL  300



>ref|WP_013324343.1| RNA pseudouridine synthase [Cyanothece sp. PCC 7822]
 ref|YP_003889555.1| RluA family pseudouridine synthase [Cyanothece sp. PCC 7822]
 gb|ADN16280.1| pseudouridine synthase, RluA family [Cyanothece sp. PCC 7822]
Length=302

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 201/345 (58%), Gaps = 44/345 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V  ++AGLTLIE+Y++KY +S P + WL+RIQ+ QI IDG    +P   L
Sbjct  1     MNKGWIYEEQVSKTEAGLTLIEYYTQKYSHSGPSE-WLERIQSGQILIDG-CSQDPQTLL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG +L YHR PW+EP  P   EV +EDD+++ + KPS L VLPGG F + T+L+ LQ +
Sbjct  59    QPGQKLTYHRPPWEEPEVPLSFEVFYEDDEVLVVAKPSLLPVLPGGGFLEHTLLSLLQQQ  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P+PVHRLGRGTSG++L A++  A++ L+                  
Sbjct  119   YP---------QRTPIPVHRLGRGTSGLVLLARSPHARANLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             E MR  ++ KIYRALV      D  VI  PIG + +P V   ++ A+  G  A S   VL
Sbjct  152   EQMRSHQVGKIYRALVGSGNIPDHFVITHPIGKIPHP-VLGYVFGATADGMKAYSECHVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R      TLVEV+I +GRPHQIRIHL+  G+PLIGDPLY  GG P       I E  A 
Sbjct  211   KRN--PTTTLVEVKILTGRPHQIRIHLAVAGYPLIGDPLYQIGGVPR------IPEPIAG  262

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
             +      + PVPGD GY+LHA+ L+  HP+T +LI +  P P+ L
Sbjct  263   E------KLPVPGDGGYHLHAYGLSFFHPVTGKLIELICPPPTPL  301



>gb|EMT21167.1| RNA pseudourine synthase 5 [Aegilops tauschii]
Length=230

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 6/189 (3%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLT--LIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
            FG  WP+ N+GL+Y D  R +DA  T  LI FYS  YK+SAPL GW+ RI+N QIT+DG+
Sbjct  18   FGRAWPDLNEGLSYTDTFRGADAETTASLINFYSENYKSSAPLPGWIHRIRNGQITVDGQ  77

Query  272  VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQR  451
            VV++PD  L  G++LVYHRL WKEP AP++L+VL+EDDDM+ALNKPSGLQVLP G+FQQR
Sbjct  78   VVTDPDMILREGSKLVYHRLAWKEPFAPHLLQVLYEDDDMVALNKPSGLQVLPKGIFQQR  137

Query  452  TVLTQLQWRAs----klsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFAD  619
            TVL QLQW+         S   + + HPVPVHRLGRGTSG+LLCAKTKLAK +L++YFA+
Sbjct  138  TVLAQLQWKEGKMPPSSCSKRKNVQLHPVPVHRLGRGTSGLLLCAKTKLAKVQLASYFAE  197

Query  620  GTSIVQEKR  646
            G +  ++KR
Sbjct  198  GAANAEKKR  206



>ref|WP_007306953.1| RNA pseudouridine synthase [Crocosphaera watsonii]
 gb|EAM49318.1| Pseudouridine synthase, RluD [Crocosphaera watsonii WH 8501]
Length=302

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/342 (41%), Positives = 200/342 (58%), Gaps = 44/342 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + ++ + AGLTLIE+Y++ Y +S   Q WL+RI + Q+ +D + V +P   L
Sbjct  1     MNKGWIYREKIKQNHAGLTLIEYYTKHYHHSN-YQQWLERIISGQVLVDEQTV-DPQTVL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G +L YHR PW+EP  P   E+++EDD+++ +NKPSGL VLPGG F + T+L QL+ +
Sbjct  59    KTGQRLSYHRPPWQEPEVPLSFEIIYEDDNLLIVNKPSGLPVLPGGGFLEHTLLWQLKKQ  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ P+P+HRLGRGTSG++L  K+ +A+S L+                  
Sbjct  119   YP---------QNEPIPIHRLGRGTSGLMLMGKSAIARSHLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR +KI K+Y+ L+      D+  I+ PIG +  P V   +Y A   GK A S  RVL
Sbjct  152   QQMREQKISKVYQGLIGKNNLPDKFSIDHPIGKIPDP-VLGYIYGAKVDGKYAYSECRVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R V+K  TL+EV I +GRPHQIRIHL+ IG+PL+GDPLY+ GG P           F +
Sbjct  211   GRYVDK--TLLEVTILTGRPHQIRIHLATIGYPLLGDPLYVVGGIP--------KTGFKE  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
             D         VPGDCGY LHA++L+  HP+T++ +      P
Sbjct  261   DNDTIN----VPGDCGYFLHAYQLSFVHPVTNQCLTFTCERP  298



>ref|WP_006512461.1| pseudouridine synthase, RluA family [Xenococcus sp. PCC 7305]
 gb|ELS00308.1| pseudouridine synthase, RluA family [Xenococcus sp. PCC 7305]
Length=311

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 202/345 (59%), Gaps = 37/345 (11%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY + V PS  G T++++YS +Y++S   + W ++I + QI++DGR V + +  L
Sbjct  3     LNQGWTYREQVPPSAVGQTVLQYYSARYRHSNE-ESWRKKIISGQISLDGRRV-DAETIL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G +L YHRLPW EP  P   EV++ED D++A+ KP+GL VLPGG F Q T+L Q++  
Sbjct  61    QLGQKLAYHRLPWLEPTVPLDFEVIYEDPDLLAIAKPAGLPVLPGGGFLQNTLLWQIK--  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ PVP+HRLGRGTSG+LL AK+ L KS LS       S  Q  + +N 
Sbjct  119   -------KIYPQNTPVPIHRLGRGTSGLLLLAKSALGKSSLSRQMRS-NSTHQTTQSAN-  169

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   +I KIY A V  V+  D   I  PIG + +P +   +Y A+P+GK A S  +V+
Sbjct  170   -----PRIQKIYLAKVDRVVPRDRFTITNPIGKIPHPHIGY-VYGATPTGKFAHSECQVI  223

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R    + T+++V I +GRPHQIRIHL+  G PL+GDPLY  GG P             Q
Sbjct  224   KR--NPDSTIIQVAILTGRPHQIRIHLAAAGFPLMGDPLYGVGGIP----------QMKQ  271

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
             D      E  VPGDCGY+LHAH+LA  HP ++E + +  P P  L
Sbjct  272   D------EVAVPGDCGYHLHAHRLAFTHPTSNERVNLICPPPVSL  310



>ref|WP_008275394.1| RNA pseudouridine synthase [Cyanothece sp. CCY0110]
 gb|EAZ91566.1| probable pseudouridine synthase [Cyanothece sp. CCY0110]
Length=299

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/335 (41%), Positives = 196/335 (59%), Gaps = 48/335 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G  Y + ++P +AGLT++E+Y++ Y +S+  Q WL+RI + Q+ ++ +VV+ P+  L
Sbjct  1     MNNGWIYREQIKPKNAGLTVLEYYTQNYHHSSS-QQWLERIISGQVLLNKKVVT-PETIL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PWKEP+ P   ++++EDDD++ +NKPSGL VLPGG F + T+L QL+  
Sbjct  59    QIGQWLSYHRTPWKEPDVPLNFDIIYEDDDLLVINKPSGLPVLPGGGFLEHTLLWQLK--  116

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +    P+HRLGRGTSG+++  K+ +A+S+L+                  
Sbjct  117   -------KQYPKDKVFPIHRLGRGTSGLMVMGKSAIARSQLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR  KI K+YR L+      D   I+ PIG +  P V   +Y A   GK A S   +L
Sbjct  152   QQMREHKITKVYRTLIGNNNLPDHFNIDHPIGKISDP-VLGYIYGAKADGKYAYSECHIL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER  +K  TLVEV I +GRPHQIRIHL+ IG+PL+GDPLY  GG P              
Sbjct  211   ERYSDK--TLVEVTILTGRPHQIRIHLATIGYPLLGDPLYTIGGIPKT------------  256

Query  1019  DGGYRRPENP--VPGDCGYNLHAHKLALPHPITDE  1117
               G+    +   VPGDCGY LHA++L+  HPIT++
Sbjct  257   --GFEEQNDTINVPGDCGYFLHAYQLSFVHPITNQ  289



>ref|WP_017287903.1| hypothetical protein [Leptolyngbya boryana]
Length=302

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/348 (41%), Positives = 201/348 (58%), Gaps = 51/348 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FN G  Y D  R    G TL+++Y+ +Y +S+  Q WL RIQ+  I+I+   VS+P+  L
Sbjct  4     FNQGWVYTD--RIDRQGRTLLDYYAERYPHSS-RQDWLDRIQSGAISINDIPVSDPEMPL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L Y R PW EP+  + ++ L+ED+ ++ L+KPSGL VLPG  F + T+   L+  
Sbjct  61    QPGQLLSYQRSPWIEPDVSFEIQSLYEDEHLLILSKPSGLPVLPGAGFLENTLWGWLR--  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                         + PVP+HRLGRGTSG+++ AKT+LA+S+LS                  
Sbjct  119   --------REYATPPVPIHRLGRGTSGVIVLAKTELARSQLS------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + +R R   K YRALV+G+ + D+  +   IG V YP + + LYVA+ +GK A+S+ +VL
Sbjct  153   KDLRDRTFEKRYRALVTGIPDADQFTVTHRIGKVAYPQLGE-LYVATETGKEAISHCQVL  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER    N TL+EV I +GRPHQIRIHL+  G+PL GDPLY  GG  +             
Sbjct  212   ERDRIPNATLLEVTIPTGRPHQIRIHLAAAGYPLWGDPLYGVGGVAIN------------  259

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKAS  1162
                    +N VPGDCGY LHA+ + L HP++ E + I A  P++L  S
Sbjct  260   -------QNSVPGDCGYLLHAYTVGLIHPVSKEKMTIQAEPPTLLSPS  300



>ref|WP_012628632.1| RNA pseudouridine synthase [Cyanothece sp. PCC 7425]
 ref|YP_002483930.1| RluA family pseudouridine synthase [Cyanothece sp. PCC 7425]
 gb|ACL45569.1| pseudouridine synthase, RluA family [Cyanothece sp. PCC 7425]
Length=303

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 197/345 (57%), Gaps = 44/345 (13%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D V    AGLTL+++YS++Y++++  + W  RI+  QI ++G+  + P   L 
Sbjct  3     NQGWVYRDQVDRRHAGLTLLDYYSQRYRHTSSAE-WQTRIELGQIHLNGQP-APPTTRLQ  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL YHR PW EP  P   E ++ D D++ ++KP+GL VLPGG F + T+L QLQ + 
Sbjct  61    AGQQLTYHRPPWPEPEVPLKFETIYSDADLLIISKPAGLPVLPGGGFLEHTLLWQLQQQY  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       +  PVP+HRLGRGTSG+++ A + LAKS LS                  +
Sbjct  121   P---------QETPVPIHRLGRGTSGLMILAISGLAKSALS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR + I K YRALV G    D   I+ PIG + +P +   +Y A+P+G+ A S  +VL+
Sbjct  154   QMRDQHIRKTYRALVGGGEMPDRFTIDYPIGKIPHPELGY-VYGATPTGRFAHSECQVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R  ++  TL+ V I +GRPHQIRIHL+  G+PL+GDPLYI+GG P  F     D+     
Sbjct  213   RTPDR--TLLAVTILTGRPHQIRIHLAAAGYPLLGDPLYINGGIPRSFGATPTDKVA---  267

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                      VPGDCGY+LHAH LA  HP T E +   +P P  L 
Sbjct  268   ---------VPGDCGYHLHAHHLAFAHPRTGEPLEFISPPPRELS  303



>ref|WP_039730479.1| pseudouridine synthase, partial [Lyngbya confervoides]
Length=292

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 137/329 (42%), Positives = 192/329 (58%), Gaps = 38/329 (12%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D V P  AG TL+++Y+++Y++S   + W  RI+  Q+T+      + D  L
Sbjct  1     MNQGWIYRDRVPPVAAGQTLLDYYAQRYRHST-REEWRTRIEQGQVTV-ADTPGHADQRL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PW+EP+ P   +VL+ED+D++A+ KPSGL VLPGG F + T+L QL+ R
Sbjct  59    QTGQLLAYHRAPWQEPDVPLNFDVLYEDEDLLAIAKPSGLPVLPGGQFLEHTLLHQLRQR  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ P PVHRLGRGTSG++L A++ LA++ LS          ++ R ++ 
Sbjct  119   FP---------QNPPTPVHRLGRGTSGVMLLARSPLARADLS----------RQLRQASD  159

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                      K YRAL+      D   +  PIG V YPG+   L+ A+PSGK A S   VL
Sbjct  160   RQRPATHFHKSYRALIGPSDLPDTFEVSVPIGPVPYPGLGT-LFAATPSGKWAYSQGSVL  218

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +RQ  +  TL+EV I +GRPHQIRIHL+ IG+PL+GDPLY  GG P+        ++ A 
Sbjct  219   QRQAHQ--TLLEVNIATGRPHQIRIHLAAIGYPLLGDPLYTSGGHPL--------KTMAT  268

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHP  1105
             D      ++P+P D GY+LHAH L   HP
Sbjct  269   D------KSPIPSDIGYHLHAHHLNFTHP  291



>ref|WP_017298821.1| hypothetical protein [Nodosilinea nodulosa]
Length=322

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 200/346 (58%), Gaps = 33/346 (10%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D +  +D GL++++FYS +Y +S   + W  RI + QI  DG  V+ PD  L
Sbjct  1     MNQGWVYTDRINKADTGLSVLDFYSDRYCHSTQAE-WRDRILSGQICQDGHPVA-PDDRL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PW+EP AP   +VL+ED+D++A+ KP+GL VLPGG F   T+L QL+ +
Sbjct  59    QAGQTLAYHRPPWQEPEAPLGFKVLYEDEDLVAIAKPAGLPVLPGGNFLTHTLLHQLKLK  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        E+ P+PVHRLGRGTSG+++  ++ LA+S LS    + T+   + +  + 
Sbjct  119   YP---------ENTPIPVHRLGRGTSGVMVLGRSPLARSVLSRQLRESTAAACDPQAPH-  168

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                    I K YRAL+      D   +   IG V +P V   +Y ASP+G PA S+ +VL
Sbjct  169   ------PIRKTYRALIGPSNLPDTFTLTTAIGKVNHP-VLGYVYAASPTGLPAYSDGKVL  221

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R      TL+EV I++GRPHQIRIHL+  G PL+GDPLY  GG P+  +        A 
Sbjct  222   HR--TPTSTLLEVTIRTGRPHQIRIHLAAAGFPLLGDPLYGVGGVPLALE--------AS  271

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
               G    + PVPGD GY+LHA++L L HP T + + + +  P IL+
Sbjct  272   PNG----KIPVPGDVGYHLHAYQLNLEHPRTQKAMELISEPPKILQ  313



>ref|WP_023172359.1| ribosomal large subunit pseudouridine synthase D [Gloeobacter 
kilaueensis]
 ref|YP_008710998.1| ribosomal large subunit pseudouridine synthase D [Gloeobacter 
kilaueensis JS1]
 gb|AGY57291.1| ribosomal large subunit pseudouridine synthase D [Gloeobacter 
kilaueensis JS1]
Length=308

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/344 (42%), Positives = 193/344 (56%), Gaps = 47/344 (14%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G TY D +    AG T+++FY  +Y++S P Q W +RI+  ++ +DG+     +  L 
Sbjct  10    NQGCTYIDRIDRVAAGATVLDFYRERYRHSQPQQ-WRERIEKGEVLLDGKRTGTGEI-LR  67

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
             PG  L YHR PW+EP  P   E+L+ED+ ++ + KPSGL VLPGG F + T+L QL+   
Sbjct  68    PGQVLSYHRQPWQEPPVPLHFEILYEDEVVLVVAKPSGLPVLPGGGFVENTLLAQLK---  124

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  PVPVHRLGRGTSG+LL A+T  +++ LS                  E
Sbjct  125   ------KHFPERTPVPVHRLGRGTSGLLLLARTPKSRAALS------------------E  160

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              +R ++I KIYRAL SG    D   I+QPIG V YPG+   L+ A+  G  A S   VL 
Sbjct  161   QLRRQQITKIYRALASGSPVADHFAIDQPIGKVPYPGLGY-LWAATDGGLTAYSECSVLR  219

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             RQ     +L+ V I++GRPHQIRIHL+  GHPL+GDPLY  GG P            A +
Sbjct  220   RQARD--SLLAVTIRTGRPHQIRIHLAAAGHPLVGDPLYGPGGVPQ-----------AVE  266

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAIN-APLPSI  1150
             G  RR    VPGDCGY LHA KL   HP +   + +  AP P +
Sbjct  267   GEGRR---AVPGDCGYWLHAWKLGFRHPESGRGLELTCAPPPGL  307



>ref|WP_012597171.1| RNA pseudouridine synthase [Cyanothece sp. PCC 8801]
 ref|YP_002374073.1| RluA family pseudouridine synthase [Cyanothece sp. PCC 8801]
 gb|ACK67917.1| pseudouridine synthase, RluA family [Cyanothece sp. PCC 8801]
Length=306

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 192/333 (58%), Gaps = 44/333 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V PSDAGLT++ +Y+++Y +S+  Q W +RI + QI ++G+  + PD  L
Sbjct  2     LNQGWIYREQVNPSDAGLTILAYYTQRYPHSSQGQ-WQERIISGQILLNGQP-TTPDTPL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L YHR PW+EP+ P   EVL+ED D++ + KPSGL VLPGG F + T+L QL+  
Sbjct  60    QPGQCLSYHRPPWQEPDVPLAFEVLYEDVDVLVVAKPSGLPVLPGGGFLEHTLLGQLK--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P P+HRLGRGTSG++L A++ LA S LS                  
Sbjct  118   -------RLYPQETPTPIHRLGRGTSGLMLLARSPLAASHLS------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               MR  ++ K+Y ALV       +  I QPIG + +P V   +Y A+P G  A S+ RVL
Sbjct  153   HQMRQGQMTKVYHALVGAGDLPHQFSIHQPIGKIPHP-VLGYVYGATPDGLFAHSHCRVL  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R  +   TLVEV I +GRPHQIRIHL+ +G+PL+GDPLY  GG P   +P++       
Sbjct  212   QRSTQG--TLVEVRIFTGRPHQIRIHLASVGYPLLGDPLYEVGGIPRT-EPEIEVNKL--  266

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDE  1117
                      PVPGDCGY LH+H L   HP T E
Sbjct  267   ---------PVPGDCGYLLHSHLLGFTHPRTHE  290



>ref|WP_015785023.1| RNA pseudouridine synthase [Cyanothece sp. PCC 8802]
 ref|YP_003139653.1| RluA family pseudouridine synthase [Cyanothece sp. PCC 8802]
 gb|ACV02818.1| pseudouridine synthase, RluA family [Cyanothece sp. PCC 8802]
Length=306

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 192/333 (58%), Gaps = 44/333 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V PSDAGLT++ +Y+++Y +S+  Q W +RI + QI ++G+  + PD  L
Sbjct  2     LNQGWIYREQVNPSDAGLTILAYYTQRYPHSSQGQ-WQERIISGQILLNGQP-TTPDTPL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L YHR PW+EP+ P   EVL+ED D++ + KPSGL VLPGG F + T+L QL+  
Sbjct  60    QPGQCLSYHRPPWQEPDVPLAFEVLYEDVDVLVVAKPSGLPVLPGGGFLEHTLLGQLK--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P P+HRLGRGTSG++L A++ LA S LS                  
Sbjct  118   -------RLYPQETPTPIHRLGRGTSGLMLLARSPLAASHLS------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR  ++ K+Y ALV       +  I QPIG + +P V   +Y A+P G  A S+ RVL
Sbjct  153   KQMRQGQMTKVYHALVGAGDLPHQFSIHQPIGKIPHP-VLGYVYGATPDGLFAHSDCRVL  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R  +   TLVEV I +GRPHQIRIHL+ +G+PL+GDPLY  GG P       +++    
Sbjct  212   QRSTQG--TLVEVRIFTGRPHQIRIHLASVGYPLLGDPLYEVGGIPRTAPKIEVNKL---  266

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDE  1117
                      PVPGDCGY LH+H L   HP T E
Sbjct  267   ---------PVPGDCGYLLHSHLLGFTHPRTHE  290



>ref|WP_035987890.1| pseudouridine synthase [Leptolyngbya sp. KIOST-1]
Length=315

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 199/347 (57%), Gaps = 33/347 (10%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D + P+ AG ++++FY+ +Y++S   + W  RI + +I  +  V   P+  L
Sbjct  1     MNQGWVYTDRITPATAGQSVLDFYTDRYRHSTRAE-WRDRILSGKIRRNN-VPLAPEDRL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G  L YHR PW+EP  P   EVL ED D++A+ KP+GL VLP G F   T+L QL+  
Sbjct  59    AVGQILAYHRPPWQEPTVPLGFEVLDEDGDLMAIAKPAGLPVLPAGNFLTHTLLHQLKRH  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        E+ P+P+HRLGRGTSG++L  ++ LA+S LS    + T+   + +  + 
Sbjct  119   YP---------ENPPIPLHRLGRGTSGVMLLGRSPLARSVLSRQLRESTATAHDPQAPH-  168

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                    I K YRALV      D   +  PIG + +P V   +Y ASP+G PA S+ +VL
Sbjct  169   ------PIRKTYRALVGASDLPDVFTLTTPIGKIGHP-VLGYVYGASPTGLPAYSDGQVL  221

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R  +   TLVEV I++GRPHQIRIHL+  G PLIGDPLY  GG P+   P        +
Sbjct  222   HRTAD--STLVEVTIRTGRPHQIRIHLAAAGFPLIGDPLYGVGGVPLAIQP-------GE  272

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
             DG     + PVPGD GY+LHA++LALPHP T E + I    P  L++
Sbjct  273   DG-----KIPVPGDMGYHLHAYRLALPHPRTQEPLVIECIPPPALRS  314



>ref|XP_001699192.1| pseudouridine synthase [Chlamydomonas reinhardtii]
 gb|EDO98832.1| pseudouridine synthase [Chlamydomonas reinhardtii]
Length=303

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/336 (43%), Positives = 187/336 (56%), Gaps = 46/336 (14%)
 Frame = +2

Query  110   WPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPD  289
             WP  N+G  + D ++   AG TLIEFY+  +  SA L  W  RI+N Q+ ++      P 
Sbjct  12    WPPQNEGFVFRDWIKGRHAGQTLIEFYTSVHPASANLSQWEVRIRNGQVAVNDVEAVEPT  71

Query  290   ASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQL  469
               L  G  + Y RLPW EP +P  ++V++ED DM+AL+KPSGLQVLP  +F QRTVL+ L
Sbjct  72    RVLRVGDVVSYRRLPWVEPPSPCHVDVVYEDADMVALSKPSGLQVLPAAMFHQRTVLSLL  131

Query  470   QWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRY  649
             + R              P PVHRLGRGTSG   C    LA    SA  A G+      R 
Sbjct  132   RRRQYLDV---------PAPVHRLGRGTSG---CGAAALAALISSAP-ASGSGCQLPLR-  177

Query  650   SNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNV  829
                         K YRALV G +  D+  ++ PIG + +PGV +GL+ A+P GKPA S  
Sbjct  178   ------------KFYRALVQGRVKADQGRVDVPIGPIPHPGVDRGLFAATPDGKPAASVW  225

Query  830   RVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDES  1009
             R     +E  CTL+EVEI +GRPHQIRIH++ +GHPL+GDPLY  GG+P           
Sbjct  226   RA--GCMEAECTLMEVEILTGRPHQIRIHMAAMGHPLVGDPLYGAGGRPKVR--------  275

Query  1010  FAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDE  1117
                   YR   +    DCGY LH+ +L LPHPIT +
Sbjct  276   ------YRLYGS----DCGYYLHSLELHLPHPITGQ  301



>ref|WP_002748287.1| pseudouridine synthase, RluA family protein [Microcystis aeruginosa]
 emb|CAO90197.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS45400.1| pseudouridine synthase, RluA family protein [Microcystis aeruginosa 
DIANCHI905]
Length=302

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 190/341 (56%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  + PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYTGKYPHSSP-EEWLDRILSAAILVNGRP-AYPDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       +  P P+HRLGRGTSGI+L AK+K A+S+LS                  +
Sbjct  120   --------YADVTPYPIHRLGRGTSGIVLMAKSKPARSKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S  RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSEGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             + ++   TL+EVEI +GRPHQIRIHL+F GHPLIGDPLY  GG P               
Sbjct  213   KHLDS--TLLEVEIFTGRPHQIRIHLAFFGHPLIGDPLYSVGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISICCPAP  291



>ref|WP_036486096.1| pseudouridine synthase [Myxosarcina sp. GI1]
Length=304

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 139/342 (41%), Positives = 190/342 (56%), Gaps = 43/342 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V   DAG T++ +Y+ KY++S+  + W +RI  +QI +D    + P+  L
Sbjct  1     MNQGWIYRERVNKFDAGQTILSYYNSKYRHSSK-EEWRERIIKRQILLD-ESPATPETKL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G +L YHR PW EP  P    VL+ED D++A+ KP GL VLPGG F + T+  QLQ +
Sbjct  59    TAGQKLAYHRPPWNEPPVPLDFTVLYEDSDLLAIAKPKGLPVLPGGGFLEHTLWWQLQQK  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  PVPVHRLGRGTSGI+L A++ LAKS LS                  
Sbjct  119   ---------YSQPIPVPVHRLGRGTSGIMLLARSHLAKSSLS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               +R   I K+Y ALVSG      L+I   IG + +  +   +Y A+  GK A S  RVL
Sbjct  152   HQLRTNSIDKVYLALVSGTDIPQHLIISDHIGKIPHSSLGY-IYGATSQGKSARSECRVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              RQ ++  T+VEV I +GRPHQIRIHL+  G PL+GDPLY+ GG+P          S ++
Sbjct  211   SRQSDR--TIVEVTIFTGRPHQIRIHLAAAGFPLLGDPLYLPGGKPRLIS------SISE  262

