BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23478_g1_i2 len=636 path=[2464:0-134 437:135-167 2631:168-184
2648:185-189 2653:190-230 4533:231-238 4250:239-293 2767:294-349
4062:350-420 2882:421-423 4589:424-444 4156:445-469 2936:470-490
1235:491-516 2981:517-635]

Length=636
                                                                      Score     E

gb|AAA98238.1|  antifungal protein                                    90.9    8e-20   Ipomoea nil [qian niu]
gb|AAA98236.1|  antifungal protein                                    84.7    1e-17   Ipomoea nil [qian niu]
sp|P81591.1|AMP_IPONI  RecName: Full=Antimicrobial protein PN-AMP...  62.4    5e-10   Ipomoea nil [qian niu]
gb|AFX66979.1|  class I chitinase                                     62.4    8e-10   
dbj|BAF47270.1|  chitinase C                                          63.5    1e-08   Ananas comosus
ref|XP_001759883.1|  predicted protein                                60.5    1e-08   
ref|XP_010941400.1|  PREDICTED: basic endochitinase A-like isofor...  63.2    2e-08   
ref|XP_010941404.1|  PREDICTED: chitinase 1-like                      62.4    2e-08   
ref|XP_010941399.1|  PREDICTED: chitinase 1-like isoform X1           62.8    2e-08   
ref|XP_010941401.1|  PREDICTED: 26 kDa endochitinase 1-like isofo...  62.4    2e-08   
gb|AHB62682.1|  putative VF chitinase I                               62.0    4e-08   
ref|XP_002270220.2|  PREDICTED: endochitinase-like                    59.7    7e-08   Vitis vinifera
ref|XP_007046548.1|  Basic chitinase                                  60.5    1e-07   
gb|ACJ23248.1|  class I chitinase                                     59.7    2e-07   Festuca arundinacea [tall fescue]
gb|AAP03087.1|  class Ib chitinase                                    59.3    3e-07   Galega orientalis
ref|XP_003629192.1|  Endochitinase                                    59.3    3e-07   
gb|AAA32640.1|  chitinase                                             59.3    3e-07   Allium sativum
ref|XP_008812110.1|  PREDICTED: chitinase 3-like                      59.3    3e-07   
gb|AAG16225.2|AF287016_1  hevein                                      54.7    4e-07   Hevea brasiliensis [jebe]
ref|XP_009394061.1|  PREDICTED: endochitinase-like                    58.5    5e-07   
ref|XP_006657361.1|  PREDICTED: chitinase 1-like                      58.2    5e-07   
gb|AAR18735.1|  chitinase                                             58.5    6e-07   Bambusa oldhamii
gb|AAC16010.1|  acidic chitinase                                      58.5    6e-07   Elaeagnus umbellata [aki-gumi]
gb|AAL73184.1|  antifungal protein                                    54.7    7e-07   Capsicum annuum
gb|ACB05666.1|  chitin binding protein                                54.7    8e-07   Capsicum annuum
ref|XP_008812099.1|  PREDICTED: chitinase 1-like                      57.8    9e-07   
emb|CBI18789.3|  unnamed protein product                              54.7    1e-06   
dbj|BAC16357.1|  hevein-like protein                                  56.2    2e-06   Eutrema japonicum [wasabe]
emb|CDX73819.1|  BnaA03g32280D                                        57.4    2e-06   
ref|XP_004509418.1|  PREDICTED: endochitinase-like                    57.0    2e-06   
sp|P02877.2|HEVE_HEVBR  RecName: Full=Pro-hevein; AltName: Full=M...  55.8    2e-06   Hevea brasiliensis [jebe]
gb|AAO63573.1|  HEV2.1                                                55.8    2e-06   Hevea brasiliensis [jebe]
gb|AAO63574.1|  HEV2.2                                                55.8    2e-06   Hevea brasiliensis [jebe]
ref|XP_006487791.1|  PREDICTED: hevein-like preproprotein-like        55.5    2e-06   
gb|EAY90475.1|  hypothetical protein OsI_12063                        56.2    2e-06   Oryza sativa Indica Group [Indian rice]
gb|ACJ62151.1|  chitinase                                             56.6    3e-06   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CDY00776.1|  BnaC03g37600D                                        56.6    3e-06   
gb|AAT40019.1|  chitinase                                             56.6    3e-06   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFK37149.1|  unknown                                               56.2    3e-06   
ref|XP_008367944.1|  PREDICTED: endochitinase-like                    55.8    3e-06   
gb|AFK33496.1|  unknown                                               56.2    3e-06   
ref|NP_001142232.1|  uncharacterized protein LOC100274400 precursor   55.8    4e-06   Zea mays [maize]
ref|XP_007023212.1|  Pathogenesis-related protein PR-4B               55.1    4e-06   
ref|XP_002264647.1|  PREDICTED: pathogenesis-related protein PR-4     55.1    4e-06   Vitis vinifera
gb|AAA32641.1|  chitinase                                             56.2    4e-06   Allium sativum
gb|AFW75731.1|  chitinase2                                            55.8    4e-06   
prf||1712313A  basic chitinase                                        55.8    4e-06
sp|P36907.1|CHIX_PEA  RecName: Full=Endochitinase; Flags: Precursor   55.8    4e-06   Pisum sativum [garden pea]
gb|ACJ38195.1|  chitinase                                             55.8    4e-06   Malus hupehensis
ref|XP_009344658.1|  PREDICTED: endochitinase-like                    55.8    5e-06   
emb|CAA82849.1|  chitinase class I                                    55.8    5e-06   Oryza sativa [red rice]
gb|AFK47528.1|  unknown                                               55.8    5e-06   
dbj|BAK02041.1|  predicted protein                                    55.8    5e-06   
ref|XP_008393545.1|  PREDICTED: endochitinase-like                    55.8    5e-06   
ref|XP_008344215.1|  PREDICTED: endochitinase-like                    55.8    5e-06   
gb|AFK35483.1|  unknown                                               55.8    5e-06   
gb|EAY90476.1|  hypothetical protein OsI_12064                        55.8    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_001781689.1|  predicted protein                                52.0    5e-06   
ref|XP_006424014.1|  hypothetical protein CICLE_v10029327mg           54.3    5e-06   
ref|XP_006487790.1|  PREDICTED: hevein-like preproprotein-like        54.3    5e-06   
gb|AAA56787.1|  chitinase                                             55.8    5e-06   Hordeum vulgare [barley]
ref|XP_006424015.1|  hypothetical protein CICLE_v10029328mg           54.3    5e-06   
dbj|BAK04967.1|  predicted protein                                    55.5    6e-06   
gb|AAB01895.1|  endochitinase                                         55.5    6e-06   Castanea sativa
ref|XP_003629191.1|  Endochitinase                                    55.8    6e-06   
pdb|1Q9B|A  Chain A, Crystal Structure Analysis Of Hev B 6.02 (He...  51.6    6e-06   
ref|NP_001280823.1|  endochitinase-like precursor                     55.5    6e-06   
ref|XP_009135234.1|  PREDICTED: endochitinase CH25-like               55.5    6e-06   
ref|XP_010242848.1|  PREDICTED: basic endochitinase-like              55.5    7e-06   
gb|AFW75728.1|  hypothetical protein ZEAMMB73_827760                  55.5    7e-06   
ref|NP_001050373.2|  Os03g0418000                                     55.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABD47583.1|  chitinase                                             55.1    8e-06   Musa x paradisiaca [banana]
gb|EAZ27337.1|  hypothetical protein OsJ_11278                        55.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008440903.1|  PREDICTED: endochitinase-like                    55.1    8e-06   
gb|ABU25226.1|  chitinase                                             55.1    8e-06   Oryza sativa Indica Group [Indian rice]
emb|CAA60590.1|  chitinase                                            55.1    8e-06   Oryza sativa [red rice]
gb|ACH92946.2|  class I chitinase                                     55.1    8e-06   Dimocarpus longan [longan]
pdb|1T0W|A  Chain A, 25 Nmr Structures Of Truncated Hevein Of 32 ...  50.8    8e-06   
ref|XP_002269727.2|  PREDICTED: LOW QUALITY PROTEIN: basic endoch...  55.1    9e-06   Vitis vinifera
emb|CAA82850.1|  chitinase class I                                    55.1    9e-06   Oryza sativa [red rice]
prf||2014210B  chitinase class I:ISOTYPE=CH6                          55.1    9e-06
gb|ACM47315.1|  chitinase                                             55.1    9e-06   Capsicum annuum
gb|EEE66386.1|  hypothetical protein OsJ_22712                        54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAX51197.1|  PR-4 like protein                                     52.0    1e-05   Galega orientalis
gb|ACJ62099.1|  chitinase                                             54.7    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40033.1|  chitinase                                             54.7    1e-05   Zea diploperennis [chapule]
ref|XP_007137310.1|  hypothetical protein PHAVU_009G116700g           54.7    1e-05   
gb|AAT40027.1|  chitinase                                             54.7    1e-05   Zea diploperennis [chapule]
ref|XP_010680951.1|  PREDICTED: endochitinase A2-like                 52.0    1e-05   
ref|XP_006367747.1|  PREDICTED: basic 30 kDa endochitinase-like       54.7    1e-05   
gb|AAT40030.1|  chitinase                                             54.7    1e-05   Zea diploperennis [chapule]
gb|AAT40029.1|  chitinase                                             54.7    1e-05   Zea diploperennis [chapule]
emb|CAB97002.1|  putative class I chitinase                           54.7    1e-05   Phaseolus vulgaris [French bean]
gb|AAD34596.1|AF147497_1  endochitinase precursor                     54.3    1e-05   Humulus lupulus [common hop]
ref|XP_006375839.1|  hypothetical protein POPTR_0013s03920g           52.8    1e-05   
gb|ACJ62110.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62153.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62131.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62117.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAA05978.1|  prohevein                                            53.1    1e-05   Hevea brasiliensis [jebe]
gb|ACJ62138.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62136.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40013.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40014.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62104.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AEZ67300.1|  chitinase 1                                           54.3    1e-05   
gb|ACJ62111.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62108.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40012.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAM77665.1|AF523071_1  chitinase KBchit5-3-1                       54.3    1e-05   Leucaena leucocephala [cassie]
gb|ACJ62087.1|  chitinase                                             54.3    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006828992.1|  hypothetical protein AMTR_s00001p00243780        54.3    1e-05   
gb|ACJ62088.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40032.1|  chitinase                                             54.3    2e-05   Zea diploperennis [chapule]
gb|ACJ62109.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62121.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40015.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40016.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62116.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62107.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62106.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62113.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62094.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62095.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002312923.2|  Chain A family protein                           54.3    2e-05   Populus trichocarpa [western balsam poplar]
gb|ACJ62086.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAB82773.1|  ripening-associated protein                           52.0    2e-05   Musa acuminata [banana]
gb|ACJ62114.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62105.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62141.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAT40017.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAK01982.1|  predicted protein                                    54.3    2e-05   
ref|XP_007156221.1|  hypothetical protein PHAVU_003G268500g           54.3    2e-05   
gb|AFK26307.1|  chitinase 1                                           54.3    2e-05   
gb|ACJ62156.1|  chitinase                                             54.3    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADN39439.1|  class I chitinase isoform 2                           53.9    2e-05   
ref|XP_010242849.1|  PREDICTED: basic endochitinase-like              54.3    2e-05   
gb|ACJ62157.1|  chitinase                                             53.9    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAC14015.1|  chitinase                                            54.3    2e-05   Vitis vinifera
gb|AEF58999.1|  class I chitinase                                     54.3    2e-05   
gb|ABK24218.1|  unknown                                               54.3    2e-05   Picea sitchensis
ref|NP_001234403.1|  basic 30 kDa endochitinase precursor             53.9    2e-05   
emb|CAN62784.1|  hypothetical protein VITISV_033490                   53.9    2e-05   Vitis vinifera
dbj|BAO45893.1|  chitinase                                            53.9    2e-05   
ref|XP_008241979.1|  PREDICTED: endochitinase-like                    53.9    2e-05   
gb|AAT40732.1|  basic chitinase 1-1                                   53.9    2e-05   Nepenthes khasiana
pdb|1WKX|A  Chain A, Crystal Structure Of A Hev B 6.02 Isoallergen    50.1    2e-05   
gb|KHG07793.1|  Endochitinase                                         53.9    2e-05   
ref|XP_006382802.1|  hypothetical protein POPTR_0005s05600g           51.6    2e-05   
sp|P52404.1|CHI2_SOLTU  RecName: Full=Endochitinase 2; Flags: Pre...  53.9    2e-05   Solanum tuberosum [potatoes]
sp|P52403.1|CHI1_SOLTU  RecName: Full=Endochitinase 1; Flags: Pre...  53.9    2e-05   Solanum tuberosum [potatoes]
ref|XP_009337094.1|  PREDICTED: endochitinase-like                    53.9    2e-05   
ref|NP_001268050.1|  class I extracellular chitinase precursor        53.9    2e-05   
gb|AEF59005.1|  class I chitinase                                     53.9    2e-05   
ref|XP_004966507.1|  PREDICTED: chitinase 1-like                      53.5    3e-05   
pdb|1ULN|A  Chain A, Crystal Structure Of Pokeweed Lectin-D1          50.4    3e-05   
sp|P52405.1|CHI3_SOLTU  RecName: Full=Endochitinase 3; Flags: Pre...  53.5    3e-05   Solanum tuberosum [potatoes]
sp|P83790.1|LED2_PHYAM  RecName: Full=Lectin-D2; AltName: Full=PL-D2  50.4    3e-05   Phytolacca americana [common pokeberry]
emb|CAA61278.1|  chitinase class 1                                    53.5    3e-05   Vigna unguiculata
ref|XP_006367376.1|  PREDICTED: endochitinase-like                    53.1    3e-05   
gb|AFK37675.1|  unknown                                               52.4    3e-05   
ref|XP_006828989.1|  hypothetical protein AMTR_s00001p00243300        53.1    3e-05   
gb|AAT40736.1|  basic chitinase 2-1                                   53.1    3e-05   Nepenthes khasiana
ref|XP_006408160.1|  hypothetical protein EUTSA_v10021503mg           52.4    3e-05   
gb|KEH24556.1|  Chitinase / Hevein / PR-4 / Wheatwin2                 52.4    3e-05   
gb|ADI79351.1|  chitinase                                             53.1    3e-05   
sp|P0DKH7.1|AMP1_FAGES  RecName: Full=Antimicrobial peptide 1; Sh...  49.3    3e-05   
gb|KDP43737.1|  hypothetical protein JCGZ_22364                       53.1    4e-05   
gb|ACN55075.1|  chitinase Ib                                          53.1    4e-05   Chimonanthus praecox [wintersweet]
emb|CAA38249.1|  endochitinase                                        53.1    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058626.1|  Os06g0726100                                     53.1    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KEH20361.1|  Chitinase (Class Ib) / Hevein                         53.1    4e-05   
sp|P0DKH8.1|AMP2_FAGES  RecName: Full=Antimicrobial peptide 2; Sh...  49.3    4e-05   
ref|XP_002319077.1|  class 4 pathogenesis-related family protein      52.0    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011038565.1|  PREDICTED: pathogenesis-related protein PR-4...  52.0    4e-05   
ref|XP_006387602.1|  hypothetical protein POPTR_0790s00210g           52.8    4e-05   
gb|EAZ02415.1|  hypothetical protein OsI_24517                        52.8    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009392870.1|  PREDICTED: chitinase 1-like                      52.8    5e-05   
gb|AAP03089.1|  class Ib chitinase 2                                  52.8    5e-05   Galega orientalis
gb|ACC68684.1|  chitinase                                             52.8    5e-05   Crocus sativus [saffron crocus]
ref|XP_010675192.1|  PREDICTED: basic endochitinase                   52.8    5e-05   
ref|XP_006828995.1|  hypothetical protein AMTR_s00001p00244240        51.6    5e-05   
gb|AES74343.2|  Chitinase (Class I) / Hevein                          52.8    5e-05   
gb|ACJ06634.3|  class I chitinase                                     52.8    5e-05   Musa AB Group
ref|XP_009383118.1|  PREDICTED: LOW QUALITY PROTEIN: lectin-like      51.6    5e-05   
gb|AAG23965.1|AF307511_1  class I chitinase                           52.8    5e-05   Vigna unguiculata subsp. sesquipedalis [yard-long-bean]
gb|AIW39714.1|  class I chitinase                                     52.8    5e-05   
sp|Q9AYP9.1|LECC_PHYAM  RecName: Full=Lectin-C; AltName: Full=PL-...  51.6    5e-05   Phytolacca americana [common pokeberry]
