BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23451_g2_i2 len=606 path=[1009:0-268 4497:269-352 1634:353-383
3955:384-415 1759:416-439 1783:440-605]

Length=606
                                                                      Score     E

ref|XP_009789939.1|  PREDICTED: protein OSB2, chloroplastic           83.2    2e-15   
ref|XP_009623310.1|  PREDICTED: protein OSB2, chloroplastic-like      79.3    4e-14   
gb|EYU41625.1|  hypothetical protein MIMGU_mgv1a0268882mg             76.6    6e-14   
emb|CDP06711.1|  unnamed protein product                              78.6    1e-13   
gb|AAX34397.1|  mitochondrial SBP40                                   75.1    1e-12   Solanum tuberosum [potatoes]
ref|XP_006361790.1|  PREDICTED: protein OSB2, chloroplastic-like      74.7    2e-12   
ref|XP_004246681.1|  PREDICTED: protein OSB2, chloroplastic-like      74.7    2e-12   
ref|XP_011094697.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  73.6    5e-12   
ref|XP_011077372.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  72.0    2e-11   
gb|EYU38517.1|  hypothetical protein MIMGU_mgv1a006607mg              70.5    6e-11   
gb|EPS61785.1|  hypothetical protein M569_13009                       66.2    6e-10   
ref|XP_009401052.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  65.9    2e-09   
ref|XP_010265382.1|  PREDICTED: protein OSB2, chloroplastic-like ...  64.3    7e-09   
ref|XP_010265383.1|  PREDICTED: protein OSB2, chloroplastic-like ...  64.3    7e-09   
ref|XP_009401053.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  63.2    1e-08   
ref|XP_009401051.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  63.2    2e-08   
ref|XP_010938619.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  63.2    2e-08   
ref|XP_003565066.1|  PREDICTED: protein OSB2, chloroplastic-like      62.8    2e-08   
ref|XP_010938617.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  62.8    2e-08   
ref|XP_008800213.1|  PREDICTED: protein OSB2, chloroplastic-like      62.0    4e-08   
ref|XP_006582909.1|  PREDICTED: uncharacterized protein LOC100788...  60.5    6e-08   
gb|KHN40325.1|  Protein OSB2, chloroplastic                           60.8    8e-08   
ref|NP_001241452.1|  uncharacterized protein LOC100788700             60.5    1e-07   
ref|XP_010656866.1|  PREDICTED: protein OSB2, chloroplastic-like ...  58.5    4e-07   
ref|XP_003633203.2|  PREDICTED: protein OSB2, chloroplastic-like ...  58.5    5e-07   
ref|XP_010045341.1|  PREDICTED: protein OSB2, chloroplastic           58.5    5e-07   
gb|KCW87512.1|  hypothetical protein EUGRSUZ_B03962                   57.8    1e-06   
ref|XP_002529525.1|  hypothetical protein RCOM_1716580                56.6    1e-06   Ricinus communis
emb|CDY39398.1|  BnaAnng05290D                                        57.4    1e-06   
ref|XP_009101638.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  57.4    1e-06   
ref|XP_009101639.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  57.0    2e-06   
gb|EMT27241.1|  Protein OSB3, chloroplastic/mitochondrial             57.0    2e-06   
dbj|BAJ91349.1|  predicted protein                                    56.6    2e-06   
dbj|BAK08277.1|  predicted protein                                    56.6    3e-06   
ref|XP_004971246.1|  PREDICTED: protein OSB2, chloroplastic-like ...  56.2    3e-06   
emb|CDY60656.1|  BnaCnng36790D                                        55.8    5e-06   
ref|XP_007041032.1|  Plastid transcriptionally active 9, putative     55.5    6e-06   
ref|XP_011008439.1|  PREDICTED: protein OSB4, chloroplastic-like ...  54.7    8e-06   
gb|KFK44893.1|  hypothetical protein AALP_AA1G316600                  54.7    8e-06   
ref|XP_004513105.1|  PREDICTED: protein OSB2, chloroplastic-like      54.7    9e-06   
ref|XP_011008438.1|  PREDICTED: protein OSB2, chloroplastic-like ...  54.7    1e-05   
ref|XP_011008435.1|  PREDICTED: protein OSB2, chloroplastic-like ...  54.7    1e-05   
emb|CBI17868.3|  unnamed protein product                              54.3    1e-05   
ref|XP_006370188.1|  hypothetical protein POPTR_0001s40460g           54.3    1e-05   
emb|CDY43175.1|  BnaCnng11030D                                        53.9    2e-05   
ref|XP_003620948.1|  Protein OSB3                                     54.3    2e-05   
gb|AES77166.2|  organellar single-stranded DNA-binding protein        54.3    2e-05   
ref|XP_006398112.1|  hypothetical protein EUTSA_v10000889mg           53.9    2e-05   
emb|CDY02351.1|  BnaA09g25510D                                        53.9    2e-05   
ref|XP_006448788.1|  hypothetical protein CICLE_v10015693mg           53.5    2e-05   
ref|XP_009115023.1|  PREDICTED: protein OSB4, chloroplastic           53.5    2e-05   
ref|XP_006468403.1|  PREDICTED: protein OSB2, chloroplastic-like ...  53.5    2e-05   
ref|XP_006468402.1|  PREDICTED: protein OSB2, chloroplastic-like ...  53.5    2e-05   
ref|XP_006468401.1|  PREDICTED: protein OSB2, chloroplastic-like ...  53.5    2e-05   
ref|XP_002863546.1|  hypothetical protein ARALYDRAFT_494502           53.9    2e-05   
ref|XP_006448787.1|  hypothetical protein CICLE_v10015693mg           53.5    2e-05   
ref|XP_006646677.1|  PREDICTED: protein OSB2, chloroplastic-like      53.5    2e-05   
gb|KDP27688.1|  hypothetical protein JCGZ_19727                       53.5    2e-05   
dbj|BAD87869.1|  unknown protein                                      53.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KDO77530.1|  hypothetical protein CISIN_1g017902mg                 53.1    3e-05   
gb|KDO77529.1|  hypothetical protein CISIN_1g017902mg                 53.1    3e-05   
gb|KDO77528.1|  hypothetical protein CISIN_1g017902mg                 53.1    3e-05   
ref|XP_006448786.1|  hypothetical protein CICLE_v10015693mg           53.1    3e-05   
gb|EEC72157.1|  hypothetical protein OsI_05193                        53.1    3e-05   Oryza sativa Indica Group [Indian rice]
gb|AAM61481.1|  unknown                                               53.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568639.1|  protein OSB3                                        53.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974885.1|  protein OSB3                                        53.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010688420.1|  PREDICTED: protein OSB2, chloroplastic-like ...  51.6    4e-05   
ref|NP_001045397.2|  Os01g0949200                                     52.8    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAC79142.1|  hypothetical protein                                  52.8    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481709.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  52.8    5e-05   
ref|XP_010441826.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  52.8    5e-05   
ref|XP_010494530.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  52.8    5e-05   
ref|XP_010538289.1|  PREDICTED: protein OSB4, chloroplastic           52.0    7e-05   
gb|KFK28646.1|  hypothetical protein AALP_AA7G026600                  52.0    8e-05   
gb|KHG18285.1|  Protein OSB2, chloroplastic -like protein             51.6    9e-05   
ref|XP_006415381.1|  hypothetical protein EUTSA_v10008085mg           51.6    9e-05   
gb|KFK31610.1|  hypothetical protein AALP_AA6G135400                  51.6    1e-04   
gb|AFW83976.1|  hypothetical protein ZEAMMB73_371709                  50.1    2e-04   
ref|XP_008225793.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  50.4    3e-04   
ref|XP_004295481.1|  PREDICTED: protein OSB3, chloroplastic/mitoc...  50.1    4e-04   
ref|XP_002893671.1|  single-stranded DNA binding protein              49.3    6e-04   
ref|NP_564370.1|  protein OSB4                                        49.3    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63642.1|  unknown                                               49.3    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280485.1|  hypothetical protein CARUB_v10026422mg           48.9    9e-04   
ref|XP_010478544.1|  PREDICTED: protein OSB4, chloroplastic-like      48.9    9e-04   
ref|XP_010460924.1|  PREDICTED: protein OSB4, chloroplastic-like      48.9    0.001   



