BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23432_g1_i2 len=2151 path=[1779:0-738 @2518@!:739-1325
3105:1326-1959 722:1960-1983 746:1984-2150]

Length=2151
                                                                      Score     E

gb|AAZ08051.1|  wax synthase                                            559   0.0      Petunia x hybrida [garden petunia]
ref|XP_009760691.1|  PREDICTED: O-acyltransferase WSD1-like             547   0.0      
ref|XP_009630816.1|  PREDICTED: O-acyltransferase WSD1-like             545   0.0      
ref|XP_009615146.1|  PREDICTED: O-acyltransferase WSD1-like             534   4e-179   
ref|XP_006362139.1|  PREDICTED: O-acyltransferase WSD1-like             532   1e-178   
ref|XP_006345292.1|  PREDICTED: O-acyltransferase WSD1-like             535   1e-177   
ref|XP_009625686.1|  PREDICTED: O-acyltransferase WSD1-like             529   1e-177   
ref|XP_004248081.1|  PREDICTED: O-acyltransferase WSD1-like             525   1e-175   
ref|XP_008233155.1|  PREDICTED: O-acyltransferase WSD1-like             521   2e-174   
ref|XP_004228362.1|  PREDICTED: O-acyltransferase WSD1-like             520   4e-174   
ref|XP_007219258.1|  hypothetical protein PRUPE_ppa018127mg             520   6e-174   
ref|XP_009793216.1|  PREDICTED: O-acyltransferase WSD1-like             518   8e-173   
ref|XP_007051549.1|  O-acyltransferase family protein, putative         511   3e-170   
gb|KDP28488.1|  hypothetical protein JCGZ_14259                         510   9e-170   
ref|XP_009760466.1|  PREDICTED: LOW QUALITY PROTEIN: O-acyltransf...    508   3e-169   
gb|KHG19161.1|  O-acyltransferase WSD1 -like protein                    505   4e-168   
emb|CDP08677.1|  unnamed protein product                                504   6e-168   
ref|XP_010095758.1|  O-acyltransferase WSD1                             501   2e-166   
ref|XP_002523348.1|  conserved hypothetical protein                     500   4e-166   Ricinus communis
ref|XP_009777803.1|  PREDICTED: O-acyltransferase WSD1-like             498   3e-165   
ref|XP_009598600.1|  PREDICTED: O-acyltransferase WSD1-like             496   2e-164   
ref|XP_006444839.1|  hypothetical protein CICLE_v10019739mg             495   4e-164   
gb|KCW78187.1|  hypothetical protein EUGRSUZ_D02376                     493   1e-163   
ref|XP_010054862.1|  PREDICTED: O-acyltransferase WSD1-like             493   3e-163   
gb|KHG26801.1|  O-acyltransferase WSD1 -like protein                    492   7e-163   
ref|XP_010661940.1|  PREDICTED: O-acyltransferase WSD1-like             489   8e-162   
emb|CBI40540.3|  unnamed protein product                                489   2e-161   
ref|XP_002263409.1|  PREDICTED: O-acyltransferase WSD1                  486   1e-160   Vitis vinifera
ref|XP_002263252.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    484   5e-160   Vitis vinifera
ref|XP_010035244.1|  PREDICTED: O-acyltransferase WSD1-like             483   2e-159   
ref|XP_002263137.1|  PREDICTED: O-acyltransferase WSD1-like             482   4e-159   Vitis vinifera
emb|CAN71951.1|  hypothetical protein VITISV_024308                     481   1e-158   Vitis vinifera
ref|XP_010266526.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    474   4e-156   
ref|XP_010661937.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       474   4e-156   
ref|XP_011024820.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    474   6e-156   
ref|XP_002278404.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       474   7e-156   Vitis vinifera
ref|XP_010266525.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    471   9e-155   
ref|XP_011024817.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    471   1e-154   
ref|XP_002318416.2|  hypothetical protein POPTR_0012s02150g             470   2e-154   Populus trichocarpa [western balsam poplar]
emb|CBI40547.3|  unnamed protein product                                486   4e-154   
ref|XP_010661938.1|  PREDICTED: O-acyltransferase WSD1-like             467   5e-153   
ref|XP_006441074.1|  hypothetical protein CICLE_v10019854mg             465   7e-153   
ref|XP_010666700.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    461   5e-151   
ref|XP_006441689.1|  hypothetical protein CICLE_v10019877mg             451   2e-147   
ref|XP_011008179.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    450   7e-147   
ref|XP_010662973.1|  PREDICTED: O-acyltransferase WSD1                  447   5e-146   
ref|XP_006478431.1|  PREDICTED: O-acyltransferase WSD1-like             447   5e-146   
gb|KDO38719.1|  hypothetical protein CISIN_1g041931mg                   446   2e-145   
emb|CBI23136.3|  unnamed protein product                                446   2e-145   
emb|CBI40536.3|  unnamed protein product                                445   3e-145   
ref|XP_004309135.1|  PREDICTED: O-acyltransferase WSD1-like             444   1e-144   
emb|CBI40544.3|  unnamed protein product                                444   7e-144   
ref|XP_007219046.1|  hypothetical protein PRUPE_ppa004668mg             442   1e-143   
ref|XP_008234742.1|  PREDICTED: O-acyltransferase WSD1-like             441   4e-143   
gb|KDP24675.1|  hypothetical protein JCGZ_26453                         439   2e-142   
ref|XP_010671458.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    437   2e-141   
ref|XP_009392540.1|  PREDICTED: O-acyltransferase WSD1-like             435   3e-141   
ref|XP_008376728.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    436   3e-141   
ref|XP_010666751.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    436   3e-141   
ref|XP_003588522.1|  O-acyltransferase WSD1                             435   4e-141   
ref|XP_009601405.1|  PREDICTED: O-acyltransferase WSD1-like             434   3e-140   