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
             D      + PVP DCGY LHA++L   HP + + I +    P
Sbjct  263   DK-----KLPVPSDCGYYLHAYRLGFTHPRSGDKITLECKPP  299



>ref|WP_002781323.1| putative enzyme [Microcystis aeruginosa]
 emb|CCI15712.1| putative enzyme [Microcystis aeruginosa PCC 9806]
Length=303

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 190/341 (56%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D V  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  S PD  L 
Sbjct  3     NQGWIYRDKVSKNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGRPAS-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSG++L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGLVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGRGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDT-VPGDCGYYLHANQILFNHPSTGERISICCPAP  291



>ref|WP_008318400.1| pseudouridine synthase, RluA family [Leptolyngbya sp. PCC 6406]
Length=309

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 152/345 (44%), Positives = 204/345 (59%), Gaps = 38/345 (11%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY++ V+ SDAGLTL+++YS++Y +S+  + W  RIQ+ Q+ +DGR  S  +A L
Sbjct  1     MNQGWTYYNQVQASDAGLTLLDYYSQRYPHSSRGE-WCDRIQSGQVEVDGRQGSE-EAIL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              P  +L YHR PW+EP AP    VL+ED D++ ++KP+GL VLPGG F   T+L QL+  
Sbjct  59    KPRQRLAYHRPPWEEPPAPLNFGVLYEDGDLLVVDKPAGLPVLPGGGFLNHTLLHQLRQH  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  PVP+HRLGRGTSG+LL  ++ LAKS LS          Q+ R S  
Sbjct  119   YP---------QETPVPIHRLGRGTSGLLLLGRSSLAKSVLS----------QQMRAST-  158

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             E      + K YRAL+      D L +  PIG + +P +   +Y AS  GK A S VRV+
Sbjct  159   EGHSTTGLEKCYRALIGPSTLPDTLTLTTPIGKLPHPTLGY-VYGASAMGKTAHSQVRVV  217

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R   +  TL+EV I++GRPHQIRIHL+  G+PL+GDPLY  GG P   D     E+   
Sbjct  218   QRTTTQ--TLIEVIIRTGRPHQIRIHLAAAGYPLLGDPLYQVGGIPRSLDVMGKMEA---  272

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
                       VPGDCGY+LHAH+L   HP T  L+ + APLP  L
Sbjct  273   ----------VPGDCGYHLHAHRLTFRHPRTQALVTLTAPLPPTL  307



>ref|WP_015171825.1| RluA family pseudouridine synthase [Geitlerinema sp. PCC 7407]
 ref|YP_007109311.1| RluA family pseudouridine synthase [Geitlerinema sp. PCC 7407]
 gb|AFY66259.1| pseudouridine synthase, RluA family [Geitlerinema sp. PCC 7407]
Length=318

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 194/345 (56%), Gaps = 44/345 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D V  + AG TL+++Y+++Y++S+  + W  RI++ QI +D R  + P+  L
Sbjct  16    LNHGWIYRDRVDAAGAGQTLLQYYTQRYRHSSEPE-WRDRIESGQIRLDDRPAA-PETLL  73

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G +L YHR PW EP  P    VL ED+D+  ++KPSGL VLPGG F + T+L QLQ R
Sbjct  74    QRGQRLAYHRPPWVEPPVPLDFAVLHEDEDLWVVSKPSGLPVLPGGGFLEHTLLWQLQVR  133

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                           PVP+HRLGRGTSG++L A++ LAK+ LS                  
Sbjct  134   CP---------RPTPVPIHRLGRGTSGLMLLARSPLAKAHLS------------------  166

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR R+I K+YRALV   +  D L +   IG + +P V   +Y A+P G  A S  +VL
Sbjct  167   QQMRDRQIHKVYRALVGPNVAGDRLSLRYAIGKLPHP-VLGYVYGATPDGLDAHSECKVL  225

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R      TLVEV I +GRPHQIRIH++  G+PL+GDPLY  GG P       +  + A 
Sbjct  226   RR--SPTSTLVEVTIFTGRPHQIRIHMAAAGYPLLGDPLYGVGGVPH------LSAAIAP  277

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
                    + PVPGDCGY LHAH+L   HP T E +A  A  P  L
Sbjct  278   G------KLPVPGDCGYLLHAHRLTFTHPRTQEPLAFVAEPPPPL  316



>ref|WP_002790931.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCI28349.1| putative enzyme [Microcystis aeruginosa PCC 9808]
Length=329

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 191/344 (56%), Gaps = 52/344 (15%)
 Frame = +2

Query  113   PEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
             P  N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  + PD 
Sbjct  26    PMANQGWIYRDKISKNQAGLSLLAYYTGKYPHSSP-EEWLDRILSAAILVNGRP-AYPDT  83

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L  G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  + 
Sbjct  84    VLEIGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVH  143

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
                          +  P P+HRLGRGTSGI+L AK+K A+++LS                
Sbjct  144   QH---------YADVTPYPIHRLGRGTSGIVLMAKSKPARAKLS----------------  178

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
               + MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ R
Sbjct  179   --QQMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSDGR  235

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VL++    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P            
Sbjct  236   VLKKH--PDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP------------  281

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                    RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  282   -------RPDA-VPGDCGYYLHANQIVFNHPSTGERISICCPAP  317



>ref|WP_017711187.1| hypothetical protein [Prochlorothrix hollandica]
Length=307

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 186/334 (56%), Gaps = 51/334 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY + V+P+ AG+TL  +Y   Y +S P Q W  RI + QI +D    S+P+  L
Sbjct  3     LNQGWTYQEQVKPAAAGMTLWNYYCHHYHHSTPEQ-WHDRIVSGQIHLD-HCPSSPETPL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PW EP  P  +E++ +D D   + KPSGL VLPGG F   T+L QL+  
Sbjct  61    RSGQTLTYHRPPWLEPEVPLDVEIVHQDPDFWIVAKPSGLPVLPGGPFLDHTLLHQLR--  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  PVP+HRLGRGTSG+++ A++ LA+S  S                  
Sbjct  119   -------RLYPQDTPVPIHRLGRGTSGLMVLARSPLARSHFS------------------  153

Query  659   EVMRVRKIIKIYRALV-----SGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALS  823
             E +R  +I KIYRALV     S  I  D     QPIG V +P +   ++ ASP G+PA S
Sbjct  154   EALRQHRITKIYRALVVAGPGSVQILPDRFTCTQPIGPVPHPSLGT-VHSASPQGRPAHS  212

Query  824   NVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLID  1003
             +  VL RQ ++  TLVEV+I +GRPHQIRIHL+ +G+PL+GDPLY  GG P+   P    
Sbjct  213   DGWVLRRQGDR--TLVEVQIHTGRPHQIRIHLASLGYPLLGDPLYGVGGVPVTVLP----  266

Query  1004  ESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHP  1105
                    G R    PVPGD GY LHAH+L   HP
Sbjct  267   -------GERM---PVPGDGGYWLHAHRLGFEHP  290



>ref|WP_002751629.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCH95464.1| putative enzyme [Microcystis aeruginosa PCC 9432]
Length=308

 Score =   225 bits (574),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 143/341 (42%), Positives = 190/341 (56%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  + PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYTGKYPHSSP-EEWLDRILSAAILVNGRP-AYPDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFSINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGVGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISICCPAP  291



>ref|WP_017324732.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=302

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/346 (41%), Positives = 195/346 (56%), Gaps = 44/346 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V    AG T++ +Y++++++S+  + WL RI+  QI +D R  +     L
Sbjct  1     MNRGWIYREQVDRCAAGQTVLAYYTQQHRHSSQTE-WLARIEAGQIWLDNRPATA-ATLL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L Y R PW+EP  P   ++ +ED D++ + KP+GL VLPGG F   T+L QL+ R
Sbjct  59    RVGQHLAYRRPPWQEPEVPLGFDIRYEDPDLLVVAKPAGLPVLPGGGFLDHTLLKQLEVR  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        ++ PVPVHRLGRGTSG++L A++ LAK+ LS                  
Sbjct  119   YP---------QAPPVPVHRLGRGTSGLVLLARSPLAKADLS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               MR R+I K+YRAL+      D   IE  IG VR+P +   LY A+ +GK A S+ +VL
Sbjct  152   RQMRDRQIHKLYRALIGPGDLPDRCAIETTIGKVRHPLLGY-LYAATETGKFARSDCQVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+   + TLVEV I +GRPHQIRIHL+ +G+PL+GDPLY  GG P    P   D+    
Sbjct  211   ERR--SDATLVEVAILTGRPHQIRIHLASVGYPLLGDPLYAIGGVPKPIPPTSTDKV---  265

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                      P+PGD GY+LHA +L+  HP TD  IA+    P IL 
Sbjct  266   ---------PLPGDGGYHLHACRLSFNHPRTDRAIAVECLAPEILS  302



>ref|WP_009545186.1| RNA pseudouridine synthase [Cyanothece sp. ATCC 51472]
Length=301

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 191/341 (56%), Gaps = 48/341 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G  Y + ++  +AGLT++E+Y++ Y +S+  Q WL+RI   Q+ +D +VV+ P+  L
Sbjct  1     MNNGWIYREQIKQKNAGLTVLEYYTQNYHHSSS-QQWLERILWAQVLLDNQVVT-PETIL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PWKE + P   ++++ED  ++ +NKPSGL VLPGG F + T+L QL+  
Sbjct  59    QTGQWLSYHRPPWKEADVPLDFDLIYEDHHILVINKPSGLPVLPGGGFLEHTLLGQLK--  116

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +    P+HRLGRGTSG++L  KT +A+S L+                  
Sbjct  117   -------KQYPKEKVFPIHRLGRGTSGLMLMGKTAIARSHLT------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               MR  K+ K+YR L+      D   IE PIG +  P V   +Y A   GK A S  +++
Sbjct  152   RQMREHKMRKVYRTLIGENNLPDYFNIEHPIGKISDP-VLGYIYGAKADGKDAYSQCQII  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER  +K  TLVEV I +GRPHQIRIHL+ IG+PL+GDPLY+ GG P              
Sbjct  211   ERYSDK--TLVEVTILTGRPHQIRIHLATIGYPLLGDPLYVVGGIPKT------------  256

Query  1019  DGGYRRPENP--VPGDCGYNLHAHKLALPHPITDELIAINA  1135
               G++  +    VPGDCGY LHA++L+  HP T + +    
Sbjct  257   --GFKEQKETVNVPGDCGYFLHAYQLSFVHPATHQCLTFTC  295



>ref|WP_016514714.1| Ribosomal large subunit pseudouridine synthase D [Microcystis 
aeruginosa]
 gb|EPF24170.1| Ribosomal large subunit pseudouridine synthase D [Microcystis 
aeruginosa SPC777]
Length=303

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 189/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYTGKYPHSSP-EEWLDRILSAAILVNGRPAC-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFSINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV+I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVQIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISICCPAP  291



>ref|WP_012362224.1| RNA pseudouridine synthase [Cyanothece sp. ATCC 51142]
 ref|YP_001805069.1| pseudouridine synthase [Cyanothece sp. ATCC 51142]
 gb|ACB53003.1| probable pseudouridine synthase [Cyanothece sp. ATCC 51142]
Length=304

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/341 (39%), Positives = 191/341 (56%), Gaps = 48/341 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G  Y + ++  +AGLT++E+Y++ Y +S+  Q WL+RI   Q+ +D +VV+ P+  L
Sbjct  4     MNNGWIYREQIKQKNAGLTVLEYYTQNYHHSSS-QQWLERILWAQVLLDNQVVT-PETIL  61

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L YHR PWKE + P   ++++ED  ++ +NKPSGL VLPGG F + T+L QL+  
Sbjct  62    QTGQWLSYHRPPWKEADVPLDFDLIYEDHHILVINKPSGLPVLPGGGFLEHTLLGQLK--  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +    P+HRLGRGTSG++L  KT +A+S L+                  
Sbjct  120   -------KQYPKEKVFPIHRLGRGTSGLMLMGKTAIARSHLT------------------  154

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               MR  K+ K+YR L+      D   IE PIG +  P V   +Y A   GK A S  +++
Sbjct  155   RQMREHKMRKVYRTLIGENNLPDYFNIEHPIGKISDP-VLGYIYGAKADGKDAYSQCQII  213

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER  +K  TLVEV I +GRPHQIRIHL+ IG+PL+GDPLY+ GG P              
Sbjct  214   ERYSDK--TLVEVTILTGRPHQIRIHLATIGYPLLGDPLYVVGGIPKT------------  259

Query  1019  DGGYRRPENP--VPGDCGYNLHAHKLALPHPITDELIAINA  1135
               G++  +    VPGDCGY LHA++L+  HP T + +    
Sbjct  260   --GFKEQKETVNVPGDCGYFLHAYQLSFVHPATHQCLTFTC  298



>ref|WP_002786331.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCI15333.1| putative enzyme [Microcystis aeruginosa PCC 9807]
Length=302

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 190/341 (56%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  + PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGRP-AYPDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWIEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQHY  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSG++L AK+K A+++LS                  +
Sbjct  121   P---------EVTPYPIHRLGRGTSGLVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--SDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGVGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISIGCPAP  291



>ref|WP_006618102.1| RNA pseudouridine synthase [Arthrospira platensis]
 ref|YP_005071350.1| probable pseudouridine synthase [Arthrospira platensis NIES-39]
 dbj|BAI92812.1| probable pseudouridine synthase [Arthrospira platensis NIES-39]
 gb|KDR54129.1| pseudouridine synthase [Arthrospira platensis str. Paraca]
Length=309

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 133/347 (38%), Positives = 190/347 (55%), Gaps = 44/347 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V    AGLT++++YS++Y +S+  + W  RI N+QI +DG+  +  D  L
Sbjct  2     LNSGWIYREQVDRLSAGLTVLDYYSKRYTHSSRNE-WCDRINNQQIWLDGKPATA-DIEL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G QL YHR PW EP+ P   +V++ED D++ + KPSGL V+PGG F + T+L QLQ +
Sbjct  60    QAGQQLAYHRPPWNEPDVPLSFQVIYEDADILVVAKPSGLPVIPGGGFLEHTLLRQLQRK  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P+P+HRLGRGTSG++L A++ + +S L+                  
Sbjct  120   YP---------QDTPIPIHRLGRGTSGLVLLARSTVGRSYLT------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR R+I K+Y AL  G    D   I   IG + +P +   +Y A+ +G  A SN +V+
Sbjct  153   KQMRQRQITKVYLALAEGCSPRDYFSINCAIGKIPHPIIGY-IYGATETGLSAESNCQVI  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R  +K   +V+V I +GRPHQIRIHL+  G PL+GDPLY  GG+P   DP     S   
Sbjct  212   RRDSDK--MIVQVTILTGRPHQIRIHLAAAGFPLVGDPLYTIGGKPRITDPTSNHHS---  266

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
                        PGDCGY LHA+ L+  HP T   + + A  P  L  
Sbjct  267   ---------TFPGDCGYYLHAYSLSFQHPQTGANLHLTATPPQELST  304



>ref|WP_008203075.1| RNA pseudouridine synthase [Microcystis sp. T1-4]
 emb|CCI33038.1| putative enzyme [Microcystis sp. T1-4]
Length=303

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 194/347 (56%), Gaps = 54/347 (16%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  S PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGRPAS-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLSYQRPPWTEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGRGDIPDNFSINQAIGQIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV+I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVQIFTGRPHQIRIHLAFFGYPLIGDPLYGPGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINA--PLPSILK  1156
                 RP+  VPGDCGY LHA+++   HP T E I+I+   PL S++ 
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISISCQPPLESVIS  297



>ref|WP_013613801.1| RNA pseudouridine synthase [Deinococcus proteolyticus]
 ref|YP_004254809.1| pseudouridine synthase, RluA family [Deinococcus proteolyticus 
MRP]
 gb|ADY25192.1| pseudouridine synthase, RluA family [Deinococcus proteolyticus 
MRP]
Length=305

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 135/349 (39%), Positives = 199/349 (57%), Gaps = 58/349 (17%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G +Y + VRP  AGL+++++Y+R Y +S   Q W  R+   ++ ++G   +  + SL
Sbjct  7     LNSGYSYRERVRPQAAGLSVLDYYARFYPHSD-RQTWGARLAAGEVELNGHPAAGSE-SL  64

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQL--Q  472
              PG +L +HR PW E   P    VL+ED  ++A++KPSGL  LP G F   T+L  L  Q
Sbjct  65    RPGDRLAWHRPPWAEEAVPLHFSVLYEDAHILAVHKPSGLPTLPAGGFLDHTLLALLRRQ  124

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             W A+              P+HRLGRGTSG++LC+ T  A SRL+A + +G          
Sbjct  125   WPAA-------------TPLHRLGRGTSGLVLCSLTPAAGSRLTADWREG----------  161

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                     +I K YRAL +GV  +++  I  PIG+V +P + + +Y A+P+GKP+ S  +
Sbjct  162   --------RIHKRYRALSAGVAAQEKYDITAPIGLVDHPRLGQ-IYAATPAGKPSRSRAQ  212

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+     TL +V+I++GRPHQIRIHL+  G PL+GDPLY+ GGQ             
Sbjct  213   VLERR--DGSTLFQVDIETGRPHQIRIHLASAGLPLLGDPLYLPGGQA------------  258

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
                    RP+  +PGD GY LHA +L   HP   E ++++AP+P  L++
Sbjct  259   -------RPDA-LPGDLGYLLHAERLEFRHPAGGEHLSLSAPVPPELRS  299



>ref|WP_002738905.1| pseudouridine synthase, RluA family protein [Microcystis aeruginosa]
 gb|ELP52860.1| pseudouridine synthase, RluA family protein [Microcystis aeruginosa 
TAIHU98]
Length=303

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 192/349 (55%), Gaps = 52/349 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+  + WL RI +  I ++GR  + PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYAGKYPHSS-REEWLDRILSAAILVNGRP-AYPDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFSINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P  L  S +
Sbjct  256   ----RPDA-VPGDCGYYLHANQIVFNHPSTGERISICCPAPPELVISYQ  299



>ref|WP_036533621.1| pseudouridine synthase [Neosynechococcus sphagnicola]
 gb|KGF72526.1| pseudouridine synthase [Neosynechococcus sphagnicola sy1]
Length=309

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 143/352 (41%), Positives = 196/352 (56%), Gaps = 47/352 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V  ++AGLT++ +++ +Y++S+    W  RI   +I +D +  +  D  L
Sbjct  1     MNQGWIYREQVDGANAGLTILAYFTHRYRHSSQTV-WQSRIICGEILLDDQQTTA-DTLL  58

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L YHR PW+EP  P   EVL++D D+  + KP+GL VLPGG F + T+L QLQ  
Sbjct  59    KPGQWLSYHRPPWEEPVVPLTFEVLYQDADVWVVAKPAGLPVLPGGGFLEHTLLWQLQ--  116

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  PVP+HRLGRGTSG+LL A++ LA+  LS                  
Sbjct  117   -------QQYPQETPVPIHRLGRGTSGLLLLARSPLARVALS------------------  151

Query  659   EVMRVRKIIKIYRALV--SGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
             E MR R+I K YRALV    +  +D   I QPIG + +P V   +Y A P G+ A S+ +
Sbjct  152   EQMRHRQICKTYRALVKTCDLPLKDTFTITQPIGKIPHP-VLGYVYGAVPDGRFAQSDCQ  210

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VL+R+ E   TL+ V I++GRPHQIRIHL+  G PL+ DPLY  GG P C          
Sbjct  211   VLKRRPET--TLLAVTIRTGRPHQIRIHLAAAGCPLVADPLYEIGGLPRC----------  258

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
              Q  G  +   PVPGDCGY LHA +L   HP T + ++I  P P +L  S+ 
Sbjct  259   -QPKGAEK--LPVPGDCGYYLHAFQLDFIHPRTHQPLSILCPAPVVLDESES  307



>ref|WP_024970894.1| pseudouridine synthase [Microcystis aeruginosa]
Length=308

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 190/341 (56%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR  + PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYTGKYPHSSP-EEWLDRILSAAILVNGRP-AYPDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFSINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGVGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I+   P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISISCQPP  291



>ref|WP_002778900.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCI08978.1| putative enzyme [Microcystis aeruginosa PCC 7941]
Length=302

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 141/341 (41%), Positives = 188/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGRPAC-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDTEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EVEI +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVEIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T   I+I+   P
Sbjct  256   ----RPDA-VPGDCGYYLHANQIVFNHPSTGRTISISCQPP  291



>ref|WP_012264949.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 ref|YP_001656607.1| pseudouridine synthase [Microcystis aeruginosa NIES-843]
 dbj|BAG01415.1| pseudouridine synthase [Microcystis aeruginosa NIES-843]
Length=299

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 141/341 (41%), Positives = 186/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYTGKYCHSSP-EEWLDRILSAAILVNGRPAC-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP  P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPEVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YAEVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGHVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVRIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I    P
Sbjct  256   ----RPDA-VPGDCGYYLHANQIVFNHPSTGERISICCQAP  291



>ref|XP_010937818.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Elaeis guineensis]
 ref|XP_010937819.1| PREDICTED: RNA pseudouridine synthase 5 isoform X3 [Elaeis guineensis]
Length=192

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = +2

Query  512   ESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKI  691
             ++HPVPVHRLGRGTSGILLCAKTK AKS L+AYFA GT  + E R      MR  +I K 
Sbjct  23    QAHPVPVHRLGRGTSGILLCAKTKRAKSCLAAYFAKGTENIVENRCEGESGMR--RISKF  80

Query  692   YRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLV  871
             YR LV+G+I  +E+VI+QPIG++ YPGVA GLYVAS SGKPA+S V VL+R +++N TLV
Sbjct  81    YRTLVTGLIENNEVVIKQPIGVMHYPGVANGLYVASSSGKPAMSKVYVLKRDLQRNQTLV  140

Query  872   EVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDG  1024
             +VEI SGRPHQIRIHL+ I HPL+GDPLY  GG P  F+PD  D+ FA+DG
Sbjct  141   QVEIHSGRPHQIRIHLASIDHPLLGDPLYGIGGCPKPFEPDPRDDDFAEDG  191



>ref|WP_002759126.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCH96824.1| Pseudouridine synthase [Microcystis aeruginosa PCC 9717]
Length=352

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 142/341 (42%), Positives = 188/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D V  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKVSKNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGRPAC-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQHY  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       +  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  121   P---------DVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGRGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVRIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDA-VPGDCGYYLHANQIVFNHPSTGERISICCPAP  291



>gb|ADC36159.1| RluA family pseudouridine synthase [uncultured bacterium 162]
Length=326

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 141/354 (40%), Positives = 189/354 (53%), Gaps = 58/354 (16%)
 Frame = +2

Query  101   GEPWPEF------NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITI  262
             G+ WP        N G  Y  ++   D G TL+   +  Y +S   Q W Q + N ++T+
Sbjct  18    GQVWPGLDSSQMLNRGYAYTTIISSKDRGRTLLSHLASLYTHST-AQAWQQNLDNGEVTV  76

Query  263   DGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLF  442
             DG V +N   SL+ G  LV++R PW EP+AP   E+LF+D  ++A+NKPSGL  LPGG F
Sbjct  77    DG-VTANGSESLASGQTLVWNRPPWVEPDAPQHFEMLFDDPYLLAVNKPSGLPTLPGGGF  135

Query  443   QQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADG  622
              + T+L  +Q +    +           PVHRLGRGTSGI+L AKT  A + L A +   
Sbjct  136   MENTLLRLVQNQCPSAN-----------PVHRLGRGTSGIVLFAKTPKAAAELCANW---  181

Query  623   TSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASP  802
                               +I K+YRA+  GV   D   I  PIG+V +P +   ++ ASP
Sbjct  182   ---------------NTPRIQKVYRAVAQGVAEHDAYEILTPIGLVPHPLIGS-VWGASP  225

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
              GKP+ S  +V+ R   ++ T  EV +QSGRPHQIRIHL+ IG+PL+GDPLY  GGQP+ 
Sbjct  226   DGKPSKSVAKVISR--AESTTTFEVSLQSGRPHQIRIHLASIGYPLVGDPLYGLGGQPLE  283

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
               P L                  PGD GY LHA  L   HPI+ E I + A LP
Sbjct  284   NLPGL------------------PGDGGYLLHAQLLKFQHPISGERIELEAALP  319



>ref|WP_019586506.1| hypothetical protein [Deinococcus apachensis]
Length=305

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 189/350 (54%), Gaps = 50/350 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG TY + +     GLT++ + +R+Y +S   + W  R+   ++ +DG V    +  L
Sbjct  3     LNDGYTYREELGGRARGLTVLAYLTRRYGHSDERE-WQARLDRGEVRLDGEVAHGSEV-L  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG +L + R PW E  AP   E+++ D +++A++KPSGL  LPGG F   T+L+ ++  
Sbjct  61    RPGQRLEWRRPPWHEEEAPLEYELIYRDAELLAVSKPSGLPTLPGGGFLNHTLLSVVR--  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                             P+HRLGRGTSG++L A+T  A S L+                  
Sbjct  119   ---------RNFPEATPLHRLGRGTSGLVLFARTAGAASFLA------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             E  R  ++ K YRAL SG+  +D   I  PIG V +P +   ++ ASP+GKP+LS  +VL
Sbjct  152   EAWRNGEVRKRYRALASGLAEQDSYTITTPIGPVPHPWLGN-VFAASPAGKPSLSEAQVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+ +++ TL  V+I +GRPHQIRIHL+  GHPL+GDPLY  GG P    P L       
Sbjct  211   ERRPDQDQTLFGVDIPTGRPHQIRIHLASAGHPLVGDPLYASGGLPRADLPGL-------  263

