BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23460_g1_i1 len=912 path=[1507:0-76 4626:77-120 3940:121-131
3951:132-693 2572:694-734 4562:735-737 2619:738-779 4760:780-911]

Length=912
                                                                      Score     E

emb|CDP03886.1|  unnamed protein product                                114   8e-26   
ref|XP_009370684.1|  PREDICTED: uncharacterized protein LOC103960024    114   1e-25   
ref|XP_004247081.1|  PREDICTED: uncharacterized protein LOC101254727    112   2e-25   
ref|XP_007201323.1|  hypothetical protein PRUPE_ppa007571mg             114   2e-25   
ref|XP_006356785.1|  PREDICTED: uncharacterized protein LOC102589913    112   2e-25   
ref|XP_008235738.1|  PREDICTED: uncharacterized protein LOC103334536    113   2e-25   
ref|XP_008358458.1|  PREDICTED: arginine and glutamate-rich prote...    113   2e-25   
ref|XP_008358459.1|  PREDICTED: arginine and glutamate-rich prote...    113   2e-25   
gb|KDO65945.1|  hypothetical protein CISIN_1g017330mg                   113   3e-25   
gb|EYU40614.1|  hypothetical protein MIMGU_mgv1a023459mg                112   3e-25   
ref|XP_006479268.1|  PREDICTED: transcriptional regulator ATRX-li...    113   3e-25   
ref|XP_006443593.1|  hypothetical protein CICLE_v10020442mg             113   3e-25   
ref|XP_009334915.1|  PREDICTED: probable E3 ubiquitin-protein lig...    107   3e-25   
ref|XP_008346202.1|  PREDICTED: uncharacterized protein LOC103409...    113   3e-25   
ref|XP_008346203.1|  PREDICTED: uncharacterized protein LOC103409...    113   4e-25   
ref|XP_009371750.1|  PREDICTED: E3 ubiquitin-protein ligase compl...    112   5e-25   
ref|XP_009371741.1|  PREDICTED: E3 ubiquitin-protein ligase compl...    112   5e-25   
ref|XP_011089224.1|  PREDICTED: RNA-binding protein MEX3B-like          110   5e-25   
ref|XP_006479267.1|  PREDICTED: transcriptional regulator ATRX-li...    112   7e-25   
ref|XP_009766796.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...    109   1e-24   
ref|XP_008792900.1|  PREDICTED: uncharacterized protein LOC103709379    111   1e-24   
ref|XP_009625414.1|  PREDICTED: LON peptidase N-terminal domain a...    108   1e-24   
ref|XP_009617312.1|  PREDICTED: E3 ubiquitin-protein ligase BRE1        110   2e-24   
ref|XP_004290202.1|  PREDICTED: uncharacterized protein LOC101292359    110   2e-24   
ref|XP_007134112.1|  hypothetical protein PHAVU_010G019900g             108   3e-24   
ref|XP_004516309.1|  PREDICTED: LON peptidase N-terminal domain a...    108   3e-24   
ref|XP_008458019.1|  PREDICTED: E3 ubiquitin-protein ligase Topor...    110   4e-24   
ref|XP_003547809.1|  PREDICTED: uncharacterized protein LOC100819018    108   4e-24   
ref|XP_003635011.1|  PREDICTED: uncharacterized protein LOC100852917    109   4e-24   
ref|XP_010110062.1|  hypothetical protein L484_003042                   110   4e-24   
emb|CAN64493.1|  hypothetical protein VITISV_001939                     109   4e-24   Vitis vinifera
ref|XP_010069645.1|  PREDICTED: uncharacterized protein LOC104456537    110   5e-24   
ref|XP_004240457.1|  PREDICTED: polycomb group RING finger protein 6    106   5e-24   
ref|XP_002521082.1|  hypothetical protein RCOM_1719530                  109   5e-24   Ricinus communis
ref|XP_007049758.1|  RING/U-box superfamily protein, putative           109   6e-24   
ref|XP_002301791.2|  zinc finger family protein                         109   7e-24   Populus trichocarpa [western balsam poplar]
emb|CBI40815.3|  unnamed protein product                                108   8e-24   
ref|XP_009794502.1|  PREDICTED: E3 ubiquitin-protein ligase BRE1-...    108   8e-24   
ref|XP_003626976.1|  Zinc finger-like protein                           107   8e-24   
ref|XP_011024653.1|  PREDICTED: uncharacterized protein LOC105125...    109   9e-24   
ref|XP_004499519.1|  PREDICTED: uncharacterized protein LOC101506094    106   1e-23   
ref|XP_004139627.1|  PREDICTED: uncharacterized protein LOC101222466    108   1e-23   
gb|KGN44609.1|  hypothetical protein Csa_7G342770                       108   1e-23   
ref|XP_010927669.1|  PREDICTED: uncharacterized protein LOC105049647    108   1e-23   
ref|XP_011024654.1|  PREDICTED: KNR4/SMI1 homolog isoform X2            108   1e-23   
ref|XP_003520924.1|  PREDICTED: uncharacterized protein LOC100802736    107   1e-23   
ref|XP_010685024.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...    108   2e-23   
ref|XP_010241393.1|  PREDICTED: uncharacterized protein LOC104586010    107   3e-23   
gb|AAO49653.1|  zinc finger-like protein                                105   3e-23   Phaseolus vulgaris [French bean]
gb|KDP26378.1|  hypothetical protein JCGZ_17536                         107   3e-23   
ref|XP_010274021.1|  PREDICTED: uncharacterized protein LOC104609415    106   3e-23   
gb|EYU39196.1|  hypothetical protein MIMGU_mgv1a010693mg                106   4e-23   
ref|XP_009411858.1|  PREDICTED: histone H3.v1-like                      107   4e-23   
ref|XP_002458987.1|  hypothetical protein SORBIDRAFT_03g043850          106   4e-23   Sorghum bicolor [broomcorn]
gb|EMS57257.1|  hypothetical protein TRIUR3_26603                       105   5e-23   
ref|XP_010232176.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    106   5e-23   
gb|EPS73039.1|  hypothetical protein M569_01721                         101   5e-23   
ref|NP_001045204.1|  Os01g0917900                                       106   6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656941.1|  PREDICTED: nucleolin                               105   6e-23   
ref|NP_001168025.1|  uncharacterized LOC100381751                       105   6e-23   Zea mays [maize]
gb|EEC72038.1|  hypothetical protein OsI_04939                          105   7e-23   Oryza sativa Indica Group [Indian rice]
emb|CDM83856.1|  unnamed protein product                                106   8e-23   
ref|XP_006646612.1|  PREDICTED: uncharacterized protein LOC102708770    102   8e-23   
ref|XP_009385495.1|  PREDICTED: uncharacterized protein LOC103972842    105   9e-23   
gb|EEE55893.1|  hypothetical protein OsJ_04552                          104   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971061.1|  PREDICTED: nucleolin-like                          104   2e-22   
ref|XP_009385146.1|  PREDICTED: putative E3 ubiquitin-protein lig...    104   2e-22   
ref|XP_006602505.1|  PREDICTED: uncharacterized protein LOC100795...    105   2e-22   
ref|XP_003551383.2|  PREDICTED: uncharacterized protein LOC100795...    105   2e-22   
ref|XP_009382896.1|  PREDICTED: uncharacterized protein LOC103970721    103   3e-22   
gb|EPS57634.1|  hypothetical protein M569_17184                       99.0    4e-22   
gb|KHN10991.1|  hypothetical protein glysoja_026726                     100   6e-22   
ref|XP_006586230.1|  PREDICTED: uncharacterized protein LOC100776...    103   6e-22   
ref|XP_003530860.2|  PREDICTED: uncharacterized protein LOC100776...    103   6e-22   
gb|KCW48452.1|  hypothetical protein EUGRSUZ_K02149                     103   7e-22   
ref|XP_009402740.1|  PREDICTED: E3 ubiquitin-protein ligase RFWD2...    102   8e-22   
ref|XP_010513807.1|  PREDICTED: LON peptidase N-terminal domain a...    102   1e-21   
ref|XP_007140631.1|  hypothetical protein PHAVU_008G128400g             102   1e-21   
ref|XP_010488610.1|  PREDICTED: probable E3 ubiquitin-protein lig...    101   1e-21   
ref|XP_007140630.1|  hypothetical protein PHAVU_008G128400g             102   1e-21   
ref|NP_189139.1|  RING/U-box domain-containing protein                  101   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883568.1|  hypothetical protein ARALYDRAFT_480010             101   2e-21   
ref|XP_010466923.1|  PREDICTED: LON peptidase N-terminal domain a...    101   2e-21   
ref|XP_009420320.1|  PREDICTED: putative E3 ubiquitin-protein lig...    102   2e-21   
ref|XP_006298377.1|  hypothetical protein CARUB_v10014448mg             100   2e-21   
ref|XP_006418677.1|  hypothetical protein EUTSA_v10002955mg             101   3e-21   
ref|XP_010038992.1|  PREDICTED: uncharacterized protein LOC104427627    103   3e-21   
ref|XP_010527247.1|  PREDICTED: uncharacterized protein LOC104804...    101   3e-21   
ref|XP_006284342.1|  hypothetical protein CARUB_v10005514mg           99.8    5e-21   
ref|XP_006284343.1|  hypothetical protein CARUB_v10005514mg             100   5e-21   
ref|NP_193046.2|  RING/U-box domain-containing protein                  100   5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190713.1|  RING/U-box domain-containing protein             99.8    5e-21   
ref|NP_001078383.1|  RING/U-box domain-containing protein             99.8    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495985.1|  PREDICTED: LON peptidase N-terminal domain a...  99.8    6e-21   
ref|NP_849372.2|  RING/U-box domain-containing protein                99.8    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440651.1|  PREDICTED: LON peptidase N-terminal domain a...  99.8    7e-21   
ref|XP_010450283.1|  PREDICTED: LON peptidase N-terminal domain a...  99.8    7e-21   
ref|XP_010527246.1|  PREDICTED: uncharacterized protein LOC104804...    100   7e-21   
emb|CAB45509.1|  putative protein                                       100   8e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69745.1|  BnaAnng31380D                                        99.0    9e-21   
ref|XP_004513525.1|  PREDICTED: uncharacterized protein LOC101512916  99.8    1e-20   
ref|XP_002863174.1|  zinc finger family protein                       99.0    1e-20   
ref|XP_009102442.1|  PREDICTED: putative E3 ubiquitin-protein lig...  98.6    2e-20   
emb|CDX77379.1|  BnaA07g05170D                                        98.2    2e-20   
ref|XP_006414976.1|  hypothetical protein EUTSA_v10026173mg           97.1    3e-20   
ref|XP_011088095.1|  PREDICTED: nucleolin-like                        98.2    3e-20   
ref|XP_006850339.1|  hypothetical protein AMTR_s00020p00238060        96.7    1e-19   
gb|KEH22672.1|  zinc finger, C3HC4 type (RING finger) protein         96.7    1e-19   
gb|KDP20692.1|  hypothetical protein JCGZ_21163                       94.0    2e-19   
ref|XP_010439356.1|  PREDICTED: LON peptidase N-terminal domain a...  94.0    3e-19   
ref|XP_003610487.1|  hypothetical protein MTR_4g132760                94.0    3e-19   
ref|XP_003600695.1|  Zinc finger-like protein                         94.7    6e-19   
ref|XP_002518414.1|  ubiquitin-protein ligase, putative               92.4    1e-18   Ricinus communis
gb|KDP30811.1|  hypothetical protein JCGZ_13754                       91.7    1e-18   
ref|XP_010532903.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  93.2    1e-18   
emb|CAN69131.1|  hypothetical protein VITISV_012047                   92.0    1e-18   Vitis vinifera
ref|XP_003549638.1|  PREDICTED: uncharacterized protein LOC100792613  91.7    1e-18   
ref|XP_006449819.1|  hypothetical protein CICLE_v10017636mg           92.0    2e-18   
ref|XP_007147676.1|  hypothetical protein PHAVU_006G145000g           90.9    2e-18   
ref|XP_004293331.1|  PREDICTED: LON peptidase N-terminal domain a...  92.0    2e-18   
gb|KFK28795.1|  hypothetical protein AALP_AA7G049300                  91.3    2e-18   
gb|KDO78382.1|  hypothetical protein CISIN_1g026976mg                 91.7    2e-18   
ref|XP_006467365.1|  PREDICTED: uncharacterized protein LOC102611...  91.7    2e-18   
ref|XP_008371042.1|  PREDICTED: nuclear factor 7, brain-like isof...  92.0    2e-18   
ref|XP_008224725.1|  PREDICTED: uncharacterized protein LOC103324...  92.0    2e-18   
ref|XP_006467366.1|  PREDICTED: uncharacterized protein LOC102611...  91.3    2e-18   
ref|XP_003534716.1|  PREDICTED: uncharacterized protein LOC100804292  90.9    2e-18   
ref|XP_007213121.1|  hypothetical protein PRUPE_ppa023929mg           92.0    2e-18   
ref|XP_008371043.1|  PREDICTED: nuclear factor 7, brain-like isof...  91.3    2e-18   
ref|XP_008224726.1|  PREDICTED: uncharacterized protein LOC103324...  91.3    3e-18   
ref|XP_004293332.1|  PREDICTED: LON peptidase N-terminal domain a...  91.3    3e-18   
ref|XP_008366072.1|  PREDICTED: uncharacterized protein LOC103429...  91.7    3e-18   
ref|XP_011096012.1|  PREDICTED: uncharacterized protein LOC105175...  91.3    3e-18   
ref|XP_008366073.1|  PREDICTED: nuclear factor 7, ovary-like isof...  91.3    3e-18   
ref|XP_008358756.1|  PREDICTED: uncharacterized protein LOC103422...  91.7    3e-18   
ref|XP_010252568.1|  PREDICTED: uncharacterized protein LOC104594111  91.3    3e-18   
ref|XP_010270046.1|  PREDICTED: uncharacterized protein LOC104606503  91.3    3e-18   
gb|KHN03506.1|  hypothetical protein glysoja_004532                   89.4    3e-18   