>ref|XP_009789939.1| PREDICTED: protein OSB2, chloroplastic [Nicotiana sylvestris]
 ref|XP_009789940.1| PREDICTED: protein OSB2, chloroplastic [Nicotiana sylvestris]
Length=377

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEI-DGYGGNFHIVAQDVYFVEGV  93
            +IPVVF GDLAHVV  HVKENDCV+VSG+ S D LP EI D Y  +FHIVA++V FV+G+
Sbjct  127  MIPVVFVGDLAHVVACHVKENDCVYVSGKFSMDPLPCEIMDKYEFSFHIVAENVNFVQGL  186

Query  92   K  90
            K
Sbjct  187  K  187



>ref|XP_009623310.1| PREDICTED: protein OSB2, chloroplastic-like [Nicotiana tomentosiformis]
Length=381

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 13/102 (13%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEI-DGYGGNFHIVAQDVYFVEGV  93
            +IPVVF GDLAHVV  HVKEND V+VSG+ S D +P EI D Y  +FHIVA++V FV+G+
Sbjct  130  MIPVVFVGDLAHVVACHVKENDSVYVSGKFSMDPMPCEIMDKYKFSFHIVAENVNFVQGL  189

Query  92   KG------------KKTGAKINSGDLENLDEVKKMKNGESIV  3
            K              K+  K    D E    +  ++N +S+V
Sbjct  190  KQIAPRKARGQFVYPKSSTKQQHSDNEKDISLSTLENDDSVV  231



>gb|EYU41625.1| hypothetical protein MIMGU_mgv1a0268882mg, partial [Erythranthe 
guttata]
Length=182

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG---  96
            IPVVFEG+LAHVV  HVKEN+CV VSGQLS D +   +    G FH+VA+++ FVEG   
Sbjct  51   IPVVFEGELAHVVACHVKENNCVFVSGQLSVDPMRLVLGDSVGKFHVVAENLSFVEGFEK  110

Query  95   -VKGKKTGAKINSGDLENLDE  36
             V  KKTGA  +  ++ N D+
Sbjct  111  HVVDKKTGASFSPVEIYNPDK  131



>emb|CDP06711.1| unnamed protein product [Coffea canephora]
Length=400

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVKG  87
            IPVVFEGDLAHVV  HVK+NDCV+V G+LS D LPF +    G FH++ +++ FV+G + 
Sbjct  132  IPVVFEGDLAHVVASHVKKNDCVYVVGRLSEDPLPFVLSESQGKFHLLVENINFVQGFEK  191

Query  86   K  84
            K
Sbjct  192  K  192



>gb|AAX34397.1| mitochondrial SBP40 [Solanum tuberosum]
Length=387

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFE-IDGYGGNFHIVAQDVYFVEGV  93
            +IPVVF GDLAHVV  HVKENDCV+V G+ S + L  E +D Y   FHIVA++V FV+G+
Sbjct  129  MIPVVFAGDLAHVVACHVKENDCVYVYGKFSMEPLSCEFMDEYQSCFHIVAENVNFVQGL  188

Query  92   K  90
            K
Sbjct  189  K  189



>ref|XP_006361790.1| PREDICTED: protein OSB2, chloroplastic-like [Solanum tuberosum]
Length=387

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFE-IDGYGGNFHIVAQDVYFVEGV  93
            +IPVVF GDLAHVV  HVKENDCV+V G+ S + L  E +D Y   FHIVA++V FV+G+
Sbjct  129  MIPVVFAGDLAHVVACHVKENDCVYVYGKFSMEPLSCEFMDEYQSCFHIVAENVNFVQGL  188

Query  92   K  90
            K
Sbjct  189  K  189



>ref|XP_004246681.1| PREDICTED: protein OSB2, chloroplastic-like [Solanum lycopersicum]
Length=387

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFE-IDGYGGNFHIVAQDVYFVEGV  93
            +IPVVF GDLAHVV  HVKENDCV+V G+ S + L  E +D Y   FHIVA++V FV+G+
Sbjct  129  MIPVVFAGDLAHVVACHVKENDCVYVYGKFSMEPLSCEFMDEYQSCFHIVAENVNFVQGL  188