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                        PGD GY LHA +L  PHP T  L+ + AP P  L A+ E
Sbjct  264   -----------PGDGGYLLHAERLVFPHPRTGGLLTLRAPPPPELLAADE  302



>ref|WP_031499912.1| pseudouridine synthase [Bryobacter aggregatus]
Length=298

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 139/343 (41%), Positives = 182/343 (53%), Gaps = 52/343 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y  ++     G TL+   +  Y +S P Q W Q++ N +IT++G V +    S+
Sbjct  2     LNRGYAYTTIISSKFHGQTLLSHLASLYPHSTP-QAWQQKLSNGEITLNG-VTATGSESV  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G  LV++R PW EP+AP   EVLFED  ++A+NKP+GL  LPGG F + T+L  +Q +
Sbjct  60    TLGQTLVWNRPPWIEPDAPQHFEVLFEDLHLLAVNKPNGLPTLPGGGFLENTLLRMVQKQ  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             +               PVHRLGR T+GI+L AKT    S LSA +               
Sbjct  120   SPNAK-----------PVHRLGRATTGIVLFAKTPQVASHLSANW---------------  153

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   K+ KIYRAL   V   D   I  PIG+V +P +   ++ ASPSGKP+ S  +V+
Sbjct  154   ---NTPKMQKIYRALAQNVAQHDAYEILTPIGLVPHPRIGS-VWAASPSGKPSKSLAKVI  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R    + T  EV + SGRPHQIRIHL+ IGHPL+GDPLY   GQP+   P L       
Sbjct  210   SR--NSSTTTFEVSLSSGRPHQIRIHLASIGHPLVGDPLYGSTGQPLENLPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
                        PGD GY LHA  L   HPIT E I + A LPS
Sbjct  261   -----------PGDGGYFLHAQYLRFHHPITGEQINLEAALPS  292



>ref|WP_034339682.1| pseudouridine synthase [Deinococcus misasensis]
Length=300

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/348 (39%), Positives = 192/348 (55%), Gaps = 56/348 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G TY + +     G TL+++ SR Y +S+  + W  R+Q  ++ +DG+  S  +  L
Sbjct  5     LNNGYTYTEQLGKKANGCTLLDYLSRFYDHSS-REDWQVRLQQGEVELDGKTASGCEP-L  62

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  LV+HR PW EP+ P     +F D  ++A+ KPSGL  +PGG F + T+L  ++  
Sbjct  63    KPGQLLVWHRPPWDEPDVPLFCTEVFADQHLLAVVKPSGLPTMPGGGFLEHTLLAVVR--  120

Query  479   AsklsslsssGESHP--VPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
                        +SHP   P+HRLGR TSG++L AKT+ A S L+  + D           
Sbjct  121   -----------QSHPEASPLHRLGRYTSGLVLFAKTREAASTLARNWRD-----------  158

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                     ++ K Y AL SG+  +D   I+ PIG V +P + + +Y A P GKP+ S  R
Sbjct  159   -------HEVHKRYLALASGLALQDTYQIDAPIGPVNHPRLGQ-VYAAHPEGKPSFSEAR  210

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VL+RQ  +  TL EV+IQ+GRPHQIRIHL+ IGHPL+GDPLY  GG P+  +P L     
Sbjct  211   VLQRQ--ETSTLFEVDIQTGRPHQIRIHLASIGHPLVGDPLYGSGGTPLSENPGL-----  263

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                          PGD GY LHA +L   HP++   + ++AP P  L+
Sbjct  264   -------------PGDGGYLLHAVRLQFRHPVSGTEMVLHAPAPEGLE  298



>ref|WP_002800981.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCI38571.1| putative enzyme [Microcystis aeruginosa PCC 9701]
Length=308

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/341 (41%), Positives = 188/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKISRNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGRPAC-PDTILE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQHY  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  121   V---------EVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGYVYGALADGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV+I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVQIFTGRPHQIRIHLAFFGYPLIGDPLYGVGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I    P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISICCQAP  291



>ref|WP_008052599.1| RNA pseudouridine synthase [Arthrospira sp. PCC 8005]
 emb|CCE17910.1| pseudouridine synthase, RluA family [Arthrospira sp. PCC 8005]
 emb|CCE17814.1| pseudouridine synthase, RluA family [Arthrospira sp. PCC 8005]
 emb|CDM96623.1| pseudouridine synthase, RluA family [Arthrospira sp. PCC 8005]
Length=309

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 189/347 (54%), Gaps = 44/347 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V    AGLT++++YS++Y +S+    W  RI  +QI ++G+  +  +  L
Sbjct  2     LNSGWIYREQVDRLSAGLTILDYYSKRYTHSS-RNEWCDRINKQQIWLNGKPATA-EIEL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G QL YHR PW EP+ P   +V++ED D++ + KPSGL V+PGG F + T+L QLQ  
Sbjct  60    QAGQQLAYHRPPWSEPDVPLSFQVIYEDADILVIAKPSGLPVIPGGGFLEHTLLRQLQ--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P+P+HRLGRGTSG++L A++ LA+S L+                  
Sbjct  118   -------REYPQDTPIPIHRLGRGTSGLVLLARSTLARSHLT------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR R+I K+Y AL  G    D   I   IG + +P +   +Y A+ +G  A S+ +V+
Sbjct  153   QQMRHRQITKVYLALAEGCSPRDYFSINCAIGKIPHPIIGY-IYGATETGLSAESHCQVI  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R  +K   +V+V I +GRPHQIRIHL+  G PL+GDPLY  GG+P   DP     S   
Sbjct  212   KRDTDK--MIVQVTILTGRPHQIRIHLAAAGFPLVGDPLYTIGGKPRIPDPTSNHHST--  267

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
                        PGDCGY LHA+ L+  HP T   + + A  P  L  
Sbjct  268   ----------FPGDCGYYLHAYSLSFQHPQTGANLHLTATPPQELST  304



>ref|WP_012694389.1| RNA pseudouridine synthase [Deinococcus deserti]
 ref|YP_002787022.1| RNA pseudouridine synthase [Deinococcus deserti VCD115]
 gb|ACO47268.1| putative RNA pseudouridine synthase [Deinococcus deserti VCD115]
Length=298

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 195/345 (57%), Gaps = 54/345 (16%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G TY   V+ S  G+++++F S +Y++SAP + W  R+   ++ +DG  V   +  L 
Sbjct  4     NAGYTYVTPVQVS--GVSVLDFLSTRYRHSAP-EVWAARLAQGEVQVDGLTVQGHE-RLR  59

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G  LV+HR PW+E + P   EVL ED  ++A++KPSGL  LPGG F + T+LT ++   
Sbjct  60    AGQTLVWHRPPWQEESVPLHFEVLHEDASLLAVHKPSGLPTLPGGGFLEHTLLTVVR---  116

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                      G S   P+HRLGRGTSG++L A+T  A S L+                   
Sbjct  117   -----AQFPGAS---PLHRLGRGTSGVVLFARTGAAGSALA------------------R  150

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
               R + + K+YRAL SGV  +DE  I   IG V +P + + ++ A P+GKP+ S  RV+E
Sbjct  151   AWREQDVRKMYRALASGVATQDETEITVSIGPVPHPRLGE-VFAACPTGKPSRSVARVVE  209

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R      TL +V+I +GRPHQIRIHL+ IG PL+GDPLY  GG P+   PDL        
Sbjct  210   RC--SGTTLFDVQIFTGRPHQIRIHLASIGQPLVGDPLYGPGGHPL---PDLPG------  258

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                      +PGD GY LHAH L+  HP++ ++I + AP PS L+
Sbjct  259   ---------LPGDLGYLLHAHTLSFTHPVSGQVITVTAPAPSALE  294



>ref|WP_006624308.1| MULTISPECIES: RNA pseudouridine synthase [Arthrospira]
 gb|EDZ96321.1| pseudouridine synthase, RluA family [Arthrospira maxima CS-328]
 gb|EKD07846.1| pseudouridine synthase RluA family [Arthrospira platensis C1]
Length=309

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 189/347 (54%), Gaps = 44/347 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + V    AGLT++++YS++Y +S+  + W  RI  +QI +DG+  +  +  L
Sbjct  2     LNSGWIYREKVDRLSAGLTVLDYYSKRYTHSSRNE-WCDRINKQQIWLDGKPATA-EIEL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G QL YHR PW EP+ P   +V++ED D++ + KPSGL V+PGG F + T+L QLQ  
Sbjct  60    QAGQQLAYHRPPWSEPDVPLSFQVIYEDADILVVAKPSGLPVIPGGGFLEHTLLRQLQ--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  P+P+HRLGRGTSG++L A++ L +S L+                  
Sbjct  118   -------REYPQDTPIPIHRLGRGTSGLVLLARSTLGRSHLT------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + MR R+I K+Y AL  G    D   I   IG + +P +   +Y A+ +G  A S+ +V+
Sbjct  153   QQMRHRQITKVYLALAEGCSPRDYFSINCAIGKIPHPIIGY-IYGATETGLSAESHCQVI  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R  +K   +V+V I +GRPHQIRIHL+  G PL+GDPLY  GG+P   DP     S   
Sbjct  212   KRDTDK--MIVQVTILTGRPHQIRIHLAAAGFPLVGDPLYTIGGKPRIPDPTSNHHST--  267

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
                        PGDCGY LHA+ L+  HP T   + + A  P  L  
Sbjct  268   ----------FPGDCGYYLHAYSLSFQHPQTGANLHLTATPPQELST  304



>dbj|GAL95412.1| ribosomal large subunit pseudouridine synthase D [Microcystis 
aeruginosa NIES-44]
Length=315

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 189/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYTGKYPHSSP-EEWLDRILSGAILVNGRPAC-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQH-  119

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       +  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  120   --------YADVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGYVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV+I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVQIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T  +I+I+   P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGRIISISCQPP  291



>ref|WP_002772370.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCI05077.1| putative enzyme [Microcystis aeruginosa PCC 9443]
Length=299

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 139/341 (41%), Positives = 188/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D +  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++G   + PD  L 
Sbjct  3     NQGWIYRDKISKNQAGLSLLAYYAGKYPHSSP-EEWLDRILSAAILVNGSP-AGPDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   E L+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFERLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQHY  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       E  P P+HRLGRGTSG++L AK+K A+++LS                  +
Sbjct  121   P---------EVTPYPIHRLGRGTSGLVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGRGDIPDNFTINQAIGKIAHP-ILGYVYGALADGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV+I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVQIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T E I+I  P P
Sbjct  256   ----RPDA-VPGDCGYYLHANQILFNHPSTGERISICCPAP  291



>ref|WP_031293173.1| pseudouridine synthase [Leptolyngbya sp. Heron Island J]
Length=301

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 190/348 (55%), Gaps = 57/348 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FNDG  Y D +  +    T++++Y+ +Y++S     W  RI+  QI ++ + ++  D  L
Sbjct  7     FNDGWVYCDRIPKNHPPATVLDYYTHRYRHSD-RATWQTRIETGQILLNNQPIAA-DTPL  64

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L YHR PW+EP  P  +  + ED+ ++ +NKPSGL VLPGG F Q T+L Q++ R
Sbjct  65    KPGQNLSYHRPPWQEPPVPLDITTIHEDNVVLVVNKPSGLPVLPGGNFLQHTLLWQVRQR  124

Query  479   AsklsslsssGESHPV--PVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
                          HP   P+HRLGRGTSGI++ AKTK A++ LS                
Sbjct  125   -------------HPTAAPIHRLGRGTSGIMMIAKTKTARAHLS----------------  155

Query  653   NLEVMRVRKIIKIYRALVSGVIN-EDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNV  829
               + MR  +  K YRAL+    +  D+  I  PIG + YP +   +Y A P G  A S+ 
Sbjct  156   --QQMRQHRFGKTYRALIGPAADLPDQFSITHPIGKIPYPQLGH-IYGAKPDGLDAHSDC  212

Query  830   RVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDES  1009
              V++RQ E   TL++V I +GRPHQIRIHL+ +G+PL+GDPLY+ GGQP    P+     
Sbjct  213   SVVQRQPE--ATLLDVTILTGRPHQIRIHLATLGYPLLGDPLYVAGGQP---HPN-----  262

Query  1010  FAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
                          +PGDCGY LHAH+L+  HP    +     P P ++
Sbjct  263   ----------GKAIPGDCGYWLHAHRLSFIHPTGKPMTLTCEPPPCLV  300



>gb|ESA35471.1| rna pseudouridine synthase [Leptolyngbya sp. Heron Island J]
Length=303

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 190/348 (55%), Gaps = 57/348 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FNDG  Y D +  +    T++++Y+ +Y++S     W  RI+  QI ++ + ++  D  L
Sbjct  9     FNDGWVYCDRIPKNHPPATVLDYYTHRYRHSD-RATWQTRIETGQILLNNQPIAA-DTPL  66

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L YHR PW+EP  P  +  + ED+ ++ +NKPSGL VLPGG F Q T+L Q++ R
Sbjct  67    KPGQNLSYHRPPWQEPPVPLDITTIHEDNVVLVVNKPSGLPVLPGGNFLQHTLLWQVRQR  126

Query  479   AsklsslsssGESHPV--PVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
                          HP   P+HRLGRGTSGI++ AKTK A++ LS                
Sbjct  127   -------------HPTAAPIHRLGRGTSGIMMIAKTKTARAHLS----------------  157

Query  653   NLEVMRVRKIIKIYRALVSGVIN-EDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNV  829
               + MR  +  K YRAL+    +  D+  I  PIG + YP +   +Y A P G  A S+ 
Sbjct  158   --QQMRQHRFGKTYRALIGPAADLPDQFSITHPIGKIPYPQLGH-IYGAKPDGLDAHSDC  214

Query  830   RVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDES  1009
              V++RQ E   TL++V I +GRPHQIRIHL+ +G+PL+GDPLY+ GGQP    P+     
Sbjct  215   SVVQRQPE--ATLLDVTILTGRPHQIRIHLATLGYPLLGDPLYVAGGQP---HPN-----  264

Query  1010  FAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
                          +PGDCGY LHAH+L+  HP    +     P P ++
Sbjct  265   ----------GKAIPGDCGYWLHAHRLSFIHPTGKPMTLTCEPPPCLV  302



>gb|EKV01348.1| pseudouridine synthase, RluA family [Leptolyngbya sp. PCC 7375]
Length=347

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 195/367 (53%), Gaps = 70/367 (19%)
 Frame = +2

Query  104   EPW-------PEFNDGLTYHDLVRPSDAGL--------TLIEFYSRKYKNSAPLQGWLQR  238
             +PW       P FNDG  Y D + P  +G         T++++Y+  +++S     W  R
Sbjct  33    KPWRVGNTHLPGFNDGWVYCDRISPDSSGHISSNHPQNTILDYYTHHHRHSD-RATWQTR  91

Query  239   IQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGL  418
             I++ QI ++G+  + PD  L  G +L YHR PW+EP  P  +  ++EDD ++ +NKPSGL
Sbjct  92    IESGQILLNGQPTT-PDTPLVAGQRLSYHRPPWQEPPVPLDIATIYEDDLLLVINKPSGL  150

Query  419   QVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSR  598
              VLPGG F Q T+L QL+                  P+HRLGRGTSGILL AKTK A++ 
Sbjct  151   PVLPGGNFLQHTLLWQLRQHNPTA-----------APIHRLGRGTSGILLIAKTKAARAH  199

Query  599   LSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVIN-EDELVIEQPIGMVRYPGV  775
             LS                  + MR R++ K YR L+    N  D+  I  PIG + YP +
Sbjct  200   LS------------------QQMRQRQLGKTYRTLIGPADNLPDQFTITHPIGKIPYPQL  241

Query  776   AKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPL  955
                +Y A+P+G  A S+  V+  +   + TL++V I +GRPHQIRIHL+ +G+PL+GDPL
Sbjct  242   GY-IYGANPNGLDAHSDCTVVHHR--PDATLLDVSILTGRPHQIRIHLATMGYPLLGDPL  298

Query  956   YIDGGQPMCFDPDLIDESFAQDGGYRRPE-NPVPGDCGYNLHAHKLALPHPITDELIAIN  1132
             YI GG P                    PE   +P DCGY LHAH L+  HP  + +    
Sbjct  299   YIPGGHP-------------------HPEGTAIPSDCGYWLHAHTLSFVHPEGESMTLTC  339

Query  1133  APLPSIL  1153
             AP P +L
Sbjct  340   APPPQLL  346



>ref|WP_002798703.1| RNA pseudouridine synthase [Microcystis aeruginosa]
 emb|CCI28148.1| putative enzyme [Microcystis aeruginosa PCC 9809]
Length=299

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 186/341 (55%), Gaps = 52/341 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D V  + AGL+L+ +Y+ KY +S+P + WL RI +  I ++GR    PD  L 
Sbjct  3     NQGWIYRDKVSKNQAGLSLLAYYTGKYCHSSP-EEWLDRILSAAILVNGRPAC-PDTVLE  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G QL Y R PW EP+ P   EVL+ED +++ + KPSGL VL GG F + T++  +    
Sbjct  61    IGQQLTYQRPPWTEPDVPLFFEVLYEDAEVLVVAKPSGLPVLAGGGFLEHTLIHLVHQHY  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                       +  P P+HRLGRGTSGI+L AK+K A+++LS                  +
Sbjct  121   P---------DVTPYPIHRLGRGTSGIVLMAKSKPARAKLS------------------Q  153

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              MR  KI KIYRALV      D   I Q IG + +P +   +Y A   G  A S+ RVL+
Sbjct  154   QMREGKITKIYRALVGQGDIPDNFTINQAIGKIAHP-ILGHVYGALTDGLSARSDGRVLK  212

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             +    + TL+EV I +GRPHQIRIHL+F G+PLIGDPLY  GG P               
Sbjct  213   KH--PDSTLLEVRIFTGRPHQIRIHLAFFGYPLIGDPLYGLGGLP---------------  255

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                 RP+  VPGDCGY LHA+++   HP T   I I+   P
Sbjct  256   ----RPDA-VPGDCGYYLHANQIVFNHPSTGRTIPISCQPP  291



>ref|WP_015234542.1| RluA family pseudouridine synthase [Deinococcus peraridilitoris]
 ref|YP_007179998.1| RluA family pseudouridine synthase [Deinococcus peraridilitoris 
DSM 19664]
 gb|AFZ66232.1| pseudouridine synthase, RluA family [Deinococcus peraridilitoris 
DSM 19664]
Length=302

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/349 (39%), Positives = 186/349 (53%), Gaps = 52/349 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y + +     G + + + S +Y +S+P Q W +R+   ++ +DGR  +    +L 
Sbjct  4     NQGYAYREQLNGQATGQSTLHYLSARYPHSSPSQ-WQERLDRGEVLLDGRP-ARAHETLR  61

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G  LV+HR PW+E  AP   EVLFEDD ++A+NKP GL  LPG  + + T+L  ++ R 
Sbjct  62    AGQILVWHRPPWQEHKAPRHYEVLFEDDVLLAVNKPGGLPTLPGAGYLENTLLQLVRART  121

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                         H  P+HRLGR TSG++L A+T  A ++LS  + D              
Sbjct  122   -----------PHAAPLHRLGRATSGLVLFARTPQAAAQLSRAWRD--------------  156

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
                 R I KIYRAL SGV   +   I  PIG V +P +   ++ ASP GK A S  R LE
Sbjct  157   ----RAIQKIYRALASGVAEHECYDIHAPIGPVPHPRLGT-VHAASPDGKAARSVARPLE  211

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R+   + TL EV+I +GRPHQIRIHL+ +GHPL GDPLY  GG P    P L        
Sbjct  212   RRA--DTTLFEVDIHTGRPHQIRIHLACVGHPLQGDPLYGTGGLPGSQHPGL--------  261

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                       PGD GY LHA +L L HP++   + + AP P+ L+ + E
Sbjct  262   ----------PGDAGYLLHAEQLILRHPMSGATLHLRAPAPAGLRLTSE  300



>ref|WP_014266545.1| RNA pseudouridine synthase [Granulicella mallensis]
 ref|YP_005058701.1| RluA family pseudouridine synthase [Granulicella mallensis MP5ACTX8]
 gb|AEU37671.1| pseudouridine synthase, RluA family [Granulicella mallensis MP5ACTX8]
Length=298

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 183/343 (53%), Gaps = 52/343 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y  ++     G TL+   +  Y +S  LQ W Q + + ++T++G +++    S+
Sbjct  2     LNRGYAYTTIIGSKSRGQTLLSHLASLYPHST-LQAWQQNLDSGEVTLNG-IIATGSESV  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G  LV+ R PW EP++P   EVL +D  ++A+NKPSGL  LPGG F + T+L  +Q +
Sbjct  60    TLGQTLVWERPPWIEPDSPQHFEVLLDDSHLLAVNKPSGLPTLPGGGFMENTLLRLVQKQ  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                          +  PVHRLGR T+GI+L AKT  A S+LSA +               
Sbjct  120   -----------NPNANPVHRLGRATTGIVLFAKTPQAASQLSANW---------------  153

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   +I KIYRAL  GV  +D   I  PIG+V +P +   ++ ASPSGKP+ S  +V+
Sbjct  154   ---NTSRIQKIYRALAQGVAQQDAYEILTPIGLVPHPLIGS-VWAASPSGKPSKSLAKVI  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R    + T  EV + SGRP QIRIHL+ IGHPL+GDPLY   GQP+   P L       
Sbjct  210   SRTT--STTTFEVSLHSGRPQQIRIHLASIGHPLVGDPLYGLNGQPLEDRPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
                        PGD GY LHA  L   HPIT E I + A LPS
Sbjct  261   -----------PGDGGYFLHAQFLRFHHPITGEQITLEAALPS  292



>ref|WP_034418839.1| pseudouridine synthase [Deinococcus frigens]
Length=299

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/352 (37%), Positives = 190/352 (54%), Gaps = 56/352 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG  Y + + P  AG+ ++ + + +Y++S P + W  R++  ++ +DG     P+  L
Sbjct  2     LNDGHAYAEHIGPRGAGVGVLAYLAGRYRHSTPEE-WQGRLERGEVVLDGVTAGGPEV-L  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ--  472
               G  L+++R PW E   P   EVL+ED +++A++KPSGL  +P G F + T+L  ++  
Sbjct  60    RTGQTLIWNRPPWPEDAVPLHFEVLYEDAELLAVSKPSGLPTVPAGGFLKHTLLALVRKT  119

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             W                 P+HRLGRGTSG++L ++T  A + LS  + +G          
Sbjct  120   W-------------PEASPLHRLGRGTSGLVLFSRTAQAGAALSRDWREG----------  156

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                     ++ K YRAL  GV+ +DE  I  PIG V +P + + +Y ASP GKP+ S  R
Sbjct  157   --------RVHKTYRALAQGVVGQDEYTITTPIGPVPHPRLGE-VYAASPDGKPSRSTAR  207

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+  +  TL EV I +GRPHQIRIHL+ IG PL+GDPLY  GG P+   P L     
Sbjct  208   VLERRDAQ--TLFEVCIDTGRPHQIRIHLASIGRPLVGDPLYGAGGLPLVHLPGL-----  260

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                          PGD GY LHA +L   HP++ + + + A  P  LK + E
Sbjct  261   -------------PGDGGYPLHAQRLGFVHPVSGQAMTLEAQPPGELKRAGE  299



>ref|WP_034386068.1| pseudouridine synthase [Deinococcus sp. YIM 77859]
Length=301

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 191/350 (55%), Gaps = 52/350 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G TY + +     GLT++ + +R Y +SA  + W  R++  ++ +DGR+V  P+  L
Sbjct  3     LNNGYTYREELGRRAQGLTVLAYLTRHYPHSAE-EDWRARLERGEVRLDGRLVHGPEG-L  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L + R PW+E + P   +++  D  ++A+ KPSGL  LPGG F + T+L  +Q  
Sbjct  61    RPGQILEWRRPPWEEEDVPLRYDLVHRDAALLAVAKPSGLPTLPGGGFLRHTLLALVQAE  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                             P+HRLGRGTSG++L A+   A S L+                  
Sbjct  121   FPAAR-----------PLHRLGRGTSGLVLFARCPQAASVLA------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                R   + K YRAL SG++ ++E VI  PIG V +P +   ++ A+ +GKP+ S  RVL
Sbjct  152   RAWREHAVQKQYRALASGIVVKEEYVITTPIGPVPHPRLGT-VFAANAAGKPSRSVARVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+     TL+ V+I +GRPHQIRIHL+ +GHPL+GDPLY  GG P              
Sbjct  211   ERRPATGETLLRVDIHTGRPHQIRIHLASVGHPLVGDPLYGPGGLP--------------  256

Query  1019  DGGYRRPENP-VPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQ  1165
                  RPE P +PGD GY LHA +L   HP+T E +++ AP P  L+ ++
Sbjct  257   -----RPELPGLPGDGGYRLHAERLTFTHPLTGERLSLEAPPPPELRGTR  301