ref|XP_010448916.1|  PREDICTED: E3 ubiquitin-protein ligase RNF17...  90.9    3e-18   
emb|CDX79140.1|  BnaA01g12070D                                        90.9    3e-18   
ref|XP_008358757.1|  PREDICTED: nuclear factor 7, ovary-like isof...  90.9    3e-18   
ref|XP_011096011.1|  PREDICTED: uncharacterized protein LOC105175...  91.7    3e-18   
ref|XP_010928415.1|  PREDICTED: uncharacterized protein LOC105050190  90.9    3e-18   
ref|XP_010529465.1|  PREDICTED: apoptosis 1 inhibitor-like            90.9    4e-18   
ref|XP_002867780.1|  hypothetical protein ARALYDRAFT_492641           90.9    4e-18   
gb|ABD32654.1|  Zinc finger, RING-type                                92.0    4e-18   Medicago truncatula
ref|XP_010686766.1|  PREDICTED: uncharacterized protein LOC104900931  91.3    4e-18   
ref|XP_006284541.1|  hypothetical protein CARUB_v10005744mg           90.5    4e-18   
ref|XP_010434067.1|  PREDICTED: uncharacterized protein LOC104718092  90.5    4e-18   
ref|XP_007026205.1|  RING/U-box superfamily protein, putative iso...  90.5    4e-18   
ref|XP_003547273.1|  PREDICTED: uncharacterized protein LOC100804959  90.5    5e-18   
ref|XP_006413677.1|  hypothetical protein EUTSA_v10026221mg           90.5    5e-18   
ref|NP_193956.2|  RING/U-box domain-containing protein                90.5    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356035.1|  PREDICTED: uncharacterized protein LOC103946...  90.9    5e-18   
ref|XP_002271383.2|  PREDICTED: uncharacterized protein LOC100253430  90.5    5e-18   Vitis vinifera
ref|XP_006383842.1|  hypothetical protein POPTR_0004s00470g           89.0    5e-18   
ref|XP_008799397.1|  PREDICTED: uncharacterized protein LOC103714043  90.1    5e-18   
gb|EYU27737.1|  hypothetical protein MIMGU_mgv1a013644mg              90.1    5e-18   
ref|XP_010099141.1|  hypothetical protein L484_014139                 90.5    5e-18   
ref|XP_009356096.1|  PREDICTED: apoptosis 1 inhibitor-like isofor...  90.1    6e-18   
ref|XP_008440052.1|  PREDICTED: uncharacterized protein LOC103484644  90.1    6e-18   
emb|CAA16775.1|  hypothetical protein                                 90.1    6e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KHN32986.1|  hypothetical protein glysoja_009977                   89.7    6e-18   
ref|XP_004134982.1|  PREDICTED: uncharacterized protein LOC101211804  90.5    7e-18   
emb|CDM85721.1|  unnamed protein product                              90.5    7e-18   
ref|XP_010943248.1|  PREDICTED: RING finger protein 26-like           90.1    8e-18   
ref|XP_004486197.1|  PREDICTED: uncharacterized protein LOC101514499  89.7    8e-18   
ref|XP_010057881.1|  PREDICTED: homeobox even-skipped homolog pro...  89.7    8e-18   
gb|KCW75227.1|  hypothetical protein EUGRSUZ_E03980                   90.1    9e-18   
ref|XP_006343415.1|  PREDICTED: uncharacterized protein LOC102605265  90.1    9e-18   
emb|CDX98736.1|  BnaA03g45210D                                        89.4    9e-18   
ref|XP_009761554.1|  PREDICTED: uncharacterized protein LOC104213715  89.7    9e-18   
emb|CBI28866.3|  unnamed protein product                              89.0    1e-17   
ref|XP_009137244.1|  PREDICTED: uncharacterized protein LOC103861291  89.0    1e-17   
ref|XP_006288670.1|  hypothetical protein CARUB_v10001978mg           89.4    1e-17   
emb|CDX82926.1|  BnaC01g13760D                                        89.0    1e-17   
ref|XP_011047008.1|  PREDICTED: uncharacterized protein LOC105141476  90.5    1e-17   
ref|XP_004234587.1|  PREDICTED: putative E3 ubiquitin-protein lig...  89.7    1e-17   
ref|XP_011047192.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  88.6    1e-17   
ref|XP_006447651.1|  hypothetical protein CICLE_v10016774mg           89.0    1e-17   
ref|NP_680579.2|  C3HC4 type RING-finger protein                      89.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KDO54310.1|  hypothetical protein CISIN_1g036555mg                 88.6    1e-17   
ref|XP_006447650.1|  hypothetical protein CICLE_v10016774mg           88.2    1e-17   
ref|XP_008449482.1|  PREDICTED: uncharacterized protein LOC103491356  88.2    1e-17   
ref|XP_004507659.1|  PREDICTED: uncharacterized protein LOC101490848  88.6    1e-17   
ref|XP_002872676.1|  protein binding protein                          88.6    2e-17   
ref|XP_004140123.1|  PREDICTED: ring finger protein 26-like           87.8    2e-17   
ref|XP_009135747.1|  PREDICTED: LOW QUALITY PROTEIN: apoptosis 1 ...  88.6    2e-17   
ref|XP_009628205.1|  PREDICTED: uncharacterized protein LOC104118626  89.0    2e-17   
ref|XP_010035514.1|  PREDICTED: nuclear factor 7, brain-like          89.0    2e-17   
gb|KFK30955.1|  hypothetical protein AALP_AA6G049200                  88.6    2e-17   
emb|CDY21289.1|  BnaC03g29730D                                        88.6    2e-17   
dbj|BAK04462.1|  predicted protein                                    89.4    2e-17   
ref|XP_008803516.1|  PREDICTED: RING finger protein 26                88.6    2e-17   
ref|XP_002320486.1|  zinc finger family protein                       87.8    2e-17   Populus trichocarpa [western balsam poplar]
gb|ABK92851.1|  unknown                                               87.8    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_009628059.1|  PREDICTED: uncharacterized protein LOC104118512  88.6    2e-17   
ref|XP_009616720.1|  PREDICTED: uncharacterized protein LOC104109198  87.0    3e-17   
ref|XP_010316564.1|  PREDICTED: uncharacterized protein LOC104645789  88.2    3e-17   
ref|XP_002302857.1|  zinc finger family protein                       87.4    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006348169.1|  PREDICTED: uncharacterized protein LOC102584506  88.2    3e-17   
ref|XP_011008922.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  87.4    3e-17   
ref|XP_009783349.1|  PREDICTED: uncharacterized protein LOC104231...  88.2    3e-17   
ref|XP_009783348.1|  PREDICTED: uncharacterized protein LOC104231...  88.6    3e-17   
ref|XP_010233581.1|  PREDICTED: probable E3 ubiquitin-protein lig...  86.7    3e-17   
ref|XP_010110624.1|  hypothetical protein L484_004822                 87.4    4e-17   
ref|XP_007049182.1|  Ubiquitin-protein ligase, putative               87.4    5e-17   
ref|XP_010496157.1|  PREDICTED: apoptosis 1 inhibitor-like            87.4    5e-17   
emb|CDP04456.1|  unnamed protein product                              87.4    6e-17   
ref|XP_010433082.1|  PREDICTED: uncharacterized protein LOC104717233  87.0    6e-17   
ref|XP_004973980.1|  PREDICTED: atherin-like                          87.8    7e-17   
ref|XP_010430290.1|  PREDICTED: apoptosis 1 inhibitor-like            86.7    9e-17   
ref|XP_010418230.1|  PREDICTED: apoptosis 1 inhibitor-like            86.7    9e-17   
ref|XP_002525340.1|  ubiquitin-protein ligase, putative               86.3    1e-16   Ricinus communis
ref|XP_004243512.1|  PREDICTED: mitochondrial ubiquitin ligase ac...  85.1    1e-16   
ref|XP_002882512.1|  hypothetical protein ARALYDRAFT_478032           88.2    1e-16   
ref|XP_002444712.1|  hypothetical protein SORBIDRAFT_07g026470        87.0    2e-16   Sorghum bicolor [broomcorn]
ref|XP_010422245.1|  PREDICTED: apoptosis 1 inhibitor-like            85.9    2e-16   
ref|XP_007153994.1|  hypothetical protein PHAVU_003G082200g           85.5    2e-16   
ref|NP_187368.1|  RING/U-box domain-containing protein                87.8    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28219.1|  contains similarity to C3HC4-type zinc fingers (P...  85.9    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539368.1|  PREDICTED: apoptosis 1 inhibitor                 85.5    2e-16   
ref|XP_006396723.1|  hypothetical protein EUTSA_v10029329mg           85.1    3e-16   
emb|CDY32036.1|  BnaA03g60400D                                        85.1    3e-16   
emb|CDY08650.1|  BnaC04g19590D                                        85.1    3e-16   
ref|XP_010546548.1|  PREDICTED: uncharacterized protein LOC104818608  84.7    4e-16   
ref|XP_009123390.1|  PREDICTED: apoptosis 1 inhibitor                 84.7    4e-16   
ref|NP_176427.1|  RING/U-box domain-containing protein                84.3    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301522.1|  hypothetical protein CARUB_v10021950mg           84.7    5e-16   
ref|XP_009134285.1|  PREDICTED: apoptosis 1 inhibitor                 84.3    5e-16   
gb|KFK40605.1|  hypothetical protein AALP_AA2G017500                  84.0    6e-16   
ref|XP_009412998.1|  PREDICTED: uncharacterized protein LOC103994402  85.1    6e-16   
ref|XP_006357969.1|  PREDICTED: mitochondrial ubiquitin ligase ac...  83.6    6e-16   
ref|XP_006391898.1|  hypothetical protein EUTSA_v10023694mg           84.0    7e-16   
ref|XP_010547084.1|  PREDICTED: uncharacterized protein LOC104818961  85.9    8e-16   
ref|XP_009761036.1|  PREDICTED: uncharacterized protein LOC104213267  82.8    9e-16   
ref|XP_010533787.1|  PREDICTED: uncharacterized protein LOC104809475  83.2    1e-15   
ref|XP_006296764.1|  hypothetical protein CARUB_v10015595mg           85.5    1e-15   
ref|XP_008664189.1|  PREDICTED: protein enabled homolog               85.5    2e-15   
ref|XP_009124480.1|  PREDICTED: LON peptidase N-terminal domain a...  84.7    2e-15   
tpg|DAA48171.1|  TPA: putative RING zinc finger domain superfamil...  83.2    2e-15   
ref|XP_004144455.1|  PREDICTED: uncharacterized protein LOC101209945  84.3    2e-15   
ref|XP_009413283.1|  PREDICTED: apoptosis 1 inhibitor                 81.6    2e-15   
ref|XP_010486253.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  84.3    3e-15   
ref|XP_010448797.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  84.3    3e-15   
gb|KGN58363.1|  hypothetical protein Csa_3G628230                     84.7    3e-15   
ref|XP_010464291.1|  PREDICTED: E3 ubiquitin-protein ligase RNF34...  84.3    4e-15   
gb|EAZ07721.1|  hypothetical protein OsI_29976                        82.4    5e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010525277.1|  PREDICTED: E3 ubiquitin-protein ligase RNF8-...  81.3    5e-15   
gb|EAZ07720.1|  hypothetical protein OsI_29975                        82.0    6e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010238335.1|  PREDICTED: E3 ubiquitin-protein ligase RNF19...  80.5    7e-15   
dbj|BAD08751.1|  zinc finger protein family-like                      81.6    8e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDY05318.1|  BnaC05g44850D                                        80.9    8e-15   
gb|EEE69034.1|  hypothetical protein OsJ_28016                        78.6    9e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06866.1|  predicted protein                                    81.3    1e-14   
emb|CDY24647.1|  BnaA05g30460D                                        80.9    1e-14   
ref|XP_002888031.1|  hypothetical protein ARALYDRAFT_893249           80.1    1e-14   
ref|XP_002462623.1|  hypothetical protein SORBIDRAFT_02g029170        80.1    2e-14   Sorghum bicolor [broomcorn]
ref|XP_006407867.1|  hypothetical protein EUTSA_v10021010mg           82.0    2e-14   
gb|EEE69035.1|  hypothetical protein OsJ_28017                        79.7    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010552051.1|  PREDICTED: uncharacterized protein LOC104822500  80.9    4e-14   
ref|XP_003574809.1|  PREDICTED: LON peptidase N-terminal domain a...  78.2    2e-13   
ref|NP_001175930.1|  Os09g0505000                                     76.3    3e-13   
ref|XP_002974913.1|  hypothetical protein SELMODRAFT_442650           78.2    6e-13   
ref|XP_002988930.1|  hypothetical protein SELMODRAFT_447521           78.2    7e-13   
emb|CDX74062.1|  BnaA03g29850D                                        77.0    1e-12   
ref|XP_003594158.1|  hypothetical protein MTR_2g025080                75.5    2e-12   
ref|XP_008670306.1|  PREDICTED: baculoviral IAP repeat-containing...  68.2    2e-10   
ref|XP_001759772.1|  predicted protein                                68.9    1e-09   
ref|XP_004957277.1|  PREDICTED: uncharacterized protein LOC101766305  65.9    2e-09   
ref|XP_004174027.1|  PREDICTED: uncharacterized LOC101209945          60.8    6e-08   
ref|XP_001767798.1|  predicted protein                                58.9    3e-06   
ref|XP_008465469.1|  PREDICTED: uncharacterized serine-rich prote...  56.6    5e-06   
ref|XP_009334946.1|  PREDICTED: uncharacterized protein LOC103927727  53.9    2e-05   
ref|XP_002969717.1|  hypothetical protein SELMODRAFT_440912           53.9    1e-04   
ref|XP_002981322.1|  hypothetical protein SELMODRAFT_420896           53.9    1e-04   
gb|AES64409.2|  RING/U-box protein, putative                          49.3    9e-04   