ref|XP_002994789.1|  hypothetical protein SELMODRAFT_139127           49.3    5e-05   
ref|XP_002312919.2|  hypothetical protein POPTR_0009s14420g           52.8    5e-05   Populus trichocarpa [western balsam poplar]
gb|ABK96628.1|  unknown                                               52.8    5e-05   Populus trichocarpa x Populus deltoides
gb|ACJ62150.1|  chitinase                                             52.8    6e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003604092.1|  Endochitinase                                    52.8    6e-05   
gb|AFK35074.1|  unknown                                               52.8    6e-05   
gb|ACJ62118.1|  chitinase                                             52.8    6e-05   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CDY50344.1|  BnaC01g38390D                                        52.8    6e-05   
gb|AFY08283.1|  class Ia chitinase                                    52.4    6e-05   
emb|CAB01591.1|  endochitinase                                        52.4    6e-05   Persea americana
gb|AAB36369.1|  mitogen 4, Pa-4=wheat germ agglutinin homolog         50.1    7e-05   
gb|KDO54390.1|  hypothetical protein CISIN_1g043941mg                 49.3    7e-05   
gb|ABD92819.1|  class Ib chitinase                                    52.4    7e-05   Limonium bicolor
gb|ACE79210.1|  chi31                                                 52.4    7e-05   Limonium bicolor
gb|KDP25869.1|  hypothetical protein JCGZ_22899                       52.4    7e-05   
ref|XP_006367374.1|  PREDICTED: endochitinase-like                    52.4    7e-05   
ref|XP_008645097.1|  PREDICTED: LOW QUALITY PROTEIN: basic endoch...  52.4    7e-05   
ref|XP_004287744.1|  PREDICTED: endochitinase-like                    52.4    8e-05   
sp|P51613.1|CHIB_VITVI  RecName: Full=Basic endochitinase; Flags:...  52.0    8e-05   Vitis vinifera
ref|XP_008440900.1|  PREDICTED: chitinase 1-like isoform X2           52.0    9e-05   
ref|XP_009344657.1|  PREDICTED: endochitinase-like                    52.0    9e-05   
gb|EMS64751.1|  Agglutinin isolectin 2                                51.2    9e-05   
gb|AHF88836.1|  chitinase-like protein                                52.0    9e-05   
ref|XP_006298619.1|  hypothetical protein CARUB_v10014707mg           51.2    9e-05   
gb|KHN15004.1|  Endochitinase                                         51.2    9e-05   
ref|XP_010418259.1|  PREDICTED: hevein-like preproprotein             50.8    9e-05   
gb|AAP03088.1|  class Ia chitinase                                    52.0    1e-04   Galega orientalis
dbj|BAJ89873.1|  predicted protein                                    52.0    1e-04   
gb|KFK37886.1|  hypothetical protein AALP_AA3G042000                  51.2    1e-04   
ref|XP_006387093.1|  hypothetical protein POPTR_1884s00200g           49.7    1e-04   
pdb|1ULK|A  Chain A, Crystal Structure Of Pokeweed Lectin-C           49.7    1e-04   
ref|XP_009392872.1|  PREDICTED: chitinase 1-like                      52.0    1e-04   
ref|XP_002488863.1|  hypothetical protein SORBIDRAFT_3219s002010      51.6    1e-04   Sorghum bicolor [broomcorn]
ref|XP_004134833.1|  PREDICTED: basic endochitinase A-like            51.6    1e-04   
ref|XP_011038567.1|  PREDICTED: pathogenesis-related protein PR-4...  50.8    1e-04   
emb|CDY42151.1|  BnaC05g40680D                                        51.6    1e-04   
gb|AAP35269.1|  hevein-like antimicrobial peptide                     51.6    1e-04   Euonymus europaeus
ref|XP_011038566.1|  PREDICTED: pathogenesis-related protein PR-4...  50.8    1e-04   
gb|AAO63572.1|  HEV1.2                                                50.8    1e-04   Hevea brasiliensis [jebe]
emb|CCX05422.1|  Similar to Antimicrobial protein PN-AMP1; acc. n...  51.2    1e-04   
ref|XP_006407328.1|  hypothetical protein EUTSA_v10021149mg           51.6    1e-04   
emb|CBI29572.3|  unnamed protein product                              48.9    1e-04   
gb|ACP43629.2|  chitinase                                             51.6    1e-04   Musa AB Group
ref|XP_006379300.1|  hypothetical protein POPTR_0009s14410g           51.6    1e-04   
gb|AAF69778.1|AF135138_1  class I chitinase                           51.6    1e-04   Turritis glabra
sp|P21226.2|CHI2_PEA  RecName: Full=Endochitinase A2; Flags: Prec...  51.6    1e-04   Pisum sativum [garden pea]
gb|AAA34070.1|  endochitinase precursor (EC 3.2.1.14)                 51.6    1e-04   Nicotiana tabacum [American tobacco]
gb|AHF88837.1|  chitinase-like protein                                51.6    1e-04   
gb|EMT27215.1|  Basic endochitinase A                                 51.6    1e-04   
ref|XP_004248637.1|  PREDICTED: endochitinase 4                       51.6    1e-04   
ref|XP_004135003.1|  PREDICTED: endochitinase-like                    51.6    1e-04   
ref|XP_004163409.1|  PREDICTED: endochitinase-like                    51.6    1e-04   
sp|Q09023.1|CHI2_BRANA  RecName: Full=Endochitinase CH25; Flags: ...  51.6    1e-04   Brassica napus [oilseed rape]
emb|CDY40674.1|  BnaC03g33900D                                        50.8    1e-04   
ref|XP_010687455.1|  PREDICTED: endochitinase A-like                  51.2    1e-04   
ref|XP_009134785.1|  PREDICTED: hevein-like preproprotein             50.8    1e-04   
ref|XP_004973075.1|  PREDICTED: root-specific lectin-like             48.5    1e-04   
gb|ACM45713.1|  class I chitinase                                     51.2    1e-04   Pyrus pyrifolia [sha li]
ref|XP_011032398.1|  PREDICTED: pathogenesis-related protein PR-4...  50.4    2e-04   
gb|AAO63571.1|  HEV1.1                                                50.4    2e-04   Hevea brasiliensis [jebe]
ref|XP_003547902.2|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...  51.6    2e-04   
gb|AFK48556.1|  unknown                                               50.4    2e-04   
sp|Q39799.1|CHI1_GOSHI  RecName: Full=Endochitinase 1; Flags: Pre...  51.2    2e-04   Gossypium hirsutum [American cotton]
gb|AAA34214.1|  chitinase                                             51.2    2e-04   Ulmus americana
gb|AET95643.1|  chitinase                                             51.2    2e-04   
ref|XP_006379301.1|  hypothetical protein POPTR_0009s14430g           51.2    2e-04   
gb|AAB41324.1|  class I chitinase                                     51.2    2e-04   Medicago sativa [alfalfa]
gb|ACX42261.1|  chitinase                                             51.2    2e-04   Camellia sinensis [black tea]
gb|AAV66072.1|  chitinase                                             51.2    2e-04   Medicago sativa [alfalfa]
sp|Q9FRV1.1|CHIA_SECCE  RecName: Full=Basic endochitinase A; AltN...  51.2    2e-04   Secale cereale
emb|CAC81812.1|  putative chitinase                                   51.2    2e-04   Musa acuminata [banana]
ref|XP_011045258.1|  PREDICTED: basic endochitinase-like              51.2    2e-04   
ref|XP_008440899.1|  PREDICTED: endochitinase-like isoform X1         51.2    2e-04   
gb|AAM49597.2|  chitinase                                             51.2    2e-04   Leucaena leucocephala [cassie]
gb|ABZ80406.1|  chitinase class I                                     51.2    2e-04   Casuarina glauca
ref|NP_001265906.1|  endochitinase A2-like precursor                  51.2    2e-04   
ref|XP_001767856.1|  predicted protein                                50.4    2e-04   
gb|KDO71433.1|  hypothetical protein CISIN_1g020187mg                 50.8    2e-04   
ref|XP_009120632.1|  PREDICTED: endochitinase CH25-like               50.8    2e-04   
ref|XP_004134832.1|  PREDICTED: endochitinase-like                    50.8    2e-04   
gb|ACL81177.1|  chitinase                                             50.8    2e-04   Chimonanthus praecox [wintersweet]
emb|CAA71402.1|  chitinase                                            50.8    2e-04   Medicago truncatula
ref|XP_004163402.1|  PREDICTED: endochitinase-like                    50.8    2e-04   
ref|NP_001055477.1|  Os05g0399400                                     50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97966.1|  hypothetical protein OsI_19884                        50.8    2e-04   Oryza sativa Indica Group [Indian rice]
gb|AAR15893.1|  chitinase                                             50.8    2e-04   Oryza sativa [red rice]
gb|AAL34318.1|L40337_1  chitinase                                     50.8    2e-04   Oryza sativa [red rice]
gb|AAA51377.1|  chitinase                                             50.8    2e-04   Oryza sativa [red rice]
ref|XP_002531287.1|  Wound-induced protein WIN2 precursor, putative   50.1    2e-04   Ricinus communis
ref|NP_001238561.1|  chitinase class I precursor                      50.8    2e-04   
ref|XP_002439136.1|  hypothetical protein SORBIDRAFT_09g001210        50.8    2e-04   Sorghum bicolor [broomcorn]
gb|KHN00426.1|  Endochitinase                                         50.8    2e-04   
gb|ABK21438.1|  unknown                                               50.8    2e-04   
gb|KHN15003.1|  Endochitinase                                         50.8    2e-04   
ref|XP_007137307.1|  hypothetical protein PHAVU_009G1165001g          48.5    3e-04   
ref|NP_001267891.1|  basic endochitinase precursor                    50.8    3e-04   
ref|XP_006384601.1|  hypothetical protein POPTR_0004s18900g           50.4    3e-04   
gb|ABD64683.1|  chitinase class I basic                               50.4    3e-04   
ref|XP_010103320.1|  Endochitinase 1                                  50.4    3e-04   
ref|XP_006367375.1|  PREDICTED: endochitinase-like                    50.4    3e-04   
gb|EMT27216.1|  Basic endochitinase A                                 50.4    3e-04   
ref|NP_001275122.1|  class I chitinase precursor                      50.4    3e-04   
dbj|BAB13369.1|  class I chitinase                                    50.4    3e-04   
gb|AAF25602.1|AF153195_1  class I chitinase                           50.4    3e-04   
gb|ACN96317.1|  class 1 chitinase                                     50.4    3e-04   
sp|P29031.2|CHIB_POPTR  RecName: Full=Acidic endochitinase WIN6.2...  50.4    3e-04   
ref|XP_010465019.1|  PREDICTED: basic endochitinase B-like            50.4    3e-04   
ref|XP_010242847.1|  PREDICTED: endochitinase A-like                  50.4    3e-04   
ref|XP_006298138.1|  hypothetical protein CARUB_v10014185mg           50.4    3e-04   
ref|NP_001284473.1|  endochitinase-like precursor                     50.4    3e-04   
ref|XP_010465018.1|  PREDICTED: basic endochitinase B-like            50.4    3e-04   
dbj|BAA82818.1|  basic endochitinase                                  50.4    3e-04   
sp|P05315.1|CHIT_SOLTU  RecName: Full=Endochitinase; Flags: Precu...  50.4    3e-04   
gb|ABK55751.1|  endochitinase MCHT-2                                  49.3    3e-04   
ref|XP_003554704.1|  PREDICTED: pro-hevein                            49.7    3e-04   
dbj|BAA82824.1|  basic endochitinase                                  50.4    4e-04   
dbj|BAA82810.1|  basic endochitinase                                  50.4    4e-04   
dbj|BAA82814.1|  basic endochitinase                                  50.4    4e-04   
ref|NP_566426.2|  basic chitinase B                                   50.4    4e-04   
gb|EEE63651.1|  hypothetical protein OsJ_18468                        50.1    4e-04   
gb|ADO24163.1|  class I pathogenesis-related protein 4                49.7    4e-04   
ref|XP_002441062.1|  hypothetical protein SORBIDRAFT_09g019660        50.4    4e-04   
gb|KGN48980.1|  hypothetical protein Csa_6G508020                     50.4    4e-04   
gb|ACU14858.1|  unknown                                               49.7    4e-04   
ref|XP_002884907.1|  basic endochitinase                              50.1    4e-04   
gb|KHN43185.1|  Wound-induced protein WIN2                            48.1    4e-04   
gb|ADN37756.1|  chitinase                                             50.4    4e-04   
ref|XP_010544253.1|  PREDICTED: endochitinase-like isoform X1         50.4    4e-04   
gb|AAP35270.1|  hevein-like antimicrobial peptide                     50.1    4e-04   
ref|XP_002312916.2|  hypothetical protein POPTR_0009s14400g           50.1    4e-04   
gb|AAT40738.1|  basic chitinase 2-2                                   50.1    4e-04   
dbj|BAA82826.1|  basic endochitinase                                  50.1    4e-04   
ref|XP_010499059.1|  PREDICTED: basic endochitinase B                 50.1    4e-04   
sp|P24091.1|CHI2_TOBAC  RecName: Full=Endochitinase B; Short=CHN-...  50.1    4e-04   
prf||1710349A  basic chitinase                                        50.1    4e-04
pir||S18750  chitinase (EC 3.2.1.14) precursor - western balsam p...  50.1    4e-04
ref|XP_009775455.1|  PREDICTED: endochitinase B                       50.1    4e-04   
ref|XP_009146610.1|  PREDICTED: endochitinase CH25                    50.1    4e-04   
gb|AAY82488.1|  chitinase                                             50.1    4e-04   
gb|AAB49688.1|  wound-induced protein                                 49.3    4e-04   
ref|XP_003575658.2|  PREDICTED: agglutinin isolectin 3-like           49.7    4e-04   
ref|XP_010102291.1|  Wound-induced protein WIN2                       49.3    4e-04   
gb|AAF69780.1|AF135140_1  class I chitinase                           50.1    5e-04   
ref|XP_010524916.1|  PREDICTED: hevein-like preproprotein             49.3    5e-04   
gb|AAK96819.1|  basic chitinase                                       50.1    5e-04   
ref|XP_006425314.1|  hypothetical protein CICLE_v10026057mg           50.1    5e-04   
gb|AHX74093.1|  putative chitodextrinase                              50.1    5e-04   
gb|AAF69777.1|AF135137_1  class I chitinase                           50.1    5e-04   
dbj|BAO09558.1|  class I chitinase a                                  50.1    5e-04   
ref|XP_006828990.1|  hypothetical protein AMTR_s00001p00243570        49.3    5e-04   
gb|AAF69775.1|AF135135_1  class I chitinase                           50.1    5e-04   
gb|AAF69785.1|AF135145_1  class I chitinase                           50.1    5e-04   
ref|XP_007202270.1|  hypothetical protein PRUPE_ppa008859mg           50.1    5e-04   
gb|AAF69792.1|AF135152_1  class I chitinase                           49.7    5e-04   
gb|KDO47621.1|  hypothetical protein CISIN_1g035991mg                 48.1    5e-04   
sp|P52406.1|CHI4_SOLTU  RecName: Full=Endochitinase 4; Flags: Pre...  49.7    5e-04   
dbj|BAO09559.1|  class I chitinase b                                  49.7    5e-04   
gb|AAF69769.1|AF135129_1  class I chitinase                           48.5    5e-04   
emb|CDP01819.1|  unnamed protein product                              49.7    5e-04   
gb|AAD11255.1|  class I chitinase                                     49.7    5e-04   
gb|KHG16133.1|  Endochitinase 1                                       49.7    5e-04   
ref|XP_003569604.1|  PREDICTED: basic endochitinase A-like            49.7    6e-04   
sp|Q39785.2|CHI2_GOSHI  RecName: Full=Endochitinase 2; Flags: Pre...  49.7    6e-04   
ref|XP_010544254.1|  PREDICTED: endochitinase-like isoform X2         49.7    6e-04   
ref|XP_006467052.1|  PREDICTED: LOW QUALITY PROTEIN: endochitinas...  49.7    6e-04   
ref|XP_007030564.1|  Pathogenesis-related protein PR-4B               48.9    6e-04   
gb|KHG21606.1|  Endochitinase 1                                       49.7    6e-04   
dbj|BAG12896.1|  chitinase                                            49.7    6e-04   
gb|AFX67005.1|  wound-induced protein WIN2                            48.9    6e-04   
dbj|BAG28346.1|  chitinase                                            49.7    6e-04   
gb|AAA18585.1|  chitinase                                             49.7    6e-04   
gb|AAF04453.1|AF000964_1  chitinase                                   49.7    6e-04   
dbj|BAK04223.1|  predicted protein                                    48.5    6e-04   
emb|CAB62537.1|  pseudo-hevein                                        48.5    6e-04   
ref|NP_001275628.1|  wound-induced protein WIN2 precursor             48.9    6e-04   
ref|XP_004249000.1|  PREDICTED: endochitinase                         49.7    6e-04   
prf||1901378A  chitinase                                              49.7    6e-04
gb|AAF04454.1|AF000966_1  chitinase                                   49.7    6e-04   
ref|XP_010232173.1|  PREDICTED: cysteine-rich receptor-like prote...  49.7    6e-04   
ref|XP_011045270.1|  PREDICTED: acidic endochitinase WIN6             49.7    7e-04   
emb|CCD30740.1|  WAMP-1, antimicrobial peptide                        47.4    7e-04   
emb|CCD30739.1|  WAMP-1, antimicrobial peptide                        47.4    7e-04   
gb|KFK38603.1|  basic endochitinase                                   49.7    7e-04   
ref|XP_002976214.1|  hypothetical protein SELMODRAFT_35272            48.1    7e-04   
ref|XP_004248635.1|  PREDICTED: endochitinase 3-like                  49.3    7e-04   
emb|CCD30733.1|  WAMP-1                                               47.4    7e-04   
sp|P29032.1|CHIC_POPTR  RecName: Full=Acidic endochitinase WIN6.2...  47.4    7e-04   
ref|XP_010544255.1|  PREDICTED: endochitinase-like isoform X3         49.3    7e-04   
sp|P80359.1|HEVP_HEVBR  RecName: Full=Pseudo-hevein; AltName: Ful...  45.8    7e-04   
emb|CAC42881.1|  putative class I chitinase                           49.3    8e-04   
emb|CAD24068.1|  class I chitinase                                    49.3    8e-04   
sp|P06215.1|CHIT_PHAVU  RecName: Full=Endochitinase; Flags: Precu...  49.3    8e-04   
ref|XP_010103322.1|  Endochitinase 1                                  49.3    9e-04   
gb|EMS53669.1|  Agglutinin isolectin 2                                48.5    0.001   
ref|XP_002973328.1|  hypothetical protein SELMODRAFT_99416            46.6    0.001   