ref|XP_010095756.1|  O-acyltransferase WSD1                             438   5e-140   
ref|XP_008376729.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    432   5e-140   
ref|XP_008376727.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    432   7e-140   
ref|XP_011008175.1|  PREDICTED: O-acyltransferase WSD1-like             432   7e-140   
ref|XP_002325936.2|  hypothetical protein POPTR_0019s09920g             431   2e-139   Populus trichocarpa [western balsam poplar]
ref|XP_009378763.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    429   2e-138   
ref|XP_010666825.1|  PREDICTED: O-acyltransferase WSD1-like             428   7e-138   
ref|XP_009357297.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    426   2e-137   
ref|XP_002325937.2|  hypothetical protein POPTR_0019s09950g             426   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_009357299.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    425   3e-137   
ref|XP_009378764.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    425   4e-137   
ref|XP_009378762.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    425   5e-137   
ref|XP_008793154.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    425   7e-137   
ref|XP_008793153.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    423   2e-136   
ref|XP_006478432.1|  PREDICTED: O-acyltransferase WSD1-like             422   6e-136   
ref|XP_010519416.1|  PREDICTED: O-acyltransferase WSD1-like             422   7e-136   
ref|XP_006587545.1|  PREDICTED: O-acyltransferase WSD1                  421   8e-136   
gb|KHN38854.1|  O-acyltransferase WSD1                                  421   9e-136   
emb|CDY54346.1|  BnaC03g14900D                                          420   2e-135   
ref|XP_010537088.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       419   4e-135   
ref|XP_009766774.1|  PREDICTED: O-acyltransferase WSD1-like             420   5e-135   
ref|XP_006401711.1|  hypothetical protein EUTSA_v10013378mg             416   6e-134   
emb|CDX96219.1|  BnaC02g14320D                                          414   3e-133   
ref|XP_011024821.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    412   2e-132   
ref|XP_007039033.1|  O-acyltransferase (WSD1-like) family protein...    414   2e-132   
emb|CDY47071.1|  BnaA03g12270D                                          412   2e-132   
ref|XP_009127172.1|  PREDICTED: O-acyltransferase WSD1-like             412   3e-132   
ref|XP_009132482.1|  PREDICTED: O-acyltransferase WSD1-like             412   4e-132   
ref|XP_002865972.1|  hypothetical protein ARALYDRAFT_918418             411   7e-132   
ref|XP_010426433.1|  PREDICTED: O-acyltransferase WSD1-like             412   1e-131   
ref|XP_006282349.1|  hypothetical protein CARUB_v10028646mg             410   1e-131   
ref|XP_010671460.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    409   2e-131   
ref|XP_004235106.1|  PREDICTED: O-acyltransferase WSD1-like             410   2e-131   
gb|KDP45597.1|  hypothetical protein JCGZ_17204                         410   2e-131   
ref|XP_010924517.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    409   1e-130   
ref|XP_011075993.1|  PREDICTED: O-acyltransferase WSD1-like             408   1e-130   
ref|XP_010442900.1|  PREDICTED: O-acyltransferase WSD1-like             408   1e-130   
ref|XP_010105248.1|  O-acyltransferase WSD1                             404   3e-130   
ref|XP_006292398.1|  hypothetical protein CARUB_v10018611mg             405   2e-129   
ref|NP_190488.1|  O-acyltransferase (WSD1-like) family protein          405   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396534.1|  PREDICTED: O-acyltransferase WSD1-like             404   7e-129   
ref|XP_010482729.1|  PREDICTED: O-acyltransferase WSD1-like             403   7e-129   
ref|XP_010537089.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       402   8e-129   
ref|XP_004231223.1|  PREDICTED: O-acyltransferase WSD1-like             404   8e-129   
ref|XP_009395725.1|  PREDICTED: O-acyltransferase WSD1-like             404   1e-128   
ref|XP_010445768.1|  PREDICTED: O-acyltransferase WSD1-like             403   1e-128   
ref|XP_006404165.1|  hypothetical protein EUTSA_v10010299mg             402   7e-128   
ref|XP_009151884.1|  PREDICTED: O-acyltransferase WSD1-like             401   8e-128   
ref|NP_200151.2|  bifunctional wax ester synthase/diacylglycerol ...    400   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339804.1|  PREDICTED: O-acyltransferase WSD1-like             400   1e-127   
ref|XP_010515262.1|  PREDICTED: O-acyltransferase WSD1                  401   1e-127   
dbj|BAB09801.1|  unnamed protein product                                400   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877655.1|  condensation domain-containing protein             401   1e-127   
dbj|BAC42871.1|  unknown protein                                        400   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520974.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    400   3e-127   
ref|XP_009149757.1|  PREDICTED: O-acyltransferase WSD1-like             400   5e-127   
ref|XP_010503571.1|  PREDICTED: O-acyltransferase WSD1-like             399   7e-127   
emb|CDY08116.1|  BnaA06g16100D                                          399   1e-126   
ref|XP_010503567.1|  PREDICTED: O-acyltransferase WSD1-like             398   1e-126   
ref|XP_002877657.1|  hypothetical protein ARALYDRAFT_485279             397   3e-126   
ref|XP_010515263.1|  PREDICTED: O-acyltransferase WSD1                  397   6e-126   
ref|XP_010426423.1|  PREDICTED: O-acyltransferase WSD1-like             396   1e-125   
ref|XP_006399759.1|  hypothetical protein EUTSA_v10013397mg             394   2e-125   