>emb|CDP03886.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCNNFILEILDIF
Sbjct  230  YNNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNNFILEILDIF  281


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 6/54 (11%)
 Frame = +2

Query  125  DAIKDDPNGG---KDHKKTWKHFKEKLGLKDAGDG--WTSSTPIPASDVPI-HP  268
            D I++DPNGG   KD +K+W+HF+EKL L+  G G  WTSS P+PASDVPI HP
Sbjct  30   DIIREDPNGGGYSKDTRKSWRHFREKLRLRRQGSGSSWTSSVPVPASDVPIQHP  83



>ref|XP_009370684.1| PREDICTED: uncharacterized protein LOC103960024 [Pyrus x bretschneideri]
Length=358

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  308  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  358


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 40/78 (51%), Gaps = 14/78 (18%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------------HPMSSRTMSRR  295
            GK  KK WK FK++L LK AG  WTSS  +P SD+PI            HP S    SRR
Sbjct  72   GKKDKKAWKSFKDRLLLKRAGSAWTSSVRVPTSDIPIRNTANYASNRHQHPRSHN--SRR  129

Query  296  ASNRFPSGEYPADEYKPE  349
             S R+ + E   D  + E
Sbjct  130  GSVRYVTPESNLDMTQQE  147



>ref|XP_004247081.1| PREDICTED: uncharacterized protein LOC101254727 [Solanum lycopersicum]
Length=247

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCNNFILE+LDIF
Sbjct  196  YNNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNNFILEVLDIF  247



>ref|XP_007201323.1| hypothetical protein PRUPE_ppa007571mg [Prunus persica]
 gb|EMJ02522.1| hypothetical protein PRUPE_ppa007571mg [Prunus persica]
Length=363

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  313  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  363



>ref|XP_006356785.1| PREDICTED: uncharacterized protein LOC102589913 [Solanum tuberosum]
Length=255

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCNNFILE+LDIF
Sbjct  204  YNNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNNFILEVLDIF  255



>ref|XP_008235738.1| PREDICTED: uncharacterized protein LOC103334536 [Prunus mume]
Length=332

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  282  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  332



>ref|XP_008358458.1| PREDICTED: arginine and glutamate-rich protein 1-like isoform 
X1 [Malus domestica]
Length=363

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  313  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  363


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 44/91 (48%), Gaps = 14/91 (15%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------------HPMSSRTMSRR  295
            GK  KK WK FK++L LK AG  WTSS  +P SD+PI            HP S    SRR
Sbjct  72   GKKDKKAWKSFKDRLLLKRAGSAWTSSVRVPTSDIPIRNTANYASNRHHHPRSHN--SRR  129

Query  296  ASNRFPSGEYPADEYKPELAASGRRELRSSP  388
             S R+ + E   D    E   + R   R SP
Sbjct  130  GSVRYVTPESNLDMTHQERQIARRGSTRFSP  160



>ref|XP_008358459.1| PREDICTED: arginine and glutamate-rich protein 1-like isoform 
X2 [Malus domestica]
Length=351

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  301  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  351


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 44/91 (48%), Gaps = 14/91 (15%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------------HPMSSRTMSRR  295
            GK  KK WK FK++L LK AG  WTSS  +P SD+PI            HP S    SRR
Sbjct  60   GKKDKKAWKSFKDRLLLKRAGSAWTSSVRVPTSDIPIRNTANYASNRHHHPRSHN--SRR  117

Query  296  ASNRFPSGEYPADEYKPELAASGRRELRSSP  388
             S R+ + E   D    E   + R   R SP
Sbjct  118  GSVRYVTPESNLDMTHQERQIARRGSTRFSP  148



>gb|KDO65945.1| hypothetical protein CISIN_1g017330mg [Citrus sinensis]
 gb|KDO65946.1| hypothetical protein CISIN_1g017330mg [Citrus sinensis]
Length=373

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            HNCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  323  HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  373


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 12/86 (14%)
 Frame = +2

Query  125  DAIKD-DPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------HPMS  274
            D I+D DPNG   G   +K+WK F+++L LK AG  WTSS  IP SD+PI      +   
Sbjct  38   DIIRDEDPNGKNFGHKDRKSWKLFRDRLRLKRAGAAWTSSVRIPTSDIPIPSSSLSNSNP  97

Query  275  SRTMSRRASNRFPSGEYPADEYKPEL  352
               + RR+S RF +   PA E   +L
Sbjct  98   RSQLIRRSSVRFQTN--PAGELASQL  121



>gb|EYU40614.1| hypothetical protein MIMGU_mgv1a023459mg [Erythranthe guttata]
Length=295

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AFVPCGH+FCRLCSRELW E+GNCPLCNN+ILEILDIF
Sbjct  244  YNNCCVCMVRHKGTAFVPCGHSFCRLCSRELWVERGNCPLCNNYILEILDIF  295


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDA---GDGWTSSTPIPASDVPIHPMSSRTMSRR  295
            D I+++    KD +KTW+HFK+KL  +++   G  WTS+  +P SD+P++  ++R ++R 
Sbjct  55   DIIREEGGSQKDSRKTWRHFKDKLRRRNSGGRGSTWTSTVTVPTSDIPLN-NNNRMIARH  113

Query  296  ASNRFPSGEYPADEYKPELAA  358
             S R  SG       +P ++A
Sbjct  114  PSTRINSGLESDPMDQPNISA  134



>ref|XP_006479268.1| PREDICTED: transcriptional regulator ATRX-like isoform X2 [Citrus 
sinensis]
Length=375

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            HNCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  325  HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  375


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 12/86 (14%)
 Frame = +2

Query  125  DAIKD-DPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------HPMS  274
            D I+D DPNG   G   +K+WK F+++L LK AG  WTSS  IP SD+PI      +   
Sbjct  38   DIIRDEDPNGKNFGHKDRKSWKLFRDRLRLKRAGAAWTSSVRIPTSDIPIPSSSLSNSNP  97

Query  275  SRTMSRRASNRFPSGEYPADEYKPEL  352
               + RR+S RF +   PA E   +L
Sbjct  98   RSQLIRRSSVRFQTN--PAGELASQL  121



>ref|XP_006443593.1| hypothetical protein CICLE_v10020442mg [Citrus clementina]
 gb|ESR56833.1| hypothetical protein CICLE_v10020442mg [Citrus clementina]
Length=402

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            HNCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  352  HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  402


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 12/86 (14%)
 Frame = +2

Query  125  DAIKD-DPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------HPMS  274
            D I+D DPNG   G   +K+WK F+++L LK AG  WTSS  IP SD+PI      +   
Sbjct  65   DIIRDEDPNGKNFGHKDRKSWKLFRDRLRLKRAGAAWTSSVRIPTSDIPIPSSSLSNSNP  124

Query  275  SRTMSRRASNRFPSGEYPADEYKPEL  352
               + RR+S RF +   PA E   +L
Sbjct  125  RSQLIRRSSVRFQTN--PAGELASQL  148



>ref|XP_009334915.1| PREDICTED: probable E3 ubiquitin-protein ligase LUL4 [Pyrus x 
bretschneideri]
Length=101

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  51   YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  101



>ref|XP_008346202.1| PREDICTED: uncharacterized protein LOC103409173 isoform X1 [Malus 
domestica]
Length=361

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  311  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  361


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI  262
            GK  KK WK FKE+L LK AG  WTSS  +P SD+PI
Sbjct  72   GKKDKKAWKSFKERLLLKRAGSAWTSSVRVPTSDIPI  108



>ref|XP_008346203.1| PREDICTED: uncharacterized protein LOC103409173 isoform X2 [Malus 
domestica]
Length=349

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  299  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  349


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI  262
            GK  KK WK FKE+L LK AG  WTSS  +P SD+PI
Sbjct  60   GKKDKKAWKSFKERLLLKRAGSAWTSSVRVPTSDIPI  96



>ref|XP_009371750.1| PREDICTED: E3 ubiquitin-protein ligase complex slx8-rfp subunit 
slx8 isoform X2 [Pyrus x bretschneideri]
Length=351

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  301  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  351


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 43/99 (43%), Gaps = 36/99 (36%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------------HPMS-------  274
            GK  KK WK FK++L LK AG  WTSS  +P SD+PI            HP S       
Sbjct  72   GKKDKKAWKSFKDRLLLKRAGSAWTSSVRVPTSDLPIRNTANYGSNHNHHPRSRNSRRSS  131

Query  275  ----------------SRTMSRRASNRF-PSGEYPADEY  340
                             R +SRR S RF P+   P+DE 
Sbjct  132  VRYVTPECDLDMTQQVERQISRRGSTRFSPNPSIPSDEV  170



>ref|XP_009371741.1| PREDICTED: E3 ubiquitin-protein ligase complex slx8-rfp subunit 
slx8 isoform X1 [Pyrus x bretschneideri]
Length=351

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  301  YNCCVCMVRHKGAAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  351


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 43/99 (43%), Gaps = 36/99 (36%)
 Frame = +2

Query  152  GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------------HPMS-------  274
            GK  KK WK FK++L LK AG  WTSS  +P SD+PI            HP S       
Sbjct  72   GKKDKKAWKSFKDRLLLKRAGSAWTSSVRVPTSDLPIRNTANYGSNHNHHPRSRNSRRSS  131

Query  275  ----------------SRTMSRRASNRF-PSGEYPADEY  340
                             R +SRR S RF P+   P+DE 
Sbjct  132  VRYVTPECDLDMTQQVERQISRRGSTRFSPNPSIPSDEV  170



>ref|XP_011089224.1| PREDICTED: RNA-binding protein MEX3B-like, partial [Sesamum indicum]
Length=245

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCNN+I+EILDIF
Sbjct  194  YNNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNNYIVEILDIF  245



>ref|XP_006479267.1| PREDICTED: transcriptional regulator ATRX-like isoform X1 [Citrus 
sinensis]
Length=446

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            HNCCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  396  HNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  446


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 12/86 (14%)
 Frame = +2

Query  125  DAIKD-DPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPI------HPMS  274
            D I+D DPNG   G   +K+WK F+++L LK AG  WTSS  IP SD+PI      +   
Sbjct  109  DIIRDEDPNGKNFGHKDRKSWKLFRDRLRLKRAGAAWTSSVRIPTSDIPIPSSSLSNSNP  168

Query  275  SRTMSRRASNRFPSGEYPADEYKPEL  352
               + RR+S RF +   PA E   +L
Sbjct  169  RSQLIRRSSVRFQTN--PAGELASQL  192



>ref|XP_009766796.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Nicotiana sylvestris]
 ref|XP_009766797.1| PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Nicotiana sylvestris]
Length=219

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++CCVCMVRHKG AFVPCGH+FCRLCSRELW E GNCPLCNNFILEILDIF
Sbjct  169  NSCCVCMVRHKGAAFVPCGHSFCRLCSRELWVEGGNCPLCNNFILEILDIF  219



>ref|XP_008792900.1| PREDICTED: uncharacterized protein LOC103709379 [Phoenix dactylifera]
 ref|XP_008792901.1| PREDICTED: uncharacterized protein LOC103709379 [Phoenix dactylifera]
Length=304

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            FH CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  253  FHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  304



>ref|XP_009625414.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Nicotiana tomentosiformis]
 ref|XP_009625415.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Nicotiana tomentosiformis]
Length=218

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++CCVCMVRHKG AFVPCGH+FCRLCSRELW E GNCPLCNNFILEILDIF
Sbjct  168  NSCCVCMVRHKGAAFVPCGHSFCRLCSRELWVEGGNCPLCNNFILEILDIF  218



>ref|XP_009617312.1| PREDICTED: E3 ubiquitin-protein ligase BRE1 [Nicotiana tomentosiformis]
Length=290

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AF+PCGHTFCRLC RELW ++GNCPLCNNFILE+LDIF
Sbjct  239  YNNCCVCMVRHKGAAFIPCGHTFCRLCCRELWVQRGNCPLCNNFILEVLDIF  290


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 14/93 (15%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMSRRASN  304
            D I++DPN  +  +KTWKHF+ KL LK A + WTS+  I   +   +P+    MSRR S 
Sbjct  73   DIIQEDPNSSRKTRKTWKHFRSKLRLKRAANTWTSNISIQQGNS--NPI---IMSRRLSP  127

Query  305  RFP----SGEYPADE-----YKPELAASGRREL  376
            R P    +  YP D       + E++ASG + +
Sbjct  128  RSPPPLDAVAYPEDLPVENFGQREVSASGSQRI  160



>ref|XP_004290202.1| PREDICTED: uncharacterized protein LOC101292359 [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++CCVCMVRHKG AF+PCGHTFCR+CSRELW ++GNCPLCNNFILEILDIF
Sbjct  285  YSCCVCMVRHKGSAFIPCGHTFCRMCSRELWVQRGNCPLCNNFILEILDIF  335



>ref|XP_007134112.1| hypothetical protein PHAVU_010G019900g [Phaseolus vulgaris]
 gb|ESW06106.1| hypothetical protein PHAVU_010G019900g [Phaseolus vulgaris]
Length=262

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            NCCVCMVRHKG AF+PCGHTFCR+CSRE+WA +GNCPLCNN ILEILDIF
Sbjct  213  NCCVCMVRHKGAAFIPCGHTFCRMCSREIWASRGNCPLCNNLILEILDIF  262



>ref|XP_004516309.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
2-like [Cicer arietinum]
Length=240

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            HNCCVCMVRHKG AF+PCGHTFCR+CSRE+W  +GNCPLCNN ILEILDIF
Sbjct  190  HNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNNSILEILDIF  240



>ref|XP_008458019.1| PREDICTED: E3 ubiquitin-protein ligase Topors-like [Cucumis melo]
Length=358

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             NCCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  308  RNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  358



>ref|XP_003547809.1| PREDICTED: uncharacterized protein LOC100819018 [Glycine max]
Length=262

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR+CSRE+W  +GNCPLCNN ILEILDIF
Sbjct  212  YNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNNLILEILDIF  262



>ref|XP_003635011.1| PREDICTED: uncharacterized protein LOC100852917 [Vitis vinifera]
Length=329

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  279  YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  329


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 9/68 (13%)
 Frame = +2

Query  125  DAIKDDPNGGKD---------HKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSS  277
            D I+D+  G KD         +K +WK FK++L ++ AG  WTSS PIPASDVP     S
Sbjct  51   DIIRDESTGYKDVLGQPNNNNNKMSWKSFKDRLRIRRAGAAWTSSMPIPASDVPTRSQLS  110

Query  278  RTMSRRAS  301
            R  S R +
Sbjct  111  RRQSTRVT  118



>ref|XP_010110062.1| hypothetical protein L484_003042 [Morus notabilis]
 gb|EXC25118.1| hypothetical protein L484_003042 [Morus notabilis]
Length=405

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             NCCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  355  QNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  405



>emb|CAN64493.1| hypothetical protein VITISV_001939 [Vitis vinifera]
Length=326

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  276  YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  326


 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 9/68 (13%)
 Frame = +2

Query  125  DAIKDDPNGGKD---------HKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSS  277
            D I+D+  G KD         +K +WK FK++L ++ AG  WTSS PIPASDVP     S
Sbjct  48   DIIRDESTGYKDVLGQPNNNNNKMSWKSFKDRLRIRRAGAAWTSSMPIPASDVPTRSQLS  107