>gb|AAA98238.1| antifungal protein [Ipomoea nil]
 gb|AAB18152.1| antifungal protein [Ipomoea nil]
Length=91

 Score = 90.9 bits (224),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  73   MKYFTMflvlfalanlllTPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAGc  252
            MKY TMF+VL  L +LLLTPTTIMAQQCG QASGRLC NGLCCSQWGYCGSTAAYCGAGC
Sbjct  1    MKYCTMFIVLLGLGSLLLTPTTIMAQQCGRQASGRLCGNGLCCSQWGYCGSTAAYCGAGC  60

Query  253  qsqckstaaastttttanqstaksDPAGGAN  345
            QSQCKSTAA+STTTTTANQSTAKSDPAGGAN
Sbjct  61   QSQCKSTAASSTTTTTANQSTAKSDPAGGAN  91



>gb|AAA98236.1| antifungal protein [Ipomoea nil]
 gb|AAA98237.1| antifungal protein [Ipomoea nil]
Length=92

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 79/92 (86%), Gaps = 1/92 (1%)
 Frame = +1

Query  73   MKYFTMflvlfalanlllTPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG-  249
            MK+ TMFLV+ ALA+LLLTP+TIMAQQCGSQA GRLC NGLCCSQWGYCGSTAAYCGAG 
Sbjct  1    MKFCTMFLVVLALASLLLTPSTIMAQQCGSQARGRLCGNGLCCSQWGYCGSTAAYCGAGC  60

Query  250  cqsqckstaaastttttanqstaksDPAGGAN  345
                  + A+A+ TTTTANQSTAKSDPAGGAN
Sbjct  61   QSQCKSTAASATDTTTTANQSTAKSDPAGGAN  92



>sp|P81591.1|AMP_IPONI RecName: Full=Antimicrobial protein PN-AMP1; Contains: RecName: 
Full=Antimicrobial protein PN-AMP2 [Ipomoea nil]
Length=41

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QQCG QASGRLC N LCCSQWGYCGSTA+YCGAG
Sbjct  1    QQCGRQASGRLCGNRLCCSQWGYCGSTASYCGAG  34



>gb|AFX66979.1| class I chitinase [Solanum tuberosum]
Length=63

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCGSQA G LCANGLCCS++GYCG+T AYCG+G
Sbjct  23   AQQCGSQAGGALCANGLCCSEYGYCGTTTAYCGSG  57



>dbj|BAF47270.1| chitinase C [Ananas comosus]
Length=333

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++AQQCGSQA G LC  GLCCSQWGYCG T  YCG G
Sbjct  20   VLAQQCGSQAGGALCPGGLCCSQWGYCGDTLPYCGDG  56



>ref|XP_001759883.1| predicted protein [Physcomitrella patens]
 gb|EDQ75387.1| predicted protein [Physcomitrella patens]
Length=117

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I+AQQCG+QA+G +CANGLCCS++GYCG+T+ YCG G
Sbjct  17   IVAQQCGTQANGAVCANGLCCSKYGYCGTTSDYCGTG  53



>ref|XP_010941400.1| PREDICTED: basic endochitinase A-like isoform X2 [Elaeis guineensis]
Length=330

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +AQQCGSQA G+ C NGLCCSQ+GYCGST+AYCG G
Sbjct  18   LAQQCGSQAGGQTCPNGLCCSQYGYCGSTSAYCGDG  53



>ref|XP_010941404.1| PREDICTED: chitinase 1-like [Elaeis guineensis]
Length=308

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +AQQCGSQA G+ C NGLCCSQ+GYCGST+AYCG G
Sbjct  18   LAQQCGSQAGGKTCPNGLCCSQFGYCGSTSAYCGNG  53



>ref|XP_010941399.1| PREDICTED: chitinase 1-like isoform X1 [Elaeis guineensis]
Length=336

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +AQQCGSQA G+ C NGLCCSQ+GYCGST+AYCG G
Sbjct  18   LAQQCGSQAGGQTCPNGLCCSQYGYCGSTSAYCGDG  53



>ref|XP_010941401.1| PREDICTED: 26 kDa endochitinase 1-like isoform X3 [Elaeis guineensis]
Length=326

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 12/91 (13%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAGcqsqckstaaastttttanqstak  321
            +AQQCGSQA G+ C NGLCCSQ+G CGST+AYCG GCQSQC     ++ + T        
Sbjct  18   LAQQCGSQAGGKTCPNGLCCSQFGSCGSTSAYCGNGCQSQCSGGGGSTPSPT--------  69