ref|XP_006339705.1|  PREDICTED: O-acyltransferase WSD1-like             394   3e-125   
ref|XP_006290854.1|  hypothetical protein CARUB_v10016964mg             395   3e-125   
ref|XP_010492003.1|  PREDICTED: O-acyltransferase WSD1-like             392   8e-125   
ref|XP_010453319.1|  PREDICTED: O-acyltransferase WSD1-like             391   3e-124   
ref|XP_006293222.1|  hypothetical protein CARUB_v10019546mg             392   3e-124   
ref|NP_190490.1|  O-acyltransferase (WSD1-like) family protein          392   5e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05910.1|  BnaC08g20870D                                          392   6e-124   
ref|XP_009150159.1|  PREDICTED: O-acyltransferase WSD1-like             391   6e-124   
ref|XP_006404166.1|  hypothetical protein EUTSA_v10011067mg             391   7e-124   
ref|XP_006287621.1|  hypothetical protein CARUB_v10000833mg             389   2e-123   
gb|ABF59162.1|  hypothetical protein At3g49200                          389   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019909.1|  O-acyltransferase family protein                   389   3e-123   
ref|XP_010503570.1|  PREDICTED: O-acyltransferase WSD1-like             389   3e-123   
gb|KEH39732.1|  O-acyltransferase (WSD1-like) family protein            386   6e-123   
ref|XP_009760114.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    389   6e-123   
gb|KDP45599.1|  hypothetical protein JCGZ_17206                         387   7e-123   
ref|NP_190489.1|  O-acyltransferase (WSD1-like) family protein          388   7e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426427.1|  PREDICTED: O-acyltransferase WSD1-like             388   1e-122   
gb|KFK34209.1|  hypothetical protein AALP_AA5G115000                    388   1e-122   
ref|XP_010550528.1|  PREDICTED: O-acyltransferase WSD1-like             386   2e-122   
ref|XP_010453795.1|  PREDICTED: O-acyltransferase WSD1-like             386   3e-122   
ref|XP_010507342.1|  PREDICTED: O-acyltransferase WSD1-like             386   4e-122   
ref|NP_197139.1|  O-acyltransferase (WSD1-like) family protein          386   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494561.1|  PREDICTED: O-acyltransferase WSD1-like             386   4e-122   
ref|XP_010537087.1|  PREDICTED: O-acyltransferase WSD1-like             385   6e-122   
gb|KFK34210.1|  hypothetical protein AALP_AA5G115100                    385   9e-122   
ref|XP_009151870.1|  PREDICTED: O-acyltransferase WSD1                  385   1e-121   
ref|XP_002877656.1|  hypothetical protein ARALYDRAFT_906195             385   1e-121   
ref|XP_010441804.1|  PREDICTED: O-acyltransferase WSD1-like             384   2e-121   
ref|XP_006401714.1|  hypothetical protein EUTSA_v10015406mg             382   5e-121   
ref|XP_010492001.1|  PREDICTED: O-acyltransferase WSD1-like             382   7e-121   
ref|XP_002871716.1|  hypothetical protein ARALYDRAFT_488487             382   9e-121   
ref|XP_006287603.1|  hypothetical protein CARUB_v10000814mg             382   1e-120   
ref|NP_568275.1|  O-acyltransferase (WSD1-like) family protein          381   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873570.1|  hypothetical protein ARALYDRAFT_488089             381   2e-120   
dbj|BAK02325.1|  predicted protein                                      383   4e-120   
emb|CDY60222.1|  BnaA06g39110D                                          380   1e-119   
ref|XP_002440221.1|  hypothetical protein SORBIDRAFT_09g027970          381   2e-119   Sorghum bicolor [broomcorn]
gb|KEH39731.1|  O-acyltransferase (WSD1-like) family protein            377   2e-119   
ref|XP_010520978.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    378   4e-119   
ref|XP_006852653.1|  hypothetical protein AMTR_s00021p00243800          377   5e-119   
emb|CDX91162.1|  BnaC02g04350D                                          377   1e-118   
ref|XP_010492529.1|  PREDICTED: O-acyltransferase WSD1-like             377   1e-118   
ref|XP_010555728.1|  PREDICTED: O-acyltransferase WSD1-like             376   2e-118   
ref|XP_010231047.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    377   4e-118   
ref|XP_009125863.1|  PREDICTED: O-acyltransferase WSD1-like             375   5e-118   
emb|CDX85687.1|  BnaA02g01260D                                          374   9e-118   
emb|CDX86991.1|  BnaC03g52610D                                          374   1e-117   
ref|XP_010520977.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    374   1e-117   
ref|XP_010315460.1|  PREDICTED: LOW QUALITY PROTEIN: O-acyltransf...    375   2e-117   
ref|XP_010420325.1|  PREDICTED: O-acyltransferase WSD1-like             374   2e-117   
ref|XP_006371406.1|  hypothetical protein POPTR_0019s09950g             370   8e-117   
ref|XP_004961273.1|  PREDICTED: O-acyltransferase WSD1-like             373   2e-116   
gb|AGT16887.1|  hypothetical protein SHCRBa_165_I15_F_280               371   1e-115   
emb|CDX68518.1|  BnaC01g25960D                                          369   2e-115   
ref|XP_009415744.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    370   3e-115   
gb|EAY98969.1|  hypothetical protein OsI_20927                          369   2e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_009627721.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    365   2e-114   
ref|XP_006401713.1|  hypothetical protein EUTSA_v10015825mg             365   2e-114   
ref|XP_009627720.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    365   2e-114   
gb|EYU33179.1|  hypothetical protein MIMGU_mgv1a026751mg                365   4e-114   
ref|XP_002516707.1|  conserved hypothetical protein                     363   5e-114   Ricinus communis
gb|KDO46855.1|  hypothetical protein CISIN_1g043866mg                   363   7e-114   