>ref|WP_011687503.1| RNA pseudouridine synthase [Candidatus Solibacter usitatus]
 ref|YP_827055.1| RluA family pseudouridine synthase [Candidatus Solibacter usitatus 
Ellin6076]
 gb|ABJ86770.1| pseudouridine synthase, RluA family [Candidatus Solibacter usitatus 
Ellin6076]
Length=304

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 182/351 (52%), Gaps = 52/351 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y  ++     G TL+   +  Y +S   + W Q + N ++T++G V +    S+
Sbjct  2     LNRGYAYTTIISSKYPGQTLLSHLASLYPHSTS-EAWQQNLNNGEVTLNG-VAATGSESV  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L+++R PW EP+ P   EVLFED  ++A+NKPSGL  LPGG F + T+L  +Q  
Sbjct  60    RSGQILIWNRPPWIEPDVPKHFEVLFEDPHLLAVNKPSGLPTLPGGGFLENTLLRLVQKH  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                 +           PVHRLGR TSGI+L A+T  A S L               ++N 
Sbjct  120   TPNAN-----------PVHRLGRATSGIVLFARTPQAASNL---------------FANW  153

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                ++R   KIYRAL   +   D   I  PIG+V +P +   ++ A+PSGKP+ S  +V+
Sbjct  154   NTPKIR---KIYRALAQNIAQHDAYEILTPIGLVPHPRIGS-VWAANPSGKPSKSLAKVI  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R    + T  EV + SGRPHQIRIHL+ IGHPL+GDPLY   GQP+   P L       
Sbjct  210   SRST--STTTFEVSLNSGRPHQIRIHLASIGHPLVGDPLYGLTGQPLENLPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
                        PGD GY LHA  L   HPIT E I + A LPS   + Q+ 
Sbjct  261   -----------PGDGGYFLHAQFLQFQHPITGEQINLEAALPSGFSSHQQV  300



>ref|WP_027479905.1| pseudouridine synthase [Deinococcus radiodurans]
Length=304

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 192/352 (55%), Gaps = 56/352 (16%)
 Frame = +2

Query  101   GEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVS  280
             G P    N G  Y   ++    G  +++F ++++++S     W  R+   ++T+DG  V 
Sbjct  3     GTPTSTLNSGYAYRTTLQ--RGGQRVLDFLAQEFRHSDRAT-WAARLAAGEVTVDGLTVR  59

Query  281   NPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVL  460
               D +L PG  LV+ R PW EP+AP   +V++ED D++A++KPSGL  +PGG F + T+L
Sbjct  60    G-DETLRPGQMLVWQRPPWAEPDAPLHFDVIYEDADLLAVSKPSGLPTMPGGGFLEHTLL  118

Query  461   TQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQE  640
              Q++ R    S           P+HRLGRGTSG++L + T  A + L             
Sbjct  119   HQVRGRWPDAS-----------PLHRLGRGTSGLVLFSLTSQAGAAL-------------  154

Query  641   KRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPAL  820
                  L+  R  ++ K+YRAL +GV  +DE  I  PIG V +P + + ++ AS +GK A 
Sbjct  155   -----LKDWRAGRVQKVYRALSAGVAEQDEYDITVPIGPVAHPRLGQ-VFAASTAGKTAH  208

Query  821   SNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLI  1000
             S  RVLER+  ++ TL EVEI +GRPHQIRIHL+ +G PL  DPLY+ GG P        
Sbjct  209   SRARVLERR--EDTTLFEVEIFTGRPHQIRIHLASLGLPLAVDPLYVSGGLP--------  258

Query  1001  DESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                        RP+  +PGD GY LHA  L   HP     + ++AP P++L 
Sbjct  259   -----------RPDA-LPGDLGYALHASTLTFQHPAHGAALTLSAPAPTLLS  298



>gb|AIE75346.1| Ribosomal large subunit pseudouridine synthase D [Synechocystis 
sp. PCC 6714]
Length=309

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 133/353 (38%), Positives = 188/353 (53%), Gaps = 49/353 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FN G  Y D+V    +G T+++FYS++Y +S   Q W +RI++ QI +DG  V      L
Sbjct  5     FNKGWLYTDVVTAKGSGQTVLDFYSQRYTHSD-RQTWQERIESGQIQVDGHSVKT-SHPL  62

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L Y R PW EP  P  L +L+ D+D+ A++KP+GL VLPGG F   TVL QL+ +
Sbjct  63    QLGQTLTYWRSPWAEPEVPLQLPILYRDEDLWAIDKPAGLPVLPGGDFVYNTVLEQLKIQ  122

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +    P+HRLG GTSG+LL  ++ LA+  LS  F +             
Sbjct  123   YP---------QESLFPLHRLGTGTSGLLLLGRSPLARQELSRQFRE-------------  160

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
              V R     KIYR L+      ++    Q IG + YP +   +Y A+P+GK + S  ++L
Sbjct  161   HVCR-----KIYRTLIGPCTLPEQFECHQAIGKIPYPQLGY-IYAATPNGKESHSYGKIL  214

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R  +K  T +EVEI +GRPHQIRIHL+ +G+PL+GD LY  GG P+             
Sbjct  215   ARSADK--TWLEVEITTGRPHQIRIHLASLGYPLLGDRLYGPGGVPIV------------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC*K  1177
                  R     P D GY LH+H+L   HP + + + + APLPS L  S++  K
Sbjct  261   -----RATTARPSDGGYILHSHQLGFIHPRSHQKLTLTAPLPSDLTFSRQMAK  308



>ref|WP_015133700.1| RluA family pseudouridine synthase [Leptolyngbya sp. PCC 7376]
 ref|YP_007070764.1| RluA family pseudouridine synthase [Leptolyngbya sp. PCC 7376]
 gb|AFY37930.1| pseudouridine synthase, RluA family [Leptolyngbya sp. PCC 7376]
Length=303

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/335 (38%), Positives = 188/335 (56%), Gaps = 48/335 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y+D ++P D GL +++FY++ Y++S   + W  R+  +QI +DG   + P+  L
Sbjct  2     LNQGWIYYDRLKPKDIGLKVLDFYTQNYRHST-REEWGDRLLAQQIFVDGEP-AQPNQIL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
                 +L YHR PW EP+AP   E+L E+ D + ++KPSGL VLPGG F + T+L QL+  
Sbjct  60    KKNQRLEYHRAPWDEPDAPLDYEILHEEADFLIIDKPSGLPVLPGGFFLENTLLHQLR--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                     +  +  P+P+HRLGRGTSG+++ A++ +AK  LS                  
Sbjct  118   -------KNFPDETPIPIHRLGRGTSGLMILARSPVAKKNLS------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + +R+ +I KIY AL+      D + I  PIG V +P +   ++ A P GK + S + VL
Sbjct  153   QQLRLHQIKKIYHALILAGDYPDHVTITTPIGKVPHP-ILGSIHAAHPEGKYSHSEMTVL  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP-MCFDPDLIDESFA  1015
              R  E   +LV ++I++GRPHQIRIH++ IG PL+GDPLY  GG P +  DP        
Sbjct  212   RR--EPKTSLVAMDIKTGRPHQIRIHVAAIGFPLVGDPLYDVGGIPKIPADPT-------  262

Query  1016  QDGGYRRPENPVPGDCGYNLHAHKLALPHPITDEL  1120
                     +  +PGD GY+L A +L   HP T E+
Sbjct  263   --------QTALPGDLGYSLRAMELKFRHPQTSEI  289



>ref|XP_010937817.1| PREDICTED: RNA pseudouridine synthase 5 isoform X2 [Elaeis guineensis]
Length=231

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = +2

Query  671   VRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQV  850
             +R+I K YR LV+G+I  +E+VI+QPIG++ YPGVA GLYVAS SGKPA+S V VL+R +
Sbjct  38    MRRISKFYRTLVTGLIENNEVVIKQPIGVMHYPGVANGLYVASSSGKPAMSKVYVLKRDL  97

Query  851   EKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGY  1030
             ++N TLV+VEI SGRPHQIRIHL+ I HPL+GDPLY  GG P  F+PD  D+ FA+DGGY
Sbjct  98    QRNQTLVQVEIHSGRPHQIRIHLASIDHPLLGDPLYGIGGCPKPFEPDPRDDDFAEDGGY  157

Query  1031  RRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
              +P   VPGD GY LHAH+L L H  T E++ I APLP IL+  +E
Sbjct  158   LKPVQSVPGDSGYFLHAHQLVLHHLTTHEMVEITAPLPLILQTQEE  203



>ref|WP_030006609.1| pseudouridine synthase [Synechococcus sp. NKBG042902]
Length=303

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/341 (36%), Positives = 190/341 (56%), Gaps = 46/341 (13%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D V+PS AGL++++FY + Y++S   Q W +R +N+QI +DG+  +     L
Sbjct  2     LNQGWVYRDRVKPSQAGLSVLDFYGQFYRHST-RQEWAERFENQQIFVDGKPATA-TQRL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             +   +L YHR PW+EP+ P   ++L +D     ++KP+GL VLP G F + T+L QL+  
Sbjct  60    AKNQRLEYHRPPWEEPDVPLNFQILHQDLHFWIIDKPAGLPVLPAGNFLENTLLAQLK--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +  PVP+HRLGRGTSG+++  ++ L +  L+                  
Sbjct  118   -------RQFPDETPVPIHRLGRGTSGLMILGRSPLGRQSLT------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               +R  +I KIYRA++      D++ I  PIG + +P +   ++ A+  G  A S +RVL
Sbjct  153   RQLREHQITKIYRAVIPAGDYPDQITITTPIGKICHPSLGT-IFAATADGLSAHSEMRVL  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER  +   + VEV+I +GRPHQIRIH++ +G PL+GD LY+ GG P  +          +
Sbjct  212   ERLAK--VSRVEVQIFTGRPHQIRIHMAAMGFPLVGDRLYLPGGLPAIY----------K  259

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPL  1141
             D  +    +P+PGDCGY+L+A+ L   HP  D+ I   + L
Sbjct  260   DANH----SPLPGDCGYSLNAYYLKFQHPHQDKPIDFFSQL  296



>ref|WP_010888319.1| RNA pseudouridine synthase [Deinococcus radiodurans]
 ref|NP_295407.1| pseudouridine synthase [Deinococcus radiodurans R1]
 gb|AAF11241.1|AE002010_4 pseudouridine synthase, putative [Deinococcus radiodurans R1]
Length=321

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/361 (37%), Positives = 195/361 (54%), Gaps = 64/361 (18%)
 Frame = +2

Query  98    FGEPWPE--------FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQ  253
             F  PWP+         N G  Y   ++    G  +++F ++++++S     W  R+   +
Sbjct  11    FPLPWPQMSGTPTSTLNSGYAYRTTLQ--RGGQRVLDFLAQEFRHS-DRATWAARLAAGE  67

Query  254   ITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPG  433
             +T+DG  V   D +L PG  LV+ R PW EP+AP   +V++ED D++A++KPSGL  +PG
Sbjct  68    VTVDGLTVRG-DETLRPGQMLVWQRPPWAEPDAPLHFDVIYEDADLLAVSKPSGLPTMPG  126

Query  434   GLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF  613
             G F + T+L Q++ R    S           P+HRLGRGTSG++L + T  A + L    
Sbjct  127   GGFLEHTLLHQVRGRWPDAS-----------PLHRLGRGTSGLVLFSLTSQAGAAL----  171

Query  614   ADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYV  793
                           L+  R  ++ K+YRAL +GV  +DE  I  PIG V +P + + ++ 
Sbjct  172   --------------LKDWRAGRVQKVYRALSAGVAEQDEYDITVPIGPVAHPRLGQ-VFA  216

Query  794   ASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQ  973
             AS +GK A S  RVLER+  ++ TL EVEI +GRPHQIRIHL+ +G PL  DPLY+ GG 
Sbjct  217   ASTAGKTAHSRARVLERR--EDTTLFEVEIFTGRPHQIRIHLASLGLPLAVDPLYVSGGL  274

Query  974   PMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
             P                   RP+  +PGD GY LHA  L   HP     + ++AP P++L
Sbjct  275   P-------------------RPDA-LPGDLGYALHASTLTFQHPAHGAALTLSAPAPTLL  314

Query  1154  K  1156
              
Sbjct  315   S  315



>ref|WP_036020494.1| pseudouridine synthase [Leptolyngbya sp. PCC 7375]
Length=293

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/329 (39%), Positives = 181/329 (55%), Gaps = 55/329 (17%)
 Frame = +2

Query  173   TLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNA  352
             T++++Y+  +++S     W  RI++ QI ++G+  + PD  L  G +L YHR PW+EP  
Sbjct  17    TILDYYTHHHRHSD-RATWQTRIESGQILLNGQPTT-PDTPLVAGQRLSYHRPPWQEPPV  74

Query  353   PYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPV  532
             P  +  ++EDD ++ +NKPSGL VLPGG F Q T+L QL+                  P+
Sbjct  75    PLDIATIYEDDLLLVINKPSGLPVLPGGNFLQHTLLWQLRQHNPTA-----------API  123

Query  533   HRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSG  712
             HRLGRGTSGILL AKTK A++ LS                  + MR R++ K YR L+  
Sbjct  124   HRLGRGTSGILLIAKTKAARAHLS------------------QQMRQRQLGKTYRTLIGP  165

Query  713   VIN-EDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQS  889
               N  D+  I  PIG + YP +   +Y A+P+G  A S+  V+  +   + TL++V I +
Sbjct  166   ADNLPDQFTITHPIGKIPYPQLGY-IYGANPNGLDAHSDCTVVHHR--PDATLLDVSILT  222

Query  890   GRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPE-NPVPGDCG  1066
             GRPHQIRIHL+ +G+PL+GDPLYI GG P                    PE   +P DCG
Sbjct  223   GRPHQIRIHLATMGYPLLGDPLYIPGGHP-------------------HPEGTAIPSDCG  263

Query  1067  YNLHAHKLALPHPITDELIAINAPLPSIL  1153
             Y LHAH L+  HP  + +    AP P +L
Sbjct  264   YWLHAHTLSFVHPEGESMTLTCAPPPQLL  292



>ref|WP_039686325.1| pseudouridine synthase [Deinococcus swuensis]
 gb|AIZ46355.1| pseudouridine synthase [Deinococcus swuensis]
Length=303

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 184/350 (53%), Gaps = 56/350 (16%)
 Frame = +2

Query  113   PEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
             P  NDG  Y + + P  AG+ ++ + + +Y +S  ++ W  R++  ++ +DG  V   + 
Sbjct  6     PTLNDGYAYTERIAPRSAGVGVLAYLAGRYGHST-VEEWQARLRRGEVVLDGVTVQGTEI  64

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLT--Q  466
              L  G  LV+HR PW E   P    VL ED  ++A+ KPSGL  +P G F   T+LT  +
Sbjct  65    -LRTGQTLVWHRPPWPEEAVPLHFAVLHEDAAVLAVFKPSGLPTVPAGGFLNHTLLTLVR  123

Query  467   LQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKR  646
              QW                 P+HRLGRGTSG++L A T  A + LS  +           
Sbjct  124   RQW-------------PQASPLHRLGRGTSGLVLFALTPQAGAALSRDW-----------  159

Query  647   YSNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSN  826
                    R  ++ K+YRAL  GV  ++   I  PIG V +P + + +Y AS  GKP+ S 
Sbjct  160   -------RENRVQKVYRALAQGVAEQERYAITTPIGPVPHPTLGE-VYAASAGGKPSHST  211

Query  827   VRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDE  1006
              +VLER+ ++  TL EV+I +GRPHQIRIHL+ IGHPL+GDPLY  GG P+   P L   
Sbjct  212   AQVLERRSDR--TLFEVDIHTGRPHQIRIHLASIGHPLVGDPLYGPGGLPLGELPGL---  266

Query  1007  SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                            PGD GY LHA++L   HP+T + + + AP P  L 
Sbjct  267   ---------------PGDSGYLLHAYRLGFVHPVTGQQMTLEAPAPDELN  301



>ref|WP_011699724.1| RNA pseudouridine synthase [Syntrophobacter fumaroxidans]
 ref|YP_846994.1| RluA family pseudouridine synthase [Syntrophobacter fumaroxidans 
MPOB]
 gb|ABK18559.1| pseudouridine synthase, RluA family [Syntrophobacter fumaroxidans 
MPOB]
Length=300

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/333 (38%), Positives = 180/333 (54%), Gaps = 52/333 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + +    AGLT+ E+ +  Y++S+  + W+ R++N ++ +DGR        L
Sbjct  3     LNQGYEYRERIDARGAGLTVREYLAAAYRHSSEAE-WMARLENGEVCLDGRRARG-SVVL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L + R PW+EP+ P    VL  D+D++A+ KP GL  +P G F   T+L  ++ R
Sbjct  61    KPGQWLAWRRPPWEEPDVPLAYAVLHADEDLLAVAKPRGLPTVPAGGFLDNTLLALVR-R  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             A   +           PVHRLGRGTSGI+L A+T  A+S L+A                 
Sbjct  120   ACPEA----------TPVHRLGRGTSGIVLLARTARARSVLAA-----------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               +R  ++ + YRAL  GV   D   +  PIG V +P +   ++ A+PSG+PALS V VL
Sbjct  153   -ALRRNEVTRTYRALAGGVPGRDAFTVGSPIGPVPHP-LLGSVHAANPSGRPALSLVEVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+    C++V V I++GRPHQIRIHL+  GHPL+GDPLY  GG        +++   A 
Sbjct  211   ERRT--GCSVVGVRIKTGRPHQIRIHLACAGHPLVGDPLYAPGGM-------IVEGGCA-  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDE  1117
                       +PGD GY LHA  L L HP T E
Sbjct  261   ----------LPGDPGYLLHAESLRLLHPATGE  283



>dbj|BAM50701.1| hypothetical protein BEST7613_1770 [Synechocystis sp. PCC 6803]
Length=317

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 183/345 (53%), Gaps = 52/345 (15%)
 Frame = +2

Query  113   PEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
             P+ N G  Y D V P  AG T+++FYS++Y +S   Q W +RI+  QI +DG+ V +P  
Sbjct  6     PKPNQGWIYTDRVNPKAAGQTVLDFYSQRYLHSE-RQAWQERIEQGQIEVDGKTV-DPTY  63

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L  G  L Y R PW EP  P  L VL  D+D+ A++KPSGL VLPGG F   TVL QL+
Sbjct  64    PLQAGQTLTYWRSPWVEPEVPLQLSVLHRDEDLWAIDKPSGLPVLPGGDFVYHTVLEQLK  123

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
              +  + S           P+HRLG GTSG+LL  ++ L +  LS  F +           
Sbjct  124   IQYPQESL---------FPLHRLGTGTSGLLLLGRSTLGRRELSRQFRE-----------  163

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                + R     KIYR ++      ++    Q IG + YP +   +Y AS  GKPA S  R
Sbjct  164   --HICR-----KIYRTVIGPCDLPEKFECHQAIGKIPYPQLGY-IYAASSHGKPAQSYGR  215

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPM-CFDPDLIDES  1009
             +L R  EK  T +EVEI++GRPHQIRIHL+ +G+PL+GD LY  GG P+ C         
Sbjct  216   ILARSPEK--TWLEVEIRTGRPHQIRIHLASLGYPLLGDRLYGPGGVPINC---------  264

Query  1010  FAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                           P D GY LH+++L   H  T + I + APLP
Sbjct  265   ----------RTARPSDGGYTLHSYQLGFLHLHTQQAIKLTAPLP  299



>ref|WP_013555281.1| RNA pseudouridine synthase [Deinococcus maricopensis]
 ref|YP_004169441.1| RluA family pseudouridine synthase [Deinococcus maricopensis 
DSM 21211]
 gb|ADV65776.1| pseudouridine synthase, RluA family [Deinococcus maricopensis 
DSM 21211]
Length=318

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 189/352 (54%), Gaps = 56/352 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G  Y + + P   G   + +   KY++S+  Q W +R+   ++T+DG  +   +  L
Sbjct  21    LNEGYAYREQLGPRAHGQRSLWYLVSKYRHSS-AQDWRERVARGEVTLDGAPIDGHEI-L  78

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  LV++R PW E   P   ++ + DD ++A+ KPSGL  + GG F + T+L+ ++  
Sbjct  79    QAGQVLVWNRPPWDEEATPRTFDIAYLDDALLAVIKPSGLPTMHGGGFLENTLLSLVR--  136

Query  479   AsklsslsssGESHP--VPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
                          HP   P+HRLGR TSG++L A+T  A SRLS                
Sbjct  137   -----------AQHPEATPLHRLGRATSGLVLFARTHAAASRLS----------------  169

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
               E  R+  + K YRAL SGV+ +D + IE PIG V +P +   ++  S +GK + S   
Sbjct  170   --EAWRMHHVEKRYRALASGVLAQDRVTIEAPIGPVPHPRLGT-VHGVSATGKASRSVAC  226

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+  ++ TL++V+I +GRPHQIRIH +F+GHPL+GDPLY  GGQP   +P L     
Sbjct  227   VLERR--EDATLLQVDIFTGRPHQIRIHTAFLGHPLVGDPLYGPGGQPKADNPGL-----  279

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                          PGD GY LHA +LA  HP+T   + + AP P  L+ + E
Sbjct  280   -------------PGDGGYLLHAERLAFTHPVTGAPLDVYAPAPPALRCAGE  318



>ref|WP_006455298.1| RNA pseudouridine synthase [Synechococcus sp. PCC 7335]
 gb|EDX85551.1| pseudouridine synthase, RluA family [Synechococcus sp. PCC 7335]
Length=328

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 137/357 (38%), Positives = 190/357 (53%), Gaps = 43/357 (12%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY D V  +  G T+++FY+++Y++S     W  RI+ +QI +DG   +  +  L
Sbjct  2     LNQGWTYLDKVPAAAVGQTVLDFYTQRYRHSK-RAVWKARIETEQILLDGDR-TQENTLL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L Y R PW+EP  P   +VL+ED+D+  +NKP+GL VLP G F + T+L QL+ R
Sbjct  60    KLGQILSYARSPWEEPAVPLDFDVLYEDEDLWVINKPAGLPVLPSGGFLEHTLLYQLRVR  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                        +    PVHRLGRGTSG +L AK+ +AK +LS  F   ++ +      N 
Sbjct  120   YR---------DCQSAPVHRLGRGTSGAMLIAKSHIAKVQLSEQFRKRSANLSSNTTPN-  169

Query  659   EVMRVRKIIKIYRALVSGVINE---DELVIEQPIGMVRYP------GVAKGLYVASPSGK  811
                    + K YRAL++    +   D  +   PIG + +       G  +  +    +  
Sbjct  170   -TASTCTLGKTYRALIAPTTPDQLRDRFICTYPIGKLPHTRLGYIYGHLRDAHSHEKTIG  228

Query  812   PALSNVRVLERQV---EKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
             P  S V   E  V     + TLVE+ IQ+GRPHQIRIHL+  G+PL+GDPLY  GG P  
Sbjct  229   PINSMVSRSEGSVLRRRAHSTLVEITIQTGRPHQIRIHLAAAGYPLLGDPLYSAGGVP--  286

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
              DP           GY      +PGDCGY+LHAH+L   HP T + IAI AP P+IL
Sbjct  287   -DPH----------GY-----ALPGDCGYHLHAHRLQFAHPRTGQSIAITAPPPAIL  327



>ref|WP_029482221.1| pseudouridine synthase [Deinococcus marmoris]
Length=301

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/348 (37%), Positives = 190/348 (55%), Gaps = 52/348 (15%)
 Frame = +2

Query  113   PEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
             P  NDG  Y + + P  AGL+++ + + +Y++S   Q W +R+   ++ +DG V +    
Sbjct  4     PTLNDGYAYAERIGPRGAGLSVLAYLAGRYEHSTQ-QEWQERLARGEVVLDG-VTAQGSE  61

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L  G +L++HR PW E   P   EVL+ED +++A+ KPSGL  +P G F + T+LT ++
Sbjct  62    ILRTGQRLIWHRPPWPEDAVPLHFEVLYEDTELLAVCKPSGLPTIPAGGFLKHTLLTLVR  121

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
              R  + S           P+HRLGRGTSG++L ++T  A + LS  + +G          
Sbjct  122   ERWPEAS-----------PLHRLGRGTSGLVLFSRTAQAGAALSRDWREG----------  160

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                     ++ K YRAL  GV  +DE  I  PIG V +P +   +Y ASP+GKP+ S  R
Sbjct  161   --------RVQKTYRALGQGVAAQDEYEITTPIGPVPHPQLGD-VYAASPNGKPSHSTAR  211

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+   +CTL +V+I +GRPHQIRIHL+ IG PL+GDPLY                  
Sbjct  212   VLERR--SDCTLFDVDIHTGRPHQIRIHLASIGQPLVGDPLY------------------  251

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                G        +PGD GY LHAH+L   HP++ + +A+ A  P  L 
Sbjct  252   GAGGLPLPHLPGLPGDGGYMLHAHRLGFVHPLSGQQMAVEAEPPGELN  299



>ref|XP_010910995.1| PREDICTED: RNA pseudouridine synthase 5-like, partial [Elaeis 
guineensis]
Length=148

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVV  277
            FG PWPEFNDGL+Y D+V+     LTLI+FYS KYKNSAPLQGWL RI+N QIT+DG V+
Sbjct  27   FGVPWPEFNDGLSYTDIVQSPSFALTLIDFYSSKYKNSAPLQGWLHRIKNGQITVDGEVI  86

Query  278  SNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTV  457
            ++P   L  G+++VYHRLPWKEP+APYVLEVL+EDDDM+ALNKPSGLQVLPGGLFQQRTV
Sbjct  87   TDPSMVLRDGSKVVYHRLPWKEPSAPYVLEVLYEDDDMVALNKPSGLQVLPGGLFQQRTV  146