Query  92   K  90
            K
Sbjct  189  K  189



>ref|XP_011094697.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like [Sesamum 
indicum]
Length=442

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
            IPVVFEGDLAHVV  HVKENDCV VSGQLS D +        G FH+VA+++ FV+G+
Sbjct  140  IPVVFEGDLAHVVACHVKENDCVFVSGQLSVDPVRLVSSESLGKFHVVAENLNFVQGL  197



>ref|XP_011077372.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial [Sesamum 
indicum]
Length=444

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
            LIPVVFEGDLAHVV  HVKE DCV VSGQL+ D L F +    G F ++A+++ FVEG+
Sbjct  120  LIPVVFEGDLAHVVACHVKEKDCVFVSGQLNVDPLRFGLSESLGRFLVLAENLNFVEGL  178



>gb|EYU38517.1| hypothetical protein MIMGU_mgv1a006607mg [Erythranthe guttata]
Length=437

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
            L PV+F GDLAHVV  HVKENDCV VSGQLS   + F ++     FH+V +++ FV+G+K
Sbjct  129  LTPVLFGGDLAHVVACHVKENDCVLVSGQLSVSPIRFALNDSPVKFHVVVENINFVQGLK  188

Query  89   GKKTGAKI  66
               +  K+
Sbjct  189  RNASDHKL  196



>gb|EPS61785.1| hypothetical protein M569_13009, partial [Genlisea aurea]
Length=283

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVE  99
            IPVVFEGDLAHVVG HVK+NDCV VSGQLS D      D   G  H+VA+++ F E
Sbjct  53   IPVVFEGDLAHVVGCHVKKNDCVFVSGQLSLDTKGL-FDESFGKLHLVAENINFAE  107



>ref|XP_009401052.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=375

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IPV F+GDLA V   H+K ND ++V+GQLSGD  P  I+       ++A  + FV+   
Sbjct  135  WIPVKFQGDLAQVAACHLKVNDVIYVTGQLSGDAPPHAIEDAHTKLQVLAHSLNFVQSKY  194

Query  89   GKKTGAKINSGDLENLD--EVKKM-KNGESI  6
              K    IN  D  +LD   VKKM K+ E++
Sbjct  195  SDKADDNINEKDEPSLDLESVKKMEKSAENL  225



>ref|XP_010265382.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=431

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = -2

Query  293  VPQGLLLDL----IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHI  126
            + Q   LDL    IP++FEGDLAH    H+KEND V+V GQLS D  PF +     N  +
Sbjct  115  IKQEKTLDLPFLWIPIIFEGDLAHTAACHLKENDRVYVGGQLSADPPPFAMQHGQANVQV  174

Query  125  VAQDVYFVEGVKGK  84
            + Q + FV   KGK
Sbjct  175  MVQSINFV-SRKGK  187



>ref|XP_010265383.1| PREDICTED: protein OSB2, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=430

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = -2

Query  293  VPQGLLLDL----IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHI  126
            + Q   LDL    IP++FEGDLAH    H+KEND V+V GQLS D  PF +     N  +
Sbjct  115  IKQEKTLDLPFLWIPIIFEGDLAHTAACHLKENDRVYVGGQLSADPPPFAMQHGQANVQV  174

Query  125  VAQDVYFVEGVKGK  84
            + Q + FV   KGK
Sbjct  175  MVQSINFV-SRKGK  187



>ref|XP_009401053.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=307

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IPV F+GDLA V   H+K ND ++V+GQLSGD  P  I+       ++A  + FV+   
Sbjct  135  WIPVKFQGDLAQVAACHLKVNDVIYVTGQLSGDAPPHAIEDAHTKLQVLAHSLNFVQSKY  194

Query  89   GKKTGAKINSGDLENLDEVKKMKNG  15
              K    IN  D  +LD  K+  +G
Sbjct  195  SDKADDNINEKDEPSLDLGKRHWDG  219



>ref|XP_009401051.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=395

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IPV F+GDLA V   H+K ND ++V+GQLSGD  P  I+       ++A  + FV+   
Sbjct  135  WIPVKFQGDLAQVAACHLKVNDVIYVTGQLSGDAPPHAIEDAHTKLQVLAHSLNFVQSKY  194

Query  89   GKKTGAKINSGDLENLDEVKKMKNG  15
              K    IN  D  +LD  K+  +G
Sbjct  195  SDKADDNINEKDEPSLDLGKRHWDG  219



>ref|XP_010938619.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like isoform 
X2 [Elaeis guineensis]
Length=457

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  287  QGLLLDLIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVY  108
            +GL    IP++F+GDLA     ++KEND ++++GQLSGD  PF +        ++A  + 
Sbjct  136  KGLPQFWIPIIFQGDLAQCAACYLKENDLIYITGQLSGDAPPFTVKDAQTKIQVLAHSIS  195

Query  107  FVEGVKGKKTGAKIN  63
            FV+    +K G K++
Sbjct  196  FVQKECPEKEGQKVS  210



>ref|XP_003565066.1| PREDICTED: protein OSB2, chloroplastic-like [Brachypodium distachyon]
Length=414

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IPV+F+ DLA V   H++END V+VSGQLSGD  PF+      N  I+AQ + FV+  K
Sbjct  136  WIPVIFQDDLAQVAASHLQENDLVYVSGQLSGDVPPFKDTDGQANIQILAQLLSFVDS-K  194

Query  89   GKKT  78
             +KT
Sbjct  195  AEKT  198



>ref|XP_010938617.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010938618.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like isoform 
X1 [Elaeis guineensis]
Length=482

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  287  QGLLLDLIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVY  108
            +GL    IP++F+GDLA     ++KEND ++++GQLSGD  PF +        ++A  + 
Sbjct  136  KGLPQFWIPIIFQGDLAQCAACYLKENDLIYITGQLSGDAPPFTVKDAQTKIQVLAHSIS  195

Query  107  FVEGVKGKKTGAKIN  63
            FV+    +K G K++
Sbjct  196  FVQKECPEKEGQKVS  210



>ref|XP_008800213.1| PREDICTED: protein OSB2, chloroplastic-like [Phoenix dactylifera]
Length=485