gb|EYU25223.1|  hypothetical protein MIMGU_mgv1a005236mg                363   2e-113   
ref|XP_009119883.1|  PREDICTED: O-acyltransferase WSD1                  363   2e-113   
ref|XP_010492524.1|  PREDICTED: O-acyltransferase WSD1-like             363   3e-113   
emb|CDX87730.1|  BnaC02g32190D                                          367   4e-113   
ref|NP_200150.1|  O-acyltransferase (WSD1-like) family protein          359   5e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006478071.1|  PREDICTED: O-acyltransferase WSD1-like             355   8e-112   
ref|XP_011024822.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    355   5e-111   
emb|CBH32551.1|  conserved hypothetical protein, expressed              357   6e-111   
ref|XP_010445765.1|  PREDICTED: O-acyltransferase WSD1-like             354   6e-111   
ref|XP_009140411.1|  PREDICTED: O-acyltransferase WSD1-like             355   8e-111   
ref|NP_001043877.1|  Os01g0681000                                       356   3e-110   Oryza sativa Japonica Group [Japonica rice]
emb|CAN79451.1|  hypothetical protein VITISV_001677                     363   9e-110   Vitis vinifera
dbj|BAJ97841.1|  predicted protein                                      353   5e-109   
ref|XP_010445752.1|  PREDICTED: O-acyltransferase WSD1                  350   8e-109   
dbj|BAJ93204.1|  predicted protein                                      351   2e-108   
emb|CDX70475.1|  BnaC03g05590D                                          349   3e-108   
emb|CDX68517.1|  BnaC01g25950D                                          353   3e-108   
ref|XP_011008181.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    347   4e-108   
gb|EAY75973.1|  hypothetical protein OsI_03895                          349   1e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_004969548.1|  PREDICTED: O-acyltransferase WSD1-like             349   3e-107   
ref|NP_001044374.1|  Os01g0770000                                       348   4e-107   Oryza sativa Japonica Group [Japonica rice]
emb|CDY15943.1|  BnaA04g11680D                                          345   1e-106   
gb|EAY75974.1|  hypothetical protein OsI_03896                          346   1e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_003569566.1|  PREDICTED: O-acyltransferase WSD1-like             346   2e-106   
ref|XP_009760121.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    343   3e-106   
emb|CDY14417.1|  BnaC03g21780D                                          343   7e-106   
emb|CDX83070.1|  BnaA01g20700D                                          342   9e-106   
emb|CDY03658.1|  BnaA02g15790D                                          342   3e-105   
ref|XP_008675193.1|  PREDICTED: O-acyltransferase WSD1-like             343   3e-105   
ref|XP_010428065.1|  PREDICTED: O-acyltransferase WSD1-like             341   3e-105   
emb|CDX78486.1|  BnaA03g03980D                                          341   4e-105   
ref|XP_009133325.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    341   4e-105   
ref|XP_009131282.1|  PREDICTED: O-acyltransferase WSD1-like             341   5e-105   
emb|CDY07682.1|  BnaA03g18290D                                          341   6e-105   
ref|XP_009127901.1|  PREDICTED: O-acyltransferase WSD1-like             340   6e-105   
ref|XP_010415938.1|  PREDICTED: O-acyltransferase WSD1-like             340   9e-105   
ref|XP_010428063.1|  PREDICTED: O-acyltransferase WSD1-like             340   1e-104   
gb|KFK41644.1|  hypothetical protein AALP_AA2G154500                    339   1e-104   
ref|XP_006302205.1|  hypothetical protein CARUB_v10020217mg             340   1e-104   
ref|XP_010520975.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    340   1e-104   
ref|XP_010427904.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    339   2e-104   
ref|XP_007019907.1|  O-acyltransferase family protein                   343   2e-104   
ref|XP_009127897.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    339   2e-104   
ref|XP_010474267.1|  PREDICTED: O-acyltransferase WSD1-like             339   2e-104   
ref|XP_002864239.1|  hypothetical protein ARALYDRAFT_495410             338   1e-103   
ref|XP_010924518.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    337   1e-103   
gb|EMS49019.1|  O-acyltransferase WSD1                                  338   1e-103   
ref|XP_006411123.1|  hypothetical protein EUTSA_v10016602mg             337   1e-103   
ref|XP_010100760.1|  O-acyltransferase WSD1                             340   4e-103   
ref|XP_010428073.1|  PREDICTED: O-acyltransferase WSD1-like             335   6e-103   
ref|XP_002879777.1|  hypothetical protein ARALYDRAFT_321593             334   2e-102   
emb|CDX78487.1|  BnaA03g03990D                                          333   2e-102   
emb|CDY27000.1|  BnaC06g12160D                                          334   3e-102   
ref|XP_006390701.1|  hypothetical protein EUTSA_v10018486mg             333   3e-102   
ref|XP_009144401.1|  PREDICTED: O-acyltransferase WSD1                  334   3e-102   
ref|XP_010492521.1|  PREDICTED: O-acyltransferase WSD1-like             332   3e-102   
ref|XP_010440837.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    333   4e-102   
ref|XP_006390705.1|  hypothetical protein EUTSA_v10018487mg             333   5e-102   
ref|XP_009127896.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    333   5e-102   
ref|XP_010415939.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    333   5e-102   
ref|XP_004984321.1|  PREDICTED: O-acyltransferase WSD1-like             334   6e-102   
ref|XP_004970103.1|  PREDICTED: O-acyltransferase WSD1-like             333   8e-102   
gb|EMT14089.1|  hypothetical protein F775_13804                         333   9e-102   
ref|XP_010231048.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    331   9e-102   