Query  458  L  460
            L
Sbjct  147  L  147



>ref|WP_015896040.1| RNA pseudouridine synthase [Acidobacterium capsulatum]
 ref|YP_002753985.1| RluA family pseudouridine synthase [Acidobacterium capsulatum 
ATCC 51196]
 gb|ACO32216.1| pseudouridine synthase, RluA family [Acidobacterium capsulatum 
ATCC 51196]
Length=301

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 185/351 (53%), Gaps = 54/351 (15%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  +   +     G TL+   +  Y +S+  + W QR+ + +IT++G + +    S++
Sbjct  3     NHGYAFTTTIGSKHHGQTLLFHLASLYPHSSA-EVWQQRLSHGEITLNG-ITAQGSESVA  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G  LV++  PW EP+AP   +VLFEDD++IA+NKPSGL  LPG  F + T+L  ++  A
Sbjct  61    AGQVLVWNCPPWTEPDAPLHFDVLFEDDELIAVNKPSGLPTLPGSGFLENTLLRLVRRYA  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                         H  PVHRLGR TSGI+L +KT           A G ++++        
Sbjct  121   -----------PHASPVHRLGRATSGIVLFSKT-----------AQGAALLE-------A  151

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
             +    K+ K+YRA+   V   +E  I  PIG V +P +   ++ AS +GKP+ S+ +VL 
Sbjct  152   IWNTSKVQKVYRAVAVNVAEHEEYEIHTPIGRVPHPRLGS-VWAASSTGKPSWSSAKVLA  210

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R         EV + SGRPHQIRIHL+ +GHPL+GD LY  GG P+   P L        
Sbjct  211   RGTTTTT--FEVTLHSGRPHQIRIHLASVGHPLVGDGLYGPGGLPLADHPGL--------  260

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS--ILKASQE  1168
                       PGD GY LHA  LA  HP +   I++ APLPS   L A QE
Sbjct  261   ----------PGDGGYLLHAQFLAFLHPTSGSQISLEAPLPSEFSLYARQE  301



>ref|WP_013570615.1| RNA pseudouridine synthase [Terriglobus saanensis]
 ref|YP_004184879.1| RluA family pseudouridine synthase [Terriglobus saanensis SP1PR4]
 gb|ADV84885.1| pseudouridine synthase, RluA family [Terriglobus saanensis SP1PR4]
Length=298

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 185/343 (54%), Gaps = 52/343 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y  ++   D G TL+   +  Y +S+P Q W Q + N ++T++G + +  +A L
Sbjct  2     LNRGYAYTTIIGGKDHGQTLLSHLASLYPHSSP-QAWQQNLNNGEVTVNGVIATGSEA-L  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G  LV++R PW EP+AP   EVL +D  ++A+NKP GL  LPGG F + T+L  +Q +
Sbjct  60    TSGQMLVWNRPPWIEPDAPQHFEVLLDDPHLLAVNKPGGLPTLPGGGFMENTLLRLVQKQ  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             +   +           PVHRLGR T+GI+L AKT  A S L+A +               
Sbjct  120   SPDAN-----------PVHRLGRATTGIVLFAKTPQAASNLTADW---------------  153

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   +I KIYRAL  G+ + D   I  PIG+V +P +   ++ A+P GKP+ S  +V+
Sbjct  154   ---NTSRIEKIYRALAQGIADRDAYEILTPIGLVPHPRIGS-VWAANPDGKPSKSLAKVI  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R  +   T  EV + SGRPHQIRIHL+ IGHPL+GDPLY   GQP+   P L       
Sbjct  210   SRTTD--ATTFEVSLGSGRPHQIRIHLASIGHPLVGDPLYGPTGQPLEDLPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
                        PGD GY LHA  L   HPIT E I + A LPS
Sbjct  261   -----------PGDGGYFLHAQFLKFHHPITGERIHLEAALPS  292



>ref|WP_038531674.1| pseudouridine synthase [Synechocystis sp. PCC 6714]
Length=296

 Score =   199 bits (507),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 183/344 (53%), Gaps = 49/344 (14%)
 Frame = +2

Query  146   LVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYH  325
             +V    +G T+++FYS++Y +S   Q W +RI++ QI +DG  V      L  G  L Y 
Sbjct  1     MVTAKGSGQTVLDFYSQRYTHSD-RQTWQERIESGQIQVDGHSVKT-SHPLQLGQTLTYW  58

Query  326   RLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslss  505
             R PW EP  P  L +L+ D+D+ A++KP+GL VLPGG F   TVL QL+ +         
Sbjct  59    RSPWAEPEVPLQLPILYRDEDLWAIDKPAGLPVLPGGDFVYNTVLEQLKIQYP-------  111

Query  506   sGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKII  685
               +    P+HRLG GTSG+LL  ++ LA+  LS  F +              V R     
Sbjct  112   --QESLFPLHRLGTGTSGLLLLGRSPLARQELSRQFRE-------------HVCR-----  151

Query  686   KIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCT  865
             KIYR L+      ++    Q IG + YP +   +Y A+P+GK + S  ++L R  +K  T
Sbjct  152   KIYRTLIGPCTLPEQFECHQAIGKIPYPQLGY-IYAATPNGKESHSYGKILARSADK--T  208

Query  866   LVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPEN  1045
              +EVEI +GRPHQIRIHL+ +G+PL+GD LY  GG P+                  R   
Sbjct  209   WLEVEITTGRPHQIRIHLASLGYPLLGDRLYGPGGVPIV-----------------RATT  251

Query  1046  PVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC*K  1177
               P D GY LH+H+L   HP + + + + APLPS L  S++  K
Sbjct  252   ARPSDGGYILHSHQLGFIHPRSHQKLTLTAPLPSDLTFSRQMAK  295



>gb|KDO36326.1| hypothetical protein CISIN_1g041166mg, partial [Citrus sinensis]
Length=133

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 118/155 (76%), Gaps = 25/155 (16%)
 Frame = +2

Query  170  LTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPN  349
            LTLIEFYS K+KNSAPLQG                          G++LVYHRLPWKEP+
Sbjct  1    LTLIEFYSTKHKNSAPLQG-------------------------AGSELVYHRLPWKEPD  35

Query  350  APYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVP  529
             PY+LEV +EDDD+IALNKPSGLQVLPGGLFQQRTVL QLQWRASK SS  SS  SHPVP
Sbjct  36   VPYLLEVFYEDDDLIALNKPSGLQVLPGGLFQQRTVLKQLQWRASKQSSSLSSQASHPVP  95

Query  530  VHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIV  634
            VHRLGRGTSGILLCAKTKLAK+ ++AYFAD TS+V
Sbjct  96   VHRLGRGTSGILLCAKTKLAKTCIAAYFADKTSVV  130



>ref|WP_017869581.1| MULTISPECIES: hypothetical protein [Deinococcus]
Length=298

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 185/336 (55%), Gaps = 54/336 (16%)
 Frame = +2

Query  164   AGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKE  343
              G+T+++F + ++++S     W  R+   ++ +DG V +  D +L PG  LV+HR PW E
Sbjct  16    GGVTVLDFLAGEFRHSD-RATWAARLAAGEVEVDG-VTAGGDETLRPGQTLVWHRPPWDE  73

Query  344   PNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHP  523
             P  P   +V ++D D++A++KPSGL  +PGG F + T+L +++            G S  
Sbjct  74    PEVPLHFDVPYQDADLLAVSKPSGLPTVPGGGFLEHTLLHRVR--------RDWPGAS--  123

Query  524   VPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRAL  703
              P+HRLGRGTSG++L + T  A + L                  L   R  ++ K+YRAL
Sbjct  124   -PLHRLGRGTSGLVLFSLTPQAGAAL------------------LRDWRGGRVRKVYRAL  164

Query  704   VSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEI  883
              +GV  +DE  +  PIG V +P + + ++ AS +GK + S  RVLER+   + TL+EVEI
Sbjct  165   SAGVAGQDEYDLTAPIGPVPHPRLGE-VFAASRAGKASHSRARVLERR--SDTTLLEVEI  221

Query  884   QSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDC  1063
              +GRPHQIRIHL+  G PL GDPLY+ GG P                   RPE  +PGD 
Sbjct  222   FTGRPHQIRIHLASAGLPLAGDPLYLSGGLP-------------------RPEA-LPGDL  261

Query  1064  GYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
             GY LHA +L L HP +   + + AP P  L  S E 
Sbjct  262   GYRLHAWQLTLTHPRSGAPLRLLAPAPPELSTSAET  297



>ref|WP_014398758.1| RNA pseudouridine synthase [Corallococcus coralloides]
 ref|YP_005371923.1| RluA family pseudouridine synthase [Corallococcus coralloides 
DSM 2259]
 gb|AFE10161.1| RluA family pseudouridine synthase [Corallococcus coralloides 
DSM 2259]
Length=308

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 181/353 (51%), Gaps = 56/353 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG  Y + +  +  G T +   + KY++S   Q W  R    ++ +DG V++  D  L
Sbjct  10    LNDGYVYRERIGATSVGRTALAHLTDKYRHSTEEQ-WRARFVRGEVRLDG-VIATGDEVL  67

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLT--QLQ  472
                 +L +HR PW+E   P   E+++ED  ++A+ KPSGL  LP G F + T+L+  +L+
Sbjct  68    QAHQELCWHRPPWRERETPDSFELVYEDASLLAVIKPSGLPTLPSGGFLKNTLLSFVRLR  127

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             W                  +HRLGR TSG++L ++T+ A ++LS  + +G          
Sbjct  128   W-------------PEASALHRLGRATSGLVLFSRTQEAAAKLSGNWREG----------  164

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                      + K YRAL  GV  +    I  PIG+V +P V   ++ A+  GKP+ S   
Sbjct  165   --------DVEKRYRALSDGVAAQASYDIHTPIGLVPHP-VLGSVHGATAKGKPSHSRAE  215

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+     TL EV I +GRP QIRIHL+ IGHPL GDP++  GG P   +P L     
Sbjct  216   VLERR--DGQTLFEVRIHTGRPEQIRIHLASIGHPLTGDPMFASGGLPREHEPGL-----  268

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
                          PGD GY LHA  LA  HP+T E + ++AP P+ L+ + E 
Sbjct  269   -------------PGDGGYLLHAETLAFTHPLTGERLRLHAPPPAALRMASEA  308



>ref|WP_017304633.1| hypothetical protein [Spirulina subsalsa]
Length=303

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 134/347 (39%), Positives = 181/347 (52%), Gaps = 53/347 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D VRP   G +++++YS+ Y++S+  + W  RI   QI ++    + P   L
Sbjct  3     LNCGWVYRDRVRPEYGGWSVLDYYSQLYRHSS-REVWGDRITQGQIRLNDHP-TTPHTRL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L YHR PW EP AP    +L  D D + + KPSGL VLPG  F ++T+  QLQ  
Sbjct  61    KPGQLLTYHRPPWVEPAAPLNFTLLASDPDFLVVAKPSGLPVLPGAGFLEQTLWFQLQ--  118

Query  479   AsklsslsssGESHP--VPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
                        + +P   P+HRLGRGTSG++L A+T   +  LS     G          
Sbjct  119   -----------QQYPEIAPIHRLGRGTSGVILWARTPQGRQNLSRQLRQG----------  157

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASP-SGKPALSNV  829
                     +++K YRALV    + D L I  PIG V +P +   +Y A+P  G  A S V
Sbjct  158   --------QMVKEYRALVPDWTHGDSLTITHPIGKVPHPTLGT-VYAATPEGGMRAESRV  208

Query  830   RVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYI-DGGQPMCFDPDLIDE  1006
             + L +Q  +   L+ V I +GRPHQIRIHL+ +GHPL GDPLY   GG  +  +P+    
Sbjct  209   QYLGKQ--ETGVLLGVIIPTGRPHQIRIHLATVGHPLKGDPLYQPGGGLNLTINPE----  262

Query  1007  SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
                  G Y      VPGD GY LHAH+L+  HP T E +   AP PS
Sbjct  263   ----TGTYA-----VPGDGGYCLHAHRLSFFHPQTGERLTYQAPPPS  300



>ref|WP_026853933.1| pseudouridine synthase [Geothrix fermentans]
Length=303

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/351 (37%), Positives = 184/351 (52%), Gaps = 55/351 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  + + V    +G+ L+   + ++  + P + W +RIQ   + ++G V + P+A L
Sbjct  3     LNQGFVHREQVGAEGSGVPLVAHLADRHPLAGP-ELWRKRIQEGLVQLEG-VPALPEAVL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLP-GGLFQQRTVLTQLQW  475
               G  + + R PW EP  P    V +ED+D++A+ KPSGL  LP GG F   T+L  ++ 
Sbjct  61    RAGQWITWARPPWVEPEVPLATAVFYEDEDLLAVAKPSGLPTLPAGGAFLDHTLLALVRR  120

Query  476   RAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSN  655
             RA +             P+HRLGR TSG++L A+T  A+  L   F              
Sbjct  121   RAPEA-----------TPMHRLGRATSGLVLFARTAAARGPLQEQF--------------  155

Query  656   LEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRV  835
                 R R++ K+Y  L +G   +D   I  PIG V Y  +   L+ ASP G+ +LS+ RV
Sbjct  156   ----RARQVRKVYLTLCTGSPEQDAFDIATPIGEVPYAPLGL-LHAASPGGRSSLSHARV  210

Query  836   LERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFA  1015
             LER+  + C L+EVEI +GRPHQIRIHL+  GHPL+GDPLY  GG P+            
Sbjct  211   LERR--EGCALMEVEIATGRPHQIRIHLASAGHPLVGDPLYGPGGVPL------------  256

Query  1016  QDGGYRRPEN-PVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQ  1165
                    PE   VPGD GY LHAH+L   HP T   +A+  P P  L++ +
Sbjct  257   -------PETRAVPGDPGYLLHAHRLEFAHPRTGTWLALACPPPPPLRSQR  300



>ref|WP_011555199.1| RNA pseudouridine synthase [Myxococcus xanthus]
 ref|YP_633384.1| RluA family pseudouridine synthase [Myxococcus xanthus DK 1622]
 gb|ABF91513.1| pseudouridine synthase, RluA family [Myxococcus xanthus DK 1622]
Length=303

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/348 (36%), Positives = 187/348 (54%), Gaps = 57/348 (16%)
 Frame = +2

Query  119   FNDGLTYHDLV--RPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
              NDG  Y + +  RP  + L  +   + KY++S+  + W  R    ++ +D  V ++   
Sbjct  5     LNDGYVYREKLGRRPGSSALAHM---TDKYRHSSE-EEWRARFARGEVRLDD-VTADGSE  59

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L PG  L +HR PW+E + P   E+++ED +++ + KPSGL  LP G F + T+L+ +Q
Sbjct  60    PLRPGQWLCWHRPPWEEADTPQSFELVYEDAELVVVVKPSGLPTLPSGGFLKNTLLSFVQ  119

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
              R  +            VP+HRLGR TSG++L  +T+ A +RL++ + +G          
Sbjct  120   ARWPEA-----------VPMHRLGRATSGLVLFTRTRDAAARLASDWREG----------  158

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                     ++ K YRAL  G+  ++   I  PIG+V +P + + ++ AS  GKP+ S  R
Sbjct  159   --------RVHKRYRALSQGLAAQESYDIRAPIGLVPHPRLGE-VHGASARGKPSHSTAR  209

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+ E   TL EV+I +GR  QIRIHL+FIGHPL+GDPL+  GG P+  +P L     
Sbjct  210   VLERRTEH--TLFEVDIHTGRSEQIRIHLAFIGHPLVGDPLFAVGGLPLAENPGL-----  262

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                          PGD GY LHA  L   HP + E + + AP P  L+
Sbjct  263   -------------PGDGGYLLHAESLTFQHPRSGEHVQLQAPAPLELR  297



>ref|WP_026114309.1| pseudouridine synthase [Myxococcus xanthus]
Length=301

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/348 (36%), Positives = 187/348 (54%), Gaps = 57/348 (16%)
 Frame = +2

Query  119   FNDGLTYHDLV--RPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
              NDG  Y + +  RP  + L  +   + KY++S+  + W  R    ++ +D  V ++   
Sbjct  3     LNDGYVYREKLGRRPGSSALAHM---TDKYRHSSE-EEWRARFARGEVRLDD-VTADGSE  57

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L PG  L +HR PW+E + P   E+++ED +++ + KPSGL  LP G F + T+L+ +Q
Sbjct  58    PLRPGQWLCWHRPPWEEADTPQSFELVYEDAELVVVVKPSGLPTLPSGGFLKNTLLSFVQ  117

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
              R  +            VP+HRLGR TSG++L  +T+ A +RL++ + +G          
Sbjct  118   ARWPEA-----------VPMHRLGRATSGLVLFTRTRDAAARLASDWREG----------  156

Query  653   NLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                     ++ K YRAL  G+  ++   I  PIG+V +P + + ++ AS  GKP+ S  R
Sbjct  157   --------RVHKRYRALSQGLAAQESYDIRAPIGLVPHPRLGE-VHGASARGKPSHSTAR  207

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+ E   TL EV+I +GR  QIRIHL+FIGHPL+GDPL+  GG P+  +P L     
Sbjct  208   VLERRTEH--TLFEVDIHTGRSEQIRIHLAFIGHPLVGDPLFAVGGLPLAENPGL-----  260

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                          PGD GY LHA  L   HP + E + + AP P  L+
Sbjct  261   -------------PGDGGYLLHAESLTFQHPRSGEHVQLQAPAPLELR  295



>ref|WP_013941775.1| RNA pseudouridine synthase [Myxococcus fulvus]
 ref|YP_004669772.1| pseudouridine synthase [Myxococcus fulvus HW-1]
 gb|AEI68694.1| pseudouridine synthase [Myxococcus fulvus HW-1]
Length=301

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/346 (36%), Positives = 184/346 (53%), Gaps = 53/346 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG  Y + +     G + +   +  Y++S+  + W  R    ++ +DG VV++    L
Sbjct  3     LNDGYVYREKL-GRQPGRSALAHLTDTYRHSSE-EEWRARFARGEVRLDG-VVADGSEPL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L +HR PW+E + P   E+++ED +++ + KPSGL  LP G F + T+L+ +Q R
Sbjct  60    RPGQWLCWHRPPWEEEDTPRSFELVYEDAELVVVVKPSGLPTLPSGGFLKNTLLSFVQAR  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
               +            VP HRLGR TSG++L  +T+ A +RL+  + +G            
Sbjct  120   WPEA-----------VPRHRLGRATSGLVLFTRTREAAARLARDWREG------------  156

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   ++ K YRAL  G+  ++   I  PIG+V +P + + ++ AS  GKP+ S  RVL
Sbjct  157   ------RVHKRYRALAQGLAAQESYDIRAPIGLVPHPRLGE-VHGASARGKPSHSTARVL  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+ E   TL EV+I +GR  QIRIHL++IGHPL+GDPL+  GG P+  DP L       
Sbjct  210   ERRTEH--TLFEVDIHTGRSEQIRIHLAYIGHPLVGDPLFAVGGLPLAKDPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                        PGD GY LHA  L   HP + E + + AP P  L+
Sbjct  261   -----------PGDGGYLLHAESLTFRHPRSGEQVQLQAPPPPELR  295



>ref|WP_027463159.1| pseudouridine synthase [Deinococcus ficus]
Length=303

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 125/339 (37%), Positives = 181/339 (53%), Gaps = 53/339 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G +Y     PS  G +L++F + ++++S   Q W +R+   ++ + GR  +  +   
Sbjct  3     LNGGYSYRLPFPPSAQGTSLLDFLTAEFRHST-RQVWEERLARGEVEVAGRPATGAEQP-  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  +V+HR PW EP+ P    +L+ED D++A+ KPSGL  LPGG F   T+LT++  R
Sbjct  61    RPGTMVVWHRPPWDEPDVPLDYTLLYEDADLLAVTKPSGLPTLPGGGFLAHTLLTRV--R  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             A    + S        P+HRLGRGTSG +L A+T  A + LSA +               
Sbjct  119   ADLDPAAS--------PLHRLGRGTSGAVLFARTTHAAATLSADW---------------  155

Query  659   EVMRVRKIIKIYRALVSGVINE--DELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                R  ++ K+YRAL +G   +      +  PIG V +P + + ++ A+P+GK A S  R
Sbjct  156   ---RAGRVDKVYRALATGHFPDAGAPTDLRTPIGPVPHPRLGR-VHAATPTGKAAHSRAR  211

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLE     + TL++VEI +GRPHQIRIHL+  GHPL+GDPLY   G P+   P L     
Sbjct  212   VLE--TRADSTLLDVEILTGRPHQIRIHLAAAGHPLVGDPLYGPDGTPLADLPGL-----  264

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAI  1129
                          PGD GY LHAH L   HP+T   + +
Sbjct  265   -------------PGDLGYLLHAHTLHFHHPVTGAAVQV  290



>ref|WP_002637447.1| RNA pseudouridine synthase [Myxococcus sp. (contaminant ex DSM 
436)]
 gb|ERK86512.1| Ribosomal large subunit pseudouridine synthase D protein [Myxococcus 
sp. (contaminant ex DSM 436)]
Length=301

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 186/347 (54%), Gaps = 53/347 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG  Y + +  S  G + +   + KY++S+  + W  R    ++ +D  V ++    L
Sbjct  3     LNDGYVYREKL-GSRPGSSALAHMTDKYRHSSE-EEWRVRFARGEVRLDD-VTADGSEPL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L +HR PW+E + P   E ++ED +++ + KPSGL  LP G F + T+L+ +Q R
Sbjct  60    RPGQWLCWHRPPWEEADTPQSFERVYEDAELVVVVKPSGLPTLPSGGFLKNTLLSFVQER  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
               +            VP+HRLGR TSG++L  +T+ A +RL++ + +G            
Sbjct  120   WPEA-----------VPMHRLGRATSGLVLFTRTRDAAARLASDWREG------------  156

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   ++ K YRAL  G+  ++   I  PIG+V +P + + ++ A+  GKP+ S  RVL
Sbjct  157   ------RVHKRYRALSQGLAAQETYDIRAPIGLVPHPRLGE-VHGATARGKPSHSTARVL  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+ E   TL EV+I +GR  QIRIHL+FIGHPL+GDPL+  GG P+  DP L       
Sbjct  210   ERRSEH--TLFEVDIHTGRSEQIRIHLAFIGHPLVGDPLFAVGGLPLAEDPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKA  1159
                        PGD GY LHA  L   HP + E + + AP P  L++
Sbjct  261   -----------PGDGGYLLHAESLTFVHPRSGEQVQLQAPPPLELRS  296



>ref|WP_022801230.1| RNA pseudouridine synthase [Deinococcus sp. 2009]
Length=305

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 126/351 (36%), Positives = 187/351 (53%), Gaps = 53/351 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G +Y     PS  G +L++F + ++++S   Q W +R+   ++ + GR  +  +   
Sbjct  3     LNGGYSYRLPFPPSAQGTSLLDFLTAEFRHST-RQVWEERLARGEVEVAGRPATGAERP-  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  +V+HR PW EP+ P    +L+ED D++A+ KPSGL  LPGG F   T+LT++  R
Sbjct  61    RPGTMVVWHRPPWDEPDVPLDYTLLYEDADLLAVTKPSGLPTLPGGGFLAHTLLTRV--R  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             A    + S        P+HRLGRGTSG +L A+T  A + LSA +               
Sbjct  119   ADLDPAAS--------PLHRLGRGTSGAVLFARTAHAAATLSADW---------------  155

Query  659   EVMRVRKIIKIYRALVSGVINE--DELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVR  832
                R  ++ K+YRAL +G   +      +   IG V +P + + ++ A+P+GK A S   
Sbjct  156   ---RAGRVDKVYRALAAGHFPDAGAPTDLRTTIGPVPHPRLGR-VHAATPTGKAAHSRAC  211

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLE +   + TL++VEI +GRPHQIRIHL+  GHPL+GDPLY   G P+   P L     
Sbjct  212   VLETRA--DSTLLDVEILTGRPHQIRIHLAAAGHPLVGDPLYGPDGTPLADLPGL-----  264

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQ  1165
                          PGD GY LHAH L   HP+T   + + +P P  L+ ++
Sbjct  265   -------------PGDLGYLLHAHTLHFHHPVTGAAVQVVSPPPPALRPAE  302



>ref|WP_005031786.1| RNA pseudouridine synthase [Holophaga foetida]
Length=293

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 176/320 (55%), Gaps = 54/320 (17%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G TY + +     G  L+++ S +Y ++ P   W +RIQ   + IDGR + +P   L 
Sbjct  3     NQGCTYTEQILLRSDGCALLDYLSGRYLHT-PEGEWRERIQAGLVRIDGRSM-DPGTPLK  60

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
              G  L + R PW+EP  P    V++ED D++A+ KPSGL  LPG  F + T+L Q++ R 
Sbjct  61    QGQILTWSRPPWEEPEVPLDYGVIYEDADLVAVAKPSGLPTLPGAGFLEHTLLHQVRLRF  120

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                            P+HRLGR TSGI++ A++  A+  LS                  +
Sbjct  121   PGAD-----------PIHRLGRTTSGIVVFARSPGARKSLS------------------Q  151

Query  662   VMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLE  841
              +R  K++K+YRALV+G    D   ++ PIG + +P +   L+  SP+GKPA+S+VRVLE
Sbjct  152   ALREHKLVKVYRALVTGWPELDAFTVDAPIGPLPHPLLGT-LHGPSPAGKPAVSHVRVLE  210

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R+  ++ +LVEV I++GRPHQIRIH++  GHPL+GDPLY  GG    F P          
Sbjct  211   RR--EDASLVEVHIETGRPHQIRIHMAVCGHPLVGDPLYGPGG---VFLP----------  255