Query  278  RTMSRRAS  301
            R  S R +
Sbjct  108  RRQSTRVT  115



>ref|XP_010069645.1| PREDICTED: uncharacterized protein LOC104456537 [Eucalyptus grandis]
 gb|KCW58060.1| hypothetical protein EUGRSUZ_H00794 [Eucalyptus grandis]
Length=401

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCNNFI+EILDIF
Sbjct  353  CCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNNFIVEILDIF  401



>ref|XP_004240457.1| PREDICTED: polycomb group RING finger protein 6 [Solanum lycopersicum]
Length=186

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             +NCCVC VRHKG AFVPCGH+FCRLCSRELW E  NCPLCNNFILEILDIF
Sbjct  135  LNNCCVCQVRHKGAAFVPCGHSFCRLCSRELWVEGANCPLCNNFILEILDIF  186



>ref|XP_002521082.1| hypothetical protein RCOM_1719530 [Ricinus communis]
 gb|EEF41233.1| hypothetical protein RCOM_1719530 [Ricinus communis]
Length=370

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FI+EILDIF
Sbjct  320  HTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFIVEILDIF  370


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 13/77 (17%)
 Frame = +2

Query  125  DAIKDD-PNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRT---  283
            D I+D+ P+G   G   KK+WK F+++L LK AG  WTS+ PIPASD+PI+  +S     
Sbjct  35   DIIRDEEPHGSLFGHKDKKSWKAFRDRLRLKRAGAAWTSTVPIPASDIPIYNANSTASNF  94

Query  284  ------MSRRASNRFPS  316
                  MSRR S RF +
Sbjct  95   NQSRSLMSRRNSVRFTT  111



>ref|XP_007049758.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX93915.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=347

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  297  YTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  347


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMSRRAS  301
            D I++D  G    KK+WK F++KL LK AG  WTSS  IPASDV +H   S   SRR S
Sbjct  38   DIIRED--GPTKDKKSWKTFRDKLRLKRAGAAWTSSVHIPASDVNVHGNRSH-FSRRGS  93



>ref|XP_002301791.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE81064.2| zinc finger family protein [Populus trichocarpa]
Length=396

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  346  YTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  396


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 18/94 (19%)
 Frame = +2

Query  125  DAIKDDPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVP-----------I  262
            D I+D+ +G   G   KK+WK F++KL LK AG  WTSS   PASD+P           I
Sbjct  53   DIIRDEESGSLFGHKDKKSWKAFRDKLRLKRAGSAWTSSVHTPASDIPIPVENRFRNSNI  112

Query  263  HPMSSRT-MSRRASNRFPSGEYPADEYKPELAAS  361
            +  SSR+ M+RR S RF +    +    PEL  S
Sbjct  113  NNASSRSLMTRRNSVRFTT---VSSVISPELEES  143



>emb|CBI40815.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  267  YNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  317


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 9/68 (13%)
 Frame = +2

Query  125  DAIKDDPNGGKD---------HKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSS  277
            D I+D+  G KD         +K +WK FK++L ++ AG  WTSS PIPASDVP     S
Sbjct  121  DIIRDESTGYKDVLGQPNNNNNKMSWKSFKDRLRIRRAGAAWTSSMPIPASDVPTRSQLS  180

Query  278  RTMSRRAS  301
            R  S R +
Sbjct  181  RRQSTRVT  188



>ref|XP_009794502.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like [Nicotiana sylvestris]
Length=290

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++NCCVCMVRHKG AF+PCGHTFCRLC RELW ++GNCPLCNN ILE+LDIF
Sbjct  239  YNNCCVCMVRHKGAAFIPCGHTFCRLCCRELWVQRGNCPLCNNLILEVLDIF  290


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 14/92 (15%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPI-PASDVPIHPMSSRTMSRRAS  301
            D I++DPN  +  +KTWKHF+ KL LK A D WTS+  I   ++ PI       MSRR S
Sbjct  73   DIIQEDPNSSRKTRKTWKHFRNKLRLKRAADTWTSNISIQQGNNNPI------VMSRRLS  126

Query  302  NRFPSGEYPADE--YKPELAAS--GRRELRSS  385
             R P    P D+  Y+ +L     G+RE+ +S
Sbjct  127  PRSPP---PLDDVTYQEDLPVENFGQREISAS  155



>ref|XP_003626976.1| Zinc finger-like protein [Medicago truncatula]
 gb|AET01452.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=234

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            HNCCVCMVR KG AF+PCGHTFCR+CSRELW  +GNCPLCN+FILE+LDIF
Sbjct  184  HNCCVCMVRDKGAAFIPCGHTFCRMCSRELWVSRGNCPLCNHFILEVLDIF  234



>ref|XP_011024653.1| PREDICTED: uncharacterized protein LOC105125764 isoform X1 [Populus 
euphratica]
Length=397

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  347  YTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  397


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 15/79 (19%)
 Frame = +2

Query  125  DAIKDDPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVP-----------I  262
            D I+D+ +G   G   KK+WK F++KL LK AG  WTSS   PASD+P           I
Sbjct  54   DIIRDEESGSLFGHKDKKSWKAFRDKLRLKRAGSAWTSSVHTPASDIPIPVENRFRNSNI  113

Query  263  HPMSSRT-MSRRASNRFPS  316
            +  SSR+ M+RR S RF +
Sbjct  114  NNASSRSLMTRRNSVRFTT  132



>ref|XP_004499519.1| PREDICTED: uncharacterized protein LOC101506094 [Cicer arietinum]
Length=210

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             NCCVCMVRHKG AF+PCGHTFCR+CSRE+W  +GNCPLCNN ILEILDIF
Sbjct  160  QNCCVCMVRHKGAAFIPCGHTFCRMCSREIWVSRGNCPLCNNSILEILDIF  210



>ref|XP_004139627.1| PREDICTED: uncharacterized protein LOC101222466 [Cucumis sativus]
 ref|XP_004154438.1| PREDICTED: uncharacterized LOC101222466 [Cucumis sativus]
Length=342

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  293  HCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  342



>gb|KGN44609.1| hypothetical protein Csa_7G342770 [Cucumis sativus]
Length=355

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  306  HCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  355



>ref|XP_010927669.1| PREDICTED: uncharacterized protein LOC105049647 [Elaeis guineensis]
 ref|XP_010927670.1| PREDICTED: uncharacterized protein LOC105049647 [Elaeis guineensis]
 ref|XP_010927671.1| PREDICTED: uncharacterized protein LOC105049647 [Elaeis guineensis]
Length=296

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++ CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FILEILDIF
Sbjct  245  YYVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFILEILDIF  296



>ref|XP_011024654.1| PREDICTED: KNR4/SMI1 homolog isoform X2 [Populus euphratica]
Length=357

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN FILEILDIF
Sbjct  307  YTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGFILEILDIF  357


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 15/79 (19%)
 Frame = +2

Query  125  DAIKDDPNG---GKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVP-----------I  262
            D I+D+ +G   G   KK+WK F++KL LK AG  WTSS   PASD+P           I
Sbjct  14   DIIRDEESGSLFGHKDKKSWKAFRDKLRLKRAGSAWTSSVHTPASDIPIPVENRFRNSNI  73

Query  263  HPMSSRT-MSRRASNRFPS  316
            +  SSR+ M+RR S RF +
Sbjct  74   NNASSRSLMTRRNSVRFTT  92



>ref|XP_003520924.1| PREDICTED: uncharacterized protein LOC100802736 [Glycine max]
Length=273

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR CSRE+W  +GNCPLCNN ILEILDIF
Sbjct  223  YNCCVCMVRHKGAAFIPCGHTFCRTCSREIWVSRGNCPLCNNLILEILDIF  273



>ref|XP_010685024.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Beta vulgaris 
subsp. vulgaris]
Length=359

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++CCVCMVRHKG AF+PCGHTFCRLCSREL+ ++GNCPLCNNFILEILDIF
Sbjct  309  YSCCVCMVRHKGAAFIPCGHTFCRLCSRELFVQRGNCPLCNNFILEILDIF  359



>ref|XP_010241393.1| PREDICTED: uncharacterized protein LOC104586010 [Nelumbo nucifera]
Length=311

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AF+PCGHTFCRLCSRE+W  +GNCPLCN FILEILDIF
Sbjct  261  YACCVCMVRHKGAAFIPCGHTFCRLCSREVWVNRGNCPLCNGFILEILDIF  311



>gb|AAO49653.1| zinc finger-like protein [Phaseolus vulgaris]
Length=213

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            NCCVCMVRHKG AF+PCGHTFCR+CSRE+WA + NCPLCNN ILEILDIF
Sbjct  164  NCCVCMVRHKGAAFIPCGHTFCRMCSREIWASRRNCPLCNNLILEILDIF  213



>gb|KDP26378.1| hypothetical protein JCGZ_17536 [Jatropha curcas]
Length=375

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHKG AF+PCGHTFCRLCSRELW ++GNCPLCN +I EILDIF
Sbjct  325  HTCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNGYISEILDIF  375


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 48/91 (53%), Gaps = 18/91 (20%)
 Frame = +2

Query  125  DAIKDDP-----NGGKDHKKTWKHFKEKLGLK-DAGDGWTSSTPIPASDVPI--------  262
            D I+DD       G KD KKTWK F+E+L L+   G  WTSS P+PASD+PI        
Sbjct  42   DIIRDDEPHVSLFGHKD-KKTWKAFRERLRLRRSGGSAWTSSVPVPASDIPIQNNNQSFS  100

Query  263  --HPMSSRTMSRRASNRFPSGEYPADEYKPE  349
              +P     ++RR S RF +G  P D    E
Sbjct  101  SNYPQPRSFIARRNSVRF-TGSSPGDSTHAE  130



>ref|XP_010274021.1| PREDICTED: uncharacterized protein LOC104609415 [Nelumbo nucifera]
Length=297

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AFVPCGHTFCRLCSRELW  +GNCPLCN +ILEILDIF
Sbjct  247  YVCCVCMVRHKGAAFVPCGHTFCRLCSRELWVSRGNCPLCNGYILEILDIF  297



>gb|EYU39196.1| hypothetical protein MIMGU_mgv1a010693mg [Erythranthe guttata]
Length=305

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCRLCSRELW ++ +CPLCNN+ILEILDIF
Sbjct  255  NNCCVCMVRHKGAAFIPCGHTFCRLCSRELWVQRKHCPLCNNYILEILDIF  305


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 59/104 (57%), Gaps = 16/104 (15%)
 Frame = +2

Query  125  DAIKDDPNGG------KDHKKTWKHFKEKLGLKDAG--DGWTSST-PIPASDVPIHPMSS  277
            D I++D   G      KD +++W+H K+K+ L+  G  D W+SST PIP+SDVP++    
Sbjct  69   DIIREDQTSGLGVGGRKDARRSWRHLKDKIRLRRRGSDDVWSSSTVPIPSSDVPLNNNRR  128

Query  278  R-TMSRRASNRFPSGEYPADEYKPEL-----AASGRRE-LRSSP  388
               M+RR S RF S    A+  +  L     +ASGR E L SSP
Sbjct  129  MLMMARRPSTRFNSNLDSAESTQASLRTNYRSASGRYEHLSSSP  172



>ref|XP_009411858.1| PREDICTED: histone H3.v1-like [Musa acuminata subsp. malaccensis]
Length=322

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             + CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN +ILEILDIF
Sbjct  271  LYVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGYILEILDIF  322



>ref|XP_002458987.1| hypothetical protein SORBIDRAFT_03g043850 [Sorghum bicolor]
 gb|EES04107.1| hypothetical protein SORBIDRAFT_03g043850 [Sorghum bicolor]
Length=294

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  243  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  294



>gb|EMS57257.1| hypothetical protein TRIUR3_26603 [Triticum urartu]
Length=231

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  180  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  231



>ref|XP_010232176.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 11-like [Brachypodium distachyon]
Length=296

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  245  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  296



>gb|EPS73039.1| hypothetical protein M569_01721, partial [Genlisea aurea]
Length=89

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +HNCCVCMVRHKG  FVPCGH+FCRLCSREL  + GNCPLCNN+ILEILDIF
Sbjct  38   YHNCCVCMVRHKGTPFVPCGHSFCRLCSRELCVQGGNCPLCNNYILEILDIF  89



>ref|NP_001045204.1| Os01g0917900 [Oryza sativa Japonica Group]
 dbj|BAB86148.1| zinc finger (C3HC4-type RING finger)-like [Oryza sativa Japonica 
Group]
 dbj|BAF07118.1| Os01g0917900 [Oryza sativa Japonica Group]
 dbj|BAG98761.1| unnamed protein product [Oryza sativa Japonica Group]
Length=313

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  263  HVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  313



>ref|XP_008656941.1| PREDICTED: nucleolin [Zea mays]
 gb|AFW84176.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=299

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  248  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  299



>ref|NP_001168025.1| uncharacterized LOC100381751 [Zea mays]
 gb|ACN26868.1| unknown [Zea mays]
 tpg|DAA56147.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=306

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  255  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  306



>gb|EEC72038.1| hypothetical protein OsI_04939 [Oryza sativa Indica Group]
Length=283

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  233  HVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  283



>emb|CDM83856.1| unnamed protein product [Triticum aestivum]
Length=357

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  306  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  357



>ref|XP_006646612.1| PREDICTED: uncharacterized protein LOC102708770 [Oryza brachyantha]
Length=165

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  114  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  165



>ref|XP_009385495.1| PREDICTED: uncharacterized protein LOC103972842 [Musa acuminata 
subsp. malaccensis]
Length=266

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             + CCVCMVRHKG AF+PCGHTFCRLCSRELW  +G+CPLCN FILEILDIF
Sbjct  215  LYVCCVCMVRHKGAAFIPCGHTFCRLCSRELWLSRGSCPLCNGFILEILDIF  266



>gb|EEE55893.1| hypothetical protein OsJ_04552 [Oryza sativa Japonica Group]
Length=270

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  219  VHVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  270



>ref|XP_004971061.1| PREDICTED: nucleolin-like [Setaria italica]
Length=301

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN FI EILDIF
Sbjct  251  HVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGFIQEILDIF  301



>ref|XP_009385146.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Musa 
acuminata subsp. malaccensis]
Length=306

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            + CCVCMVRHKG AF+PCGHTFCRLCSRELW  +GNCPLCN  ILEILDI+
Sbjct  256  YMCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGHILEILDIY  306