gb|EMT09727.1|  hypothetical protein F775_13549                         333   1e-101   
gb|KEH39735.1|  O-acyltransferase (WSD1-like) family protein            329   1e-101   
ref|XP_002458560.1|  hypothetical protein SORBIDRAFT_03g035790          333   1e-101   Sorghum bicolor [broomcorn]
ref|XP_006294091.1|  hypothetical protein CARUB_v10023084mg             332   3e-101   
ref|NP_177356.1|  O-acyltransferase (WSD1-like) family protein          331   3e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14418.1|  BnaC03g21770D                                          331   4e-101   
ref|XP_009133034.1|  PREDICTED: O-acyltransferase WSD1-like             330   5e-101   
ref|XP_006302204.1|  hypothetical protein CARUB_v10020216mg             330   6e-101   
ref|NP_197641.1|  O-acyltransferase (WSD1-like) family protein          330   6e-101   Arabidopsis thaliana [mouse-ear cress]
gb|EMT13303.1|  hypothetical protein F775_11197                         330   7e-101   
ref|XP_006371408.1|  hypothetical protein POPTR_0019s09950g             327   9e-101   
dbj|BAJ33896.1|  unnamed protein product                                329   1e-100   
ref|XP_010450747.1|  PREDICTED: O-acyltransferase WSD1-like             328   1e-100   
ref|XP_002868506.1|  hypothetical protein ARALYDRAFT_330267             329   2e-100   
dbj|BAB09102.1|  unnamed protein product                                329   4e-100   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79616.1|  BnaC03g19520D                                          328   4e-100   
gb|KFK36802.1|  hypothetical protein AALP_AA4G173300                    328   4e-100   
ref|XP_006294114.1|  hypothetical protein CARUB_v10023110mg             328   5e-100   
ref|XP_010471231.1|  PREDICTED: O-acyltransferase WSD1-like             327   5e-100   
ref|XP_010435559.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       327   6e-100   
dbj|BAJ84892.1|  predicted protein                                      328   1e-99    
ref|NP_568547.1|  o-acyltransferase WSD1                                327   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505562.1|  PREDICTED: O-acyltransferase WSD1-like             327   1e-99    
ref|NP_850307.2|  O-acyltransferase (WSD1-like) family protein          326   3e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390703.1|  hypothetical protein EUTSA_v10018482mg             325   4e-99    
ref|XP_004979823.1|  PREDICTED: O-acyltransferase WSD1-like             326   7e-99    
ref|XP_006283626.1|  hypothetical protein CARUB_v10004683mg             325   1e-98    
ref|XP_010509088.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    324   2e-98    
ref|XP_003571567.2|  PREDICTED: O-acyltransferase WSD1-like             325   2e-98    
ref|NP_001189709.1|  O-acyltransferase (WSD1-like) family protein       323   2e-98    
ref|XP_009133323.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    323   4e-98    
ref|XP_010505558.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    323   5e-98    
ref|XP_010509086.1|  PREDICTED: O-acyltransferase WSD1-like             322   6e-98    
ref|XP_002870738.1|  hypothetical protein ARALYDRAFT_916278             321   1e-97    
ref|XP_009133324.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    322   1e-97    
ref|XP_006296409.1|  hypothetical protein CARUB_v10025587mg             322   1e-97    
ref|XP_010451688.1|  PREDICTED: O-acyltransferase WSD1-like             320   4e-97    
emb|CDM84376.1|  unnamed protein product                                318   1e-96    
ref|XP_010517234.1|  PREDICTED: O-acyltransferase WSD1-like             319   1e-96    
ref|XP_004979822.1|  PREDICTED: O-acyltransferase WSD1-like             319   3e-96    
ref|NP_001140997.1|  uncharacterized protein LOC100273076               314   3e-96    
ref|XP_010509090.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    317   6e-96    
gb|AIE57507.1|  WSD1                                                    318   3e-95    
ref|XP_010428071.1|  PREDICTED: O-acyltransferase WSD1-like             314   9e-95    
ref|XP_010435561.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       313   2e-94    
gb|KFK25517.1|  hypothetical protein AALP_AA8G125200                    311   2e-94    
emb|CDX82186.1|  BnaC02g21040D                                          310   2e-92    
ref|XP_008347254.1|  PREDICTED: O-acyltransferase WSD1-like             302   3e-92    
emb|CDM80145.1|  unnamed protein product                                308   5e-92    
ref|XP_010505559.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    306   1e-91    
emb|CDY30395.1|  BnaA04g24960D                                          306   1e-91    
ref|XP_009142183.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       305   3e-91    
dbj|BAK05274.1|  predicted protein                                      305   6e-91    
ref|XP_002459294.1|  hypothetical protein SORBIDRAFT_02g001860          304   8e-91    
ref|XP_010505561.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    303   1e-90    
emb|CDY14382.1|  BnaA10g06730D                                          300   1e-90    
ref|XP_009142184.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       303   2e-90    
ref|XP_006300458.1|  hypothetical protein CARUB_v10020227mg             302   2e-90    
emb|CAN71950.1|  hypothetical protein VITISV_024307                     298   9e-90    
ref|XP_004955390.1|  PREDICTED: O-acyltransferase WSD1-like             301   1e-89    
ref|NP_001185377.1|  O-acyltransferase (WSD1-like) family protein       300   1e-89    
ref|XP_010427905.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    299   1e-89    
gb|EEE64643.1|  hypothetical protein OsJ_19497                          301   2e-89    