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -2

Query  287  QGLLLDLIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVY  108
            +GL    IP++F+GDLA     H+KEND ++V G+LSGD  PF I        ++A  V 
Sbjct  127  KGLPQLWIPIIFQGDLAQCAACHLKENDLIYVIGKLSGDVPPFTIKDAQTKIQVLAHSVS  186

Query  107  FVEGVKGKKTGAKIN  63
            FV+    +K G K++
Sbjct  187  FVQKECPEKEGQKVS  201



>ref|XP_006582909.1| PREDICTED: uncharacterized protein LOC100788700 isoform X1 [Glycine 
max]
Length=263

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVKG  87
            IPV+FEGDLAH   FH+  NDC+H++G+L+ D    E      N  ++ Q + FV+    
Sbjct  78   IPVIFEGDLAHTAKFHLNLNDCIHIAGKLTTDSPQLEHLHPQSNIQVMVQTLNFVQRYPQ  137

Query  86   KKTGAKIN  63
              T   I+
Sbjct  138  PNTTTSID  145



>gb|KHN40325.1| Protein OSB2, chloroplastic [Glycine soja]
Length=305

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVKG  87
            IPV+FEGDLAH   FH+  NDC+H++G+L+ D    E      N  ++ Q + FV+    
Sbjct  78   IPVIFEGDLAHTAKFHLNLNDCIHIAGKLTTDSPQLEHLHPQSNIQVMVQTLNFVQRYPQ  137

Query  86   KKTGAKIN  63
              T   I+
Sbjct  138  PNTTTSID  145



>ref|NP_001241452.1| uncharacterized protein LOC100788700 [Glycine max]
 gb|ACU17891.1| unknown [Glycine max]
Length=309

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVKG  87
            IPV+FEGDLAH   FH+  NDC+H++G+L+ D    E      N  ++ Q + FV+    
Sbjct  78   IPVIFEGDLAHTAKFHLNLNDCIHIAGKLTTDSPQLEHLHPQSNIQVMVQTLNFVQRYPQ  137

Query  86   KKTGAKIN  63
              T   I+
Sbjct  138  PNTTTSID  145



>ref|XP_010656866.1| PREDICTED: protein OSB2, chloroplastic-like isoform X2 [Vitis 
vinifera]
Length=377

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFV  102
             IP+ FEGDLA++   H+KENDCV+++GQL  D  P +++    +F ++   V FV
Sbjct  148  WIPLTFEGDLAYIAVCHLKENDCVYIAGQLITDPPPLDLNQGPSSFQVMVHTVNFV  203



>ref|XP_003633203.2| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Vitis 
vinifera]
Length=380

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFV  102
             IP+ FEGDLA++   H+KENDCV+++GQL  D  P +++    +F ++   V FV
Sbjct  148  WIPLTFEGDLAYIAVCHLKENDCVYIAGQLITDPPPLDLNQGPSSFQVMVHTVNFV  203



>ref|XP_010045341.1| PREDICTED: protein OSB2, chloroplastic [Eucalyptus grandis]
 gb|KCW87513.1| hypothetical protein EUGRSUZ_B03962 [Eucalyptus grandis]
Length=359

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP+ FEGDLAHV   H++END V ++GQLS +  P +++       ++   + FVEG
Sbjct  130  WIPITFEGDLAHVAASHLRENDHVCIAGQLSANPPPLDVNQGQTKVQVMVHSINFVEG  187



>gb|KCW87512.1| hypothetical protein EUGRSUZ_B03962 [Eucalyptus grandis]
Length=357

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP+ FEGDLAHV   H++END V ++GQLS +  P +++   G   ++   + FVEG
Sbjct  130  WIPITFEGDLAHVAASHLRENDHVCIAGQLSANPPPLDVN--QGQTKVMVHSINFVEG  185



>ref|XP_002529525.1| hypothetical protein RCOM_1716580 [Ricinus communis]
 gb|EEF32863.1| hypothetical protein RCOM_1716580 [Ricinus communis]
Length=218

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IPV+FEGDLA     H+K ND VH++G+LS D  P ++        I+ Q++ F++G
Sbjct  108  WIPVIFEGDLARAAASHLKINDHVHIAGKLSADAPPIDVTHGQAQVRIMVQNINFIQG  165



>emb|CDY39398.1| BnaAnng05290D [Brassica napus]
Length=552

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEG+LA +   HVK++D +H+SG+L  D  P  +     N  I+ Q++ FVEG 
Sbjct  110  WIPIIFEGELAKIAAHHVKKDDRIHISGKLFIDSPPANVTYPQSNVQIMVQNLNFVEGA  168



>ref|XP_009101638.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial isoform 
X1 [Brassica rapa]
Length=551

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEG+LA +   HVK++D +H+SG+L  D  P  +     N  I+ Q++ FVEG 
Sbjct  110  WIPIIFEGELAKIAAHHVKKDDRIHISGKLFIDSPPATVTYPQSNVQIMVQNLNFVEGA  168



>ref|XP_009101639.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial isoform 
X2 [Brassica rapa]
Length=474

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEG+LA +   HVK++D +H+SG+L  D  P  +     N  I+ Q++ FVEG 
Sbjct  110  WIPIIFEGELAKIAAHHVKKDDRIHISGKLFIDSPPATVTYPQSNVQIMVQNLNFVEGA  168



>gb|EMT27241.1| Protein OSB3, chloroplastic/mitochondrial [Aegilops tauschii]
Length=390

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IPV+F+ DLA +   H++END V+VSGQL+GD  PF+      N  +VA  + FV+ 
Sbjct  76   WIPVIFQDDLAQIAASHLQENDLVYVSGQLTGDVPPFKHTDGQANIQVVAHLLSFVDS  133



>dbj|BAJ91349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IPV+F+ DLA +   H++END V+VSGQL+GD  PF+      N  ++A  + FV+ 
Sbjct  136  WIPVIFQDDLAQIAASHLQENDLVYVSGQLTGDVPPFKHTDGQANIQVLAHLLSFVDS  193