>ref|XP_006602505.1| PREDICTED: uncharacterized protein LOC100795449 isoform X2 [Glycine 
max]
Length=345

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMV+HK  AF+PCGHTFCR+CSREL   +GNCPLCNNFILEILDIF
Sbjct  295  HTCCVCMVKHKAAAFIPCGHTFCRMCSRELMVSRGNCPLCNNFILEILDIF  345


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS---RR  295
            D IK+D +  KD +++WK FK+KL LK AG  WTSS  IP SDVPI   +SRT +   RR
Sbjct  44   DIIKEDESNKKD-RRSWKAFKDKLRLKRAGSAWTSSIHIPTSDVPIPNPNSRTFTQFGRR  102

Query  296  ASNRFPS  316
             S R P+
Sbjct  103  NSVRSPT  109



>ref|XP_003551383.2| PREDICTED: uncharacterized protein LOC100795449 isoform X1 [Glycine 
max]
Length=357

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMV+HK  AF+PCGHTFCR+CSREL   +GNCPLCNNFILEILDIF
Sbjct  307  HTCCVCMVKHKAAAFIPCGHTFCRMCSRELMVSRGNCPLCNNFILEILDIF  357


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS---RR  295
            D IK+D +  KD +++WK FK+KL LK AG  WTSS  IP SDVPI   +SRT +   RR
Sbjct  56   DIIKEDESNKKD-RRSWKAFKDKLRLKRAGSAWTSSIHIPTSDVPIPNPNSRTFTQFGRR  114

Query  296  ASNRFPS  316
             S R P+
Sbjct  115  NSVRSPT  121



>ref|XP_009382896.1| PREDICTED: uncharacterized protein LOC103970721 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382897.1| PREDICTED: uncharacterized protein LOC103970721 [Musa acuminata 
subsp. malaccensis]
Length=293

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             + CCVCMVRHKG AF+PCGHTFCRLCSRELW  +G+CPLCN +ILEILDIF
Sbjct  242  MYVCCVCMVRHKGAAFIPCGHTFCRLCSRELWVNRGSCPLCNGYILEILDIF  293



>gb|EPS57634.1| hypothetical protein M569_17184, partial [Genlisea aurea]
Length=104

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +NCCVCMVRHKG AF+PCGHTFCR CSRE+W ++G+CPLCNN I+EILDIF
Sbjct  54   YNCCVCMVRHKGAAFIPCGHTFCRRCSREVWVQRGHCPLCNNAIVEILDIF  104



>gb|KHN10991.1| hypothetical protein glysoja_026726 [Glycine soja]
Length=190

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHK  AF+PCGHTFCR+CSREL   +GNCP CNNFILEILDIF
Sbjct  140  HTCCVCMVRHKAAAFIPCGHTFCRMCSRELMVSRGNCPRCNNFILEILDIF  190


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMSR  292
            D IK+D +  KD +++WK FK+KL LK AG  WTS+  IP SDVPI   +SR  ++
Sbjct  44   DIIKEDESNKKD-RRSWKAFKDKLRLKRAGSAWTSTIHIPTSDVPIPNPNSRIFTQ  98



>ref|XP_006586230.1| PREDICTED: uncharacterized protein LOC100776257 isoform X2 [Glycine 
max]
 ref|XP_006586231.1| PREDICTED: uncharacterized protein LOC100776257 isoform X3 [Glycine 
max]
Length=343

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHK  AF+PCGHTFCR+CSREL   +GNCP CNNFILEILDIF
Sbjct  293  HTCCVCMVRHKAAAFIPCGHTFCRMCSRELMVSRGNCPRCNNFILEILDIF  343


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMSR  292
            D IK+D +  KD +++WK FK+KL LK AG  WTS+  IP SDVPI   +SR  ++
Sbjct  44   DIIKEDESNKKD-RRSWKAFKDKLRLKRAGSAWTSTIHIPTSDVPIPNPNSRIFTQ  98



>ref|XP_003530860.2| PREDICTED: uncharacterized protein LOC100776257 isoform X1 [Glycine 
max]
Length=355

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHK  AF+PCGHTFCR+CSREL   +GNCP CNNFILEILDIF
Sbjct  305  HTCCVCMVRHKAAAFIPCGHTFCRMCSRELMVSRGNCPRCNNFILEILDIF  355


 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMSR  292
            D IK+D +  KD +++WK FK+KL LK AG  WTS+  IP SDVPI   +SR  ++
Sbjct  56   DIIKEDESNKKD-RRSWKAFKDKLRLKRAGSAWTSTIHIPTSDVPIPNPNSRIFTQ  110



>gb|KCW48452.1| hypothetical protein EUGRSUZ_K02149 [Eucalyptus grandis]
Length=387

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++CCVCMVRHKG AF+PCGHTFCR+CSREL   +GNCPLCN FILEILDIF
Sbjct  337  YSCCVCMVRHKGSAFIPCGHTFCRMCSRELMVARGNCPLCNKFILEILDIF  387



>ref|XP_009402740.1| PREDICTED: E3 ubiquitin-protein ligase RFWD2-like [Musa acuminata 
subsp. malaccensis]
Length=297

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             + CCVCMVRHKG AF+PCGHTFCRLCSRELW  +G+CPLCN +I+EILDIF
Sbjct  246  LYMCCVCMVRHKGAAFIPCGHTFCRLCSRELWVSRGSCPLCNAYIVEILDIF  297



>ref|XP_010513807.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
1-like [Camelina sativa]
 ref|XP_010513808.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
1-like [Camelina sativa]
Length=265

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILE+LD+F
Sbjct  216  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF  265



>ref|XP_007140631.1| hypothetical protein PHAVU_008G128400g [Phaseolus vulgaris]
 gb|ESW12625.1| hypothetical protein PHAVU_008G128400g [Phaseolus vulgaris]
Length=364

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHK  AF+PCGHTFCR+CSREL   +GNCPLCNNFILEIL+IF
Sbjct  314  HTCCVCMVRHKTAAFIPCGHTFCRMCSRELMVSRGNCPLCNNFILEILEIF  364


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS---RR  295
            D I++D    KD +++WK FK+KL LK AG  W S+  IP SDVPI   +SR  +   RR
Sbjct  44   DIIREDETNKKD-RRSWKAFKDKLRLKRAGSAWISTIHIPTSDVPIPNPNSRIFTQFGRR  102

Query  296  ASNRFPS  316
             S RFPS
Sbjct  103  NSVRFPS  109



>ref|XP_010488610.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Camelina 
sativa]
 ref|XP_010488611.1| PREDICTED: probable E3 ubiquitin-protein ligase HIP1 [Camelina 
sativa]
Length=263

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILE+LD+F
Sbjct  214  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF  263



>ref|XP_007140630.1| hypothetical protein PHAVU_008G128400g [Phaseolus vulgaris]
 gb|ESW12624.1| hypothetical protein PHAVU_008G128400g [Phaseolus vulgaris]
Length=376

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMVRHK  AF+PCGHTFCR+CSREL   +GNCPLCNNFILEIL+IF
Sbjct  326  HTCCVCMVRHKTAAFIPCGHTFCRMCSRELMVSRGNCPLCNNFILEILEIF  376


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS---RR  295
            D I++D    KD +++WK FK+KL LK AG  W S+  IP SDVPI   +SR  +   RR
Sbjct  56   DIIREDETNKKD-RRSWKAFKDKLRLKRAGSAWISTIHIPTSDVPIPNPNSRIFTQFGRR  114

Query  296  ASNRFPS  316
             S RFPS
Sbjct  115  NSVRFPS  121



>ref|NP_189139.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_001030762.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAB01888.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT47796.1| At3g25030 [Arabidopsis thaliana]
 gb|AAU05520.1| At3g25030 [Arabidopsis thaliana]
 gb|AEE76969.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE76970.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=250

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILE+LD+F
Sbjct  201  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF  250



>ref|XP_002883568.1| hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59827.1| hypothetical protein ARALYDRAFT_480010 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILE+LD+F
Sbjct  198  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF  247



>ref|XP_010466923.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
Length=267

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILE+LD+F
Sbjct  218  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF  267



>ref|XP_009420320.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Musa 
acuminata subsp. malaccensis]
Length=299

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
             H CCVCMVRHKG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  248  LHVCCVCMVRHKGAAFIPCGHTFCRMCSRELWVNRGSCPLCNGNILEILDIF  299



>ref|XP_006298377.1| hypothetical protein CARUB_v10014448mg [Capsella rubella]
 ref|XP_006298378.1| hypothetical protein CARUB_v10014448mg [Capsella rubella]
 gb|EOA31275.1| hypothetical protein CARUB_v10014448mg [Capsella rubella]
 gb|EOA31276.1| hypothetical protein CARUB_v10014448mg [Capsella rubella]
Length=256

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILE+LD+F
Sbjct  207  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILEVLDLF  256



>ref|XP_006418677.1| hypothetical protein EUTSA_v10002955mg, partial [Eutrema salsugineum]
 gb|ESQ37113.1| hypothetical protein EUTSA_v10002955mg, partial [Eutrema salsugineum]
Length=354

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILEILD+F
Sbjct  305  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTSILEILDLF  354



>ref|XP_010038992.1| PREDICTED: uncharacterized protein LOC104427627 [Eucalyptus grandis]
Length=502

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            ++CCVCMVRHKG AF+PCGHTFCR+CSREL   +GNCPLCN FILEILDIF
Sbjct  452  YSCCVCMVRHKGSAFIPCGHTFCRMCSRELMVARGNCPLCNKFILEILDIF  502



>ref|XP_010527247.1| PREDICTED: uncharacterized protein LOC104804618 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010527248.1| PREDICTED: uncharacterized protein LOC104804618 isoform X2 [Tarenaya 
hassleriana]
Length=310

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILEILDIF
Sbjct  262  CCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNASILEILDIF  310



>ref|XP_006284342.1| hypothetical protein CARUB_v10005514mg [Capsella rubella]
 gb|EOA17240.1| hypothetical protein CARUB_v10005514mg [Capsella rubella]
Length=248

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  199  SCCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILQVLDIF  248



>ref|XP_006284343.1| hypothetical protein CARUB_v10005514mg [Capsella rubella]
 gb|EOA17241.1| hypothetical protein CARUB_v10005514mg [Capsella rubella]
Length=265

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  216  SCCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILQVLDIF  265



>ref|NP_193046.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE83231.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=259

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  211  CCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF  259



>ref|NP_001190713.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE83234.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=256

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  208  CCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF  256



>ref|NP_001078383.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_001190714.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE83233.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE83235.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=256

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  208  CCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF  256



>ref|XP_010495985.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495986.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495987.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495988.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495989.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495990.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495991.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010495992.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
Length=264

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  215  SCCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILQVLDIF  264



>ref|NP_849372.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE83232.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=265

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  217  CCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF  265



>ref|XP_010440651.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010440652.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010440653.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
Length=264

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  215  SCCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILQVLDIF  264



>ref|XP_010450283.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450284.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450285.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450287.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450288.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450289.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450290.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450291.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450292.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450293.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
 ref|XP_010450294.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
Length=264

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  216  CCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTTILQVLDIF  264



>ref|XP_010527246.1| PREDICTED: uncharacterized protein LOC104804618 isoform X1 [Tarenaya 
hassleriana]
Length=333

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  ILEILDIF
Sbjct  285  CCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNASILEILDIF  333



>emb|CAB45509.1| putative protein [Arabidopsis thaliana]
 emb|CAB78352.1| putative protein [Arabidopsis thaliana]
Length=304

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  256  CCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF  304



>emb|CDY69745.1| BnaAnng31380D [Brassica napus]
Length=245

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  I EILD+F
Sbjct  196  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTSISEILDLF  245



>ref|XP_004513525.1| PREDICTED: uncharacterized protein LOC101512916 [Cicer arietinum]
Length=340

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H CCVCMV+HKG +  PCGH+FCR+CSREL   KGNCPLCNNFILEIL+IF
Sbjct  290  HTCCVCMVKHKGASIAPCGHSFCRMCSRELMVAKGNCPLCNNFILEILEIF  340


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS---RR  295
            D I++D    KD +++WK FK+KL LK AG  WTSS  IP SD+PI   +SR+ S   RR
Sbjct  46   DIIREDETNKKD-RRSWKAFKDKLRLKRAGSAWTSSIHIPTSDIPIQNPNSRSYSQFGRR  104

Query  296  ASNRFPSGEYPAD  334
             S RF   ++ AD
Sbjct  105  NSVRF-QNQHEAD  116



>ref|XP_002863174.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39433.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=259

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++LDIF
Sbjct  211  CCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTAILQVLDIF  259



>ref|XP_009102442.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102444.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102445.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102446.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102447.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102448.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102449.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
 ref|XP_009102450.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Brassica 
rapa]
Length=266

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  I EILD+F
Sbjct  217  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTSISEILDLF  266



>emb|CDX77379.1| BnaA07g05170D [Brassica napus]
Length=250

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMVR KG AF+PCGHTFCRLCSRELW ++GNCPLCN  I EILD+F
Sbjct  201  SCCVCMVRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTSISEILDLF  250



>ref|XP_006414976.1| hypothetical protein EUTSA_v10026173mg [Eutrema salsugineum]
 gb|ESQ56429.1| hypothetical protein EUTSA_v10026173mg [Eutrema salsugineum]
Length=225

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM+R KG AF+PCGHTFCRLCSRELW ++GNCPLCN  IL++L+IF
Sbjct  177  CCVCMIRSKGAAFIPCGHTFCRLCSRELWVQRGNCPLCNTSILQVLNIF  225



>ref|XP_011088095.1| PREDICTED: nucleolin-like [Sesamum indicum]
Length=290

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +++CCVCMVRHKG AF  CGH+FCRLCSRE+  + GNCPLCNN+ILEILDIF
Sbjct  239  YNSCCVCMVRHKGVAFDRCGHSFCRLCSREMGVQGGNCPLCNNYILEILDIF  290



>ref|XP_006850339.1| hypothetical protein AMTR_s00020p00238060 [Amborella trichopoda]
 gb|ERN11920.1| hypothetical protein AMTR_s00020p00238060 [Amborella trichopoda]
Length=313

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR+KG AF+PCGHTFCR+CSRE+W  +G+CPLCN FI E+LDIF
Sbjct  265  CCVCMVRNKGAAFIPCGHTFCRVCSREVWVSRGSCPLCNGFIREVLDIF  313