Query  322  sDPAGGAN*S--ISSIMYDHLHHARTHADMP  408
              P+GG+  +  ISS ++D +   R  AD P
Sbjct  70   --PSGGSGVASLISSSLFDQMLKHRNDADCP  98



>gb|AHB62682.1| putative VF chitinase I [Dionaea muscipula]
Length=314

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +A+QCGSQA G LC NGLCCSQ+G+CG+T+AYCGAG
Sbjct  19   LAEQCGSQAGGALCPNGLCCSQYGWCGTTSAYCGAG  54



>ref|XP_002270220.2| PREDICTED: endochitinase-like [Vitis vinifera]
Length=198

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I AQQCG QA G+ CA GLCCSQ+GYCGST  YCG G
Sbjct  17   ISAQQCGRQARGKRCAGGLCCSQYGYCGSTRPYCGVG  53



>ref|XP_007046548.1| Basic chitinase [Theobroma cacao]
 gb|EOX90705.1| Basic chitinase [Theobroma cacao]
Length=311

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            + AQQCGSQA G LCANGLCCSQ+G+CG+T  YCG G
Sbjct  19   VSAQQCGSQAGGALCANGLCCSQFGWCGNTPEYCGTG  55



>gb|ACJ23248.1| class I chitinase [Festuca arundinacea]
Length=316

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QQCGSQA G  CAN LCCSQ+GYCGST+AYCGAG
Sbjct  22   QQCGSQAGGATCANCLCCSQYGYCGSTSAYCGAG  55



>gb|AAP03087.1| class Ib chitinase [Galega orientalis]
Length=326

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+G +C NGLCCSQ+GYCG+T  YCGAG
Sbjct  24   AEQCGSQANGAVCPNGLCCSQFGYCGNTDQYCGAG  58



>ref|XP_003629192.1| Endochitinase [Medicago truncatula]
 gb|AET03668.1| Chitinase (Class Ib) / Hevein [Medicago truncatula]
Length=320

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCG QA+G +CAN LCCSQ+GYCG+TA YCGAG
Sbjct  23   AQQCGRQANGAVCANRLCCSQFGYCGNTADYCGAG  57



>gb|AAA32640.1| chitinase, partial [Allium sativum]
Length=302

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            T   AQQCGSQ SG LC+NGLCCSQ+GYCG+   YCG G
Sbjct  9    TNSYAQQCGSQGSGALCSNGLCCSQYGYCGNGGPYCGTG  47



>ref|XP_008812110.1| PREDICTED: chitinase 3-like [Phoenix dactylifera]
Length=319

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +AQQCGSQA G  C NGLCCSQ+GYCGST+AYC  G
Sbjct  18   LAQQCGSQAGGTTCPNGLCCSQYGYCGSTSAYCSTG  53



>gb|AAG16225.2|AF287016_1 hevein [Hevea brasiliensis]
Length=50

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +A+QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  16   IAEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  48



>ref|XP_009394061.1| PREDICTED: endochitinase-like [Musa acuminata subsp. malaccensis]
Length=313

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 6/66 (9%)
 Frame = +1

Query  52   IHKLKEKMKYFTMflvlfalanlllTPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTA  231
            + K K+KMK   + L+  A           +A+QCG+QA G LC  GLCCSQ+G+CGST 
Sbjct  1    MQKQKQKMKILFLTLLSVAALFGG------LAEQCGTQAGGALCPGGLCCSQYGFCGSTE  54

Query  232  AYCGAG  249
            AYCG+G
Sbjct  55   AYCGSG  60



>ref|XP_006657361.1| PREDICTED: chitinase 1-like [Oryza brachyantha]
Length=262

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              + ++QCGSQA G LC N LCCS+WG+CGST+ YCGAG
Sbjct  15   VAVRSEQCGSQAGGALCPNCLCCSKWGWCGSTSDYCGAG  53



>gb|AAR18735.1| chitinase [Bambusa oldhamii]
Length=334

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCGSQA G  C + LCCSQWGYCGSTA YCG G
Sbjct  20   AQQCGSQAGGATCPDCLCCSQWGYCGSTADYCGDG  54



>gb|AAC16010.1| acidic chitinase [Elaeagnus umbellata]
Length=335

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCG Q  G LC+ GLCCSQWGYCG+T  YCG G
Sbjct  22   AQQCGQQLGGALCSGGLCCSQWGYCGNTDPYCGDG  56



>gb|AAL73184.1| antifungal protein [Capsicum annuum]
Length=85

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            T   AQ CG QA  R+CAN LCCSQ+G+CG+T  YCGAG
Sbjct  16   TRTSAQNCGRQAGRRVCANRLCCSQFGFCGTTREYCGAG  54



>gb|ACB05666.1| chitin binding protein [Capsicum annuum]
Length=85

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            T   AQ CG QA  R+CAN LCCSQ+G+CG+T  YCGAG
Sbjct  16   TRTSAQNCGRQAGRRVCANRLCCSQFGFCGTTREYCGAG  54



>ref|XP_008812099.1| PREDICTED: chitinase 1-like [Phoenix dactylifera]
Length=319

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGA  246
            +AQQCGSQA G  C + LCCSQ+GYCGST+AYCGA
Sbjct  18   LAQQCGSQAGGTTCPDDLCCSQYGYCGSTSAYCGA  52



>emb|CBI18789.3| unnamed protein product [Vitis vinifera]
Length=104

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G LC+ GLCCSQ+GYCGST AYC  G
Sbjct  52   EQCGSQAGGALCSGGLCCSQYGYCGSTPAYCSTG  85



>dbj|BAC16357.1| hevein-like protein [Eutrema japonicum]
Length=231

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T  T+  QQCG QA G+ C  G+CCSQWGYCG+TA YC
Sbjct  15   TVATVAGQQCGRQAGGQTCPGGICCSQWGYCGTTADYC  52



>emb|CDX73819.1| BnaA03g32280D [Brassica napus]
Length=512

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QQCG QA G LC NGLCCS++G+CG+T AYCG G
Sbjct  21   QQCGRQAQGALCPNGLCCSEYGWCGTTEAYCGRG  54



>ref|XP_004509418.1| PREDICTED: endochitinase-like [Cicer arietinum]
Length=318

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG+QASG +C NGLCCSQ GYCG+T  YCG G
Sbjct  22   AEQCGTQASGAVCPNGLCCSQHGYCGTTDPYCGQG  56



>sp|P02877.2|HEVE_HEVBR RecName: Full=Pro-hevein; AltName: Full=Major hevein; Contains: 
RecName: Full=Hevein; AltName: Allergen=Hev b 6; Contains: 
RecName: Full=Win-like protein; Flags: Precursor [Hevea brasiliensis]
 gb|AAA33357.1| hevein (HEV1) precursor [Hevea brasiliensis]
Length=204

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +A+QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  16   IAEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  48



>gb|AAO63573.1| HEV2.1 [Hevea brasiliensis]
Length=204

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +A+QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  16   IAEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  48



>gb|AAO63574.1| HEV2.2 [Hevea brasiliensis]
 gb|ABW34946.1| hevein [Hevea brasiliensis]
Length=204

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +A+QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  16   IAEQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  48



>ref|XP_006487791.1| PREDICTED: hevein-like preproprotein-like [Citrus sinensis]
 ref|XP_006487792.1| PREDICTED: hevein-like preproprotein-like [Citrus sinensis]
Length=193

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T   AQQCG QA GR CAN LCCSQ+GYCGST  YC
Sbjct  16   TIAAAQQCGRQAGGRTCANNLCCSQYGYCGSTDEYC  51



>gb|EAY90475.1| hypothetical protein OsI_12063 [Oryza sativa Indica Group]
Length=240

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  19   VHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>gb|ACJ62151.1| chitinase [Zea mays subsp. parviglumis]
Length=323

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             P    A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   VPVPARAEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  58



>emb|CDY00776.1| BnaC03g37600D [Brassica napus]
Length=328

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             QQCG QA G LC NGLCCSQ+G+CG+T AYCG G
Sbjct  20   GQQCGRQAQGALCPNGLCCSQYGWCGTTEAYCGRG  54



>gb|AAT40019.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62161.1| chitinase [Zea mays subsp. parviglumis]
Length=323

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             P    A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   VPVPARAEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  58



>gb|AFK37149.1| unknown [Lotus japonicus]
Length=324

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGA  246
            +A+QCG+QA G +C NGLCCS++GYCG+T +YCGA
Sbjct  21   IAEQCGTQAGGAVCPNGLCCSKYGYCGNTDSYCGA  55



>ref|XP_008367944.1| PREDICTED: endochitinase-like [Malus domestica]
Length=233

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C NGLCCSQ+G+CG+T+ YC AG
Sbjct  57   AEQCGSQAGGAVCPNGLCCSQFGWCGTTSDYCAAG  91



>gb|AFK33496.1| unknown [Lotus japonicus]
Length=324

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGA  246
            +A+QCG+QA G +C NGLCCS++GYCG+T +YCGA
Sbjct  21   IAEQCGTQAGGAVCPNGLCCSKYGYCGNTDSYCGA  55



>ref|NP_001142232.1| uncharacterized protein LOC100274400 precursor [Zea mays]
 gb|ACF87946.1| unknown [Zea mays]
Length=261

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>ref|XP_007023212.1| Pathogenesis-related protein PR-4B [Theobroma cacao]
 gb|EOY25834.1| Pathogenesis-related protein PR-4B [Theobroma cacao]
Length=199

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +T  AQQCG QA+GR CAN LCCSQ+GYCG+T  YC
Sbjct  23   STATAQQCGRQAAGRTCANNLCCSQFGYCGTTNEYC  58



>ref|XP_002264647.1| PREDICTED: pathogenesis-related protein PR-4 [Vitis vinifera]
Length=197

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            AQQCG QA GR CAN LCCSQ+GYCG+TA YC
Sbjct  21   AQQCGRQAGGRTCANNLCCSQYGYCGTTAEYC  52



>gb|AAA32641.1| chitinase, partial [Allium sativum]
 prf||2001449A chitinase 1
Length=318

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCGSQA G LC+N LCCS++GYCGST  YCG G
Sbjct  17   AQQCGSQAGGALCSNRLCCSKFGYCGSTDPYCGTG  51



>gb|AFW75731.1| chitinase2 [Zea mays]
Length=261

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>prf||1712313A basic chitinase
Length=336

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  19   VHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>sp|P36907.1|CHIX_PEA RecName: Full=Endochitinase; Flags: Precursor [Pisum sativum]
 emb|CAA45359.1| chitinase [Pisum sativum]
Length=320

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C NGLCCS++G+CGST  YCG G
Sbjct  23   AEQCGSQAGGAVCPNGLCCSKFGFCGSTDPYCGDG  57



>gb|ACJ38195.1| chitinase [Malus hupehensis]
Length=316

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I A+QCGSQA G +C NGLCCSQ+G+CG+T+ YC  G
Sbjct  17   ISAEQCGSQAGGAVCPNGLCCSQYGWCGTTSDYCATG  53



>ref|XP_009344658.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=323

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I A+QCGSQA G +C NGLCCSQ+G+CG+T+ YC  G
Sbjct  17   ISAEQCGSQAGGAVCPNGLCCSQYGWCGTTSDYCATG  53



>emb|CAA82849.1| chitinase class I [Oryza sativa]
 prf||2014210A chitinase class I:ISOTYPE=CH16
Length=319

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              +  +QCGSQA G LC N LCCSQ+G+CGST+AYCG+G
Sbjct  16   VAVPPEQCGSQAGGALCPNCLCCSQYGWCGSTSAYCGSG  54



>gb|AFK47528.1| unknown [Medicago truncatula]
 gb|AET03667.2| Chitinase (Class Ib) / Hevein [Medicago truncatula]
Length=320

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+G LC NGLCCS++G+CG+T  YCG G
Sbjct  22   AEQCGSQANGALCPNGLCCSKFGFCGNTDQYCGDG  56



>dbj|BAK02041.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90914.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            + AQQCGSQA G  CAN LCCS++GYCGS  AYCGAG
Sbjct  28   VDAQQCGSQAGGARCANCLCCSRFGYCGSGDAYCGAG  64



>ref|XP_008393545.1| PREDICTED: endochitinase-like [Malus domestica]
Length=317

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I A+QCGSQA G +C NGLCCSQ+G+CG+T+ YC  G
Sbjct  17   ISAEQCGSQAGGAVCPNGLCCSQYGWCGTTSDYCATG  53



>ref|XP_008344215.1| PREDICTED: endochitinase-like [Malus domestica]
Length=319

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I A+QCGSQA G +C NGLCCSQ+G+CG+T+ YC  G
Sbjct  17   ISAEQCGSQAGGAVCPNGLCCSQYGWCGTTSDYCATG  53



>gb|AFK35483.1| unknown [Medicago truncatula]
Length=320

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+G LC NGLCCS++G+CG+T  YCG G
Sbjct  22   AEQCGSQANGALCPNGLCCSKFGFCGNTDQYCGDG  56



>gb|EAY90476.1| hypothetical protein OsI_12064 [Oryza sativa Indica Group]
Length=337