Query  1022  GGYRRPENPVPGDCGYNLHA  1081
                      VPGD GY LHA
Sbjct  256   -------GAVPGDGGYLLHA  268



>ref|WP_024545511.1| pseudouridine synthase [Synechococcus sp. NKBG15041c]
Length=301

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/335 (35%), Positives = 182/335 (54%), Gaps = 46/335 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D V+P+ AGL++++FY++ Y++S   + W  RI  +QI +DG+        L
Sbjct  2     LNQGWVYRDRVKPAWAGLSVLDFYAQNYRHSTRPE-WAARIDKQQIFVDGKPALW-GQIL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             +    L YHR PW+EP+ P    +L +D     + KP+GL V+P G F + T+L QL+  
Sbjct  60    AANQTLEYHREPWEEPDVPLNFSILHQDPHFWIIEKPAGLPVMPAGNFLENTLLGQLK--  117

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                    +   + +  P+HRLGRGTSG+++  ++ L K  L+                  
Sbjct  118   -------TQFPQENLAPIHRLGRGTSGLMILGRSPLGKQHLT------------------  152

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             + +R  +I KIYRAL+      D++ I+ PIG V +  +   ++VA   G  A S ++VL
Sbjct  153   QQLREHQITKIYRALIPAGDYPDQVTIKTPIGKVAHLTLGT-IFVAKADGLFAHSEMQVL  211

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R    + +LV+V+I +GRPHQIRIH++ IG+PL+GDPLY+ GG P   + D        
Sbjct  212   QR--FNDLSLVQVQIFTGRPHQIRIHMAAIGYPLVGDPLYLPGGLPKVANGD--------  261

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELI  1123
                       +PGDCGY L+AH L   HP   +++
Sbjct  262   ------QRTALPGDCGYFLNAHYLQFMHPSGQQVV  290



>ref|WP_011131407.1| pseudouridine synthase [Prochlorococcus marinus]
 ref|NP_895867.1| pseudouridine synthase [Prochlorococcus marinus str. MIT 9313]
 emb|CAE22216.1| Pseudouridine synthase [Prochlorococcus marinus str. MIT 9313]
Length=338

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 186/367 (51%), Gaps = 61/367 (17%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDAS  295
              FN G TY   +   DAG  L+E  +  Y +S+    W QR+Q  QI ++G +V   D  
Sbjct  16    SFNHGWTYSQRIAAVDAGRGLVELLAVHYTHSSR-DVWQQRLQAGQIRLNGELV-RLDQL  73

Query  296   LSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQW  475
             L+ G Q+ + R PW E   P   EV+F+D D++ +NKPSGL V+PGG F   T+   LQ 
Sbjct  74    LASGDQVCWQRPPWLEAAVPASWEVIFDDGDLLVVNKPSGLPVIPGGGFLDHTLTGLLQR  133

Query  476   RAsklsslsssGESH-PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             R          GES  P PVHRLGR TSG+L+CA+ +  +++LSA F   T+  Q  +  
Sbjct  134   RC------QLDGESRLPRPVHRLGRFTSGLLICARQRETRAKLSAMFRRATAGDQGCK--  185

Query  653   NLEVMRVRKIIKIYRALVSGVIN---EDELVIEQPIGMVRYPGVAKGLYVASPSGK----  811
                        KIYRAL    +N   ++   I  PI    +P V K ++VA+ S +    
Sbjct  186   -----------KIYRALAHRNLNVHCDEVATIRVPIVQTAHPMVGK-VWVAADSSRQHDS  233

Query  812   --------PALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
                      ALS VR+LER+  ++  L+EV IQ+GRPHQIRIHL+ IG PLIGDPLY   
Sbjct  234   KQSESRVLTALSTVRLLERR--QDADLLEVAIQTGRPHQIRIHLAAIGSPLIGDPLYGFD  291

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             GQ                          PGD GY LHAH+L L  P  + L    A  P 
Sbjct  292   GQI--------------------SSAATPGDGGYCLHAHRL-LDVPYRNRLHGFTACSPR  330

Query  1148  ILKASQE  1168
              L+   E
Sbjct  331   CLQMKTE  337



>ref|WP_013580605.1| RNA pseudouridine synthase [Granulicella tundricola]
 ref|YP_004218069.1| pseudouridine synthase [Granulicella tundricola MP5ACTX9]
 gb|ADW69289.1| pseudouridine synthase, RluA family [Granulicella tundricola 
MP5ACTX9]
Length=297

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 176/343 (51%), Gaps = 52/343 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y  ++     G TL+   +  Y +S+  + W + + N ++T+DG   +  +  L
Sbjct  2     LNRGYAYTTIIGSKQHGWTLLSHLAGLYPHSSA-EAWQENLDNGEVTLDGITAAGSEL-L  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             S G  LV+ R  W EP+AP   EVLF+D  ++A+NKPSGL  LPGG F + T+L  +   
Sbjct  60    SSGQILVWKRPAWIEPDAPQHFEVLFDDLHLLAVNKPSGLPTLPGGGFLENTLLRLVHRH  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
             +   +           PVHRLGR T+GI++ AKT  A + L+A +               
Sbjct  120   SPSAN-----------PVHRLGRATTGIVMFAKTAQAAAGLTADW---------------  153

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                   ++ KIYRAL  GV  ++   I  PIG+V +P +   ++ AS  GK + S+ +V+
Sbjct  154   ---NTPRVQKIYRALAQGVARQEAYEILTPIGLVPHPRLGS-VWAASAGGKASKSSAKVI  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R      T  EV + SGRPHQIRIHL+ IGHPL+GDPLY   G P+   P L       
Sbjct  210   SRTAA--TTTFEVRLGSGRPHQIRIHLASIGHPLVGDPLYGSTGLPLDDLPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
                        PGD GY LHA  L   HP+T E I + A LPS
Sbjct  261   -----------PGDGGYLLHAQFLKFHHPVTGEQIELEAALPS  292



>ref|WP_011531341.1| RNA pseudouridine synthase [Deinococcus geothermalis]
 ref|YP_605689.1| pseudouridine synthase [Deinococcus geothermalis DSM 11300]
 gb|ABF46520.1| Pseudouridine synthase, RluD [Deinococcus geothermalis DSM 11300]
Length=301

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 184/351 (52%), Gaps = 52/351 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG TY + +     GLTL+ + +R Y +S+    W  R++  ++ +DG     P+ +L
Sbjct  3     LNDGYTYREELGRRACGLTLLAYLTRHYLHSSE-SDWQARLERGEVCLDGLPAYGPE-TL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L +HR PW+E +AP    V++ D  ++A+ KPSGL  LPGG F + T+L Q++  
Sbjct  61    RPGQVLEWHRPPWEEEDAPLDFAVVYRDAALLAVAKPSGLPTLPGGGFLKHTLLAQVR--  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                      +      P+HRLGRGTSG++L A+T  A + L+                  
Sbjct  119   ---------TDFPEARPLHRLGRGTSGLVLFARTHEAGAILA------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                RVR + K YRAL  G   ++E  I  PIG V +P +   ++ AS +GK A S   VL
Sbjct  152   RAWRVRAVQKRYRALAVGTPLQEEYAITTPIGPVPHPRLGS-VFAASAAGKAASSLAHVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+      L  V+I +GRPHQIRIHL+ IGHPL+GDPLY  GG P    P L       
Sbjct  211   ERRA--ATALFAVDIHTGRPHQIRIHLAAIGHPLVGDPLYASGGLPRADLPGL-------  261

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
                        PGD GY LHA +L   HP+T E +++ AP P  L+ + E 
Sbjct  262   -----------PGDLGYLLHAERLTFLHPLTGERLSLKAPPPPELRRADET  301



>ref|WP_011140187.1| RNA pseudouridine synthase [Gloeobacter violaceus]
 ref|NP_923129.1| pseudouridine synthase [Gloeobacter violaceus PCC 7421]
 dbj|BAC88124.1| gll0183 [Gloeobacter violaceus PCC 7421]
Length=314

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 134/344 (39%), Positives = 189/344 (55%), Gaps = 52/344 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY D + P  AGLT++E+Y  +Y++S   + W  RI+  Q+ +D R  S+ +  L
Sbjct  17    MNQGWTYCDRIGPESAGLTVLEYYLLRYRHSGDHE-WQARIETGQVLLDHRSTSSTEL-L  74

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
                  L Y R PW+EP+ P  + +++ D+ ++ + KP GL VLPGG F + T+L Q++ R
Sbjct  75    RSAQVLTYCRPPWQEPSVPLDIVIIYADEQVLVVAKPGGLPVLPGGGFLEHTLLWQVRRR  134

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                      +GE  PVP+HRLGRGTSG++L A+T  +++ LS                  
Sbjct  135   --------FAGEEPPVPIHRLGRGTSGLVLLARTHSSRAALS------------------  168

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
             E MR ++I K+YRAL SG    D   I QPIG V +P +   L+ A+  G PA S+  VL
Sbjct  169   EQMRRQRIGKLYRALASGTGMRDRFTIRQPIGKVPHPLLGT-LWAAAADGLPARSDCVVL  227

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              RQ     +L+ V I +GRPHQIRIHL+  G+PL+GDPL         F P         
Sbjct  228   RRQCTD--SLLAVAISTGRPHQIRIHLAAAGYPLVGDPL---------FGP---------  267

Query  1019  DGGYRRPEN--PVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
              GG  R +N   VPGD GY LHAH+L+  HP +   + +  P P
Sbjct  268   -GGVARLDNDASVPGDGGYFLHAHRLSFLHPTSGRRLVLECPPP  310



>ref|WP_027892639.1| pseudouridine synthase [Meiothermus chliarophilus]
Length=304

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 122/342 (36%), Positives = 179/342 (52%), Gaps = 52/342 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FN G +Y + +     G T++ + +R+Y++S+P Q W  R+   ++ +DG V    +  L
Sbjct  3     FNRGYSYREELDRRALGHTVLSYLARRYRHSSP-QEWEARLARGEVWLDGAVAGGGE-PL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  LV+HR PW+E  AP    ++++D+ ++A+NKPSGL  +P G F   T+L+ ++ R
Sbjct  61    RPGQTLVWHRPPWEEEPAPRHYGIVYQDEAILAVNKPSGLPTVPAGGFLHNTLLSLVRER  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                 +           PVHRLGRGTSG++L A    A SRL   +A              
Sbjct  121   FPGAN-----------PVHRLGRGTSGLVLFALEGAAASRLGRAWAG-------------  156

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                  R++ K YRAL SG   +D   I+ PIG V +P +   +Y A+P+GKP+ S   VL
Sbjct  157   -----REVEKTYRALASGAAAQDRYAIDAPIGPVPHPRLGT-VYAANPTGKPSHSVAWVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+ E   T+  V I +GRPHQIRIHL+ +GHPL+GDPLY  G                 
Sbjct  211   ERRPE--ATVFAVRILTGRPHQIRIHLATLGHPLVGDPLY--GAGGQPLPGLPGLPGDGG  266

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
                             Y LHA +L  PHP++ E + + AP+P
Sbjct  267   ----------------YWLHAERLVFPHPVSGEELVLEAPVP  292



>ref|XP_007220366.1| hypothetical protein PRUPE_ppa016984mg, partial [Prunus persica]
 gb|EMJ21565.1| hypothetical protein PRUPE_ppa016984mg, partial [Prunus persica]
Length=130

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  188  YSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLE  367
            YS KYKNSAPLQGWLQRI+N QIT+DG VV +P   L  G++LVYHRLPW+EP+APY+L 
Sbjct  1    YSSKYKNSAPLQGWLQRIRNGQITVDGEVVRDPSTILRVGSELVYHRLPWREPDAPYLLG  60

Query  368  VLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVHRLGR  547
            VL+EDDDMIALNKPSGLQVLPGGLFQQRTVLTQL   A+   S  S  E HPVPVHRLGR
Sbjct  61   VLYEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLLCWATNKISPLSCQEPHPVPVHRLGR  120

Query  548  GTSGI  562
            GTSGI
Sbjct  121  GTSGI  125



>ref|WP_011827290.1| pseudouridine synthase [Prochlorococcus marinus]
 ref|YP_001018712.1| pseudouridine synthase [Prochlorococcus marinus str. MIT 9303]
 gb|ABM79447.1| Pseudouridine synthase [Prochlorococcus marinus str. MIT 9303]
Length=338

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 186/367 (51%), Gaps = 61/367 (17%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDAS  295
              FN G TY   +   DAG  L+E  +  Y +S+    W QR+Q  QI ++G +V   D  
Sbjct  16    SFNHGWTYSQRIAAVDAGRGLVELLAVHYTHSSR-DVWQQRLQAGQIRLNGELV-RLDQL  73

Query  296   LSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQW  475
             L+ G Q+ + R PW E   P   EV+F+D D++ +NKPSGL V+PGG F   T+   LQ 
Sbjct  74    LASGDQVCWQRPPWLEAAVPASWEVIFDDGDLLVVNKPSGLPVIPGGGFLDHTLTGLLQR  133

Query  476   RAsklsslsssGESH-PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             R          GES  P PVHRLGR TSG+L+CA+ +  +++LSA F   T+  Q  +  
Sbjct  134   RC------QLDGESRLPRPVHRLGRFTSGLLICARQRETRAKLSAMFRRATAGDQGCK--  185

Query  653   NLEVMRVRKIIKIYRALVSGVIN---EDELVIEQPIGMVRYPGVAKGLYVASPSGK----  811
                        KIYRAL    +N   ++   I  PI    +P V K ++VA+ S +    
Sbjct  186   -----------KIYRALAHRNLNVHCDEVATIRVPIVQTAHPMVGK-VWVAADSSRQHDS  233

Query  812   --------PALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
                      ALS VR+LER+  ++  L+EV IQ+GRPHQIRIHL+ IG PLIGDPLY   
Sbjct  234   KQSESRVLTALSTVRLLERR--QDADLLEVAIQTGRPHQIRIHLAAIGSPLIGDPLYGFD  291

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             GQ                          PGD GY LHAH+L +  P  + L    A  P 
Sbjct  292   GQI--------------------SSAATPGDGGYCLHAHRL-VDVPYRNRLHGFTACSPR  330

Query  1148  ILKASQE  1168
              L+   E
Sbjct  331   RLQMKTE  337



>ref|WP_012307762.1| RNA pseudouridine synthase [Synechococcus sp. PCC 7002]
 ref|YP_001735398.1| putative pseudouridine synthase [Synechococcus sp. PCC 7002]
 gb|ACB00143.1| putative pseudouridine synthase [Synechococcus sp. PCC 7002]
Length=282

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 177/315 (56%), Gaps = 46/315 (15%)
 Frame = +2

Query  179   IEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPY  358
             ++FY+  Y++S   Q W +R++N+QI +DG+  +     L+   +L YHR PW+EP+ P 
Sbjct  1     MDFYAEFYRHST-RQEWAKRLENQQIFVDGKPATA-TQRLAKNQRLEYHRPPWEEPDVPL  58

Query  359   VLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVHR  538
               ++L +D     ++KP+GL VLP G F + T+L QL+ +           +  PVP+HR
Sbjct  59    NFQILHQDPHFWIIDKPAGLPVLPAGNFLENTLLAQLKRQFP---------DETPVPIHR  109

Query  539   LGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGVI  718
             LGRGTSG+++  ++ L +  L+                    +R  +I KIYRA++    
Sbjct  110   LGRGTSGLMILGRSPLGRQSLT------------------RQLREHQITKIYRAVIPAGD  151

Query  719   NEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRP  898
               D++ I  PIG + +P +   ++ A+  G  A S +RVLER  +   + VEV+I +GRP
Sbjct  152   YPDQITITTPIGKIFHPSLGT-IFAATADGLSAHSEMRVLERLAK--VSRVEVQIFTGRP  208

Query  899   HQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLH  1078
             HQIRIH++ +G PL+GD LY+ GG P  ++          D  +    +P+PGDCGY+L+
Sbjct  209   HQIRIHMAAMGFPLVGDRLYLPGGLPAIYE----------DANH----SPLPGDCGYSLN  254

Query  1079  AHKLALPHPITDELI  1123
             A+ L   HP  D+ I
Sbjct  255   AYYLKFQHPHQDKPI  269



>ref|WP_010871616.1| RNA pseudouridine synthase [Synechocystis sp. PCC 6803]
 ref|NP_440308.1| hypothetical protein slr1592 [Synechocystis sp. PCC 6803]
 ref|YP_005382174.1| hypothetical protein SYNGTI_0412 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005385344.1| hypothetical protein SYNPCCP_0412 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005408051.1| hypothetical protein SYNPCCN_0412 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005650365.1| hypothetical protein SYNGTS_0412 [Synechocystis sp. PCC 6803]
 ref|YP_007450191.1| hypothetical protein MYO_14170 [Synechocystis sp. PCC 6803]
 sp|P72970.1|Y1592_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine synthase slr1592; 
AltName: Full=RNA pseudouridylate synthase; AltName: Full=RNA-uridine 
isomerase [Synechocystis sp. PCC 6803 substr. 
Kazusa]
 dbj|BAA16988.1| slr1592 [Synechocystis sp. PCC 6803]
 dbj|BAK49160.1| hypothetical protein SYNGTS_0412 [Synechocystis sp. PCC 6803]
 dbj|BAL28159.1| hypothetical protein SYNGTI_0412 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31329.1| hypothetical protein SYNPCCN_0412 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34498.1| hypothetical protein SYNPCCP_0412 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 gb|AGF50677.1| hypothetical protein MYO_14170 [Synechocystis sp. PCC 6803]
Length=291

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/324 (39%), Positives = 172/324 (53%), Gaps = 52/324 (16%)
 Frame = +2

Query  176   LIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAP  355
             +++FYS++Y +S   Q W +RI+  QI +DG+ V +P   L  G  L Y R PW EP  P
Sbjct  1     MLDFYSQRYLHSE-RQAWQERIEQGQIEVDGKTV-DPTYPLQAGQTLTYWRSPWVEPEVP  58

Query  356   YVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGESHPVPVH  535
               L VL  D+D+ A++KPSGL VLPGG F   TVL QL+ +  + S           P+H
Sbjct  59    LQLSVLHRDEDLWAIDKPSGLPVLPGGDFVYHTVLEQLKIQYPQESL---------FPLH  109

Query  536   RLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRALVSGV  715
             RLG GTSG+LL  ++ L +  LS  F +              + R     KIYR ++   
Sbjct  110   RLGTGTSGLLLLGRSTLGRRELSRQFRE-------------HICR-----KIYRTVIGPC  151

Query  716   INEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGR  895
                ++    Q IG + YP +   +Y AS  GKPA S  R+L R  EK  T +EVEI++GR
Sbjct  152   DLPEKFECHQAIGKIPYPQLGY-IYAASSHGKPAQSYGRILARSPEK--TWLEVEIRTGR  208

Query  896   PHQIRIHLSFIGHPLIGDPLYIDGGQPM-CFDPDLIDESFAQDGGYRRPENPVPGDCGYN  1072
             PHQIRIHL+ +G+PL+GD LY  GG P+ C                       P D GY 
Sbjct  209   PHQIRIHLASLGYPLLGDRLYGPGGVPINC-------------------RTARPSDGGYT  249

Query  1073  LHAHKLALPHPITDELIAINAPLP  1144
             LH+++L   H  T + I + APLP
Sbjct  250   LHSYQLGFLHLHTQQAIKLTAPLP  273



>gb|KGG27122.1| Pseudouridine synthase [Prochlorococcus sp. MIT 0701]
 gb|KGG28912.1| Pseudouridine synthase [Prochlorococcus sp. MIT 0702]
 gb|KGG37156.1| Pseudouridine synthase [Prochlorococcus sp. MIT 0703]
Length=332

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 186/367 (51%), Gaps = 61/367 (17%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDAS  295
              FN G TY   +   DAG  L+E  +  Y +S+    W QR+Q  QI ++G +V   D  
Sbjct  10    SFNHGWTYSQRIAAVDAGRGLVELLAVHYTHSSR-DVWQQRLQAGQIRLNGELV-RLDQL  67

Query  296   LSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQW  475
             L+ G Q+ + R PW E   P   EV+F+D D++ +NKPSGL V+PGG F   T+   LQ 
Sbjct  68    LASGDQVSWQRPPWLEAAVPASWEVIFDDGDLLVVNKPSGLPVIPGGGFLDHTLTGLLQR  127

Query  476   RAsklsslsssGESH-PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             R         +GES  P PVHRLGR TSG+L+CA+ +  +++LSA F   T+  Q  +  
Sbjct  128   RC------QLAGESQVPRPVHRLGRFTSGLLICARQRETRAKLSAMFRRATAGDQGCK--  179

Query  653   NLEVMRVRKIIKIYRALVSGVIN---EDELVIEQPIGMVRYPGVAKGLYVASPSG-----  808
                        KIYRAL    +N   ++   I  PI    +P V + ++VA+ S      
Sbjct  180   -----------KIYRALAHRNLNVHCDEVATIRVPIVQTAHPMVGQ-VWVAADSSLQHDS  227

Query  809   -------KPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
                      ALS VR+LER+ + +  L+EV IQ+GRPHQIRIHL+ IG PLIGDPLY   
Sbjct  228   KQSESRVLTALSTVRLLERRSDAD--LLEVAIQTGRPHQIRIHLAAIGSPLIGDPLYGFD  285

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             GQ                          PGD GY LHAH+L L  P  + L    A  P 
Sbjct  286   GQI--------------------SSAATPGDGGYCLHAHRL-LDVPYRNHLHGFTACSPR  324

Query  1148  ILKASQE  1168
              L+   E
Sbjct  325   HLQMETE  331



>ref|WP_036912972.1| MULTISPECIES: pseudouridine synthase [Prochlorococcus]
Length=338

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/367 (38%), Positives = 186/367 (51%), Gaps = 61/367 (17%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDAS  295
              FN G TY   +   DAG  L+E  +  Y +S+    W QR+Q  QI ++G +V   D  
Sbjct  16    SFNHGWTYSQRIAAVDAGRGLVELLAVHYTHSSR-DVWQQRLQAGQIRLNGELV-RLDQL  73

Query  296   LSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQW  475
             L+ G Q+ + R PW E   P   EV+F+D D++ +NKPSGL V+PGG F   T+   LQ 
Sbjct  74    LASGDQVSWQRPPWLEAAVPASWEVIFDDGDLLVVNKPSGLPVIPGGGFLDHTLTGLLQR  133

Query  476   RAsklsslsssGESH-PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
             R         +GES  P PVHRLGR TSG+L+CA+ +  +++LSA F   T+  Q  +  
Sbjct  134   RC------QLAGESQVPRPVHRLGRFTSGLLICARQRETRAKLSAMFRRATAGDQGCK--  185

Query  653   NLEVMRVRKIIKIYRALVSGVIN---EDELVIEQPIGMVRYPGVAKGLYVASPSG-----  808
                        KIYRAL    +N   ++   I  PI    +P V + ++VA+ S      
Sbjct  186   -----------KIYRALAHRNLNVHCDEVATIRVPIVQTAHPMVGQ-VWVAADSSLQHDS  233

Query  809   -------KPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
                      ALS VR+LER+ + +  L+EV IQ+GRPHQIRIHL+ IG PLIGDPLY   
Sbjct  234   KQSESRVLTALSTVRLLERRSDAD--LLEVAIQTGRPHQIRIHLAAIGSPLIGDPLYGFD  291

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
             GQ                          PGD GY LHAH+L L  P  + L    A  P 
Sbjct  292   GQI--------------------SSAATPGDGGYCLHAHRL-LDVPYRNHLHGFTACSPR  330

Query  1148  ILKASQE  1168
              L+   E
Sbjct  331   HLQMETE  337



>gb|KFA86731.1| pseudouridine synthase [Cystobacter violaceus Cb vi76]
Length=305

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 125/352 (36%), Positives = 187/352 (53%), Gaps = 56/352 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N+G  Y + +     G + + +    Y++S P   W +R+   +I ++  + +  +  L
Sbjct  3     LNEGYAYREQLGARARGQSTLSYLIDSYRHS-PEAVWRERLARGEILLED-LPATGEERL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  LV++R PW+E +AP    ++ ED+ ++A+ KP GL ++PGG F   T+L  ++ R
Sbjct  61    KPGQWLVWNRPPWEEQDAPRDYSIVHEDEALLAVLKPGGLPMMPGGNFLANTLLGVVRER  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
               + S           P+HRLGRGTSG++L ++T  A ++LS                  
Sbjct  121   FPEAS-----------PLHRLGRGTSGLVLFSRTYDAAAKLS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYP--GVAKGLYVASPSGKPALSNVR  832
                R  ++ K YRAL SGV  E+   I  PIGMV +P  G+  G+   SP G+ + S  R
Sbjct  152   RAWREHEVDKRYRALSSGVATEEHYDITAPIGMVAHPRLGLTHGV---SPDGRASRSLAR  208

Query  833   VLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESF  1012
             VLER+     TL EV+I +GRP QIRIHL+ IGHPL GDPLY  GG P+  +P L     
Sbjct  209   VLERRT--ASTLFEVDILTGRPQQIRIHLAAIGHPLEGDPLYGAGGVPLAGEPGL-----  261

Query  1013  AQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                          PGD GY LHA +L+  HP++ E + ++AP+P  L+   E
Sbjct  262   -------------PGDLGYLLHAERLSFVHPLSGERLVLHAPVPPELRWEGE  300



>gb|ABF95377.1| pseudouridine synthase family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=208