>gb|KEH22672.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=339

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
              CC+CMV+HKG AF PCGH+FCR+CSREL   KG+CPLCNNFI+EIL+IF
Sbjct  289  ETCCICMVKHKGAAFAPCGHSFCRMCSRELMVAKGSCPLCNNFIVEILEIF  339


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 4/67 (6%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS---RR  295
            D IK+D    KD +++WK FK+K+ LK  G  WTS+  IP SD+PI   +SR+ S   RR
Sbjct  44   DTIKEDEINKKD-RRSWKAFKDKIRLKRTGSAWTSTIHIPTSDIPIQNPNSRSFSQFGRR  102

Query  296  ASNRFPS  316
             S R  +
Sbjct  103  NSVRIQT  109



>gb|KDP20692.1| hypothetical protein JCGZ_21163 [Jatropha curcas]
Length=196

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHT+CR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  148  CCVCMVRKKGAAFIPCGHTYCRVCSREVWLNRGSCPLCNRLILEILDIF  196



>ref|XP_010439356.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Camelina sativa]
Length=220

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  172  CCVCMVRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  220



>ref|XP_003610487.1| hypothetical protein MTR_4g132760 [Medicago truncatula]
 gb|AES92684.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=217

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +GNCPLCN  ILEILDIF
Sbjct  169  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGNCPLCNRSILEILDIF  217



>ref|XP_003600695.1| Zinc finger-like protein [Medicago truncatula]
 gb|AES70946.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=340

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  632  HNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            H C +CMV+HKG A   CGH+FCR+CSREL   KGNCPLCNNF+LEIL+IF
Sbjct  290  HTCSICMVKHKGTALAACGHSFCRMCSRELLVSKGNCPLCNNFVLEILEIF  340


 Score = 62.8 bits (151),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  125  DAIKDDPNGGKDHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMSR  292
            D IKDD +  KD +++WK FK+KL LK AG  WTSS PIP SD+PI   +SR+ S+
Sbjct  48   DIIKDDESNKKD-RRSWKAFKDKLRLKRAGSAWTSSIPIPTSDIPIQNPNSRSFSQ  102



>ref|XP_002518414.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF43801.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=211

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHT+CR+CSRE+W  +G+CPLCN  ILEILD+F
Sbjct  163  CCVCMVRKKGAAFIPCGHTYCRVCSREVWLNRGSCPLCNRSILEILDLF  211



>gb|KDP30811.1| hypothetical protein JCGZ_13754 [Jatropha curcas]
Length=187

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRE+WA +G+CP+CN  ILEILDIF
Sbjct  139  CCVCMERNKGAAFIPCGHTFCRVCSREMWANRGSCPVCNRSILEILDIF  187



>ref|XP_010532903.1| PREDICTED: E3 ubiquitin-protein ligase RNF123-like [Tarenaya 
hassleriana]
 ref|XP_010532904.1| PREDICTED: E3 ubiquitin-protein ligase RNF123-like [Tarenaya 
hassleriana]
 ref|XP_010532905.1| PREDICTED: E3 ubiquitin-protein ligase RNF123-like [Tarenaya 
hassleriana]
 ref|XP_010532906.1| PREDICTED: E3 ubiquitin-protein ligase RNF123-like [Tarenaya 
hassleriana]
 ref|XP_010532907.1| PREDICTED: E3 ubiquitin-protein ligase RNF123-like [Tarenaya 
hassleriana]
Length=266

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVR KG AF+PCGHTFCR CSRELW ++G+CPLCN  I EILDIF
Sbjct  218  CCVCMVRSKGAAFIPCGHTFCRSCSRELWVQRGSCPLCNASITEILDIF  266



>emb|CAN69131.1| hypothetical protein VITISV_012047 [Vitis vinifera]
Length=207

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  159  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  207



>ref|XP_003549638.1| PREDICTED: uncharacterized protein LOC100792613 [Glycine max]
Length=198

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDIF
Sbjct  150  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGTCPLCNRSILEILDIF  198



>ref|XP_006449819.1| hypothetical protein CICLE_v10017636mg [Citrus clementina]
 gb|ESR63059.1| hypothetical protein CICLE_v10017636mg [Citrus clementina]
Length=232

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  184  CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF  232



>ref|XP_007147676.1| hypothetical protein PHAVU_006G145000g [Phaseolus vulgaris]
 gb|ESW19670.1| hypothetical protein PHAVU_006G145000g [Phaseolus vulgaris]
Length=189

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  141  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  189



>ref|XP_004293331.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
2-like isoform 1 [Fragaria vesca subsp. vesca]
Length=236

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  188  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRTILEILDIF  236



>gb|KFK28795.1| hypothetical protein AALP_AA7G049300 [Arabis alpina]
Length=205

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  157  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPILEILDIF  205



>gb|KDO78382.1| hypothetical protein CISIN_1g026976mg [Citrus sinensis]
Length=230

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  182  CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF  230



>ref|XP_006467365.1| PREDICTED: uncharacterized protein LOC102611819 isoform X1 [Citrus 
sinensis]
Length=230

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  182  CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF  230



>ref|XP_008371042.1| PREDICTED: nuclear factor 7, brain-like isoform X1 [Malus domestica]
Length=245

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  197  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  245



>ref|XP_008224725.1| PREDICTED: uncharacterized protein LOC103324448 isoform X1 [Prunus 
mume]
Length=247

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  199  CCVCMSRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  247



>ref|XP_006467366.1| PREDICTED: uncharacterized protein LOC102611819 isoform X2 [Citrus 
sinensis]
Length=202

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  154  CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSILEILDIF  202



>ref|XP_003534716.1| PREDICTED: uncharacterized protein LOC100804292 [Glycine max]
Length=196

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  148  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  196



>ref|XP_007213121.1| hypothetical protein PRUPE_ppa023929mg [Prunus persica]
 gb|EMJ14320.1| hypothetical protein PRUPE_ppa023929mg [Prunus persica]
Length=247

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  199  CCVCMSRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  247



>ref|XP_008371043.1| PREDICTED: nuclear factor 7, brain-like isoform X2 [Malus domestica]
Length=217

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  169  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  217



>ref|XP_008224726.1| PREDICTED: uncharacterized protein LOC103324448 isoform X2 [Prunus 
mume]
 ref|XP_008224727.1| PREDICTED: uncharacterized protein LOC103324448 isoform X2 [Prunus 
mume]
Length=219

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  171  CCVCMSRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  219



>ref|XP_004293332.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
2-like isoform 2 [Fragaria vesca subsp. vesca]
Length=208

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  160  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRTILEILDIF  208



>ref|XP_008366072.1| PREDICTED: uncharacterized protein LOC103429722 isoform X1 [Malus 
domestica]
Length=245

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  197  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  245



>ref|XP_011096012.1| PREDICTED: uncharacterized protein LOC105175305 isoform X2 [Sesamum 
indicum]
 ref|XP_011096013.1| PREDICTED: uncharacterized protein LOC105175305 isoform X2 [Sesamum 
indicum]
Length=215

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDI+
Sbjct  167  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPILEILDIY  215



>ref|XP_008366073.1| PREDICTED: nuclear factor 7, ovary-like isoform X2 [Malus domestica]
Length=217

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  169  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  217



>ref|XP_008358756.1| PREDICTED: uncharacterized protein LOC103422474 isoform X1 [Malus 
domestica]
Length=245

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  197  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  245



>ref|XP_010252568.1| PREDICTED: uncharacterized protein LOC104594111 [Nelumbo nucifera]
Length=221

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  173  CCVCMGRRKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  221



>ref|XP_010270046.1| PREDICTED: uncharacterized protein LOC104606503 [Nelumbo nucifera]
Length=227

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  179  CCVCMGRRKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  227



>gb|KHN03506.1| hypothetical protein glysoja_004532, partial [Glycine soja]
Length=151

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDIF
Sbjct  103  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGTCPLCNRSILEILDIF  151



>ref|XP_010448916.1| PREDICTED: E3 ubiquitin-protein ligase RNF170-like [Camelina 
sativa]
Length=217

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  169  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  217



>emb|CDX79140.1| BnaA01g12070D [Brassica napus]
Length=208

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  160  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  208



>ref|XP_008358757.1| PREDICTED: nuclear factor 7, ovary-like isoform X2 [Malus domestica]
Length=217

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILEILDIF
Sbjct  169  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEILDIF  217



>ref|XP_011096011.1| PREDICTED: uncharacterized protein LOC105175305 isoform X1 [Sesamum 
indicum]
Length=247

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDI+
Sbjct  199  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPILEILDIY  247



>ref|XP_010928415.1| PREDICTED: uncharacterized protein LOC105050190 [Elaeis guineensis]
Length=216

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+C+RELW  +G+CPLCN  ILE LDI+
Sbjct  168  CCVCMGRQKGAAFIPCGHTFCRVCARELWISRGSCPLCNQLILETLDIY  216



>ref|XP_010529465.1| PREDICTED: apoptosis 1 inhibitor-like [Tarenaya hassleriana]
Length=211

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  I+EILDI+
Sbjct  163  CCVCMGREKGAAFIPCGHTFCRVCSRELWLNRGTCPLCNRPIIEILDIY  211



>ref|XP_002867780.1| hypothetical protein ARALYDRAFT_492641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44039.1| hypothetical protein ARALYDRAFT_492641 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  166  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  214



>gb|ABD32654.1| Zinc finger, RING-type [Medicago truncatula]
Length=304

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  256  CCVCMGRNKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSIIEILDIF  304



>ref|XP_010686766.1| PREDICTED: uncharacterized protein LOC104900931 [Beta vulgaris 
subsp. vulgaris]
Length=251

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  203  CCVCMGRKKGAAFIPCGHTYCRVCSRELWVNRGSCPLCNRQIIEILDIF  251



>ref|XP_006284541.1| hypothetical protein CARUB_v10005744mg [Capsella rubella]
 gb|EOA17439.1| hypothetical protein CARUB_v10005744mg [Capsella rubella]
Length=207

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  159  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  207



>ref|XP_010434067.1| PREDICTED: uncharacterized protein LOC104718092 [Camelina sativa]
Length=219

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  171  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  219



>ref|XP_007026205.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007026206.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY28827.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY28828.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=205

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM + KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  157  CCVCMGKKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  205



>ref|XP_003547273.1| PREDICTED: uncharacterized protein LOC100804959 [Glycine max]
Length=209

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  161  CCVCMGRKKGAALIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  209



>ref|XP_006413677.1| hypothetical protein EUTSA_v10026221mg [Eutrema salsugineum]
 gb|ESQ55130.1| hypothetical protein EUTSA_v10026221mg [Eutrema salsugineum]
Length=214

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  166  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  214



>ref|NP_193956.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAC42910.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64022.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84582.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=214

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  166  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  214



>ref|XP_009356035.1| PREDICTED: uncharacterized protein LOC103946903 isoform X1 [Pyrus 
x bretschneideri]
Length=240

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILE+LDIF
Sbjct  192  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEVLDIF  240



>ref|XP_002271383.2| PREDICTED: uncharacterized protein LOC100253430 [Vitis vinifera]
Length=229

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRELW  +G CP+CN  ILEILDIF
Sbjct  181  CCVCMERNKGAAFIPCGHTFCRVCSRELWLNRGCCPICNRSILEILDIF  229



>ref|XP_006383842.1| hypothetical protein POPTR_0004s00470g, partial [Populus trichocarpa]
 gb|ERP61639.1| hypothetical protein POPTR_0004s00470g, partial [Populus trichocarpa]
Length=155

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  107  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  155



>ref|XP_008799397.1| PREDICTED: uncharacterized protein LOC103714043 [Phoenix dactylifera]
Length=207

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +  CCVCM R KG AF+PCGHTFCR+C+RELW  +G+CPLCN  ILE LDI+
Sbjct  156  WWGCCVCMGRRKGAAFIPCGHTFCRVCARELWISRGSCPLCNQLILETLDIY  207



>gb|EYU27737.1| hypothetical protein MIMGU_mgv1a013644mg [Erythranthe guttata]
Length=214

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R +G AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  166  CCVCMGRKRGAAFIPCGHTFCRVCSRELWLNRGTCPLCNRSILEILDIY  214



>ref|XP_010099141.1| hypothetical protein L484_014139 [Morus notabilis]
 gb|EXB77013.1| hypothetical protein L484_014139 [Morus notabilis]
Length=229

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDIF
Sbjct  181  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGACPLCNRPILEILDIF  229



>ref|XP_009356096.1| PREDICTED: apoptosis 1 inhibitor-like isoform X2 [Pyrus x bretschneideri]
Length=212

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  ILE+LDIF
Sbjct  164  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRSILEVLDIF  212



>ref|XP_008440052.1| PREDICTED: uncharacterized protein LOC103484644 [Cucumis melo]
 ref|XP_008440053.1| PREDICTED: uncharacterized protein LOC103484644 [Cucumis melo]
Length=213

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  165  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  213



>emb|CAA16775.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79180.1| hypothetical protein [Arabidopsis thaliana]
Length=202

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  154  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  202



>gb|KHN32986.1| hypothetical protein glysoja_009977 [Glycine soja]
Length=187

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  139  CCVCMGRKKGAALIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  187



>ref|XP_004134982.1| PREDICTED: uncharacterized protein LOC101211804 [Cucumis sativus]
 gb|KGN49071.1| hypothetical protein Csa_6G512860 [Cucumis sativus]
Length=243

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  195  CCVCMGRKKGAAFIPCGHTFCRICSRELWLNRGSCPLCNRPIIEILDIF  243



>emb|CDM85721.1| unnamed protein product [Triticum aestivum]
Length=252

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM RHKG AF+PCGHTFCRLCSREL   +GNCPLCN FI +IL IF
Sbjct  204  CCVCMARHKGAAFIPCGHTFCRLCSRELRHTRGNCPLCNVFIQDILHIF  252



>ref|XP_010943248.1| PREDICTED: RING finger protein 26-like [Elaeis guineensis]
 ref|XP_010943250.1| PREDICTED: RING finger protein 26-like [Elaeis guineensis]
 ref|XP_010943251.1| PREDICTED: RING finger protein 26-like [Elaeis guineensis]
Length=220

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +  CCVCM R KG AF+PCGHTFCR+C+RELW  +G+CPLCN  ILE LDI+
Sbjct  169  WWGCCVCMGRRKGAAFIPCGHTFCRVCARELWITRGSCPLCNQLILETLDIY  220