ref|XP_010509091.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    299   3e-89    
dbj|BAK08349.1|  predicted protein                                      300   4e-89    
emb|CDY35652.1|  BnaC09g29740D                                          301   6e-89    
gb|KFK36801.1|  hypothetical protein AALP_AA4G173200                    298   7e-89    
emb|CDM83947.1|  unnamed protein product                                299   7e-89    
ref|XP_010415940.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    296   9e-89    
emb|CDY07684.1|  BnaA03g18270D                                          296   2e-88    
gb|KDO40779.1|  hypothetical protein CISIN_1g047223mg                   293   2e-88    
ref|XP_010088855.1|  O-acyltransferase WSD1                             293   3e-88    
ref|XP_010517229.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    296   3e-88    
ref|XP_002992800.1|  hypothetical protein SELMODRAFT_269987             296   3e-88    
emb|CDM80272.1|  unnamed protein product                                297   6e-88    
dbj|BAJ85619.1|  predicted protein                                      296   7e-88    
gb|EEE55448.1|  hypothetical protein OsJ_03604                          294   9e-88    
ref|XP_009124641.1|  PREDICTED: O-acyltransferase WSD1-like             295   1e-87    
ref|XP_009630814.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    292   3e-87    
ref|XP_010661939.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    293   3e-87    
emb|CBH32550.1|  conserved hypothetical protein                         294   4e-87    
ref|XP_010509089.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    291   5e-87    
ref|XP_010236483.1|  PREDICTED: O-acyltransferase WSD1-like             291   3e-86    
ref|XP_006401712.1|  hypothetical protein EUTSA_v10015275mg             288   6e-86    
emb|CDM80267.1|  unnamed protein product                                291   9e-86    
dbj|BAJ93623.1|  predicted protein                                      290   2e-85    
gb|AJA71659.1|  hypothetical protein                                    290   3e-85    
ref|XP_002862308.1|  hypothetical protein ARALYDRAFT_920929             283   1e-84    
gb|EAZ13098.1|  hypothetical protein OsJ_03018                          281   3e-83    
ref|XP_010517230.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    281   2e-82    
gb|EMT13687.1|  hypothetical protein F775_52291                         281   5e-82    
ref|XP_010671461.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    275   1e-81    
ref|XP_002987493.1|  hypothetical protein SELMODRAFT_235299             278   1e-81    
ref|XP_009415745.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    278   5e-81    
ref|XP_006390704.1|  hypothetical protein EUTSA_v10018487mg             274   5e-81    
gb|KFK41631.1|  hypothetical protein AALP_AA2G152800                    274   1e-80    
ref|XP_010424071.1|  PREDICTED: O-acyltransferase WSD1-like             273   2e-80    
ref|XP_010232394.1|  PREDICTED: O-acyltransferase WSD1-like             275   2e-80    
dbj|BAK06983.1|  predicted protein                                      270   1e-79    
dbj|BAF01088.1|  hypothetical protein                                   269   2e-79    
ref|XP_001780431.1|  predicted protein                                  273   6e-79    
ref|XP_006371409.1|  hypothetical protein POPTR_0019s09950g             265   5e-78    
gb|EMT12337.1|  hypothetical protein F775_12701                         272   6e-78    
ref|XP_010517232.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    265   5e-77    
gb|EMT29057.1|  hypothetical protein F775_31636                         265   1e-76    
ref|XP_006441690.1|  hypothetical protein CICLE_v10023773mg             262   2e-76    
gb|KEH39734.1|  O-acyltransferase (WSD1-like) family protein            259   2e-76    
ref|XP_002963877.1|  hypothetical protein SELMODRAFT_80096              266   3e-76    
emb|CBI40534.3|  unnamed protein product                                260   4e-76    
gb|KEH39733.1|  O-acyltransferase (WSD1-like) family protein            259   4e-76    
ref|XP_002988280.1|  hypothetical protein SELMODRAFT_127447             264   1e-75    
ref|XP_004136970.1|  PREDICTED: O-acyltransferase WSD1-like             263   1e-75    
ref|XP_009133326.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    260   2e-75    
ref|XP_010427906.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    258   7e-75    
gb|EMT13037.1|  hypothetical protein F775_19306                         261   8e-75    
ref|XP_010440835.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    258   1e-74    
ref|XP_010517231.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    257   1e-73    
gb|EMT14090.1|  hypothetical protein F775_33073                         255   4e-73    
ref|XP_008454962.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    256   4e-73    
ref|XP_010647731.1|  PREDICTED: O-acyltransferase WSD1-like             256   5e-73    
ref|XP_006655577.1|  PREDICTED: O-acyltransferase WSD1-like             256   7e-73    
ref|XP_002888859.1|  hypothetical protein ARALYDRAFT_476341             254   7e-73    
gb|EMS61797.1|  O-acyltransferase WSD1                                  262   2e-72    
gb|EMS64139.1|  O-acyltransferase WSD1                                  253   6e-72    
ref|NP_001276179.1|  O-acyltransferase WSD1-like                        252   8e-72    
ref|XP_010431166.1|  PREDICTED: O-acyltransferase WSD1-like             259   8e-72    
ref|XP_010495223.1|  PREDICTED: O-acyltransferase WSD1-like             248   8e-72    
gb|KDP25010.1|  hypothetical protein JCGZ_23993                         252   2e-71    
ref|XP_009630815.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    248   2e-71    