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  17   AAVHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>ref|XP_001781689.1| predicted protein [Physcomitrella patens]
 gb|EDQ53502.1| predicted protein [Physcomitrella patens]
Length=67

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             + AQ CGSQA G  C N LCCSQ+GYCG T+AYC +G
Sbjct  28   VVSAQTCGSQAGGAKCQNNLCCSQYGYCGQTSAYCDSG  65



>ref|XP_006424014.1| hypothetical protein CICLE_v10029327mg [Citrus clementina]
 gb|ESR37254.1| hypothetical protein CICLE_v10029327mg [Citrus clementina]
Length=193

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            AQQCG QA GR CAN LCCSQ+GYCGST  YC
Sbjct  20   AQQCGRQAGGRTCANNLCCSQYGYCGSTDEYC  51



>ref|XP_006487790.1| PREDICTED: hevein-like preproprotein-like [Citrus sinensis]
Length=193

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            AQQCG QA GR CAN LCCSQ+GYCGST  YC
Sbjct  20   AQQCGRQAGGRTCANNLCCSQYGYCGSTDEYC  51



>gb|AAA56787.1| chitinase [Hordeum vulgare]
Length=332

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             + AQQCGSQA G  C N LCCS++GYCGST+ YCGAG
Sbjct  24   VVRAQQCGSQAGGATCPNCLCCSRFGYCGSTSDYCGAG  61



>ref|XP_006424015.1| hypothetical protein CICLE_v10029328mg [Citrus clementina]
 gb|ESR37255.1| hypothetical protein CICLE_v10029328mg [Citrus clementina]
Length=193

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            AQQCG QA GR CAN LCCSQ+GYCGST  YC
Sbjct  20   AQQCGRQAGGRTCANNLCCSQYGYCGSTDEYC  51



>dbj|BAK04967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             + AQQCGSQA G  C N LCCS++GYCGST+ YCGAG
Sbjct  24   VVRAQQCGSQAGGATCPNCLCCSRFGYCGSTSDYCGAG  61



>gb|AAB01895.1| endochitinase [Castanea sativa]
 emb|CAA64868.1| chitinase Ib [Castanea sativa]
Length=316

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G  CAN LCCSQ+G+CG+TA YCGAG
Sbjct  18   AEQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAG  52



>ref|XP_003629191.1| Endochitinase [Medicago truncatula]
Length=629

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+G LC NGLCCS++G+CG+T  YCG G
Sbjct  22   AEQCGSQANGALCPNGLCCSKFGFCGNTDQYCGDG  56


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+  +C NGLCCS++G+CG+T  YCGAG
Sbjct  342  AEQCGSQANRAVCPNGLCCSKFGWCGTTDQYCGAG  376



>pdb|1Q9B|A Chain A, Crystal Structure Analysis Of Hev B 6.02 (Hevein) At 
1.5 Angstroms Resolution
 pdb|1HEV|A Chain A, Hevein: The Nmr Assignment And An Assessment Of Solution- 
State Folding For The Agglutinin-Toxin Motif
Length=43

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  1    EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  31



>ref|NP_001280823.1| endochitinase-like precursor [Malus domestica]
 gb|ADQ39593.1| class II chitinase [Malus domestica]
Length=317

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C NGLCCSQ+G+CG+T+ YC AG
Sbjct  19   AEQCGSQAGGAVCPNGLCCSQFGWCGTTSDYCAAG  53



>ref|XP_009135234.1| PREDICTED: endochitinase CH25-like [Brassica rapa]
Length=340

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             QQCG QA G LC NGLCCS++G+CG+T AYCG G
Sbjct  20   GQQCGRQAQGALCPNGLCCSEYGWCGTTEAYCGRG  54



>ref|XP_010242848.1| PREDICTED: basic endochitinase-like [Nelumbo nucifera]
Length=319

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++A+QCG QA G LC  GLCCSQ+G+CG+T  YCG G
Sbjct  21   VLAEQCGRQAGGALCPGGLCCSQYGWCGNTGDYCGEG  57



>gb|AFW75728.1| hypothetical protein ZEAMMB73_827760 [Zea mays]
Length=379

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCG+QA G LC + LCCSQWGYCGST  YC  G
Sbjct  60   AQQCGTQAGGALCPDCLCCSQWGYCGSTPDYCTDG  94



>ref|NP_001050373.2| Os03g0418000 [Oryza sativa Japonica Group]
 sp|P25765.2|CHI12_ORYSJ RecName: Full=Chitinase 12; AltName: Full=Basic endochitinase 
2; AltName: Full=Pathogenesis related (PR)-3 chitinase 12; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAP44624.1| putative endochitinase [Oryza sativa Japonica Group]
 gb|AAR01697.1| endochitinase [Oryza sativa Japonica Group]
 gb|ABF96639.1| Basic endochitinase 2 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12287.2| Os03g0418000 [Oryza sativa Japonica Group]
Length=326

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  17   AAVHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>gb|ABD47583.1| chitinase [Musa x paradisiaca]
Length=326

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  19   VHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>gb|EAZ27337.1| hypothetical protein OsJ_11278 [Oryza sativa Japonica Group]
Length=327

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  17   AAVHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>ref|XP_008440903.1| PREDICTED: endochitinase-like [Cucumis melo]
Length=325

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G +C NGLCCSQ+G+CG+  AYCGAG
Sbjct  27   AEQCGWQAGGAVCPNGLCCSQYGWCGTVNAYCGAG  61



>gb|ABU25226.1| chitinase [Oryza sativa Indica Group]
Length=326

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              + A+QCGSQA G +C N LCCSQ+G+CGST+ YCGAG
Sbjct  17   AAVHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAG  55



>emb|CAA60590.1| chitinase [Oryza sativa Indica Group]
Length=322

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G LC N LCCSQ+G+CGST+AYCG+G
Sbjct  21   EQCGSQARGALCPNCLCCSQYGWCGSTSAYCGSG  54



>gb|ACH92946.2| class I chitinase [Dimocarpus longan]
 gb|ADK70388.1| class I chitinase [Dimocarpus longan]
Length=322

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             I A+QCG QA G +C NGLCCSQ G+CGST  YCG G
Sbjct  19   VISAEQCGRQAGGAVCPNGLCCSQHGWCGSTTEYCGTG  56



>pdb|1T0W|A Chain A, 25 Nmr Structures Of Truncated Hevein Of 32 Aa (Hevein-32) 
Complex With N,N,N-Triacetylglucosamina
Length=33

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  1    EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  31



>ref|XP_002269727.2| PREDICTED: LOW QUALITY PROTEIN: basic endochitinase [Vitis vinifera]
Length=324

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G LC+ GLCCSQ+GYCGST AYC  G
Sbjct  22   EQCGSQAGGALCSGGLCCSQYGYCGSTPAYCSTG  55



>emb|CAA82850.1| chitinase class I [Oryza sativa]
Length=308

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G LC N LCCSQ+G+CGST+ YCGAG
Sbjct  18   EQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGAG  51



>prf||2014210B chitinase class I:ISOTYPE=CH6
Length=308

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G LC N LCCSQ+G+CGST+ YCGAG
Sbjct  18   EQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGAG  51



>gb|ACM47315.1| chitinase [Capsicum annuum]
Length=322

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LCA GLCCS++G+CG+T  YCGAG
Sbjct  22   AEQCGSQAGGALCAAGLCCSKFGWCGNTNDYCGAG  56



>gb|EEE66386.1| hypothetical protein OsJ_22712 [Oryza sativa Japonica Group]
Length=235

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGA  246
              +  +QCGSQA G LC N LCCSQ+G+CGST+ YCGA
Sbjct  4    VAVRGEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGA  41



>gb|AAX51197.1| PR-4 like protein [Galega orientalis]
Length=101

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +A+QCG QA G+ C N LCCSQ+GYCG+T  YC
Sbjct  20   TTIAEQCGRQAGGKTCPNNLCCSQYGYCGNTDDYC  54



>gb|ACJ62099.1| chitinase [Zea mays subsp. parviglumis]
Length=313

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  17   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  51



>gb|AAT40033.1| chitinase [Zea diploperennis]
Length=321

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGSG  56



>ref|XP_007137310.1| hypothetical protein PHAVU_009G116700g [Phaseolus vulgaris]
 gb|ESW09304.1| hypothetical protein PHAVU_009G116700g [Phaseolus vulgaris]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCG++A G LC  GLCCSQWG+CGST  YCG G
Sbjct  28   QCGTEAGGALCPRGLCCSQWGWCGSTIDYCGPG  60



>gb|AAT40027.1| chitinase [Zea diploperennis]
Length=321

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGSG  56



>ref|XP_010680951.1| PREDICTED: endochitinase A2-like [Beta vulgaris subsp. vulgaris]
Length=103

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            MA QCG QA G  C  GLCCSQ+GYCG+T+ YCG G
Sbjct  23   MAFQCGRQAGGARCPGGLCCSQYGYCGTTSQYCGRG  58



>ref|XP_006367747.1| PREDICTED: basic 30 kDa endochitinase-like [Solanum tuberosum]
Length=323

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +CA+GLCCS++G+CG+T  YCG G
Sbjct  22   AEQCGSQAGGAICASGLCCSKFGWCGNTDTYCGPG  56



>gb|AAT40030.1| chitinase [Zea diploperennis]
 gb|AAT40031.1| chitinase [Zea diploperennis]
 gb|AAT40034.1| chitinase [Zea diploperennis]
Length=321

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGSG  56



>gb|AAT40029.1| chitinase [Zea diploperennis]
Length=321

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGSG  56



>emb|CAB97002.1| putative class I chitinase [Phaseolus vulgaris]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCG++A G LC  GLCCSQWG+CGST  YCG G
Sbjct  28   QCGTEAGGALCPRGLCCSQWGWCGSTIDYCGPG  60



>gb|AAD34596.1|AF147497_1 endochitinase precursor [Humulus lupulus]
Length=316

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +A+QCG QA G LC NGLCCSQ G+CG+T+ YC AG
Sbjct  18   LAEQCGRQAGGALCPNGLCCSQHGWCGTTSDYCAAG  53



>ref|XP_006375839.1| hypothetical protein POPTR_0013s03920g, partial [Populus trichocarpa]
 gb|ERP53636.1| hypothetical protein POPTR_0013s03920g, partial [Populus trichocarpa]
Length=156

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA G+ CAN LCCSQWG+CG++  +C
Sbjct  17   TAIAQNCGRQAGGQTCANNLCCSQWGFCGTSDDHC  51



>gb|ACJ62110.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62140.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|ACJ62153.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|ACJ62131.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62139.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|ACJ62117.1| chitinase [Zea mays subsp. parviglumis]
Length=318

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  19   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  53



>emb|CAA05978.1| prohevein [Hevea brasiliensis]
Length=187

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +QCG QA G+LC N LCCSQWG+CGST  YC
Sbjct  1    EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYC  31



>gb|ACJ62138.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|ACJ62136.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|AAT40013.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40021.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62092.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62137.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62142.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62145.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62152.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|AAT40014.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40022.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40024.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40025.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40026.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40028.1| chitinase [Zea diploperennis]
 gb|ACJ62089.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62090.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62093.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62096.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62100.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62124.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62126.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62127.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62128.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62129.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62130.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62133.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62135.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62155.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62159.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|ACJ62104.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  52



>gb|AEZ67300.1| chitinase 1 [Populus x canadensis]
Length=318

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC  GLCCSQ+G+CGST  YCG G
Sbjct  21   AEQCGSQAGGALCPGGLCCSQFGWCGSTNDYCGTG  55



>gb|ACJ62111.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62112.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62123.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62134.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|ACJ62108.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|AAT40012.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40018.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40020.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62132.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62154.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62160.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|AAM77665.1|AF523071_1 chitinase KBchit5-3-1 [Leucaena leucocephala]
Length=323

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +A+QCGSQA G LC  GLCCSQ+G+CGS   YCG G
Sbjct  22   LAEQCGSQAGGALCPGGLCCSQFGWCGSNNDYCGPG  57



>gb|ACJ62087.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>ref|XP_006828992.1| hypothetical protein AMTR_s00001p00243780 [Amborella trichopoda]
 gb|ERM96408.1| hypothetical protein AMTR_s00001p00243780 [Amborella trichopoda]
Length=334

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++ QQCG    G +CA GLCCS+WG+CGST  YCG G
Sbjct  24   VLGQQCGRDRGGAVCAGGLCCSKWGFCGSTNDYCGEG  60



>gb|ACJ62088.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62098.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|AAT40032.1| chitinase [Zea diploperennis]
 gb|AAT40035.1| chitinase [Zea diploperennis]
Length=321

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|ACJ62109.1| chitinase [Zea mays subsp. parviglumis]
Length=316

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  17   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  51



>gb|ACJ62121.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62122.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  52



>gb|AAT40015.1| chitinase [Zea mays subsp. parviglumis]
 gb|AAT40023.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62091.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62097.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62101.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62115.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62158.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|AAT40016.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62103.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|ACJ62116.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62147.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  52



>gb|ACJ62107.1| chitinase [Zea mays subsp. parviglumis]
Length=318

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  19   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  53



>gb|ACJ62106.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62119.1| chitinase [Zea mays subsp. parviglumis]
Length=318

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  19   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  53