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = +2

Query  296  LSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ-  472
            L  G++LVYHRLPW+EP AP++L+VL+EDDDMIALNKPSGLQVLP GLFQQRTVL QLQ 
Sbjct  3    LREGSKLVYHRLPWQEPFAPHLLDVLYEDDDMIALNKPSGLQVLPKGLFQQRTVLAQLQL  62

Query  473  --WRA-sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEK  643
              W+  S   S     +SHPVPVHRLGRGTSG+LLCAKTKLAK++L+AYFA+G +   + 
Sbjct  63   KDWKMPSSFCSKRKDAQSHPVPVHRLGRGTSGLLLCAKTKLAKAQLAAYFAEGATNAGKS  122

Query  644  RYSNLEVMRVRKIIKIYRALVSGVINEDELVIEQP  748
            R    ++ + RKI K YRALV+G++  DE++   P
Sbjct  123  R-DETDICKARKISKFYRALVTGILENDEVLTFPP  156



>ref|WP_034404242.1| pseudouridine synthase [Deinococcus sp. RL]
 gb|KEF34491.1| pseudouridine synthase [Deinococcus sp. RL]
Length=307

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 177/350 (51%), Gaps = 52/350 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  + + V     GL+++ +  R + +S     W  R+   ++ +DG+     +  L
Sbjct  3     LNSGHVHRERVPAWARGLSVLAYLVRAHGHSDEAT-WRSRLAAGEVRLDGKTAHGGE-EL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L +HR PW+E   P    V+ ED  ++A+ KPSGL  LPGG F + T+LT ++ R
Sbjct  61    RPGGHLDWHRPPWEEEAVPLDFAVVHEDAALLAVAKPSGLPTLPGGGFLEGTLLTGVRRR  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                             P+HRLGRGTSG++L A                  +  E   +  
Sbjct  121   WPGAR-----------PLHRLGRGTSGLVLFA------------------LTPEAAAALA  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                R  ++ K YRAL +G  + +E  +  P+G V +P +   +Y AS  GKP+LS  RVL
Sbjct  152   RAWRAGEVGKGYRALGAGHPDWEERALTTPVGPVPHPRLGT-VYAASAFGKPSLSVARVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+     TL EV++ +GRPHQIRIHL+  GHPL+GDPLY  GG P   DP L       
Sbjct  211   ERR--SGATLFEVDLHTGRPHQIRIHLAAAGHPLLGDPLYAPGGLPRPDDPAL-------  261

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                        PGD GY LHA +L L HP+T E + + A  P+ L+ + E
Sbjct  262   -----------PGDLGYLLHAERLTLAHPLTGERLTLRAGPPAALRRAGE  300



>ref|WP_027460263.1| pseudouridine synthase [Deinococcus murrayi]
Length=307

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 123/350 (35%), Positives = 177/350 (51%), Gaps = 52/350 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  + + V     GL+++ +  R + +S     W  R+   ++ +DG+     +  L
Sbjct  3     LNSGHVHRERVPAWARGLSVLAYLVRAHGHSDEAT-WRSRLAAGEVRLDGKTAHGGE-EL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG  L +HR PW+E   P    V+ ED  ++A+ KPSGL  LPGG F + T+LT ++ R
Sbjct  61    RPGGHLDWHRPPWEEEAVPLDFAVVHEDAALLAVAKPSGLPTLPGGGFLEGTLLTGVRRR  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                             P+HRLGRGTSG++L A                  +  E   +  
Sbjct  121   WPGAR-----------PLHRLGRGTSGLVLFA------------------LTPEAAAALA  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                R  ++ K YRAL +G  + +E  +  P+G V +P +   +Y AS  GKP+LS  RVL
Sbjct  152   RAWRAGEVGKGYRALGAGHPDWEERALTTPVGPVPHPRLGT-VYAASAFGKPSLSVARVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             ER+     TL EV++ +GRPHQIRIHL+  GHPL+GDPLY  GG P   +P L       
Sbjct  211   ERR--SGATLFEVDLHTGRPHQIRIHLAAAGHPLLGDPLYAPGGLPRADNPGL-------  261

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                        PGD GY LHA +L L HP+T E + + A  P+ L+ + E
Sbjct  262   -----------PGDLGYLLHAERLTLAHPLTGERLTLRAGPPAALRRAGE  300



>ref|WP_019010972.1| hypothetical protein [Deinococcus aquatilis]
Length=332

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 126/345 (37%), Positives = 185/345 (54%), Gaps = 52/345 (15%)
 Frame = +2

Query  137   YHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQL  316
             Y D +  +  G T++ + + +Y++S        R+   ++T+DG+     +  L  G  L
Sbjct  39    YRDQIGAAGQGQTVLAYLTGRYRHSDAATW-AARLAAGEVTLDGQTTHGTE-RLRQGQAL  96

Query  317   VYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklss  496
             ++ R PW E  AP    VL+ED+ ++A+ KPSGL  LPGG F + T+LTQ++ +  +   
Sbjct  97    IWSRPPWHEEPAPLEFRVLYEDESLLAVAKPSGLPTLPGGGFLEHTLLTQVRKQFPEA--  154

Query  497   lsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVR  676
                       P+HRLGRGTSG++LC++T+ A S +                  L   R  
Sbjct  155   ---------TPLHRLGRGTSGLVLCSRTRAAASGV------------------LRSWREH  187

Query  677   KIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEK  856
             +I K YRAL SG+ ++D   I  PIG V +P +   +Y AS  GKP+LS  RVLER+   
Sbjct  188   EIQKTYRALASGLSSQDSYRISTPIGPVPHP-LLGSVYAASAVGKPSLSVARVLERR--P  244

Query  857   NCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQDGGYRR  1036
             + TL EVEI +GRPHQIRIHL+ IG PL+GDPLY          PD +            
Sbjct  245   DSTLFEVEIHTGRPHQIRIHLASIGLPLVGDPLY---------GPDGLPLPQLPG-----  290

Query  1037  PENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQEC  1171
                 +PGD GY LH+ +LA  HP +   + ++AP P IL+  ++ 
Sbjct  291   ----LPGDGGYWLHSARLAFTHPASGAWLELSAPAPDILQNGRDS  331



>gb|EAQ76692.1| Pseudouridine synthase [Synechococcus sp. WH 5701]
Length=328

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 133/360 (37%), Positives = 192/360 (53%), Gaps = 48/360 (13%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLI--EFYSRKYKNSA-PLQGWLQRIQNKQITIDGRVVSNP  286
             +FN G TY D V  + A + ++   F + +Y++SA PL  W QR+Q  +I ++GR +   
Sbjct  4     QFNQGWTYSDRVSQAQAQVPVLISVFLAERYRHSAAPL--WRQRLQEGEILLNGRRLDG-  60

Query  287   DASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQ  466
             D  L  G +L + R PW+E   P    V+ +D D+  ++KPSGL VLP G F + T+L  
Sbjct  61    DGPLHAGDRLQWQRPPWREEAVPARWRVIHDDGDLYVIDKPSGLPVLPAGGFLEHTLLRL  120

Query  467   LQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTS--IVQE  640
             L+         S + ++ P PVHRLGR TSG+L+CA+   +++ LSA   + T+  + Q 
Sbjct  121   LE--------RSCAAQALPRPVHRLGRHTSGLLVCARRPQSRAWLSARLRESTAQLLNQP  172

Query  641   KRYSNLEVMRVRKIIKIYRALVS----GVINEDELVIEQPIGMVRYPGVAKGLYVAS---  799
                +     R     K+YRAL       +   + L I  PIG   + G+ + ++ A    
Sbjct  173   GSEARSAATRAGACRKVYRALTVPAPLQLAPGESLAITTPIGRRPHAGLGQ-IWAADGPD  231

Query  800   -PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
              P   PA S +R+LER+ + +  LVEV I +GRPHQIRIHL+  G PL+GDPLY  GG+P
Sbjct  232   DPGALPAWSEMRLLERRPQGH--LVEVSIHTGRPHQIRIHLASAGVPLLGDPLYRPGGEP  289

Query  977   MCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                                RP   +PGD GY LHAH+L LP P    L  + AP+P  L 
Sbjct  290   -------------------RP-GALPGDGGYLLHAHRLRLPLPAGGWL-DLEAPVPPELS  328



>ref|WP_037981177.1| pseudouridine synthase [Synechococcus sp. WH 5701]
Length=337

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 133/360 (37%), Positives = 192/360 (53%), Gaps = 48/360 (13%)
 Frame = +2

Query  116   EFNDGLTYHDLVRPSDAGLTLI--EFYSRKYKNSA-PLQGWLQRIQNKQITIDGRVVSNP  286
             +FN G TY D V  + A + ++   F + +Y++SA PL  W QR+Q  +I ++GR +   
Sbjct  13    QFNQGWTYSDRVSQAQAQVPVLISVFLAERYRHSAAPL--WRQRLQEGEILLNGRRLDG-  69

Query  287   DASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQ  466
             D  L  G +L + R PW+E   P    V+ +D D+  ++KPSGL VLP G F + T+L  
Sbjct  70    DGPLHAGDRLQWQRPPWREEAVPARWRVIHDDGDLYVIDKPSGLPVLPAGGFLEHTLLRL  129

Query  467   LQWRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTS--IVQE  640
             L+         S + ++ P PVHRLGR TSG+L+CA+   +++ LSA   + T+  + Q 
Sbjct  130   LE--------RSCAAQALPRPVHRLGRHTSGLLVCARRPQSRAWLSARLRESTAQLLNQP  181

Query  641   KRYSNLEVMRVRKIIKIYRALVS----GVINEDELVIEQPIGMVRYPGVAKGLYVAS---  799
                +     R     K+YRAL       +   + L I  PIG   + G+ + ++ A    
Sbjct  182   GSEARSAATRAGACRKVYRALTVPAPLQLAPGESLAITTPIGRRPHAGLGQ-IWAADGPD  240

Query  800   -PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
              P   PA S +R+LER+ + +  LVEV I +GRPHQIRIHL+  G PL+GDPLY  GG+P
Sbjct  241   DPGALPAWSEMRLLERRPQGH--LVEVSIHTGRPHQIRIHLASAGVPLLGDPLYRPGGEP  298

Query  977   MCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                                RP   +PGD GY LHAH+L LP P    L  + AP+P  L 
Sbjct  299   -------------------RP-GALPGDGGYLLHAHRLRLPLPAGGWL-DLEAPVPPELS  337



>ref|WP_002614167.1| RNA pseudouridine synthase [Stigmatella aurantiaca]
 ref|YP_003953511.1| pseudouridine synthase [Stigmatella aurantiaca DW4/3-1]
 gb|EAU66315.1| ribosomal large subunit pseudouridine synthase D [Stigmatella 
aurantiaca DW4/3-1]
 gb|ADO71684.1| Pseudouridine synthase, RluA family [Stigmatella aurantiaca DW4/3-1]
Length=298

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 124/346 (36%), Positives = 183/346 (53%), Gaps = 54/346 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FN G  Y + +     G + + +    Y++S P   W +R+   ++ +D  + +  +  L
Sbjct  3     FNTGYAYREQLGVRARGQSTLSYLVASYRHS-PEPVWRERLARGEVLLDD-LPATGEELL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              PG +LV++R PW+E   P    +++ D+ ++A++KP GL  +PGG F   T+L  ++ R
Sbjct  61    KPGQRLVWNRPPWEEKETPRDYTLVYADEAILAVDKPGGLPTMPGGGFLVNTLLHVVRER  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
               ++S           P+HRLGRGTSG++L A+T  A ++LS                  
Sbjct  121   FPEVS-----------PLHRLGRGTSGLVLFARTHDAAAKLS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLY-VASPSGKPALSNVRV  835
                R  ++ K YRAL S V ++D   I  PIG   +PG  +GL  +A PSGK + S  RV
Sbjct  152   RAWREHEVEKRYRALSSHVASQDAYDITAPIGEAVHPG--RGLLSMALPSGKASRSLARV  209

Query  836   LERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFA  1015
             L+R+     TL EV+IQ+GR  QIRIHL+FIGHPL GDP+Y  GG P    P L+     
Sbjct  210   LQRRA--ASTLFEVDIQTGRSQQIRIHLAFIGHPLEGDPVYTVGGVPRAEQPGLL-----  262

Query  1016  QDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSIL  1153
                          GD GY LHA +L   HP+T E + ++A LPS L
Sbjct  263   -------------GDTGYLLHAERLCFVHPLTGERLELHATLPSEL  295



>ref|WP_010313395.1| pseudouridine synthase [Synechococcus sp. CB0205]
Length=318

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 188/359 (52%), Gaps = 60/359 (17%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y D V+   A  + + +Y+ +Y +S P   W +R+   +I  +G+ +   DA+L
Sbjct  10    LNRGHRYRDRVQ--AAAQSTVGYYAERYGHSDP-SVWRERLAAGEIWCNGQQL-RADAAL  65

Query  299   SPGAQLVYHRLPWKEPNAPYVLE--VLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
             + G QL++HR PW+E   P + +  V+F+D D++ LNKPSGL VLP G F + T+LTQLQ
Sbjct  66    AAGDQLIWHRPPWEEAAVPVLSQRAVVFDDGDLLVLNKPSGLPVLPAGGFLEHTLLTQLQ  125

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYS  652
               A +             PVHRLGR TSG+L+CA+ +  + +LSA   + T+     R  
Sbjct  126   TWAPEAR-----------PVHRLGRFTSGLLVCARQRETRGQLSAQLRESTAASAASR--  172

Query  653   NLEVMRVRKIIKIYRALVSGVINE----DELVIEQPIGMVRYPGVAKGLYVASPSGKPAL  820
                       +K+YRAL   +  +    +   I  PIG   +  + +    A P    AL
Sbjct  173   --------GCLKVYRALTEPLAADWRCGESRAITVPIGRRPHALLGQLWCAALPGDSSAL  224

Query  821   ---SNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDP  991
                S + +LER+ E+   LVE+EI +GRPHQIRIH + +G PL+GDPLY+          
Sbjct  225   ESRSALTLLERRPER--CLVEMEIATGRPHQIRIHTAALGSPLLGDPLYL----------  272

Query  992   DLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKASQE  1168
                       GG  RPE  +PG  GY LHAH+L L        +A+ APLPS L   Q+
Sbjct  273   ---------PGGVARPEV-LPGAGGYQLHAHRLRL----EPRGLALEAPLPSGLLECQQ  317



>ref|WP_002627459.1| Ribosomal large subunit pseudouridine synthase D [Cystobacter 
fuscus]
 gb|EPX56983.1| Ribosomal large subunit pseudouridine synthase D [Cystobacter 
fuscus DSM 2262]
Length=298

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 178/346 (51%), Gaps = 52/346 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y + +     G + + +    Y++S PL+ W +R+   ++ +D  + +  +  L
Sbjct  3     LNTGYAYREQLGARARGQSTLAYLVAAYRHS-PLEVWRERLSRGEVLLDD-IPATGEERL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  LV++R PW+E   P    ++ ED+ ++A+ KP GL  +PGG F   T+L  ++ R
Sbjct  61    KAGQWLVWNRPPWEEKETPRDYSLVHEDEALLAVIKPGGLPTVPGGGFLVNTLLFLVRER  120

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
               + S           P+HRLGRGTSG++L A+T  A ++LS                  
Sbjct  121   FPEAS-----------PLHRLGRGTSGLVLFARTHDAAAKLS------------------  151

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                R  ++ K YRAL  GV  ++   I  PIG   +PG+   + +A P GK + S  RVL
Sbjct  152   RAWREHEVEKRYRALSGGVATQERYDITAPIGEAVHPGMGM-VPMAMPGGKASRSLARVL  210

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
             +R+     TL EV+IQ+GR  QIRIHL+FIGHPL GDP+Y  GG P    P L+      
Sbjct  211   QRRA--ASTLFEVDIQTGRSQQIRIHLAFIGHPLEGDPVYAVGGVPRAEHPGLL------  262

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                         GD GY LHA +L   HP+T E + ++A +PS L+
Sbjct  263   ------------GDVGYLLHAERLCFVHPLTGERLELHASIPSELE  296



>ref|XP_005767427.1| hypothetical protein EMIHUDRAFT_43988, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD14998.1| hypothetical protein EMIHUDRAFT_43988, partial [Emiliania huxleyi 
CCMP1516]
Length=271

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 156/298 (52%), Gaps = 42/298 (14%)
 Frame = +2

Query  119  FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             N+G TY + V  S AG  L++F   +Y +S   + W    +  ++ ++G   +  D  L
Sbjct  1    LNEGNTYPETVPASAAGQPLLDFLVDRYAHST-REAWTSHCRAGRLRLNG-TPATADCLL  58

Query  299  SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              G +L YHR PW+EP AP  L  LF D+  + L KPSGL  LP  L+   TVL+ L+  
Sbjct  59   REGQRLEYHRPPWREPAAPRWLWTLFADEHAVVLCKPSGLPTLPSELYHDSTVLSLLR--  116

Query  479  AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                      GE  P PVHRLG GTSG+LLCA + L +  LS         +QE+R S  
Sbjct  117  --------CGGEPVPSPVHRLGVGTSGLLLCAASALGRRALSV-------ALQERRVS--  159

Query  659  EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMV----RYPGVAKGLYVASPSG----KP  814
                     K YRALV G++  + L I+ PIG V     + G    +  A P G    K 
Sbjct  160  ---------KTYRALVQGLVAGETLDIDCPIGPVPHAAAFGGSCGEVCAARPEGGAGCKA  210

Query  815  ALSNVRVLERQVEKNC----TLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
            A S++RV+ R          TLVEV I +GRPHQIRIH ++ GHPL+GDPLY  GG P
Sbjct  211  ARSHLRVVRRDASAAGGAGATLVEVRIPTGRPHQIRIHTAYAGHPLVGDPLYCRGGLP  268



>ref|XP_005780575.1| hypothetical protein EMIHUDRAFT_44091, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD28146.1| hypothetical protein EMIHUDRAFT_44091, partial [Emiliania huxleyi 
CCMP1516]
Length=271

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/298 (40%), Positives = 156/298 (52%), Gaps = 42/298 (14%)
 Frame = +2

Query  119  FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             N+G TY + V  S AG  L++F   +Y +S   + W    +  ++ ++G   +  D  L
Sbjct  1    LNEGNTYPETVPASAAGQPLLDFLVDRYAHST-REAWTSHCRAGRLRLNG-TPATADCLL  58

Query  299  SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
              G +L YHR PW+EP AP  L  LF D+  + L KPSGL  LP  L+   TVL+ L+  
Sbjct  59   REGQRLEYHRPPWREPAAPRWLWTLFADEHAVVLCKPSGLPTLPSELYHDSTVLSLLR--  116

Query  479  AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                      GE  P PVHRLG GTSG+LLCA + L +  LS         +QE+R S  
Sbjct  117  --------RGGEPVPSPVHRLGVGTSGLLLCAASALGRRALSV-------ALQERRVS--  159

Query  659  EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMV----RYPGVAKGLYVASPSG----KP  814
                     K YRALV G++  + L I+ PIG V     + G    +  A P G    K 
Sbjct  160  ---------KTYRALVQGLVAGETLDIDCPIGPVPHAAAFGGSCGEVCAARPEGGAGCKA  210

Query  815  ALSNVRVLERQVEKNC----TLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
            A S++RV+ R          TLVEV I +GRPHQIRIH ++ GHPL+GDPLY  GG P
Sbjct  211  ARSHLRVVRRDASAAGGAGATLVEVRIPTGRPHQIRIHTAYAGHPLVGDPLYCRGGLP  268



>ref|WP_006910140.1| pseudouridine synthase [Cyanobium sp. PCC 7001]
 gb|EDY38241.1| ribosomal large subunit pseudouridine synthase D [Cyanobium sp. 
PCC 7001]
Length=350

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 178/346 (51%), Gaps = 43/346 (12%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D VR     ++   FY+ +Y +S P   WL+RI   +I  +G+ +   D  L 
Sbjct  8     NGGHAYRDTVRRGHPQVS--RFYAGRYPHS-PASVWLERIAAGEIVRNGQQLRA-DGELQ  63

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
             PG QLV+HR PW EP  P +   LF+D D++ L KP+GL VLP G + + TVL  L+ + 
Sbjct  64    PGDQLVWHRPPWLEPAVPDLPGPLFDDGDLLVLAKPAGLPVLPAGGYLEHTVLRLLERQV  123

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLE  661
                      G   P PVHRLGR TSG+L+CA+ + +++ LSA   DGT+  +  R   LE
Sbjct  124   RAGRLDGRFGL--PRPVHRLGRFTSGLLVCARRRASRAWLSALLRDGTA--EASRAVPLE  179

Query  662   VMRV-----RKIIKIYRALVS-------GVINEDE-LVIEQPIGMVRYPGVAKGLYVASP  802
             +  +         K+YRAL         G +   E L I  PIG   +  + +       
Sbjct  180   LQEMVGEAPAACRKLYRALAGPLPVSGPGALELGETLRITTPIGRRPHQRLGEVWSAGGR  239

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
             +  PAL+ + +LER+   +  LVE  I +GRPHQIRIHL+ +G PL+GDPLY  GG    
Sbjct  240   NALPALTTITLLERR--GHGCLVEAAIGTGRPHQIRIHLAAVGAPLLGDPLYRPGG---G  294

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDEL  1120
              +P  +                 PGD GY LHAH+L LP P    L
Sbjct  295   VNPGAL-----------------PGDPGYRLHAHRLTLPWPPGQRL  323



>gb|EMS51962.1| RNA pseudourine synthase 5 [Triticum urartu]
Length=352

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +2

Query  734   VIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRI  913
             V+ QPIG+V YPGVA+GLYVA  SGKPA+S V VLER V +N TLV+VEI SGRPHQIRI
Sbjct  140   VVTQPIGLVHYPGVAEGLYVACSSGKPAMSKVCVLERLVHQNQTLVQVEIHSGRPHQIRI  199

Query  914   HLSFIGHPLIGDPLYIDGGQPMCFDPD--LIDESFAQDGGYRRPENPVPGDCGYNLHAHK  1087
             HL++IGHPL+ DPLY  GGQP   D +    D SFA DGGY RP  PVPGDCGY+LHAH 
Sbjct  200   HLAYIGHPLVDDPLYGIGGQPKFHDLESTSTDISFAYDGGYERPLQPVPGDCGYHLHAHW  259

Query  1088  LALPHPITDELIAIN  1132
             L L HP T++++ +N
Sbjct  260   LVLSHPTTNKIVRLN  274


 Score =   137 bits (346),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 90/128 (70%), Gaps = 7/128 (5%)
 Frame = +2

Query  98   FGEPWPEFNDGLTYHDLVRPSDAGLT--LIEFYSRKYKNSAPLQGWLQRIQNKQITIDGR  271
            FG PWP+ N+GL+Y D  R +DA  T  LI FYS  YK+SAPL GW+ RI+N QIT+DG+
Sbjct  18   FGRPWPDLNEGLSYTDTFRGADAETTAALINFYSENYKSSAPLPGWIHRIRNGQITVDGQ  77

Query  272  VVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPG---GLF  442
            VV++PD  L  G++LVYHRL WKEP AP++L+VL+EDDDM+    P   Q LP     L 
Sbjct  78   VVTDPDMILRVGSKLVYHRLAWKEPFAPHLLQVLYEDDDMVYCFVPR--QSLPKFNLHLI  135

Query  443  QQRTVLTQ  466
             Q+ V+TQ
Sbjct  136  LQKDVVTQ  143



>ref|WP_034358669.1| pseudouridine synthase [Deinococcus phoenicis]
 gb|EYB67384.1| pseudouridine synthase [Deinococcus phoenicis]
Length=307

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 127/352 (36%), Positives = 184/352 (52%), Gaps = 54/352 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              NDG TY + +     GLT++ + +R Y++SA    W  R+   ++ +DG+     +  L
Sbjct  3     LNDGYTYREELGGRARGLTVLAYLARHYRHSAAAD-WQARLDRGEVHLDGQPARGAE-KL  60

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  L + R PW E + P   +++++D  ++A+ KP GL  LPGG F + T+LT+++  
Sbjct  61    RAGQVLEWRRPPWHEEDVPLGYDLVYQDAALLAVAKPPGLPTLPGGGFLKHTLLTRVR--  118

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                      +      P+HRLGRGTSG++L A+T  A S L+  + D             
Sbjct  119   ---------AAFPEASPLHRLGRGTSGLVLFARTPQAGSVLARAWRD-------------  156

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                    + K YRAL +G+   +E  I  PIG V +P +   ++ AS +GK A S  RVL
Sbjct  157   -----HAVQKRYRALAAGLAAREEYAITTPIGPVPHPRLGD-VFAASAAGKAASSQARVL  210

Query  839   ERQVEKNCT----LVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDE  1006
             ER+     T    L  V+I++GRPHQIRIHL+ IGHPL+GDPLY  GG P    P L   
Sbjct  211   ERRAATAQTPAETLFAVDIRTGRPHQIRIHLAAIGHPLVGDPLYAPGGGPRADLPGL---  267

Query  1007  SFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILKAS  1162
                            PGD GY LHA +L L HP+T E + + APLP  L+ +
Sbjct  268   ---------------PGDGGYRLHAERLVLAHPLTGERLRLEAPLPPELRCA  304



>ref|WP_014785626.1| RNA pseudouridine synthase [Terriglobus roseus]
 ref|YP_006421392.1| RluA family pseudouridine synthase [Terriglobus roseus DSM 18391]
 gb|AFL88057.1| pseudouridine synthase, RluA family [Terriglobus roseus DSM 18391]
Length=298

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 129/343 (38%), Positives = 173/343 (50%), Gaps = 52/343 (15%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G  Y  ++     G TL+   +  Y + A  Q W Q++ ++++T+DG VV+     L
Sbjct  2     LNRGYAYTTVISNKYCGRTLLAHLASLYPH-ATAQEWQQKLNDREVTLDG-VVATGSEWL  59