>dbj|BAK08277.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IPV+F+ DLA +   H++END V+VSGQL+GD  PF+      N  ++A  + FV+ 
Sbjct  136  WIPVIFQDDLAQIAASHLQENDLVYVSGQLTGDVPPFKHTDGQANIQVLAHLLSFVDS  193



>ref|XP_004971246.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Setaria 
italica]
 ref|XP_004971247.1| PREDICTED: protein OSB2, chloroplastic-like isoform X2 [Setaria 
italica]
Length=422

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             +P+VF+ DLA V   H+KEND V+VSGQL+ D  P ++D    N  ++A  + FV+ 
Sbjct  140  WVPIVFKDDLAQVAASHLKENDLVYVSGQLTCDVPPLKLDDGQANIQVLAHLLSFVDS  197



>emb|CDY60656.1| BnaCnng36790D [Brassica napus]
Length=557

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEG+LA +   HVK++D +H+SG+L  D  P  +     N  I+ Q++ FV+G 
Sbjct  115  WIPIIFEGELAKIAAHHVKKDDRIHISGKLFIDSPPPNVTYPQSNVQIMVQNLNFVQGA  173



>ref|XP_007041032.1| Plastid transcriptionally active 9, putative [Theobroma cacao]
 gb|EOX96863.1| Plastid transcriptionally active 9, putative [Theobroma cacao]
Length=344

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVE  99
             IP++FEGDLAH+   H+KEND V++ GQLS D           N  ++ + + FV+
Sbjct  108  WIPIIFEGDLAHIAACHLKENDHVYIDGQLSADPPSSNATHAQANVQVMVRTINFVD  164



>ref|XP_011008439.1| PREDICTED: protein OSB4, chloroplastic-like isoform X3 [Populus 
euphratica]
 ref|XP_011016229.1| PREDICTED: protein OSB4, chloroplastic-like isoform X3 [Populus 
euphratica]
Length=304

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
            IP++FEGDLAH+   H+K+ D V++ GQLS D  PF          ++   + F+EG
Sbjct  126  IPIIFEGDLAHIAASHLKKGDFVYIDGQLSTDPPPFSEMQDQTQVQVLVNSINFIEG  182



>gb|KFK44893.1| hypothetical protein AALP_AA1G316600 [Arabis alpina]
Length=346

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
            LIPV+FEG+LAH    H+KEND VH++GQ+  D  P           ++ +D++++EG K
Sbjct  115  LIPVLFEGELAHTANCHLKENDRVHITGQVFVDTSPSGEKPDQEYVQVMVRDLHYIEGSK  174

Query  89   G  87
             
Sbjct  175  A  175



>ref|XP_004513105.1| PREDICTED: protein OSB2, chloroplastic-like [Cicer arietinum]
Length=377

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLS  177
            LIPVVF+GDLAH   FH+K+ND VHV+GQL+
Sbjct  85   LIPVVFQGDLAHTANFHLKQNDVVHVAGQLT  115



>ref|XP_011008438.1| PREDICTED: protein OSB2, chloroplastic-like isoform X2 [Populus 
euphratica]
 ref|XP_011016228.1| PREDICTED: protein OSB2, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=305

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
            IP++FEGDLAH+   H+K+ D V++ GQLS D  PF          ++   + F+EG
Sbjct  126  IPIIFEGDLAHIAASHLKKGDFVYIDGQLSTDPPPFSEMQDQTQVQVLVNSINFIEG  182



>ref|XP_011008435.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011008436.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011008437.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011016225.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011016226.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011016227.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Populus 
euphratica]
Length=362

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
            IP++FEGDLAH+   H+K+ D V++ GQLS D  PF          ++   + F+EG
Sbjct  126  IPIIFEGDLAHIAASHLKKGDFVYIDGQLSTDPPPFSEMQDQTQVQVLVNSINFIEG  182



>emb|CBI17868.3| unnamed protein product [Vitis vinifera]
Length=263

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (58%), Gaps = 8/71 (11%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP+ FEGDLA++   H+KENDCV+++GQL  D  P +++    +F + +  +       
Sbjct  148  WIPLTFEGDLAYIAVCHLKENDCVYIAGQLITDPPPLDLNQGPSSFQVKSSYI-------  200

Query  89   GKKTGAKINSG  57
             K+ GA +  G
Sbjct  201  -KEIGASLRCG  210



>ref|XP_006370188.1| hypothetical protein POPTR_0001s40460g [Populus trichocarpa]
 gb|ERP66757.1| hypothetical protein POPTR_0001s40460g [Populus trichocarpa]
Length=357

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
            IP++FEGDLAH+   H+K+ D V++ GQLS D  PF          ++   + F+EG
Sbjct  126  IPIIFEGDLAHIAASHLKKGDFVYIDGQLSTDPPPFPEMQDQTQVQVLVNSINFIEG  182



>emb|CDY43175.1| BnaCnng11030D [Brassica napus]
Length=346

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGN---FHIVAQDVYFVE  99
             IPV+FEGDLAH    H+K+ND VH++GQ+  D    EI G   +    HI+  D+++++
Sbjct  120  WIPVIFEGDLAHTANCHLKKNDRVHITGQIFVDA--SEIAGAKPDQAYVHIMVSDLHYIQ  177

Query  98   GVK  90
            G K
Sbjct  178  GSK  180



>ref|XP_003620948.1| Protein OSB3 [Medicago truncatula]
Length=491

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 50/90 (56%), Gaps = 5/90 (6%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGG-NFHIVAQDVYFVEG-  96
            LIP+VF GDLA    FH+K ND VHV GQLS +    ++D      F +  Q + FVEG 
Sbjct  118  LIPLVFHGDLALTAQFHLKLNDVVHVEGQLSTEDDQIKLDKPQQYQFQVKVQSLNFVEGY  177

Query  95   --VKGKKTGAKINSGDLENLDEVKKMKNGE  12
              VK     +K  S D+E+  E  ++K+ E
Sbjct  178  PRVKKASLTSKEKS-DIEDESENDEIKSSE  206



>gb|AES77166.2| organellar single-stranded DNA-binding protein [Medicago truncatula]
Length=490