>gb|ACJ62113.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>gb|ACJ62094.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62125.1| chitinase [Zea mays subsp. parviglumis]
Length=316

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  17   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  51



>gb|ACJ62095.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62102.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62120.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62146.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62148.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62149.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  52



>ref|XP_002312923.2| Chain A family protein [Populus trichocarpa]
 gb|EEE86878.2| Chain A family protein [Populus trichocarpa]
Length=318

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC  GLCCSQ+G+CGST  YCG G
Sbjct  21   AEQCGSQAGGALCPGGLCCSQFGWCGSTNDYCGNG  55



>gb|ACJ62086.1| chitinase [Zea mays subsp. parviglumis]
Length=320

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  21   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  55



>gb|AAB82773.1| ripening-associated protein [Musa acuminata AAA Group]
Length=122

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCG QA G LC  GLCCSQ+G+CG+T  YCG G
Sbjct  12   FAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQG  47



>gb|ACJ62114.1| chitinase [Zea mays subsp. parviglumis]
Length=322

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  23   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  57



>gb|ACJ62105.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  18   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  52



>gb|ACJ62141.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62143.1| chitinase [Zea mays subsp. parviglumis]
 gb|ACJ62144.1| chitinase [Zea mays subsp. parviglumis]
Length=316

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  17   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  51



>gb|AAT40017.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>dbj|BAK01982.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00158.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=323

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QQCGSQA G  CAN +CCSQ+G+CGST+AYCG G
Sbjct  28   QQCGSQAGGAKCANCMCCSQFGFCGSTSAYCGGG  61



>ref|XP_007156221.1| hypothetical protein PHAVU_003G268500g [Phaseolus vulgaris]
 gb|ESW28215.1| hypothetical protein PHAVU_003G268500g [Phaseolus vulgaris]
Length=310

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCG QA G LCAN LCCSQ G+CGST+ YCG G
Sbjct  24   AQQCGRQAGGALCANRLCCSQHGWCGSTSEYCGTG  58



>gb|AFK26307.1| chitinase 1 [Aegiceras corniculatum]
Length=316

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            T  AQQCG    G+LC  GLCCSQ+GYCGST  YCG
Sbjct  17   TTSAQQCGKDVGGKLCDGGLCCSQYGYCGSTKEYCG  52



>gb|ACJ62156.1| chitinase [Zea mays subsp. parviglumis]
Length=309

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  10   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  44



>gb|ADN39439.1| class I chitinase isoform 2, partial [Castanea sativa]
Length=298

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCG QA G  CAN LCCSQ+G+CG+TA YCGAG
Sbjct  1    EQCGRQAGGAACANNLCCSQFGWCGNTAEYCGAG  34



>ref|XP_010242849.1| PREDICTED: basic endochitinase-like [Nelumbo nucifera]
Length=320

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++A+QCG QA G LC  GLCCSQ+G+CG+T  YCG G
Sbjct  23   VLAEQCGWQAGGALCPGGLCCSQYGWCGNTDTYCGEG  59



>gb|ACJ62157.1| chitinase [Zea mays subsp. parviglumis]
Length=312

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  13   AEQCGSQAGGALCPNCLCCSQFGWCGSTSDYCGSG  47



>emb|CAC14015.1| chitinase [Vitis vinifera]
Length=325

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCG QA G LC+ GLCCSQ+GYCGST+AYC  G
Sbjct  23   EQCGRQAGGALCSGGLCCSQYGYCGSTSAYCSTG  56



>gb|AEF58999.1| class I chitinase [Picea engelmannii x Picea glauca]
Length=338

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            A+QCG QASG LC  GLCCS+WG+CG+T A+CG
Sbjct  26   AEQCGRQASGALCPGGLCCSKWGWCGNTEAHCG  58



>gb|ABK24218.1| unknown [Picea sitchensis]
Length=338

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            A+QCG QASG LC  GLCCS+WG+CG+T A+CG
Sbjct  26   AEQCGRQASGALCPGGLCCSKWGWCGNTEAHCG  58



>ref|NP_001234403.1| basic 30 kDa endochitinase precursor [Solanum lycopersicum]
 sp|Q05538.1|CHIC_SOLLC RecName: Full=Basic 30 kDa endochitinase; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA78845.1| chitinase [Solanum lycopersicum]
Length=322

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LCA+GLCCS++G+CG+T  YCG G
Sbjct  22   AEQCGSQAGGALCASGLCCSKFGWCGNTNEYCGPG  56



>emb|CAN62784.1| hypothetical protein VITISV_033490 [Vitis vinifera]
Length=325

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCG QA G LC+ GLCCSQ+GYCGST+AYC  G
Sbjct  23   EQCGRQAGGALCSGGLCCSQYGYCGSTSAYCSTG  56



>dbj|BAO45893.1| chitinase [Acacia mangium]
Length=323

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +A+QCG QA G LC  GLCCSQ+G+CGST  YCG G
Sbjct  22   LAEQCGRQAGGALCPGGLCCSQFGWCGSTDDYCGRG  57



>ref|XP_008241979.1| PREDICTED: endochitinase-like [Prunus mume]
Length=321

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA   +C NGLCCSQ+G+CGSTAAYC  G
Sbjct  19   AEQCGRQAGNAVCPNGLCCSQYGWCGSTAAYCATG  53



>gb|AAT40732.1| basic chitinase 1-1 [Nepenthes khasiana]
 gb|AAT40733.1| basic chitinase 1-1 [Nepenthes khasiana]
 gb|AAT40734.1| basic chitinase 1-2 [Nepenthes khasiana]
 gb|AAT40735.1| basic chitinase 1-2 [Nepenthes khasiana]
Length=351

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A QCG QA G LC +GLCCSQWG+CG+T+ YCG G
Sbjct  37   AFQCGQQAGGALCHSGLCCSQWGWCGTTSDYCGNG  71



>pdb|1WKX|A Chain A, Crystal Structure Of A Hev B 6.02 Isoallergen
Length=43

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +QCG QA G+LC + LCCSQWG+CGST  YC
Sbjct  1    EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYC  31



>gb|KHG07793.1| Endochitinase [Gossypium arboreum]
Length=314

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQQCG QA G LCAN LCCSQ G+CGST  YCG G
Sbjct  22   AQQCGRQAGGALCANRLCCSQHGWCGSTPEYCGTG  56



>ref|XP_006382802.1| hypothetical protein POPTR_0005s05600g, partial [Populus trichocarpa]
 gb|ERP60599.1| hypothetical protein POPTR_0005s05600g, partial [Populus trichocarpa]
Length=125

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            AQ CG QA GR CAN LCCSQWG+CG++  +C
Sbjct  4    AQNCGRQAGGRTCANNLCCSQWGFCGTSDDHC  35



>sp|P52404.1|CHI2_SOLTU RecName: Full=Endochitinase 2; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA17408.1| chitinase, partial [Solanum tuberosum]
Length=316

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LCA+GLCCS++G+CG+T  YCG G
Sbjct  18   AEQCGSQAGGALCASGLCCSKFGWCGNTNDYCGPG  52



>sp|P52403.1|CHI1_SOLTU RecName: Full=Endochitinase 1; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA18332.1| chitinase, partial [Solanum tuberosum]
Length=318

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LCA+GLCCS++G+CG T  YCG G
Sbjct  18   AEQCGSQAGGALCASGLCCSKFGWCGDTNDYCGPG  52



>ref|XP_009337094.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=317

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G +C NGLCCSQ+G+CG+T+ YC AG
Sbjct  19   AEQCGRQAGGAVCPNGLCCSQFGWCGTTSDYCAAG  53



>ref|NP_001268050.1| class I extracellular chitinase precursor [Vitis vinifera]
 gb|AAD04295.1| class I extracellular chitinase [Vitis vinifera]
Length=325

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCG QA G LC+ GLCCSQ+GYCGST+AYC  G
Sbjct  23   EQCGRQAGGALCSGGLCCSQYGYCGSTSAYCSTG  56



>gb|AEF59005.1| class I chitinase [Pinus contorta]
Length=338

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            + A+QCG QA G LC  GLCCS+WG+CG+T A+CG
Sbjct  24   VSAEQCGQQAGGALCPGGLCCSKWGWCGNTDAHCG  58



>ref|XP_004966507.1| PREDICTED: chitinase 1-like [Setaria italica]
Length=323

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             T  A+QCGSQA G +C N +CCS+WG+CG+T+ YCG G
Sbjct  17   VTARAEQCGSQAGGAVCPNCMCCSKWGWCGTTSDYCGTG  55



>pdb|1ULN|A Chain A, Crystal Structure Of Pokeweed Lectin-D1
Length=84

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A +CG +ASG+ C NG CCSQWGYCG+T  YCG G
Sbjct  1    APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQG  35



>sp|P52405.1|CHI3_SOLTU RecName: Full=Endochitinase 3; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA17409.1| chitinase, partial [Solanum tuberosum]
Length=318

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LCA GLCCS++G+CG+T  YCG G
Sbjct  18   AEQCGSQAGGALCAPGLCCSKFGWCGNTNDYCGPG  52



>sp|P83790.1|LED2_PHYAM RecName: Full=Lectin-D2; AltName: Full=PL-D2 [Phytolacca americana]
 pdb|1ULM|A Chain A, Crystal Structure Of Pokeweed Lectin-D2 Complexed With 
Tri-N- Acetylchitotriose
 pdb|1ULM|B Chain B, Crystal Structure Of Pokeweed Lectin-D2 Complexed With 
Tri-N- Acetylchitotriose
 pdb|1UHA|A Chain A, Crystal Structure Of Pokeweed Lectin-D2
Length=82

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A +CG +ASG+ C NG CCSQWGYCG+T  YCG G
Sbjct  1    APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQG  35



>emb|CAA61278.1| chitinase class 1 [Vigna unguiculata]
Length=321

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             +QCGSQA G LC  GLCCSQ+G+CGST  YCG G
Sbjct  24   GEQCGSQAGGALCPGGLCCSQFGWCGSTDDYCGKG  58



>ref|XP_006367376.1| PREDICTED: endochitinase-like [Solanum tuberosum]
Length=297

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQ CGSQA G LCA+GLCCS++G+CG+T  +CG+G
Sbjct  23   AQNCGSQAGGALCASGLCCSKFGWCGNTNDHCGSG  57



>gb|AFK37675.1| unknown [Medicago truncatula]
Length=202

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            +A+QCG QA G+ C N LCCSQ+GYCG+T  YCG
Sbjct  17   IAEQCGRQAGGKTCPNNLCCSQYGYCGTTDEYCG  50



>ref|XP_006828989.1| hypothetical protein AMTR_s00001p00243300 [Amborella trichopoda]
 gb|ERM96405.1| hypothetical protein AMTR_s00001p00243300 [Amborella trichopoda]
Length=330

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++AQ CG +  G +CA GLCCS+WG+CGST  +CG G
Sbjct  24   VLAQNCGKERGGAVCAGGLCCSRWGFCGSTDEHCGEG  60



>gb|AAT40736.1| basic chitinase 2-1 [Nepenthes khasiana]
 gb|AAT40737.1| basic chitinase 2-1 [Nepenthes khasiana]
Length=318

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G +C  GLCCSQ+G+CG+T  YCGAG
Sbjct  24   EQCGSQAGGAVCPGGLCCSQYGWCGTTDDYCGAG  57



>ref|XP_006408160.1| hypothetical protein EUTSA_v10021503mg [Eutrema salsugineum]
 dbj|BAJ33708.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ49613.1| hypothetical protein EUTSA_v10021503mg [Eutrema salsugineum]
Length=214

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T  T+  QQCGSQA G+ C   +CCSQ+GYCG+TA YC
Sbjct  16   TVATVAGQQCGSQAGGQTCPGNICCSQYGYCGTTADYC  53



>gb|KEH24556.1| Chitinase / Hevein / PR-4 / Wheatwin2 [Medicago truncatula]
Length=202

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            +A+QCG QA G+ C N LCCSQ+GYCG+T  YCG
Sbjct  17   IAEQCGRQAGGKTCPNNLCCSQYGYCGTTDEYCG  50



>gb|ADI79351.1| chitinase [Medicago sativa]
Length=309

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCGSQA+  +C NGLCCS++G+CG+T  YCGAG
Sbjct  21   QAEQCGSQANRAVCPNGLCCSKFGWCGTTDQYCGAG  56



>sp|P0DKH7.1|AMP1_FAGES RecName: Full=Antimicrobial peptide 1; Short=Fa-AMP1 [Fagopyrum 
esculentum]
Length=40

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCG+Q  G  C  GLCCSQWG+CGST  YCGAG
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAG  34



>gb|KDP43737.1| hypothetical protein JCGZ_22364 [Jatropha curcas]
Length=322

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA+   C NGLCCSQ+G+CG+T  YCGAG
Sbjct  20   AEQCGRQANNAQCPNGLCCSQFGWCGNTPEYCGAG  54



>gb|ACN55075.1| chitinase Ib [Chimonanthus praecox]
Length=317

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+ CGSQA G LC  GLCCS++G+CG+TA YCG G
Sbjct  19   FAEDCGSQAGGALCPGGLCCSKFGFCGTTADYCGTG  54



>emb|CAA38249.1| endochitinase [Oryza sativa]
Length=318

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGA  246
            +QCGSQA G LC N LCCSQ+G+CGST+ YCGA
Sbjct  19   EQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGA  51