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  LV+ R  W E   P   EVLFED  ++A+NKP GL  LPGG F + T+L  +Q +
Sbjct  60    KLGQTLVWDRPTWIEAETPQHFEVLFEDPYLLAVNKPGGLPTLPGGGFMENTLLRLVQKQ  119

Query  479   AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                 +           PVHRLGR T+GI+L AKT    + LSA +               
Sbjct  120   RPSAN-----------PVHRLGRATTGIVLFAKTSKVAAHLSANW---------------  153

Query  659   EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
                    I KIYRAL  G+   D   I  PIG V +P +   ++ A P GKP+ S  +V+
Sbjct  154   ---NTPSIQKIYRALAQGIAQHDVYEILTPIGPVPHPRIGS-VWAAHPGGKPSKSLAKVI  209

Query  839   ERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQ  1018
              R  +   T  +V + SGRPHQIRIHL+ IGHPL+GDPLY   G P+   P L       
Sbjct  210   ARGAD--TTTFQVSLYSGRPHQIRIHLASIGHPLVGDPLYGPTGMPLEDLPGL-------  260

Query  1019  DGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPS  1147
                        PGD GY LHA  L L HP+T E + + AP+PS
Sbjct  261   -----------PGDGGYLLHAGLLTLDHPVTGERLELAAPVPS  292



>ref|WP_014685701.1| RNA pseudouridine synthase [Deinococcus gobiensis]
 ref|YP_006261676.1| Pseudouridine synthase, RluA family [Deinococcus gobiensis I-0]
 gb|AFD26218.1| Pseudouridine synthase, RluA family [Deinococcus gobiensis I-0]
Length=300

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 160/283 (57%), Gaps = 37/283 (13%)
 Frame = +2

Query  119  FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             N G +YH   R    G +++ + +  +++S   + W  R+   ++ +DG V +     L
Sbjct  3    LNAGYSYHS--RAERGGPSVLAYLTATFRHSE-AEVWALRLAAGEVEVDG-VRATGSERL  58

Query  299  SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             PG ++V+HR PW+EP+AP    VLFED  ++A+ KP+GL  LPGG F + T+L +++  
Sbjct  59   RPGQEVVWHRPPWEEPDAPLEFGVLFEDASLLAVTKPAGLPTLPGGGFYEHTLLRRVR--  116

Query  479  AsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNL  658
                      G S   P+HRLGRGTSG++L A+   A + LSA +               
Sbjct  117  ------AQFPGAS---PLHRLGRGTSGLVLFAREGAAGAALSAAW---------------  152

Query  659  EVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVL  838
               R R++ K Y AL +GV   D L I  PIG V +P + + +Y A P+GK + S  RVL
Sbjct  153  ---REREVRKTYLALAAGVPGWDTLEITAPIGPVAHPRLGE-VYAAHPAGKASHSAARVL  208

Query  839  ERQVEKNC---TLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLY  958
            ER+ +      TL+ V+I++GRPHQIRIH ++ G PL+GDPLY
Sbjct  209  ERRTQAGPAGETLLAVDIRTGRPHQIRIHTAWAGFPLVGDPLY  251



>gb|KEF42526.1| pseudouridine synthase [Cyanobium sp. CACIAM 14]
Length=372

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 129/359 (36%), Positives = 179/359 (50%), Gaps = 47/359 (13%)
 Frame = +2

Query  113   PEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
             P  N G  Y D +    AG  +  FY+ +Y++S   Q W +R+ + +I  +G  +   DA
Sbjct  18    PGVNGGWIYRDRIAADAAGQEVSAFYAGRYRHSQ-RQAWQRRLASGEIERNGERLGA-DA  75

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L+   +L +HR PW EP  P    V+F+D D+  ++KP+GL VLP G F + TVL  L+
Sbjct  76    LLAVEDRLAWHRPPWWEPAVPAGWRVVFDDGDLHVIDKPAGLPVLPAGGFLEHTVLRLLE  135

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF--------ADGTS  628
              R     +        P PVHRLGR TSG+L+CA+    ++ LSA          ADG  
Sbjct  136   RRHGADPAGV------PRPVHRLGRFTSGLLVCARRPGTRAWLSAQLRESTASLSADGCP  189

Query  629   IVQEKRYSNLEVMRVRKIIKIYRA-LVSGVIN---EDELVIEQPIGMVRYP---GVAKGL  787
               Q       E   V    KIYRA LV G +     + L+I  PIG   +P    +   +
Sbjct  190   SGQRATPCQNE-GGVNGCRKIYRAWLVPGDLALAIGESLLITTPIGRRSHPLLGAIWCAV  248

Query  788   YVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
                 P   P+LS + +LER  E +  +VEV I +GRPHQIRIH + +G PL+GDPLY+ G
Sbjct  249   ETGQPDALPSLSRLTLLERGREAD--VVEVAIATGRPHQIRIHCAAVGAPLLGDPLYVPG  306

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLP  1144
             G              A+ G        +PG+ GY L A +L L  P    L A+ A LP
Sbjct  307   G-------------LARPGA-------LPGEGGYRLRAQRLCLSRPDGSPL-ALEAALP  344



>ref|WP_010305171.1| pseudouridine synthase [Synechococcus sp. CB0101]
Length=349

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 131/358 (37%), Positives = 184/358 (51%), Gaps = 50/358 (14%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FN G  Y D  R S A  +++ FY+ +Y +S     W +R+   ++  +G+ +   DA L
Sbjct  16    FNGGHAYRD--RISAASPSVVAFYAGRYTHSD-RALWSERLAAGEVWRNGQPLLA-DAPL  71

Query  299   SPGAQLVYHRLPWKEPNAPYVLE--VLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
             S G +LV+HR PW EP  P + E  V+F+D D++ LNKPSGL VLP G F + T+L QLQ
Sbjct  72    SAGDRLVWHRPPWLEPAVPVLNEASVVFDDGDLLVLNKPSGLPVLPAGGFLEHTLLAQLQ  131

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQ---EK  643
               A +             PVHRLGR TSG+L+CA+   +++ LSA   + T+  Q   ++
Sbjct  132   GWAPEAR-----------PVHRLGRFTSGLLVCARRAESRAWLSAQLRESTAAAQPHGDQ  180

Query  644   RYSNLEVMRVRKIIKIYRALVSGVINE----DELVIEQPIGMVRYPGVAKGLYVASPSGK  811
              Y   E       +KIYRAL   +  +    +   +   IG   +P + +    A  S +
Sbjct  181   EYFGAEEHPHSGCLKIYRALTQPLPADWQVGESRDVTTAIGRRPHPLLGEIWCAADVSPR  240

Query  812   PAL---SNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
              AL   S   +LER+ E    LVEV I +GRPHQIRIH + IG PL GDPLY  GG+   
Sbjct  241   AALPSRSCFTLLERRPES--CLVEVAIATGRPHQIRIHAAAIGAPLEGDPLYRAGGR---  295

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
              DP ++                 PGD GY LHA +  L  P     + + AP P  L+
Sbjct  296   ADPQVL-----------------PGDGGYLLHACRFVL-RPPARAPLHLEAPPPLPLR  335



>ref|NP_001049785.1| Os03g0288500 [Oryza sativa Japonica Group]
 dbj|BAF11699.1| Os03g0288500, partial [Oryza sativa Japonica Group]
Length=162

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 105/153 (69%), Gaps = 15/153 (10%)
 Frame = +2

Query  218  LQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIA  397
            L  W++RI++ QIT+DG V ++PD  L  G++LVYHRLPW+EP AP++L+VL+EDDDMIA
Sbjct  6    LCRWIKRIRDGQITVDGEVATDPDMILREGSKLVYHRLPWQEPFAPHLLDVLYEDDDMIA  65

Query  398  LNKPSGLQVLPGGLFQQRTVLTQLQ---WRA-sklsslsssGESHPVPVHRLGRGTSGIL  565
            LNKPSGLQVLP GLFQQRTVL QLQ   W+  S   S     +SHPVPVHRLGRGTSG+ 
Sbjct  66   LNKPSGLQVLPKGLFQQRTVLAQLQLKDWKMPSSFCSKRKDAQSHPVPVHRLGRGTSGLF  125

Query  566  LC-----------AKTKLAKSRLSAYFADGTSI  631
            LC             T+L+ S     F D  S+
Sbjct  126  LCFCSVHAQKPWSIDTQLSSSGCKFLFTDHQSV  158



>ref|WP_038001808.1| pseudouridine synthase [Synechococcus sp. RS9917]
Length=332

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 126/360 (35%), Positives = 181/360 (50%), Gaps = 62/360 (17%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
             FN G  Y D V    +G  L  + + +Y++S+    W QR+Q+ ++ ++GR++   D  +
Sbjct  9     FNQGWVYRDRVAAGQSGQLLSAWLADRYRHSSAAT-WRQRLQSGELGLNGRLLQG-DVVV  66

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
             + G ++ + R PW EP  P   + L +D D++ +NKPSGL V+P G F   T+  QL   
Sbjct  67    AAGDRIRWQRPPWVEPAIPEHWQTLHDDGDVLVINKPSGLPVMPAGGFLVHTLSHQL---  123

Query  479   AsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSN  655
                +      GE   P PVHRLGR TSG+L+CA+   +++ LS    D T+         
Sbjct  124   ---VLWSREQGEPLAPKPVHRLGRFTSGLLVCARRPESRAWLSRLLRDSTADGAAS----  176

Query  656   LEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLY----------VASPS  805
                       K+YRAL       + L  + P+G  R   VA G +           A PS
Sbjct  177   -------ACRKVYRALT------EPLPPDWPLGESREVTVAIGRHPHPLLGEIWCAADPS  223

Query  806   ---GKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
                  P+ S+  +LER+ E +C LVEV I SGRPHQIRIH +  G PL+GDPLY+ GG  
Sbjct  224   VATALPSRSSFTLLERRPE-SC-LVEVVIASGRPHQIRIHAATAGAPLLGDPLYLPGG--  279

Query  977   MCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                     D+S              PG+ GY+LHAH+L L  P    L+ + APLP  L+
Sbjct  280   -----GASDQSL-------------PGEGGYHLHAHRLQLASP-DGGLLDLEAPLPEPLR  320



>ref|WP_035830602.1| pseudouridine synthase, partial [Cyanobium sp. CACIAM 14]
Length=327

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 122/341 (36%), Positives = 171/341 (50%), Gaps = 46/341 (13%)
 Frame = +2

Query  113   PEFNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDA  292
             P  N G  Y D +    AG  +  FY+ +Y++S   Q W +R+ + +I  +G  +   DA
Sbjct  18    PGVNGGWIYRDRIAADAAGQEVSAFYAGRYRHSQ-RQAWQRRLASGEIERNGERLGA-DA  75

Query  293   SLSPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQ  472
              L+   +L +HR PW EP  P    V+F+D D+  ++KP+GL VLP G F + TVL  L+
Sbjct  76    LLAVEDRLAWHRPPWWEPAVPAGWRVVFDDGDLHVIDKPAGLPVLPAGGFLEHTVLRLLE  135

Query  473   WRAsklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSAYF--------ADGTS  628
              R     +        P PVHRLGR TSG+L+CA+    ++ LSA          ADG  
Sbjct  136   RRHGADPAGV------PRPVHRLGRFTSGLLVCARRPGTRAWLSAQLRESTASLSADGCP  189

Query  629   IVQEKRYSNLEVMRVRKIIKIYRA-LVSGVIN---EDELVIEQPIGMVRYP---GVAKGL  787
               Q       E   V    KIYRA LV G +     + L+I  PIG   +P    +   +
Sbjct  190   SGQRATPCQNEGG-VNGCRKIYRAWLVPGDLALAIGESLLITTPIGRRSHPLLGAIWCAV  248

Query  788   YVASPSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDG  967
                 P   P+LS + +LER  E +  +VEV I +GRPHQIRIH + +G PL+GDPLY+ G
Sbjct  249   ETGQPDALPSLSRLTLLERGREAD--VVEVAIATGRPHQIRIHCAAVGAPLLGDPLYVPG  306

Query  968   GQPMCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKL  1090
             G              A+ G        +PG+ GY L A +L
Sbjct  307   G-------------LARPGA-------LPGEGGYRLRAQRL  327



>ref|WP_015110385.1| 23S RNA-specific pseudouridylate synthase [Cyanobium gracile]
 ref|YP_007047291.1| 23S RNA-specific pseudouridylate synthase [Cyanobium gracile 
PCC 6307]
 gb|AFY29950.1| 23S RNA-specific pseudouridylate synthase [Cyanobium gracile 
PCC 6307]
Length=352

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 172/343 (50%), Gaps = 46/343 (13%)
 Frame = +2

Query  122   NDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLS  301
             N G  Y D + P+ AGL ++ FY+ +Y +++    W +R+   +I+ +G V    DA L+
Sbjct  25    NGGWAYRDRISPAAAGLGVVAFYAGRYGHTSATV-WERRLAAGEISRNG-VPLRADAILA  82

Query  302   PGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRA  481
                +LV+ R PW EP  P    V+ +D D++ ++KPSGL VLP G F + TVL  L+ R 
Sbjct  83    GADRLVWQRPPWPEPAVPAHWGVIHDDGDLLVIDKPSGLPVLPAGGFLEHTVLRLLERRH  142

Query  482   sklsslsssGESHPVPVHRLGRGTSGILLCAKTKLAKSRLSA-------YFADGTSIVQE  640
                          P PVHRLGR TSG+L+CA+   +++ LSA         A+G S    
Sbjct  143   GGDPGGV------PRPVHRLGRFTSGLLVCARRPASRAWLSAQLRESTGSLANGASGGVG  196

Query  641   KRYSNLEVMRVRKIIKIYRALVS----GVINEDELVIEQPIGMVRYPGVAKGLYVAS---  799
                            K+YRAL+      +   D L I   IG   +P + + ++ A+   
Sbjct  197   GGVGGGVGGGAPPCRKLYRALLVPGRLALATGDSLAITTAIGRRPHPPLGE-IWCAAEAG  255

Query  800   -PSGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQP  976
              P   PA S + +L +  E +  LVEV I SGRPHQIRIH + IG PL GDPLY+ GG+ 
Sbjct  256   DPGALPARSQLTLLAKGSEAD--LVEVAIVSGRPHQIRIHCAAIGAPLRGDPLYVPGGR-  312

Query  977   MCFDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHP  1105
                         A+ GG       +PG+ GY L A  L L  P
Sbjct  313   ------------ARPGG-------LPGEGGYRLQARWLRLQPP  336



>ref|WP_007099135.1| pseudouridine synthase [Synechococcus sp. RS9916]
 gb|EAU75038.1| probable pseudouridine synthase [Synechococcus sp. RS9916]
Length=333

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 117/358 (33%), Positives = 179/358 (50%), Gaps = 58/358 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TYHD +  S+AG  L    + +Y +S+  Q W QR+++ ++  DG ++   D  +
Sbjct  17    LNQGWTYHDSITASEAGQWLTAVMAARYNHSSAEQ-WKQRLESGELRRDGHLL-QVDVMV  74

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G ++ +HR PW E   P   + + +D D++ +NKPSGL V+PGG F   T+   L+ R
Sbjct  75    ERGERISWHRPPWLEAAVPDQWQTIHDDGDLLVINKPSGLPVMPGGGFLLHTLTALLEQR  134

Query  479   AsklsslsssGES-HPVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSN  655
             +         GES  P PVHRLGR TSG+ +CA+    ++ LSA+F              
Sbjct  135   S------RERGESLAPKPVHRLGRFTSGLQVCARRPETRAALSAHFRPQGG---------  179

Query  656   LEVMRVRKIIKIYRALVSGVINEDEL-----VIEQPIGMVRY------PGVAKGLYVASP  802
                   RK+ + +   V G+  E  +     V+E+P  ++ +      P  A+G      
Sbjct  180   -----CRKLYQAWSQRVEGLDLEASVEVCTDVVERPHPLLGWVWGPEPPDDARGDATPVR  234

Query  803   SGKPALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMC  982
               + A S + +L+R  + +   ++V I +GRPHQIRIHL+ +G PL+GDPLY+       
Sbjct  235   RRRNAHSELTLLQRGEQGD--RLQVAITTGRPHQIRIHLAQLGSPLLGDPLYLR------  286

Query  983   FDPDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKL-ALPHPITDELIAINAPLPSIL  1153
                           G R   +  PGD GY LHA +L  LP   +D L A+ APLP+  
Sbjct  287   --------------GRRLAPSATPGDGGYWLHAWRLEKLPSRGSDGL-ALEAPLPAAF  329



>gb|EAQ70555.1| probable pseudouridine synthase [Synechococcus sp. RS9917]
Length=314

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 120/345 (35%), Positives = 175/345 (51%), Gaps = 62/345 (18%)
 Frame = +2

Query  164   AGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASLSPGAQLVYHRLPWKE  343
             +G  L  + + +Y++S+    W QR+Q+ ++ ++GR++   D  ++ G ++ + R PW E
Sbjct  6     SGQLLSAWLADRYRHSSAAT-WRQRLQSGELGLNGRLLQG-DVVVAAGDRIRWQRPPWVE  63

Query  344   PNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWRAsklsslsssGES-H  520
             P  P   + L +D D++ +NKPSGL V+P G F   T+  QL      +      GE   
Sbjct  64    PAIPEHWQTLHDDGDVLVINKPSGLPVMPAGGFLVHTLSHQL------VLWSREQGEPLA  117

Query  521   PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSNLEVMRVRKIIKIYRA  700
             P PVHRLGR TSG+L+CA+   +++ LS    D T+                   K+YRA
Sbjct  118   PKPVHRLGRFTSGLLVCARRPESRAWLSRLLRDSTADGAAS-----------ACRKVYRA  166

Query  701   LVSGVINEDELVIEQPIGMVRYPGVAKGLY----------VASPS---GKPALSNVRVLE  841
             L       + L  + P+G  R   VA G +           A PS     P+ S+  +LE
Sbjct  167   LT------EPLPPDWPLGESREVTVAIGRHPHPLLGEIWCAADPSVATALPSRSSFTLLE  220

Query  842   RQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPDLIDESFAQD  1021
             R+ E +C LVEV I SGRPHQIRIH +  G PL+GDPLY+ GG          D+S    
Sbjct  221   RRPE-SC-LVEVVIASGRPHQIRIHAATAGAPLLGDPLYLPGG-------GASDQSL---  268

Query  1022  GGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAINAPLPSILK  1156
                       PG+ GY+LHAH+L L  P    L+ + APLP  L+
Sbjct  269   ----------PGEGGYHLHAHRLQLASP-DGGLLDLEAPLPEPLR  302



>ref|WP_037991475.1| pseudouridine synthase, partial [Synechococcus sp. CC9616]
Length=290

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/334 (31%), Positives = 166/334 (50%), Gaps = 65/334 (19%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TYHD V  ++A + L ++ + +Y++S P + WL+RI N ++  DG+ +   D  L
Sbjct  10    LNQGWTYHDRVPTAEADIVLSDWLASRYRHS-PAELWLERIVNGELDCDGQRL-EVDRLL  67

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
               G  +++ R PW EP  P   E + +D D++ +NKPSGL V+PGG F + T+ + L+  
Sbjct  68    RGGESILWRRAPWLEPAIPDQWETIHDDGDLLVINKPSGLPVMPGGGFLRHTLTSLLE--  125

Query  479   AsklsslsssGESHPV---PVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRY  649
                           PV   PVHRLGR TSG+ LCA+    ++ LS  F    +       
Sbjct  126   --------------PVGAQPVHRLGRFTSGLQLCARQAKTRAALSRLFRPEGNCC-----  166

Query  650   SNLEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPAL---  820
                      K+ + +   V G+   + LV+E  +   ++P +   ++   P    A+   
Sbjct  167   ---------KVYQAWTQRVVGLEPGNTLVVETDVVERQHP-LLGWIWGPEPMTAEAIRKR  216

Query  821   ----SNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFD  988
                 S +R+LER  + +   ++V I +GRPHQIRIHL+ +G PL+GDPLY          
Sbjct  217   LSARSELRLLERSADGD--RLKVTITTGRPHQIRIHLAQLGSPLLGDPLY----------  264

Query  989   PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKL  1090
               L+++  +            PGD GY LHA + 
Sbjct  265   --LLNQGIST--------TATPGDGGYRLHAWRF  288



>ref|WP_038004644.1| pseudouridine synthase [Synechococcus sp. WH 7805]
Length=324

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 179/362 (49%), Gaps = 59/362 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY D +  S++G  L    + +Y +S P   W  RI++ ++ ++G+ + N D  +
Sbjct  9     LNQGWTYSDRMDRSESGRMLSAVMASRYGHS-PRDVWDSRIRSGELLLNGQSLQN-DVPV  66

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
                  + + R PW EP  P    V+++D D++ +NKPSGL V+PGG F Q T+       
Sbjct  67    GSRDVVQWRRPPWLEPAIPDQWSVVYDDGDVLVINKPSGLPVMPGGGFLQHTL------S  120

Query  479   AsklsslsssGESH-PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSN  655
             A  + +  S+G S  P PVHRLGR TSG+ +CA+    ++ LS  F              
Sbjct  121   ALLMEASRSAGASQVPKPVHRLGRFTSGLQVCARRPQTRAELSRQFRPEGG---------  171

Query  656   LEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPS---GKP----  814
                   RK    +   V G+  +  LV+   +    +P +    +V  P    G+P    
Sbjct  172   -----CRKTYLAWANPVKGLRADQPLVVTTDVVERVHPLLG---WVWGPDPFDGEPLRRR  223

Query  815   --ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFD  988
               A S +R+L+R  + +  LVEV I +GRPHQIRIHL+ +G PL+GDPLY+         
Sbjct  224   LHARSELRLLKRCDQGD--LVEVAISTGRPHQIRIHLAQLGSPLLGDPLYL---------  272

Query  989   PDLIDESFAQDGGYRRPENPVPGDCGYNLHAHKLALPHPITDELIAIN--APLPSILKAS  1162
             P     + A           VPGD GY LHAH LAL + +    +A +  AP   +L AS
Sbjct  273   PQQRINAAA-----------VPGDGGYRLHAHTLALENGLHLSCVAGSGFAPGELLLAAS  321

Query  1163  QE  1168
             QE
Sbjct  322   QE  323



>ref|WP_011934195.1| pseudouridine synthase [Synechococcus sp. WH 7803]
 ref|YP_001226031.1| pseudouridylate synthase [Synechococcus sp. WH 7803]
 emb|CAK24734.1| Pseudouridylate synthase [Synechococcus sp. WH 7803]
Length=314

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 109/334 (33%), Positives = 163/334 (49%), Gaps = 53/334 (16%)
 Frame = +2

Query  119   FNDGLTYHDLVRPSDAGLTLIEFYSRKYKNSAPLQGWLQRIQNKQITIDGRVVSNPDASL  298
              N G TY D +  S++G  L    + +Y +S+    W  RI+  ++ ++G  + N D  +
Sbjct  9     LNQGWTYSDRIERSESGQMLTAVMASRYGHSS-RDVWQSRIRTGELLLNGTCLQN-DVPV  66

Query  299   SPGAQLVYHRLPWKEPNAPYVLEVLFEDDDMIALNKPSGLQVLPGGLFQQRTVLTQLQWR  478
                  + + R PW EP  P    V+++D D++ +NKPSGL V+PGG F Q T+       
Sbjct  67    GSKDVVQWRRPPWLEPAIPDRWSVVYDDGDVLVINKPSGLPVMPGGGFLQHTL------S  120

Query  479   AsklsslsssGESH-PVPVHRLGRGTSGILLCAKTKLAKSRLSAYFADGTSIVQEKRYSN  655
             A  + +   +G S  P PVHRLGR TSG+ +CA+    ++RLS  F              
Sbjct  121   ALLMETSRLAGSSQAPKPVHRLGRFTSGLQVCARRPQTRARLSRQFRPEGG---------  171

Query  656   LEVMRVRKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPS-GKP------  814
                   RK    +   ++G+  +  LV+   +    +P +   ++   PS G+P      
Sbjct  172   -----CRKTYLAWAQPMAGLRADQPLVVTTDVVERSHP-LLGWVWGPDPSDGEPLRRRLQ  225

Query  815   ALSNVRVLERQVEKNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPLYIDGGQPMCFDPD  994
             A S +R+L R  + +  LVEV I +GRPHQIRIHL+ +G PL+GDPLY+         P 
Sbjct  226   ARSELRLLRRCSQGD--LVEVAISTGRPHQIRIHLAQLGSPLLGDPLYL---------PQ  274

Query  995   LIDESFAQDGGYRRPENPVPGDCGYNLHAHKLAL  1096
                 + A           VPGD GY LHAH L  
Sbjct  275   QRINTAA-----------VPGDGGYRLHAHTLVF  297



>tpg|DAA44823.1| TPA: hypothetical protein ZEAMMB73_153874, partial [Zea mays]
Length=115

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  674  RKIIKIYRALVSGVINEDELVIEQPIGMVRYPGVAKGLYVASPSGKPALSNVRVLERQVE  853
            RKI K YRALV+G++++DE+V+ QPIG+V YPGVA+GLY A  SGKPA+S V VLER   
Sbjct  21   RKISKFYRALVTGILDDDEVVVTQPIGLVHYPGVAEGLYAACSSGKPAMSKVCVLERLAH  80

Query  854  KNCTLVEVEIQSGRPHQIRIHLSFIGHPLIGDPL  955
            +N TLV+VEI SGRPHQIRIHL++IGHPL+G  L
Sbjct  81   QNHTLVQVEIHSGRPHQIRIHLAYIGHPLVGKSL  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3744971002710