ref|XP_006375366.1|  hypothetical protein POPTR_0014s09440g             244   4e-70    
ref|XP_011000126.1|  PREDICTED: O-acyltransferase WSD1-like             248   5e-70    
ref|XP_010440836.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    243   3e-69    
ref|XP_010028428.1|  PREDICTED: O-acyltransferase WSD1-like             245   3e-69    
gb|EMT25966.1|  hypothetical protein F775_19053                         246   7e-69    
ref|XP_004290593.1|  PREDICTED: O-acyltransferase WSD1-like             244   9e-69    
emb|CAN72806.1|  hypothetical protein VITISV_035309                     243   1e-68    
ref|XP_010495694.1|  PREDICTED: O-acyltransferase WSD1-like             240   1e-68    
ref|XP_006646368.1|  PREDICTED: O-acyltransferase WSD1-like             241   2e-68    
ref|XP_006350634.1|  PREDICTED: O-acyltransferase WSD1-like             236   2e-68    
ref|XP_007201626.1|  hypothetical protein PRUPE_ppa021430mg             243   5e-68    
ref|XP_007157237.1|  hypothetical protein PHAVU_002G054200g             242   5e-68    
emb|CDX83071.1|  BnaA01g20710D                                          235   1e-67    
ref|XP_010048502.1|  PREDICTED: O-acyltransferase WSD1-like             241   1e-67    
ref|XP_010028432.1|  PREDICTED: O-acyltransferase WSD1-like             241   1e-67    
emb|CDY65667.1|  BnaCnng48100D                                          240   1e-67    
ref|XP_010028434.1|  PREDICTED: O-acyltransferase WSD1-like             241   1e-67    
ref|XP_011088231.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    239   6e-67    
ref|XP_009588191.1|  PREDICTED: O-acyltransferase WSD1-like             239   7e-67    
ref|XP_010095755.1|  O-acyltransferase WSD1                             238   3e-66    
ref|XP_006487043.1|  PREDICTED: O-acyltransferase WSD1-like             236   4e-66    
ref|XP_011092556.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    237   4e-66    
gb|EEC71274.1|  hypothetical protein OsI_03277                          239   4e-66    
ref|XP_006646204.1|  PREDICTED: O-acyltransferase WSD1-like             237   4e-66    
ref|XP_004230765.1|  PREDICTED: O-acyltransferase WSD1-like             237   5e-66    
ref|XP_009350397.1|  PREDICTED: O-acyltransferase WSD1-like             238   2e-65    
ref|XP_011092557.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    235   2e-65    
ref|XP_010270333.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    235   4e-65    
gb|KFK25514.1|  hypothetical protein AALP_AA8G124600                    239   4e-65    
ref|XP_006346395.1|  PREDICTED: O-acyltransferase WSD1-like             234   5e-65    
gb|KHG08035.1|  O-acyltransferase WSD1 -like protein                    234   7e-65    
gb|KFK25513.1|  hypothetical protein AALP_AA8G124600                    238   2e-64    
gb|KDP25009.1|  hypothetical protein JCGZ_23992                         232   3e-64    
gb|EMS49490.1|  O-acyltransferase WSD1                                  234   4e-64    
ref|XP_008373840.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    231   7e-64    
gb|EYU42683.1|  hypothetical protein MIMGU_mgv1a006065mg                230   1e-63    
ref|XP_008236483.1|  PREDICTED: O-acyltransferase WSD1-like             230   2e-63    
ref|XP_007199467.1|  hypothetical protein PRUPE_ppa027070mg             229   3e-63    
ref|XP_010690929.1|  PREDICTED: O-acyltransferase WSD1-like             226   3e-62    
ref|XP_004511283.1|  PREDICTED: O-acyltransferase WSD1-like             226   4e-62    
ref|XP_010041135.1|  PREDICTED: O-acyltransferase WSD1-like             225   9e-62    
gb|KHG19380.1|  O-acyltransferase WSD1                                  224   2e-61    
ref|XP_008236479.1|  PREDICTED: O-acyltransferase WSD1-like             224   2e-61    
ref|XP_010030645.1|  PREDICTED: O-acyltransferase WSD1-like             223   5e-61    
ref|XP_007199357.1|  hypothetical protein PRUPE_ppa025347mg             223   5e-61    
ref|XP_010509092.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    219   5e-61    
ref|XP_007042465.1|  O-acyltransferase family protein, putative i...    223   7e-61    
ref|XP_010427907.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    216   4e-60    
gb|EMS63989.1|  O-acyltransferase WSD1                                  215   4e-60    
ref|XP_008236478.1|  PREDICTED: O-acyltransferase WSD1-like             220   8e-60    
gb|EMT32673.1|  hypothetical protein F775_06655                         215   1e-59    
ref|XP_010661936.1|  PREDICTED: LOW QUALITY PROTEIN: O-acyltransf...    210   3e-59    
emb|CBI40545.3|  unnamed protein product                                210   3e-59    
ref|XP_011088232.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    216   4e-59    
gb|EYU42685.1|  hypothetical protein MIMGU_mgv1a006752mg                217   5e-59    
ref|XP_010107910.1|  O-acyltransferase WSD1                             218   6e-59    
ref|XP_008236495.1|  PREDICTED: O-acyltransferase WSD1-like             218   9e-59    
ref|XP_010030633.1|  PREDICTED: O-acyltransferase WSD1-like             217   9e-59    
ref|XP_010665875.1|  PREDICTED: O-acyltransferase WSD1-like             216   1e-58    
ref|XP_008236477.1|  PREDICTED: O-acyltransferase WSD1-like             217   2e-58    
ref|XP_010691738.1|  PREDICTED: O-acyltransferase WSD1-like             216   2e-58    
emb|CDX84605.1|  BnaA03g16250D                                          214   3e-58    
ref|XP_010492523.1|  PREDICTED: O-acyltransferase WSD1-like             211   7e-58    
dbj|BAJ92722.1|  predicted protein                                      211   8e-58    
ref|XP_002873571.1|  hypothetical protein ARALYDRAFT_350432             209   1e-57    