>ref|XP_004486197.1| PREDICTED: uncharacterized protein LOC101514499 [Cicer arietinum]
Length=212

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R++G AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  164  CCVCMGRNRGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSIVEILDIF  212



>ref|XP_010057881.1| PREDICTED: homeobox even-skipped homolog protein 2 [Eucalyptus 
grandis]
Length=216

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  168  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGSCPLCNRPILEILDIF  216



>gb|KCW75227.1| hypothetical protein EUGRSUZ_E03980 [Eucalyptus grandis]
Length=236

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  188  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGSCPLCNRPILEILDIF  236



>ref|XP_006343415.1| PREDICTED: uncharacterized protein LOC102605265 [Solanum tuberosum]
Length=241

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  193  CCVCMRRKKGAAFIPCGHTFCRVCSRELWVNRGYCPLCNRSILEILDIY  241



>emb|CDX98736.1| BnaA03g45210D [Brassica napus]
Length=201

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R +G AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  153  CCVCMGRKRGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIEILDIF  201



>ref|XP_009761554.1| PREDICTED: uncharacterized protein LOC104213715 [Nicotiana sylvestris]
 ref|XP_009761555.1| PREDICTED: uncharacterized protein LOC104213715 [Nicotiana sylvestris]
Length=213

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  165  CCVCMQRKKGAAFIPCGHTFCRVCSRELWVNRGCCPLCNRSILEILDIY  213



>emb|CBI28866.3| unnamed protein product [Vitis vinifera]
Length=193

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRELW  +G CP+CN  ILEILDIF
Sbjct  145  CCVCMERNKGAAFIPCGHTFCRVCSRELWLNRGCCPICNRSILEILDIF  193



>ref|XP_009137244.1| PREDICTED: uncharacterized protein LOC103861291 [Brassica rapa]
Length=197

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R +G AF+PCGHTFCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  149  CCVCMGRKRGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIVEILDIF  197



>ref|XP_006288670.1| hypothetical protein CARUB_v10001978mg [Capsella rubella]
 gb|EOA21568.1| hypothetical protein CARUB_v10001978mg [Capsella rubella]
Length=206

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  158  CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRPIIEILDIY  206



>emb|CDX82926.1| BnaC01g13760D [Brassica napus]
Length=201

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  I+E LDIF
Sbjct  153  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRPIIETLDIF  201



>ref|XP_011047008.1| PREDICTED: uncharacterized protein LOC105141476 [Populus euphratica]
Length=287

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CPLCN  ILEILDIF
Sbjct  239  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPLCNRSILEILDIF  287



>ref|XP_004234587.1| PREDICTED: putative E3 ubiquitin-protein ligase XBAT35 [Solanum 
lycopersicum]
Length=245

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  197  CCVCMRRKKGAAFIPCGHTFCRVCSRELWVNRGCCPLCNRSILEILDIY  245



>ref|XP_011047192.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Populus euphratica]
Length=184

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRE+W  +G CP+CN  IL+ILDIF
Sbjct  136  CCVCMERNKGAAFIPCGHTFCRVCSREMWVNRGCCPICNRSILDILDIF  184



>ref|XP_006447651.1| hypothetical protein CICLE_v10016774mg [Citrus clementina]
 ref|XP_006469610.1| PREDICTED: uncharacterized protein LOC102613521 [Citrus sinensis]
 gb|ESR60891.1| hypothetical protein CICLE_v10016774mg [Citrus clementina]
Length=199

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSR+LW  +G CP+CN  I+EILDIF
Sbjct  151  CCVCMERNKGAAFIPCGHTFCRVCSRDLWLNRGTCPICNRSIIEILDIF  199



>ref|NP_680579.2| C3HC4 type RING-finger protein [Arabidopsis thaliana]
 gb|AAU44505.1| hypothetical protein AT4G03965 [Arabidopsis thaliana]
 gb|AAV63915.1| hypothetical protein At4g03965 [Arabidopsis thaliana]
 gb|AEE82362.1| C3HC4 type RING-finger protein [Arabidopsis thaliana]
Length=209

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  161  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  209



>gb|KDO54310.1| hypothetical protein CISIN_1g036555mg [Citrus sinensis]
Length=198

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSR+LW  +G CP+CN  I+EILDIF
Sbjct  150  CCVCMERNKGAAFIPCGHTFCRVCSRDLWLNRGTCPICNRSIIEILDIF  198



>ref|XP_006447650.1| hypothetical protein CICLE_v10016774mg [Citrus clementina]
 gb|ESR60890.1| hypothetical protein CICLE_v10016774mg [Citrus clementina]
Length=177

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSR+LW  +G CP+CN  I+EILDIF
Sbjct  129  CCVCMERNKGAAFIPCGHTFCRVCSRDLWLNRGTCPICNRSIIEILDIF  177



>ref|XP_008449482.1| PREDICTED: uncharacterized protein LOC103491356 [Cucumis melo]
Length=169

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CP+C+  I+EILDIF
Sbjct  121  CCVCMERSKGAAFIPCGHTFCRVCSRELWLNRGTCPICSRSIIEILDIF  169



>ref|XP_004507659.1| PREDICTED: uncharacterized protein LOC101490848 [Cicer arietinum]
Length=194

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  +LEILDIF
Sbjct  146  CCVCMGRKKGAAFIPCGHTFCRVCSREMWLNRGSCPLCNRSVLEILDIF  194



>ref|XP_002872676.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48935.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=203

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  155  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  203



>ref|XP_004140123.1| PREDICTED: ring finger protein 26-like [Cucumis sativus]
 ref|XP_004156092.1| PREDICTED: ring finger protein 26-like [Cucumis sativus]
 gb|KGN47968.1| hypothetical protein Csa_6G421620 [Cucumis sativus]
Length=169

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CP+C+  I+EILDIF
Sbjct  121  CCVCMERSKGAAFIPCGHTFCRVCSRELWLNRGTCPICSRSIIEILDIF  169



>ref|XP_009135747.1| PREDICTED: LOW QUALITY PROTEIN: apoptosis 1 inhibitor [Brassica 
rapa]
Length=207

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGH FCR+CSRELW  +G+CPLCN  I+EILDIF
Sbjct  159  CCVCMGRKKGAAFIPCGHXFCRVCSRELWLNRGSCPLCNRPIIEILDIF  207



>ref|XP_009628205.1| PREDICTED: uncharacterized protein LOC104118626 [Nicotiana tomentosiformis]
Length=224

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  176  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGYCPLCNRSILEILDIY  224



>ref|XP_010035514.1| PREDICTED: nuclear factor 7, brain-like [Eucalyptus grandis]
 ref|XP_010035515.1| PREDICTED: nuclear factor 7, brain-like [Eucalyptus grandis]
 gb|KCW46936.1| hypothetical protein EUGRSUZ_K00751 [Eucalyptus grandis]
 gb|KCW46937.1| hypothetical protein EUGRSUZ_K00751 [Eucalyptus grandis]
Length=210

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G CP+CN  ILEILD+F
Sbjct  162  CCVCMERSKGAAFIPCGHTFCRVCSRELWVNRGCCPICNRSILEILDLF  210



>gb|KFK30955.1| hypothetical protein AALP_AA6G049200 [Arabis alpina]
Length=207

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  159  CCVCMGRKKGAAFIPCGHTFCRVCSREIWLNRGSCPLCNRPIIEILDIY  207



>emb|CDY21289.1| BnaC03g29730D [Brassica napus]
Length=202

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  154  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  202



>dbj|BAK04462.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=253

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR C+REL A +G CPLCN  IL++LDIF
Sbjct  205  CCVCMARAKGAAFIPCGHTFCRACARELLAVRGRCPLCNAAILDVLDIF  253



>ref|XP_008803516.1| PREDICTED: RING finger protein 26 [Phoenix dactylifera]
Length=218

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  629  FHNCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +  CCVCM R KG AF+PCGHTFCR+C+RELW  +G+CPLCN  ILE LDI+
Sbjct  167  WWGCCVCMGRRKGAAFIPCGHTFCRVCARELWITRGSCPLCNQSILETLDIY  218



>ref|XP_002320486.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE98801.1| zinc finger family protein [Populus trichocarpa]
Length=187

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRE+W  +G CP+CN  IL+ILDIF
Sbjct  139  CCVCMERNKGAAFIPCGHTFCRVCSREMWVNRGCCPICNRSILDILDIF  187



>gb|ABK92851.1| unknown [Populus trichocarpa]
Length=188

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRE+W  +G CP+CN  IL+ILDIF
Sbjct  140  CCVCMERNKGAAFIPCGHTFCRVCSREMWVNRGCCPICNRSILDILDIF  188



>ref|XP_009628059.1| PREDICTED: uncharacterized protein LOC104118512 [Nicotiana tomentosiformis]
 ref|XP_009628060.1| PREDICTED: uncharacterized protein LOC104118512 [Nicotiana tomentosiformis]
Length=216

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSR+LW  +G CPLCN  ILEILDI+
Sbjct  168  CCVCMQRKKGAAFIPCGHTFCRVCSRDLWVNRGCCPLCNRSILEILDIY  216



>ref|XP_009616720.1| PREDICTED: uncharacterized protein LOC104109198 [Nicotiana tomentosiformis]
 ref|XP_009616721.1| PREDICTED: uncharacterized protein LOC104109198 [Nicotiana tomentosiformis]
 ref|XP_009616722.1| PREDICTED: uncharacterized protein LOC104109198 [Nicotiana tomentosiformis]
Length=153

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHT+CR+CSRELW+ +G CPLCN  I EILDIF
Sbjct  105  CCVCMERNKGAAFIPCGHTYCRVCSRELWSGRGLCPLCNRSIYEILDIF  153



>ref|XP_010316564.1| PREDICTED: uncharacterized protein LOC104645789 [Solanum lycopersicum]
Length=203

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  155  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGCCPLCNRSILEILDIY  203



>ref|XP_002302857.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE82130.1| zinc finger family protein [Populus trichocarpa]
Length=180

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGH FCR+CSRE+W  +G+CP+CN  IL+ILDIF
Sbjct  132  CCVCMERKKGAAFIPCGHAFCRVCSREMWVNRGSCPICNRSILDILDIF  180



>ref|XP_006348169.1| PREDICTED: uncharacterized protein LOC102584506 [Solanum tuberosum]
Length=208

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G CPLCN  ILEILDI+
Sbjct  160  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGCCPLCNRSILEILDIY  208



>ref|XP_011008922.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Populus euphratica]
 ref|XP_011008923.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Populus euphratica]
 ref|XP_011008924.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Populus euphratica]
Length=180

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGH FCR+CSRE+W  +G+CP+CN  IL+ILDIF
Sbjct  132  CCVCMERKKGAAFIPCGHAFCRVCSREMWVNRGSCPICNRSILDILDIF  180



>ref|XP_009783349.1| PREDICTED: uncharacterized protein LOC104231962 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009783350.1| PREDICTED: uncharacterized protein LOC104231962 isoform X2 [Nicotiana 
sylvestris]
Length=218

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G CPLCN  I+EILDI+
Sbjct  170  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGYCPLCNRSIIEILDIY  218



>ref|XP_009783348.1| PREDICTED: uncharacterized protein LOC104231962 isoform X1 [Nicotiana 
sylvestris]
Length=243

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRELW  +G CPLCN  I+EILDI+
Sbjct  195  CCVCMGRKKGAAFIPCGHTYCRVCSRELWLNRGYCPLCNRSIIEILDIY  243



>ref|XP_010233581.1| PREDICTED: probable E3 ubiquitin-protein ligase XBOS34 [Brachypodium 
distachyon]
Length=160

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCMVRHKG AFVPCGHTFCRLCSR+L   +  CPLCN FI +IL IF
Sbjct  112  CCVCMVRHKGAAFVPCGHTFCRLCSRDLRLARATCPLCNAFIHDILHIF  160



>ref|XP_010110624.1| hypothetical protein L484_004822 [Morus notabilis]
 gb|EXC27246.1| hypothetical protein L484_004822 [Morus notabilis]
Length=199

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+CSRE+W  +G CPLC+  I+EILDI+
Sbjct  151  CCVCMERNKGAAFIPCGHTFCRVCSREMWVNRGTCPLCSRPIVEILDIY  199



>ref|XP_007049182.1| Ubiquitin-protein ligase, putative [Theobroma cacao]
 gb|EOX93339.1| Ubiquitin-protein ligase, putative [Theobroma cacao]
Length=221

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGH FCR+CSRE+W  +G+CP+CN  IL+ILDIF
Sbjct  173  CCVCMERKKGAAFIPCGHAFCRVCSREVWVNRGSCPVCNRSILDILDIF  221



>ref|XP_010496157.1| PREDICTED: apoptosis 1 inhibitor-like [Camelina sativa]
Length=212

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  164  CCVCMGRKKGAALIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  212



>emb|CDP04456.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R K  AF+PCGHTFCR+CSRELW  +G CPLCN  ILEILDIF
Sbjct  166  CCVCMGRKKDAAFIPCGHTFCRVCSRELWFNRGLCPLCNRSILEILDIF  214



>ref|XP_010433082.1| PREDICTED: uncharacterized protein LOC104717233 [Camelina sativa]
Length=213

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  165  CCVCMGRKKGAALIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  213



>ref|XP_004973980.1| PREDICTED: atherin-like [Setaria italica]
Length=276

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR C+REL A +G CPLCN  I+++LDIF
Sbjct  228  CCVCMARAKGAAFIPCGHTFCRACARELLAGRGRCPLCNAAIVDVLDIF  276



>ref|XP_010430290.1| PREDICTED: apoptosis 1 inhibitor-like [Camelina sativa]
Length=212

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+WA +G CPLCN  I ++LD++
Sbjct  164  CCVCMGREKGAAFIPCGHTYCRVCSREIWANRGTCPLCNRSIFDVLDLY  212



>ref|XP_010418230.1| PREDICTED: apoptosis 1 inhibitor-like [Camelina sativa]
Length=209

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+WA +G CPLCN  I ++LD++
Sbjct  161  CCVCMGREKGAAFIPCGHTYCRVCSREIWANRGTCPLCNRSIFDVLDLY  209



>ref|XP_002525340.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF37073.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=193

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHTFCR+C RE+W  +G CP+CN  I+EILD+F
Sbjct  145  CCVCMERNKGAAFIPCGHTFCRICCREMWVNRGTCPICNRPIVEILDLF  193