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 50/90 (56%), Gaps = 5/90 (6%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGG-NFHIVAQDVYFVEG-  96
            LIP+VF GDLA    FH+K ND VHV GQLS +    ++D      F +  Q + FVEG 
Sbjct  118  LIPLVFHGDLALTAQFHLKLNDVVHVEGQLSTEDDQIKLDKPQQYQFQVKVQSLNFVEGY  177

Query  95   --VKGKKTGAKINSGDLENLDEVKKMKNGE  12
              VK     +K  S D+E+  E  ++K+ E
Sbjct  178  PRVKKASLTSKEKS-DIEDESENDEIKSSE  206



>ref|XP_006398112.1| hypothetical protein EUTSA_v10000889mg [Eutrema salsugineum]
 gb|ESQ39565.1| hypothetical protein EUTSA_v10000889mg [Eutrema salsugineum]
Length=437

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++F+GD+A +   HVK++D +HVSG+L  D  P  +     N  I+ Q++ FVE  
Sbjct  117  WIPIIFKGDIAKIAARHVKKDDRIHVSGKLFIDSPPPNVTYPQSNAQIMVQNLNFVEAT  175



>emb|CDY02351.1| BnaA09g25510D [Brassica napus]
Length=347

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGN---FHIVAQDVYFVE  99
             IPV+FEGDLAH    H+K+ND +H++GQ+  D    EI G   +    HI+ +D+++++
Sbjct  121  WIPVIFEGDLAHTANCHLKKNDRLHITGQIFVDA--SEIAGAKPDQAYVHIMVRDLHYIQ  178

Query  98   GVK  90
            G K
Sbjct  179  GSK  181



>ref|XP_006448788.1| hypothetical protein CICLE_v10015693mg [Citrus clementina]
 gb|ESR62028.1| hypothetical protein CICLE_v10015693mg [Citrus clementina]
Length=339

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>ref|XP_009115023.1| PREDICTED: protein OSB4, chloroplastic [Brassica rapa]
Length=347

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGN---FHIVAQDVYFVE  99
             IPV+FEGDLAH    H+K+ND +H++GQ+  D    EI G   +    HI+ +D+++++
Sbjct  121  WIPVIFEGDLAHTANCHLKKNDRLHITGQIFVDA--SEIAGAKPDQAYVHIMVRDLHYIQ  178

Query  98   GVK  90
            G K
Sbjct  179  GSK  181



>ref|XP_006468403.1| PREDICTED: protein OSB2, chloroplastic-like isoform X3 [Citrus 
sinensis]
 gb|KDO77527.1| hypothetical protein CISIN_1g017902mg [Citrus sinensis]
Length=339

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>ref|XP_006468402.1| PREDICTED: protein OSB2, chloroplastic-like isoform X2 [Citrus 
sinensis]
Length=339

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>ref|XP_006468401.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Citrus 
sinensis]
 gb|KDO77526.1| hypothetical protein CISIN_1g017902mg [Citrus sinensis]
Length=364

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>ref|XP_002863546.1| hypothetical protein ARALYDRAFT_494502 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39805.1| hypothetical protein ARALYDRAFT_494502 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEGDLA +   HVK+ D +HVSG+L  D  P  +     N  ++ Q++ FV+  
Sbjct  122  WIPIIFEGDLAQIAVQHVKKEDRIHVSGKLFIDSPPPNVTYSQSNVQVMVQNLNFVQAA  180



>ref|XP_006448787.1| hypothetical protein CICLE_v10015693mg [Citrus clementina]
 gb|ESR62027.1| hypothetical protein CICLE_v10015693mg [Citrus clementina]
Length=364

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>ref|XP_006646677.1| PREDICTED: protein OSB2, chloroplastic-like [Oryza brachyantha]
Length=334

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFV  102
            IP++F+ DLA V   H++E D +HVSGQL+GD  P ++     +  ++AQ + FV
Sbjct  57   IPIIFQDDLAQVAASHLQEKDLIHVSGQLTGDIPPTKLMDGQADIQVLAQTLSFV  111



>gb|KDP27688.1| hypothetical protein JCGZ_19727 [Jatropha curcas]
Length=359

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 16/96 (17%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFV----  102
             IP++FEGDLAHV   H+K+ND ++++GQLS    P ++        I+ +D+ FV    
Sbjct  115  WIPIIFEGDLAHVAASHIKKNDHIYIAGQLSTTP-PIDVIQGQTPLLIMVRDINFVQVSS  173

Query  101  -----------EGVKGKKTGAKINSGDLENLDEVKK  27
                       EG   K+   +     L++ D VKK
Sbjct  174  EITKSHGCWQQEGFSPKQNAEQQKEKTLKDYDSVKK  209



>dbj|BAD87869.1| unknown protein [Oryza sativa Japonica Group]
Length=395

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP++F+ DLA V   H++E D ++VSGQL+GD  P ++     N  ++AQ + FV G
Sbjct  123  WIPIIFQDDLAQVAASHLQEKDHIYVSGQLTGDIPPTKLMDGQANIQVLAQMLSFVGG  180



>gb|KDO77530.1| hypothetical protein CISIN_1g017902mg [Citrus sinensis]
Length=315

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>gb|KDO77529.1| hypothetical protein CISIN_1g017902mg [Citrus sinensis]
Length=307

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>gb|KDO77528.1| hypothetical protein CISIN_1g017902mg [Citrus sinensis]
Length=332

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>ref|XP_006448786.1| hypothetical protein CICLE_v10015693mg [Citrus clementina]
 gb|ESR62026.1| hypothetical protein CICLE_v10015693mg [Citrus clementina]
Length=321

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+K++D VH++GQL+ D  P  I+G   N  ++   +  +E   
Sbjct  108  WIPILFEGDLAHIASSHLKKDDHVHIAGQLTAD--PPAIEG-QANVQVMVHSLNLIEPTS  164

Query  89   GKK  81
             K+
Sbjct  165  QKR  167



>gb|EEC72157.1| hypothetical protein OsI_05193 [Oryza sativa Indica Group]
 gb|EEE56002.1| hypothetical protein OsJ_04758 [Oryza sativa Japonica Group]
Length=421