>ref|NP_001058626.1| Os06g0726100 [Oryza sativa Japonica Group]
 sp|P24626.2|CHI3_ORYSJ RecName: Full=Chitinase 3; AltName: Full=Basic endochitinase 
1; AltName: Full=Class I chitinase c; Short=OsChia1c; AltName: 
Full=Pathogenesis related (PR)-3 chitinase 3; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAA03751.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAD61708.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAD61800.1| endochitinase [Oryza sativa Japonica Group]
 dbj|BAF20540.1| Os06g0726100 [Oryza sativa Japonica Group]
 dbj|BAG87832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86858.1| endochitinase [Oryza sativa Japonica Group]
Length=320

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGA  246
            +QCGSQA G LC N LCCSQ+G+CGST+ YCGA
Sbjct  19   EQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGA  51



>gb|KEH20361.1| Chitinase (Class Ib) / Hevein [Medicago truncatula]
Length=309

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+  +C NGLCCS++G+CG+T  YCGAG
Sbjct  22   AEQCGSQANRAVCPNGLCCSKFGWCGTTDQYCGAG  56



>sp|P0DKH8.1|AMP2_FAGES RecName: Full=Antimicrobial peptide 2; Short=Fa-AMP2 [Fagopyrum 
esculentum]
Length=40

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCG+Q  G  C  GLCCSQWG+CGST  YCGAG
Sbjct  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAG  34



>ref|XP_002319077.1| class 4 pathogenesis-related family protein [Populus trichocarpa]
 gb|ABK95810.1| unknown [Populus trichocarpa]
 gb|EEE95000.1| class 4 pathogenesis-related family protein [Populus trichocarpa]
Length=196

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA G+ CAN LCCSQWGYCG++  +C
Sbjct  17   TAIAQNCGRQAGGQTCANNLCCSQWGYCGTSDDHC  51



>ref|XP_011038565.1| PREDICTED: pathogenesis-related protein PR-4-like isoform X1 
[Populus euphratica]
Length=196

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA G+ CAN LCCSQWGYCG++  +C
Sbjct  17   TAIAQNCGRQAGGQTCANNLCCSQWGYCGTSDDHC  51



>ref|XP_006387602.1| hypothetical protein POPTR_0790s00210g [Populus trichocarpa]
 gb|ERP46516.1| hypothetical protein POPTR_0790s00210g [Populus trichocarpa]
Length=309

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C  GLCCSQ+G+CGST  YCG G
Sbjct  21   AEQCGSQAGGAVCPGGLCCSQFGWCGSTNDYCGTG  55



>gb|EAZ02415.1| hypothetical protein OsI_24517 [Oryza sativa Indica Group]
Length=320

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +QCGSQA G LC N LCCSQ+G+CGST+ YCG G
Sbjct  19   EQCGSQAGGALCPNCLCCSQYGWCGSTSDYCGTG  52



>ref|XP_009392870.1| PREDICTED: chitinase 1-like [Musa acuminata subsp. malaccensis]
Length=315

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCG QA G LC  GLCCSQ+G+CG+T  YCG G
Sbjct  18   FAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQG  53



>gb|AAP03089.1| class Ib chitinase 2 [Galega orientalis]
Length=331

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA+G +C NGLCCS++G+CG+T  +CG G
Sbjct  24   AEQCGSQANGAVCPNGLCCSKFGWCGNTDPWCGDG  58



>gb|ACC68684.1| chitinase [Crocus sativus]
Length=282

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
             A QCG +A+G +C N LCCS WGYCGST AYC
Sbjct  18   FAAQCGKEANGAICPNDLCCSFWGYCGSTEAYC  50



>ref|XP_010675192.1| PREDICTED: basic endochitinase [Beta vulgaris subsp. vulgaris]
Length=328

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+ CG+QA G LC NGLCCSQ+G+CG+T  YCG G
Sbjct  20   AELCGNQAGGALCPNGLCCSQYGWCGNTNPYCGTG  54



>ref|XP_006828995.1| hypothetical protein AMTR_s00001p00244240 [Amborella trichopoda]
 gb|ERM96411.1| hypothetical protein AMTR_s00001p00244240 [Amborella trichopoda]
Length=192

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++AQ CG    G +CA GLCCS+WG+CGS   +CG G
Sbjct  57   VLAQNCGRDRGGAVCAGGLCCSKWGFCGSINEHCGEG  93



>gb|AES74343.2| Chitinase (Class I) / Hevein [Medicago truncatula]
Length=382

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCG QA G LC  GLCCS++G+CGST  YCG G
Sbjct  79   FAEQCGKQAGGALCPGGLCCSKFGWCGSTGDYCGDG  114



>gb|ACJ06634.3| class I chitinase [Musa AB Group]
 gb|ADH10169.2| chitinase [Musa AB Group]
Length=315

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCG QA G LC  GLCCSQ+G+CG+T  YCG G
Sbjct  18   FAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQG  53



>ref|XP_009383118.1| PREDICTED: LOW QUALITY PROTEIN: lectin-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCGSQA+G +C +G CCSQ+GYCG+T+ YCG+G
Sbjct  69   QCGSQAAGAVCPDGQCCSQYGYCGTTSDYCGSG  101



>gb|AAG23965.1|AF307511_1 class I chitinase [Vigna unguiculata subsp. sesquipedalis]
Length=297

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCGSQA G LC  GLCCSQ+G+CGST  YCG G
Sbjct  1    QCGSQAGGALCPGGLCCSQFGWCGSTDDYCGKG  33



>gb|AIW39714.1| class I chitinase, partial [Vigna unguiculata]
Length=297

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCGSQA G LC  GLCCSQ+G+CGST  YCG G
Sbjct  1    QCGSQAGGALCPGGLCCSQFGWCGSTDDYCGKG  33



>sp|Q9AYP9.1|LECC_PHYAM RecName: Full=Lectin-C; AltName: Full=PL-C; Flags: Precursor 
[Phytolacca americana]
 dbj|BAB21577.1| lectin-C [Phytolacca americana]
Length=194

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            + A  CG +ASGR+C +G CCSQWGYCG+T  YCG G
Sbjct  43   LGAPVCGVRASGRVCPDGYCCSQWGYCGTTEEYCGKG  79



>ref|XP_002994789.1| hypothetical protein SELMODRAFT_139127 [Selaginella moellendorffii]
 gb|EFJ04146.1| hypothetical protein SELMODRAFT_139127 [Selaginella moellendorffii]
Length=59

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  154  CGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            CG Q  GR C +GLCCSQ+GYCGST+ YCGAG
Sbjct  19   CGRQGRGRRCNSGLCCSQFGYCGSTSEYCGAG  50



>ref|XP_002312919.2| hypothetical protein POPTR_0009s14420g [Populus trichocarpa]
 gb|EEE86874.2| hypothetical protein POPTR_0009s14420g [Populus trichocarpa]
Length=318

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C  GLCCSQ+G+CGST  YCG G
Sbjct  21   AEQCGSQAGGAVCPGGLCCSQFGWCGSTNDYCGNG  55



>gb|ABK96628.1| unknown [Populus trichocarpa x Populus deltoides]
Length=318

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C  GLCCSQ+G+CGST  YCG G
Sbjct  21   AEQCGSQAGGAVCPGGLCCSQFGWCGSTNDYCGNG  55



>gb|ACJ62150.1| chitinase [Zea mays subsp. parviglumis]
Length=321

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGS+A G LC N LCCSQ+G+CGST+ YCG+G
Sbjct  22   AEQCGSRAGGALCPNCLCCSQFGWCGSTSDYCGSG  56



>ref|XP_003604092.1| Endochitinase [Medicago truncatula]
Length=324

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCG QA G LC  GLCCS++G+CGST  YCG G
Sbjct  21   FAEQCGKQAGGALCPGGLCCSKFGWCGSTGDYCGDG  56



>gb|AFK35074.1| unknown [Medicago truncatula]
Length=325

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             A+QCG QA G LC  GLCCS++G+CGST  YCG G
Sbjct  22   FAEQCGKQAGGALCPGGLCCSKFGWCGSTGDYCGDG  57



>gb|ACJ62118.1| chitinase [Zea mays subsp. parviglumis]
Length=317

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G LC N LCCS++G+CGST+ YCG+G
Sbjct  18   AEQCGSQAGGALCPNCLCCSRFGWCGSTSDYCGSG  52



>emb|CDY50344.1| BnaC01g38390D [Brassica napus]
Length=370

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            A+QCG QA G LC N LCCS++G+CGST AYC
Sbjct  20   AEQCGRQAGGALCPNNLCCSEYGWCGSTEAYC  51



>gb|AFY08283.1| class Ia chitinase [Acacia koa]
Length=323

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +A+QCG QA G LC  GLCCSQ+G+CG T  YCG G
Sbjct  22   LAEQCGRQAGGALCPGGLCCSQYGWCGQTYDYCGTG  57



>emb|CAB01591.1| endochitinase [Persea americana]
Length=326

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
             A+QCG QA G LC  GLCCSQ+G+CGST+ YCG
Sbjct  24   FAEQCGRQAGGALCPGGLCCSQFGWCGSTSDYCG  57



>gb|AAB36369.1| mitogen 4, Pa-4=wheat germ agglutinin homolog [pokeweeds, roots, 
Peptide, 126 aa]
Length=126

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  154  CGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            CG +ASGR+C +G CCSQWGYCG+T  YCG G
Sbjct  4    CGVRASGRVCPDGYCCSQWGYCGTTEEYCGKG  35



>gb|KDO54390.1| hypothetical protein CISIN_1g043941mg [Citrus sinensis]
Length=78

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T+ AQQCG Q   R C N LCCSQ+G+CGST  YC
Sbjct  26   TVKAQQCGRQGLDRPCPNNLCCSQFGFCGSTYDYC  60



>gb|ABD92819.1| class Ib chitinase [Limonium bicolor]
Length=322

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C NGLCCS++G+CGST  YC  G
Sbjct  23   AEQCGSQAGGAVCPNGLCCSKYGWCGSTDTYCKDG  57



>gb|ACE79210.1| chi31 [Limonium bicolor]
Length=326

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G +C NGLCCS++G+CGST  YC  G
Sbjct  23   AEQCGSQAGGAVCPNGLCCSKYGWCGSTDTYCKDG  57



>gb|KDP25869.1| hypothetical protein JCGZ_22899 [Jatropha curcas]
Length=338

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +AQ+CG+QA G LC++GLCCS++GYCG T  YC  G
Sbjct  19   LAQRCGNQAGGALCSDGLCCSEFGYCGMTLEYCSNG  54



>ref|XP_006367374.1| PREDICTED: endochitinase-like [Solanum tuberosum]
Length=312

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQ CGSQA G LCA+GLCCS++G+CG+T  +CG+G
Sbjct  23   AQNCGSQAGGALCASGLCCSKFGWCGNTNDHCGSG  57



>ref|XP_008645097.1| PREDICTED: LOW QUALITY PROTEIN: basic endochitinase A [Zea mays]
Length=352

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCG  A G+LC + LCCS+WGYCGST+ YCG G
Sbjct  23   QCGDGADGKLCPDCLCCSKWGYCGSTSDYCGDG  55



>ref|XP_004287744.1| PREDICTED: endochitinase-like [Fragaria vesca subsp. vesca]
Length=326

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            I A+QCG QA G  C NGLCCS++G+CG+T  YC  G
Sbjct  17   ISAEQCGRQAGGATCPNGLCCSEYGWCGTTPDYCATG  53



>sp|P51613.1|CHIB_VITVI RecName: Full=Basic endochitinase; Flags: Precursor [Vitis vinifera]
 emb|CAA90970.1| chitinase [Vitis vinifera]
 emb|CAC14014.1| chitinase [Vitis vinifera]
 gb|ABB53242.1| chitinase class I [Vitis vinifera]
 emb|CAN76701.1| hypothetical protein VITISV_016509 [Vitis vinifera]
Length=314

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA GR+C  G CCS++G+CG+TA YCG+G
Sbjct  20   AEQCGGQAGGRVCPGGACCSKFGWCGNTADYCGSG  54



>ref|XP_008440900.1| PREDICTED: chitinase 1-like isoform X2 [Cucumis melo]
Length=317

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA+G LC N LCCSQ+G+CG T AYC  G
Sbjct  22   AEQCGRQANGALCPNNLCCSQYGWCGDTDAYCKDG  56



>ref|XP_009344657.1| PREDICTED: endochitinase-like [Pyrus x bretschneideri]
Length=316

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G +C NGLCCSQ G+CG+T+ YC AG
Sbjct  19   AEQCGRQAGGVVCPNGLCCSQHGWCGTTSDYCAAG  53



>gb|EMS64751.1| Agglutinin isolectin 2 [Triticum urartu]
Length=208

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +++CGSQA G+LC N LCCSQWGYCG  + +CG G
Sbjct  106  SKRCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGVG  140



>gb|AHF88836.1| chitinase-like protein [Hevea brasiliensis]
Length=313

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  130  PTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            P    A+QCG QA G LC  GLCCSQ+G+C +T  YCG+G
Sbjct  14   PKDKAAEQCGWQAGGALCPGGLCCSQYGWCANTPEYCGSG  53