>ref|XP_004243512.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like 
[Solanum lycopersicum]
 ref|XP_010323853.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like 
[Solanum lycopersicum]
Length=170

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHT+CR+CSRELW ++G+CPLCN  I EIL+IF
Sbjct  122  CCVCMERNKGAAFIPCGHTYCRVCSRELWMKRGSCPLCNCSIDEILNIF  170



>ref|XP_002882512.1| hypothetical protein ARALYDRAFT_478032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58771.1| hypothetical protein ARALYDRAFT_478032 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMV+ KG +F PCGHTFC+LCS+EL A+KG+CP+C++F+LE L+IF
Sbjct  311  SCCVCMVKIKGASFTPCGHTFCKLCSKELMAQKGHCPVCSSFVLEFLEIF  360



>ref|XP_002444712.1| hypothetical protein SORBIDRAFT_07g026470 [Sorghum bicolor]
 gb|EES14207.1| hypothetical protein SORBIDRAFT_07g026470 [Sorghum bicolor]
Length=288

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR C+REL A +G CPLCN  I+++LDIF
Sbjct  240  CCVCMARAKGAAFIPCGHTFCRACARELLAGRGRCPLCNAAIVDVLDIF  288



>ref|XP_010422245.1| PREDICTED: apoptosis 1 inhibitor-like [Camelina sativa]
Length=212

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  164  CCVCMGRKKGAALIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  212



>ref|XP_007153994.1| hypothetical protein PHAVU_003G082200g [Phaseolus vulgaris]
 gb|ESW25988.1| hypothetical protein PHAVU_003G082200g [Phaseolus vulgaris]
Length=195

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CS+E+W ++G CPLCN  +L+IL IF
Sbjct  147  CCVCMGRKKGAAFIPCGHTFCRVCSKEMWLKRGTCPLCNRSVLDILHIF  195



>ref|NP_187368.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAF20234.1|AC012395_21 putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAV85664.1| At3g07120 [Arabidopsis thaliana]
 gb|AAW78594.1| At3g07120 [Arabidopsis thaliana]
 gb|AEE74501.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=360

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMV+ KG +F PCGHTFC+LCS+EL A+KG+CP+C++F+LE L+IF
Sbjct  311  SCCVCMVKIKGASFTPCGHTFCKLCSKELMAQKGHCPVCSSFVLEFLEIF  360



>gb|AAC28219.1| contains similarity to C3HC4-type zinc fingers (Pfam: zf-C3HC4.hmm, 
score: 32.94) [Arabidopsis thaliana]
 emb|CAB80819.1| putative protein [Arabidopsis thaliana]
Length=233

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  185  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  233



>ref|XP_010539368.1| PREDICTED: apoptosis 1 inhibitor [Tarenaya hassleriana]
Length=208

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRELW  +G+CP+C   I+EILDI+
Sbjct  160  CCVCMGRKKGAAFIPCGHTFCRVCSRELWLNRGSCPICIRPIIEILDIY  208



>ref|XP_006396723.1| hypothetical protein EUTSA_v10029329mg [Eutrema salsugineum]
 gb|ESQ38176.1| hypothetical protein EUTSA_v10029329mg [Eutrema salsugineum]
Length=204

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+ ILDI+
Sbjct  156  CCVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNCPIIAILDIY  204



>emb|CDY32036.1| BnaA03g60400D [Brassica napus]
Length=211

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G+CPLCN  I ++LD++
Sbjct  163  CCVCMGREKGAAFIPCGHTYCRMCSREIWMNRGSCPLCNRSIFDVLDLY  211



>emb|CDY08650.1| BnaC04g19590D [Brassica napus]
Length=211

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G+CPLCN  I ++LD++
Sbjct  163  CCVCMGREKGAAFIPCGHTYCRVCSREIWMNRGSCPLCNRSIFDVLDLY  211



>ref|XP_010546548.1| PREDICTED: uncharacterized protein LOC104818608 [Tarenaya hassleriana]
Length=196

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHT+CR+CSR++W ++G CPLCN  IL++LD++
Sbjct  148  CCVCMGREKGAALIPCGHTYCRVCSRKIWLDRGTCPLCNRLILDVLDLY  196



>ref|XP_009123390.1| PREDICTED: apoptosis 1 inhibitor [Brassica rapa]
Length=211

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G+CPLCN  I ++LD++
Sbjct  163  CCVCMGREKGAAFIPCGHTYCRVCSREIWMNRGSCPLCNRSIFDVLDLY  211



>ref|NP_176427.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAF70837.1|AC003113_4 F2401.10 [Arabidopsis thaliana]
 gb|AEE33959.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=204

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G CPLCN  I ++LD++
Sbjct  156  CCVCMGREKGAAFIPCGHTYCRVCSREIWMNRGTCPLCNRSIFDVLDLY  204



>ref|XP_006301522.1| hypothetical protein CARUB_v10021950mg [Capsella rubella]
 gb|EOA34420.1| hypothetical protein CARUB_v10021950mg [Capsella rubella]
Length=220

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G CPLCN  I ++LD++
Sbjct  172  CCVCMGREKGAAFIPCGHTYCRVCSREIWMNRGTCPLCNRSIFDVLDLY  220



>ref|XP_009134285.1| PREDICTED: apoptosis 1 inhibitor [Brassica rapa]
 emb|CDX90849.1| BnaA03g25290D [Brassica napus]
Length=202

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            C VCM R KG AF+PCGHTFCR+CSRE+W  +G+CPLCN  I+EILDI+
Sbjct  154  CRVCMGRKKGAAFIPCGHTFCRVCSREVWLNRGSCPLCNRPIIEILDIY  202



>gb|KFK40605.1| hypothetical protein AALP_AA2G017500 [Arabis alpina]
Length=199

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G CPLCN  I ++LD++
Sbjct  151  CCVCMGREKGAAFIPCGHTYCRVCSREIWLNRGKCPLCNRSIFDVLDLY  199



>ref|XP_009412998.1| PREDICTED: uncharacterized protein LOC103994402 [Musa acuminata 
subsp. malaccensis]
Length=270

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  662  KGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +G AF+PCGHTFCRLCSRELW  +GNCPLCN +ILEILDIF
Sbjct  230  RGAAFIPCGHTFCRLCSRELWVSRGNCPLCNGYILEILDIF  270



>ref|XP_006357969.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like 
[Solanum tuberosum]
Length=175

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHT+CR+CS+ELW ++G+CPLCN  I EIL+IF
Sbjct  127  CCVCMERNKGAAFIPCGHTYCRVCSKELWLKRGSCPLCNCSIDEILNIF  175



>ref|XP_006391898.1| hypothetical protein EUTSA_v10023694mg [Eutrema salsugineum]
 gb|ESQ29184.1| hypothetical protein EUTSA_v10023694mg [Eutrema salsugineum]
Length=206

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHT+CR+CSRE+W  +G CPLCN  I ++LD++
Sbjct  158  CCVCMGREKGAAFIPCGHTYCRVCSREIWMNRGTCPLCNRSIFDVLDLY  206



>ref|XP_010547084.1| PREDICTED: uncharacterized protein LOC104818961 [Tarenaya hassleriana]
 ref|XP_010547085.1| PREDICTED: uncharacterized protein LOC104818961 [Tarenaya hassleriana]
Length=348

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            NCCVC V+ KG AF+PCGHTFC+LCS+EL  ++G+CP+C+ F++E L+IF
Sbjct  299  NCCVCSVKIKGAAFIPCGHTFCKLCSKELLVQEGHCPVCSTFVIEFLEIF  348



>ref|XP_009761036.1| PREDICTED: uncharacterized protein LOC104213267 [Nicotiana sylvestris]
Length=170

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R+KG AF+PCGHT+CR+CSRE+W  +G CPLCN  I EIL+IF
Sbjct  122  CCVCMERNKGAAFIPCGHTYCRVCSREVWLNRGLCPLCNRSINEILNIF  170



>ref|XP_010533787.1| PREDICTED: uncharacterized protein LOC104809475 [Tarenaya hassleriana]
Length=207

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG A +PCGHT+CR+CSRE+W ++G CPLCN  I ++LD++
Sbjct  159  CCVCMGREKGAAMIPCGHTYCRVCSREIWVDRGTCPLCNRPIFDVLDLY  207



>ref|XP_006296764.1| hypothetical protein CARUB_v10015595mg [Capsella rubella]
 gb|EOA29662.1| hypothetical protein CARUB_v10015595mg [Capsella rubella]
Length=365

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CC CMV+ KG +F PCGHTFC+LCS+EL A+KG+CP+C++F++E L+IF
Sbjct  316  SCCACMVKIKGASFTPCGHTFCKLCSKELMAQKGHCPVCSSFVVEFLEIF  365



>ref|XP_008664189.1| PREDICTED: protein enabled homolog [Zea mays]
Length=379

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR C+REL   +G CPLCN  I+++LDIF
Sbjct  331  CCVCMARAKGAAFIPCGHTFCRGCARELLGGRGRCPLCNAAIVDVLDIF  379



>ref|XP_009124480.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Brassica rapa]
 ref|XP_009124486.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 
3-like [Brassica rapa]
Length=346

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            NCCVC V  KG  F PCGHTFC+LCS+EL A+KG+CP+C++F+LE L+IF
Sbjct  297  NCCVCQVNIKGATFTPCGHTFCKLCSKELSAQKGHCPVCSSFVLEFLEIF  346



>tpg|DAA48171.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=250

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  638  CCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            CCVCM R KG AF+PCGHTFCR C+REL   +G CPLCN  I+++LDIF
Sbjct  202  CCVCMARAKGAAFIPCGHTFCRGCARELLGGRGRCPLCNAAIVDVLDIF  250



>ref|XP_004144455.1| PREDICTED: uncharacterized protein LOC101209945 [Cucumis sativus]
Length=343

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMV+HK      CGHTFCRLCS+EL   +GNCP C+NFILEILD F
Sbjct  294  SCCVCMVKHKNGPLASCGHTFCRLCSKELMVSRGNCPTCSNFILEILDAF  343


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +2

Query  125  DAIKDD-PNGGK----DHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS  289
            D I+D+ P+ GK      K+TWK F++KL LK AG  W S+ PIP SD+P+H   S  M 
Sbjct  42   DIIRDEEPSTGKGLFGKDKRTWKSFRDKLRLKRAGSAWVSTVPIPTSDIPVHNKRS-LMG  100

Query  290  RRASNRFPSG---EYPADEYK---PELAASGRREL  376
            RR   RF +G     P ++ +    E + S RR++
Sbjct  101  RRNQVRFNTGSSKNSPDNQSRHPSEETSKSTRRQM  135



>ref|XP_009413283.1| PREDICTED: apoptosis 1 inhibitor [Musa acuminata subsp. malaccensis]
Length=176

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  644  VCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            VCM R KG AF+PCGHTFCR+C+RE+W  +G+CPLCN  I++ILDIF
Sbjct  130  VCMGRRKGAAFIPCGHTFCRVCAREMWVNRGSCPLCNRPIVDILDIF  176



>ref|XP_010486253.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Camelina sativa]
Length=362

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CC CMV+ KG +F PCGHTFC+LCS+EL A+KG+CP+C++F++E L+IF
Sbjct  313  SCCACMVKIKGASFSPCGHTFCKLCSKELMAQKGHCPVCSSFVVEFLEIF  362



>ref|XP_010448797.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Camelina sativa]
Length=364

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CC CMV+ KG +F PCGHTFC+LCS+EL A+KG+CP+C++F++E L+IF
Sbjct  315  SCCACMVKIKGASFSPCGHTFCKLCSKELMAQKGHCPVCSSFVVEFLEIF  364



>gb|KGN58363.1| hypothetical protein Csa_3G628230 [Cucumis sativus]
Length=382

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVCMV+HK      CGHTFCRLCS+EL   +GNCP C+NFILEILD F
Sbjct  333  SCCVCMVKHKNGPLASCGHTFCRLCSKELMVSRGNCPTCSNFILEILDAF  382


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +2

Query  125  DAIKDD-PNGGK----DHKKTWKHFKEKLGLKDAGDGWTSSTPIPASDVPIHPMSSRTMS  289
            D I+D+ P+ GK      K+TWK F++KL LK AG  W S+ PIP SD+P+H   S  M 
Sbjct  42   DIIRDEEPSTGKGLFGKDKRTWKSFRDKLRLKRAGSAWVSTVPIPTSDIPVHNKRS-LMG  100

Query  290  RRASNRFPSG---EYPADEYK---PELAASGRREL  376
            RR   RF +G     P ++ +    E + S RR++
Sbjct  101  RRNQVRFNTGSSKNSPDNQSRHPSEETSKSTRRQM  135



>ref|XP_010464291.1| PREDICTED: E3 ubiquitin-protein ligase RNF34-like [Camelina sativa]
Length=364

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CC CMV+ KG +F PCGHTFC+LCS+EL A+KG+CP+C++F++E L+IF
Sbjct  315  SCCACMVKIKGASFSPCGHTFCKLCSKELMAQKGHCPVCSSFVVEFLEIF  364



>gb|EAZ07721.1| hypothetical protein OsI_29976 [Oryza sativa Indica Group]
Length=263

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  644  VCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            VCM R KG AF+PCGHTFCR C+REL A +G CPLCN  IL++LDIF
Sbjct  217  VCMARAKGAAFIPCGHTFCRTCARELLAGRGRCPLCNAAILDVLDIF  263



>ref|XP_010525277.1| PREDICTED: E3 ubiquitin-protein ligase RNF8-like [Tarenaya hassleriana]
Length=199

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  635  NCCVCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            +CCVC V+ KG AF+PCGHTFC+LCS++L  +KG+CP+C+ FI+E L+IF
Sbjct  150  DCCVCGVKIKGAAFIPCGHTFCQLCSKDLMVQKGHCPVCSCFIIEFLEIF  199



>gb|EAZ07720.1| hypothetical protein OsI_29975 [Oryza sativa Indica Group]
Length=263

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  644  VCMVRHKGEAFVPCGHTFCRLCSRELWAEKGNCPLCNNFILEILDIF  784
            VCM R KG AF+PCGHTFCR C+REL A +G CPLCN  IL++LDIF
Sbjct  217  VCMARAKGAAFIPCGHTFCRTCARELLAGRGRCPLCNAAILDVLDIF  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1899776125104