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP++F+ DLA V   H++E D ++VSGQL+GD  P ++     N  ++AQ + FV G
Sbjct  123  WIPIIFQDDLAQVAASHLQEKDHIYVSGQLTGDIPPTKLMDGQANIQVLAQMLSFVGG  180



>gb|AAM61481.1| unknown [Arabidopsis thaliana]
Length=440

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEGDLA +   HVK+ D +HVSG+L  D  P  +     N  ++ Q++ FV+  
Sbjct  122  WIPIIFEGDLAKIAVQHVKKEDRIHVSGKLFIDSPPPNVTYSQSNVQVMVQNLNFVQAA  180



>ref|NP_568639.1| protein OSB3 [Arabidopsis thaliana]
 sp|Q8GWJ4.1|OSB3_ARATH RecName: Full=Protein OSB3, chloroplastic/mitochondrial; AltName: 
Full=Organellar single-stranded DNA-binding protein 3; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAC43396.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63831.1| unknown protein [Arabidopsis thaliana]
 gb|AAP21285.1| At5g44785 [Arabidopsis thaliana]
 dbj|BAE99530.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95162.1| protein OSB3 [Arabidopsis thaliana]
Length=440

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEGDLA +   HVK+ D +HVSG+L  D  P  +     N  ++ Q++ FV+  
Sbjct  122  WIPIIFEGDLAKIAVQHVKKEDRIHVSGKLFIDSPPPNVTYSQSNVQVMVQNLNFVQAA  180



>ref|NP_974885.1| protein OSB3 [Arabidopsis thaliana]
 gb|AED95161.1| protein OSB3 [Arabidopsis thaliana]
Length=442

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEGDLA +   HVK+ D +HVSG+L  D  P  +     N  ++ Q++ FV+  
Sbjct  122  WIPIIFEGDLAKIAVQHVKKEDRIHVSGKLFIDSPPPNVTYSQSNVQVMVQNLNFVQAA  180



>ref|XP_010688420.1| PREDICTED: protein OSB2, chloroplastic-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=176

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVE  99
             I VVFEG+LA     HVKEN  ++V G LSG +LP  +        ++  D+YFV 
Sbjct  104  WISVVFEGELAETAATHVKENHYIYVGGHLSGHRLPINMTNDQVTLQVMVHDLYFVR  160



>ref|NP_001045397.2| Os01g0949200 [Oryza sativa Japonica Group]
 dbj|BAD87868.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07311.2| Os01g0949200 [Oryza sativa Japonica Group]
Length=309

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
            IP++F+ DLA V   H++E D ++VSGQL+GD  P ++     N  ++AQ + FV G
Sbjct  38   IPIIFQDDLAQVAASHLQEKDHIYVSGQLTGDIPPTKLMDGQANIQVLAQMLSFVGG  94



>gb|AAC79142.1| hypothetical protein [Arabidopsis thaliana]
Length=395

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGV  93
             IP++FEGDLA +   HVK+ D +HVSG+L  D  P  +     N  ++ Q++ FV+  
Sbjct  122  WIPIIFEGDLAKIAVQHVKKEDRIHVSGKLFIDSPPPNVTYSQSNVQVMVQNLNFVQAA  180



>ref|XP_010481709.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like [Camelina 
sativa]
Length=445

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP++FEGDLA +   HVK+ D +H+SG+L  D  P  +     N  ++ Q + FV+ 
Sbjct  125  WIPIIFEGDLAQIAVQHVKKEDRIHISGKLFIDSPPPSVTYTQSNVQVMVQSLNFVQA  182



>ref|XP_010441826.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like [Camelina 
sativa]
Length=431

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP++FEGDLA +   HVK+ D +H+SG+L  D  P  +     N  ++ Q + FV+ 
Sbjct  124  WIPIIFEGDLAQIAVQHVKKEDRIHISGKLFIDSPPPSVTYTQSNVQVMVQSLNFVQA  181



>ref|XP_010494530.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like [Camelina 
sativa]
Length=432

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP++FEGDLA +   HVK+ D +H+SG+L  D  P  +     N  ++ Q + FV+ 
Sbjct  124  WIPIIFEGDLAQIAVQHVKKEDRIHISGKLFIDSPPPNVTYTQSNVQVMVQSLNFVQA  181



>ref|XP_010538289.1| PREDICTED: protein OSB4, chloroplastic [Tarenaya hassleriana]
Length=361

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IPV+FEGDLA     H+K++D +H++GQL  D LP   +    N  ++ Q ++FV+   
Sbjct  126  WIPVIFEGDLARTAACHLKKDDRIHIAGQLFVDILPSGANLGQANVQVMVQSLHFVDNSL  185

Query  89   GKKTGA  72
              K  A
Sbjct  186  ATKAFA  191



>gb|KFK28646.1| hypothetical protein AALP_AA7G026600 [Arabis alpina]
Length=346

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVE  99
             IP++FEGDLA V    + ++DC+HVSG+L  D  P  +     N  ++ Q++ FV+
Sbjct  118  WIPIIFEGDLAKVAARFINKDDCIHVSGKLFIDTPPPNMTYAQANVQVLVQNLDFVQ  174



>gb|KHG18285.1| Protein OSB2, chloroplastic -like protein [Gossypium arboreum]
Length=330

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (56%), Gaps = 1/62 (2%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVK  90
             IP++FEGDLAH+   H+KEND V++ GQLS D  P        +  ++   + FV+   
Sbjct  105  WIPIIFEGDLAHMAACHLKENDHVYIDGQLSADP-PSNATRNQASVQVMVHAINFVDESS  163

Query  89   GK  84
             K
Sbjct  164  PK  165



>ref|XP_006415381.1| hypothetical protein EUTSA_v10008085mg [Eutrema salsugineum]
 gb|ESQ33734.1| hypothetical protein EUTSA_v10008085mg [Eutrema salsugineum]
Length=347

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGN---FHIVAQDVYFVE  99
             IPV+FEGDLAH    H+K+ND V+++GQ+  D    E+ G   +    H++A+D+ +++
Sbjct  123  WIPVIFEGDLAHTANCHLKKNDRVYITGQIFVDVS--EVSGAKPDQAYVHVMARDLRYIQ  180