>ref|XP_006298619.1| hypothetical protein CARUB_v10014707mg [Capsella rubella]
 gb|EOA31517.1| hypothetical protein CARUB_v10014707mg [Capsella rubella]
Length=193

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T  T+  QQCG QA GR C   +CCSQ+GYCG+T  YC
Sbjct  15   TAATVAGQQCGRQAGGRTCPGNICCSQYGYCGTTPEYC  52



>gb|KHN15004.1| Endochitinase [Glycine soja]
Length=196

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQ CGSQ +G LC NGLCCS++G+CG +  +CGAG
Sbjct  24   AQNCGSQVAGALCPNGLCCSKFGWCGESDTHCGAG  58



>ref|XP_010418259.1| PREDICTED: hevein-like preproprotein [Camelina sativa]
Length=193

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T  T+  QQCG QA GR C   +CCSQ+GYCG+T  YC
Sbjct  15   TAATVAGQQCGRQAGGRTCPGNICCSQYGYCGTTPEYC  52



>gb|AAP03088.1| class Ia chitinase [Galega orientalis]
Length=326

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G LC  GLCCS++G+CGST  YCG G
Sbjct  26   AEQCGRQAGGALCPGGLCCSKFGWCGSTGDYCGDG  60



>dbj|BAJ89873.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85898.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
             ++ A+QCGSQA G  C N LCCS++G+CGST+ YCG G
Sbjct  16   VSVHAEQCGSQAGGATCPNCLCCSRFGFCGSTSDYCGTG  54



>gb|KFK37886.1| hypothetical protein AALP_AA3G042000 [Arabis alpina]
Length=211

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T   +  QQCGSQA G+ C   +CCSQ+GYCG+TA YC
Sbjct  15   TAAMVAGQQCGSQAGGKTCPGNICCSQYGYCGTTADYC  52



>ref|XP_006387093.1| hypothetical protein POPTR_1884s00200g, partial [Populus trichocarpa]
 gb|ERP46007.1| hypothetical protein POPTR_1884s00200g, partial [Populus trichocarpa]
Length=134

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA G+ CAN LCCSQWG+CG+   +C
Sbjct  17   TAIAQNCGRQAGGQTCANNLCCSQWGFCGTNDDHC  51



>pdb|1ULK|A Chain A, Crystal Structure Of Pokeweed Lectin-C
 pdb|1ULK|B Chain B, Crystal Structure Of Pokeweed Lectin-C
 gb|AAB35257.1| lectin-C, PL-C [Phytolacca americana=pokeweeds, roots, Peptide, 
126 aa]
Length=126

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  154  CGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            CG +ASGR+C +G CCSQWGYCG+T  YCG G
Sbjct  4    CGVRASGRVCPDGYCCSQWGYCGTTEEYCGKG  35



>ref|XP_009392872.1| PREDICTED: chitinase 1-like [Musa acuminata subsp. malaccensis]
Length=315

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
             A+QCG QA G LC  GLCCSQ+G+CG+T  YCG
Sbjct  18   FAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCG  51



>ref|XP_002488863.1| hypothetical protein SORBIDRAFT_3219s002010 [Sorghum bicolor]
 gb|EES20467.1| hypothetical protein SORBIDRAFT_3219s002010 [Sorghum bicolor]
Length=309

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            ++  A+QCG+QA G LC N LCCS++G+CGST+ YCG+G
Sbjct  17   SSARAEQCGTQAGGALCPNCLCCSKFGWCGSTSDYCGSG  55



>ref|XP_004134833.1| PREDICTED: basic endochitinase A-like [Cucumis sativus]
 gb|KGN48979.1| hypothetical protein Csa_6G507520 [Cucumis sativus]
Length=320

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
              + A+QCG QA+G LC N LCCSQ+G+CG T  YC  G
Sbjct  24   VVVAAEQCGRQANGALCPNNLCCSQFGFCGDTDDYCKNG  62



>ref|XP_011038567.1| PREDICTED: pathogenesis-related protein PR-4-like isoform X3 
[Populus euphratica]
Length=192

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA G+ CAN LCCSQWG+CG++  +C
Sbjct  17   TAIAQNCGRQAGGQTCANNLCCSQWGFCGTSDDHC  51



>emb|CDY42151.1| BnaC05g40680D [Brassica napus]
Length=341

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            A+QCG QA G LC NGLCCS++G+CG T AYC
Sbjct  39   AEQCGRQAGGALCPNGLCCSEFGWCGDTEAYC  70



>gb|AAP35269.1| hevein-like antimicrobial peptide [Euonymus europaeus]
Length=320

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            AQQCG QA  R CAN LCCSQ+GYCG T  YC
Sbjct  21   AQQCGRQAGNRRCANNLCCSQYGYCGRTNEYC  52



>ref|XP_011038566.1| PREDICTED: pathogenesis-related protein PR-4-like isoform X2 
[Populus euphratica]
Length=192

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA G+ CAN LCCSQWG+CG++  +C
Sbjct  17   TAIAQNCGRQAGGQTCANNLCCSQWGFCGTSDDHC  51



>gb|AAO63572.1| HEV1.2 [Hevea brasiliensis]
Length=206

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +A+QCG QA G+LC N LCCSQ+G+CGS+  YC
Sbjct  16   IAEQCGRQAGGKLCPNNLCCSQYGWCGSSDDYC  48



>emb|CCX05422.1| Similar to Antimicrobial protein PN-AMP1; acc. no. P81591 [Pyronema 
omphalodes CBS 100304]
Length=233

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            +AQ CG QA+ R+CA G CCSQ+ YCG+TAAYC  G
Sbjct  19   IAQNCGPQANNRVCAPGFCCSQYSYCGNTAAYCAPG  54



>ref|XP_006407328.1| hypothetical protein EUTSA_v10021149mg [Eutrema salsugineum]
 dbj|BAJ34362.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48781.1| hypothetical protein EUTSA_v10021149mg [Eutrema salsugineum]
Length=322

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            A+QCG QA G LC NGLCCS++G+CG T AYC
Sbjct  21   AEQCGRQAGGALCPNGLCCSEFGWCGDTEAYC  52



>emb|CBI29572.3| unnamed protein product [Vitis vinifera]
Length=97

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +1

Query  139  IMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            I AQQCG QA G+ CA GLCCSQ+GYCG+  A  G
Sbjct  18   ISAQQCGRQARGKRCAGGLCCSQYGYCGTALAPLG  52



>gb|ACP43629.2| chitinase [Musa AB Group]
 gb|ADH10170.2| chitinase [Musa AB Group]
Length=307

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
             A+QCG QA G LC  GLCCSQ+G+CG+T  YCG
Sbjct  18   FAEQCGRQAGGALCPGGLCCSQYGWCGNTDPYCG  51



>ref|XP_006379300.1| hypothetical protein POPTR_0009s14410g, partial [Populus trichocarpa]
 gb|ERP57097.1| hypothetical protein POPTR_0009s14410g, partial [Populus trichocarpa]
Length=304

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG +A G LC  GLCCSQ+G+CGST  YCG+G
Sbjct  3    AEQCGRKAGGALCPGGLCCSQFGWCGSTNDYCGSG  37



>gb|AAF69778.1|AF135138_1 class I chitinase [Turritis glabra]
Length=310

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            A+QCG QA G LC NGLCCS++G+CG T AYC
Sbjct  16   AEQCGRQAGGALCPNGLCCSEFGWCGDTEAYC  47



>sp|P21226.2|CHI2_PEA RecName: Full=Endochitinase A2; Flags: Precursor [Pisum sativum]
 gb|AAA75196.1| chitinase class I [Pisum sativum]
Length=324

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCG  243
            A+QCG+QA G LC  GLCCS++G+CGST+ YCG
Sbjct  20   AEQCGTQAGGALCPGGLCCSKFGWCGSTSEYCG  52



>gb|AAA34070.1| endochitinase precursor (EC 3.2.1.14), partial [Nicotiana tabacum]
 prf||1302305A chitinase
Length=310

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCGSQA G  CA+GLCCS++G+CG+T  YCG G
Sbjct  9    AEQCGSQAGGARCASGLCCSKFGWCGNTNDYCGPG  43



>gb|AHF88837.1| chitinase-like protein [Hevea brasiliensis]
Length=342

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  130  PTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            P    A+QCG QA G LC  GLCCSQ+G+C +T  YCG+G
Sbjct  14   PKDKAAEQCGWQAGGALCPGGLCCSQYGWCANTPEYCGSG  53



>gb|EMT27215.1| Basic endochitinase A [Aegilops tauschii]
Length=310

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            T+ A QCGSQA G  C N LCCS++G+CGST+ YCG G
Sbjct  8    TVHAAQCGSQAGGATCPNCLCCSRYGWCGSTSEYCGDG  45



>ref|XP_004248637.1| PREDICTED: endochitinase 4 [Solanum lycopersicum]
Length=329

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            T+ A+QCG QA G  CA GLCCS +G+CG+T  YCG G
Sbjct  16   TVSAEQCGRQAGGARCAAGLCCSNFGWCGNTNDYCGPG  53



>ref|XP_004135003.1| PREDICTED: endochitinase-like [Cucumis sativus]
 gb|KGN48984.1| hypothetical protein Csa_6G509040 [Cucumis sativus]
Length=324

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G +C NGLCCSQ+G+CG+  AYC  G
Sbjct  28   AEQCGWQAGGAVCPNGLCCSQYGWCGTVKAYCAEG  62



>ref|XP_004163409.1| PREDICTED: endochitinase-like [Cucumis sativus]
Length=324

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G +C NGLCCSQ+G+CG+  AYC  G
Sbjct  28   AEQCGWQAGGAVCPNGLCCSQYGWCGTVKAYCAEG  62



>sp|Q09023.1|CHI2_BRANA RecName: Full=Endochitinase CH25; Flags: Precursor [Brassica 
napus]
 gb|AAA32986.1| endochitinase [Brassica napus]
Length=322

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            A+QCG QA G LC NGLCCS++G+CG T AYC
Sbjct  20   AEQCGRQAGGALCPNGLCCSEFGWCGDTEAYC  51



>emb|CDY40674.1| BnaC03g33900D [Brassica napus]
Length=214

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T   +  QQCG QA G+ CA  +CCSQ+GYCG+TA YC
Sbjct  15   TAAMVAGQQCGRQAGGQTCAGNICCSQYGYCGTTADYC  52



>ref|XP_010687455.1| PREDICTED: endochitinase A-like [Beta vulgaris subsp. vulgaris]
Length=267

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 7/39 (18%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            T ++AQ+CG       CA+GLCCS+WGYCG+TAAYCG G
Sbjct  20   TLVVAQKCG-------CASGLCCSRWGYCGTTAAYCGDG  51



>ref|XP_009134785.1| PREDICTED: hevein-like preproprotein [Brassica rapa]
 emb|CDX74169.1| BnaA03g28780D [Brassica napus]
Length=214

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  127  TPTTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T   +  QQCG QA G+ CA  +CCSQ+GYCG+TA YC
Sbjct  15   TAAMVAGQQCGRQAGGQTCAGNICCSQYGYCGTTADYC  52



>ref|XP_004973075.1| PREDICTED: root-specific lectin-like [Setaria italica]
Length=75

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  151  QCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            QCGSQ  G  C+N LCCSQWGYCG    YCG G
Sbjct  34   QCGSQGGGATCSNNLCCSQWGYCGLGGDYCGNG  66



>gb|ACM45713.1| class I chitinase [Pyrus pyrifolia]
Length=317

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            A+QCG QA G +C NGLCCSQ+G+CG+T+ YC  G
Sbjct  19   AEQCGRQAGGAVCPNGLCCSQFGWCGTTSDYCTTG  53



>ref|XP_011032398.1| PREDICTED: pathogenesis-related protein PR-4-like [Populus euphratica]
Length=201

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  136  TIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            T +AQ CG QA GR CAN LCCS+WG+CG++  +C
Sbjct  22   TGIAQNCGRQAGGRTCANNLCCSEWGFCGTSDDHC  56



>gb|AAO63571.1| HEV1.1 [Hevea brasiliensis]
Length=204

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  142  MAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
            +A+QCG QA G+LC N LCCSQ+G+CGS+  YC
Sbjct  16   IAEQCGWQAGGKLCPNNLCCSQYGWCGSSDDYC  48



>ref|XP_003547902.2| PREDICTED: LOW QUALITY PROTEIN: endochitinase A-like [Glycine 
max]
Length=634

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  145  AQQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            AQ CGSQ +G LC NGLCCS++G+CG +  +CGAG
Sbjct  341  AQNCGSQVAGALCPNGLCCSKFGWCGESDTHCGAG  375


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  148  QQCGSQASGRLCANGLCCSQWGYCGSTAAYCGAG  249
            Q CG+Q  G +C NGLCCSQ+G+CG+T A+CG G
Sbjct  24   QNCGTQVGGVICPNGLCCSQYGWCGNTEAHCGRG  57



>gb|AFK48556.1| unknown [Lotus japonicus]
Length=207

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  133  TTIMAQQCGSQASGRLCANGLCCSQWGYCGSTAAYC  240
             T M +QCGSQA G+LC N  CCSQ+G+CG+T  YC
Sbjct  18   VTAMGEQCGSQAGGQLCPNNQCCSQYGWCGNTEDYC  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 876761086880