Query  98   GVK  90
            G K
Sbjct  181  GSK  183



>gb|KFK31610.1| hypothetical protein AALP_AA6G135400 [Arabis alpina]
Length=507

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 9/76 (12%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG--  96
             IP++FEG+LA +   HVK++D +HVSG+L  D     +     N  I+ Q++ FVE   
Sbjct  121  WIPIIFEGELAKIAAHHVKKDDRIHVSGKLFIDSPLSNVTYPQSNVQIMVQNLNFVEAMI  180

Query  95   -------VKGKKTGAK  69
                   +K KK  A+
Sbjct  181  TPTEKEEIKPKKRPAR  196



>gb|AFW83976.1| hypothetical protein ZEAMMB73_371709, partial [Zea mays]
Length=233

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             +P+VF+ + A +   H+KEND V+VSG+L+ D  PF++     N  ++A  + FV+ 
Sbjct  134  WVPIVFKDNWAQIAASHLKENDLVYVSGKLTCDGPPFKLADGEANIQVLANSLKFVDS  191



>ref|XP_008225793.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like [Prunus 
mume]
Length=428

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 38/78 (49%), Gaps = 0/78 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEGVKG  87
            +P++FEGDLAH+   H+KEND V V+G L  D              ++   +YFVE    
Sbjct  116  MPIIFEGDLAHIASLHLKENDFVFVAGSLRSDLHHLNASKGQTPLQVMVHTLYFVEESSQ  175

Query  86   KKTGAKINSGDLENLDEV  33
                +K +  + + +D  
Sbjct  176  TNKSSKDDRQEEKTIDHT  193



>ref|XP_004295481.1| PREDICTED: protein OSB3, chloroplastic/mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=440

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  266  IPVVFEGDLAHVVGFHVKENDCVHVSGQLSGD  171
            IP+VFEGDLAHV   HVK+ DCV V+G L  D
Sbjct  136  IPIVFEGDLAHVASLHVKDGDCVFVAGSLRSD  167



>ref|XP_002893671.1| single-stranded DNA binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69930.1| single-stranded DNA binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 12/73 (16%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEID----------GYGGNF--HI  126
             IPV+FEGDLAH    ++K+ND VH++GQ+ GD +    +           + G+F   +
Sbjct  117  WIPVLFEGDLAHTANSYLKKNDRVHITGQILGDVIQSGANSDQACVQLFKSFHGSFSHQV  176

Query  125  VAQDVYFVEGVKG  87
            + +D++++EG K 
Sbjct  177  MVRDLHYIEGSKA  189



>ref|NP_564370.1| protein OSB4 [Arabidopsis thaliana]
 sp|Q9FYJ2.1|OSB4_ARATH RecName: Full=Protein OSB4, chloroplastic; AltName: Full=Organellar 
single-stranded DNA-binding protein 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF98182.1|AC000107_5 F17F8.7 [Arabidopsis thaliana]
 gb|AEE31306.1| protein OSB4 [Arabidopsis thaliana]
Length=360

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 12/73 (16%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEID----------GYGGNF--HI  126
             IPV+FEGDLAH    ++K+ND VH++GQ+ GD +    +           + G+F   +
Sbjct  120  WIPVLFEGDLAHTANSYLKKNDRVHITGQILGDVIQSGANSDQAHVQLFKSFHGSFSHQV  179

Query  125  VAQDVYFVEGVKG  87
            + +D++++EG K 
Sbjct  180  MVRDLHYIEGSKA  192



>gb|AAM63642.1| unknown [Arabidopsis thaliana]
Length=360

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 12/73 (16%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEID----------GYGGNF--HI  126
             IPV+FEGDLAH    ++K+ND VH++GQ+ GD +    +           + G+F   +
Sbjct  120  WIPVLFEGDLAHTANSYLKKNDRVHITGQILGDVIQSGANSDQAHVQLFKSFHGSFSHQV  179

Query  125  VAQDVYFVEGVKG  87
            + +D++++EG K 
Sbjct  180  MVRDLHYIEGSKA  192



>ref|XP_006280485.1| hypothetical protein CARUB_v10026422mg [Capsella rubella]
 gb|EOA13383.1| hypothetical protein CARUB_v10026422mg [Capsella rubella]
Length=437

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEIDGYGGNFHIVAQDVYFVEG  96
             IP++FEGDLA +   H+K+ D +H+SG+L  D  P  +     N  ++  ++ FV+ 
Sbjct  119  WIPIIFEGDLARIAVQHLKKEDRIHISGKLFIDSPPPNVTYTQSNVQVMVHNLNFVQA  176



>ref|XP_010478544.1| PREDICTED: protein OSB4, chloroplastic-like [Camelina sativa]
Length=338

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 53/98 (54%), Gaps = 15/98 (15%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGDKLPFEID----------GYGGNF--HI  126
             IP++FEGDLAH    ++K+ND VH++GQ+ GD +    +           + G+F   +
Sbjct  109  WIPLLFEGDLAHTANSYLKKNDRVHITGQILGDVIQSGANSEQAYVQMFKSFHGSFSHQV  168

Query  125  VAQDVYFVEGVKGKKTGAKI---NSGDLENLDEVKKMK  21
            + +D++++EG K           N G L++   VKK++
Sbjct  169  MVRDLHYIEGSKPLPKALPTLDQNEGVLKHSASVKKVR  206



>ref|XP_010460924.1| PREDICTED: protein OSB4, chloroplastic-like [Camelina sativa]
Length=343

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 15/98 (15%)
 Frame = -2

Query  269  LIPVVFEGDLAHVVGFHVKENDCVHVSGQLSGD--------KLPF--EIDGYGGNF--HI  126
             IP++FEGDLAH+   ++K+ND VH++GQ+ GD        K  +      + G+F   +
Sbjct  114  WIPLLFEGDLAHMANSYLKKNDRVHITGQILGDVIQSGANSKQAYVQMFKSFHGSFSHQV  173

Query  125  VAQDVYFVEGVKGKKTGAKI---NSGDLENLDEVKKMK  21
            + +D++++EG K           N G L++   VKK++
Sbjct  174  MVRDLHYIEGSKPLPKALPTLEQNEGVLKHSASVKKVR  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 767563575474