ref|XP_010028433.1|  PREDICTED: O-acyltransferase WSD1-like             214   1e-57    
gb|EYU42684.1|  hypothetical protein MIMGU_mgv1a006065mg                210   5e-57    
gb|EYU25225.1|  hypothetical protein MIMGU_mgv1a011770mg                206   6e-57    
ref|XP_010414830.1|  PREDICTED: O-acyltransferase WSD1-like             205   6e-57    
gb|KFK30158.1|  hypothetical protein AALP_AA7G224600                    210   7e-57    
ref|XP_007200992.1|  hypothetical protein PRUPE_ppa005024mg             211   2e-56    
ref|XP_010691752.1|  PREDICTED: O-acyltransferase WSD1-like             210   3e-56    
ref|XP_008373842.1|  PREDICTED: O-acyltransferase WSD1-like             208   3e-55    
ref|XP_009354302.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    207   4e-55    
ref|XP_010040257.1|  PREDICTED: O-acyltransferase WSD1-like             204   7e-55    
gb|EMS59183.1|  O-acyltransferase WSD1                                  207   1e-54    
ref|XP_006371410.1|  hypothetical protein POPTR_0019s09950g             200   1e-54    
gb|EMT04080.1|  hypothetical protein F775_10949                         198   2e-54    
ref|XP_009354301.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    204   4e-54    
gb|AGV54754.1|  O-acyltransferase WSD1                                  203   5e-54    
gb|ACU18891.1|  unknown                                                 197   6e-54    
gb|EMS62721.1|  O-acyltransferase WSD1                                  194   2e-52    
ref|XP_007140988.1|  hypothetical protein PHAVU_008G157700g             194   2e-52    
ref|XP_010030646.1|  PREDICTED: O-acyltransferase WSD1-like             197   6e-52    
ref|XP_010107911.1|  O-acyltransferase WSD1                             197   7e-52    
emb|CDY67442.1|  BnaUnng02180D                                          191   1e-51    
emb|CAN76656.1|  hypothetical protein VITISV_042358                     187   2e-51    
emb|CAN78450.1|  hypothetical protein VITISV_005944                     191   2e-51    
ref|XP_010415937.1|  PREDICTED: O-acyltransferase WSD1-like             188   2e-50    
gb|KDP45602.1|  hypothetical protein JCGZ_17209                         185   3e-50    
emb|CDY35650.1|  BnaC09g29720D                                          186   3e-50    
dbj|BAJ86545.1|  predicted protein                                      189   1e-49    
ref|XP_010662018.1|  PREDICTED: O-acyltransferase WSD1-like             184   1e-49    
ref|XP_010691737.1|  PREDICTED: O-acyltransferase WSD1-like             191   2e-49    
ref|XP_010105246.1|  O-acyltransferase WSD1                             182   3e-49    
ref|XP_010270343.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    189   4e-49    
ref|XP_006289920.1|  hypothetical protein CARUB_v10003536mg             184   3e-48    
ref|XP_008791832.1|  PREDICTED: O-acyltransferase WSD1-like             187   3e-48    
ref|XP_010030641.1|  PREDICTED: O-acyltransferase WSD1-like             180   4e-46    
gb|EYU25224.1|  hypothetical protein MIMGU_mgv11b019954mg               178   7e-46    
gb|KHG19381.1|  O-acyltransferase WSD1                                  179   7e-46    
gb|EPS64282.1|  hypothetical protein M569_10500                         179   7e-46    
ref|NP_001044375.1|  Os01g0770100                                       182   1e-45    
ref|XP_009624957.1|  PREDICTED: O-acyltransferase WSD1-like             179   2e-45    
ref|XP_010107912.1|  O-acyltransferase WSD1                             174   4e-45    
emb|CBI32385.3|  unnamed protein product                                174   4e-45    
gb|ADE76190.1|  unknown                                                 178   4e-45    
ref|XP_008454964.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    175   2e-44    
ref|XP_004516682.1|  PREDICTED: O-acyltransferase WSD1-like             176   2e-44    
ref|XP_009131286.1|  PREDICTED: O-acyltransferase WSD1-like             168   3e-44    
ref|XP_010517233.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    168   4e-44    
gb|ADE77834.1|  unknown                                                 176   4e-44    
ref|XP_007042468.1|  O-acyltransferase family protein, putative i...    172   6e-44    
ref|XP_009782424.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    174   7e-44    
ref|XP_007042467.1|  O-acyltransferase family protein, putative i...    171   1e-43    
ref|XP_006469879.1|  PREDICTED: O-acyltransferase WSD1-like             173   2e-43    
ref|XP_002310400.1|  hypothetical protein POPTR_0007s00950g             173   2e-43    
ref|XP_006447283.1|  hypothetical protein CICLE_v10015126mg             173   2e-43    
ref|XP_008227240.1|  PREDICTED: O-acyltransferase WSD1-like             172   3e-43    
ref|XP_010260232.1|  PREDICTED: O-acyltransferase WSD1-like             172   6e-43    



>gb|AAZ08051.1| wax synthase [Petunia x hybrida]
Length=521

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/508 (54%), Positives = 367/508 (72%), Gaps = 22/508 (4%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             E  LKPIET K+K+  E   +++ EEP+SP++RL H+  FN+H++ I+  +++I+P    
Sbjct  14    EPCLKPIET-KRKTIEEYETVAVEEEPLSPTARLFHDANFNVHVVVIIALDTRISPQPIK  72

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
               + HTLLKHPRFTSLMVVD+E    MKWV+T++DL QHI V E  E ++E  +      
Sbjct  73    DKLVHTLLKHPRFTSLMVVDEENLADMKWVQTKIDLDQHIIVPEVDETQLESPD------  126

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACT  638
             KFVEDY+Y L+K  +D ++PLWDLH++N+KTRDAEA+A+LR+HH+LGDG S+ SLLLACT
Sbjct  127   KFVEDYIYNLTKTSLDRTKPLWDLHLVNVKTRDAEAVALLRVHHSLGDGTSLISLLLACT  186

Query  639   RQTANPKLLPTISTRS--------SSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT  794
             RQTA+   LPTI T+         S+  ++ K  +       F +++ NTLVDV +FI T
Sbjct  187   RQTADELKLPTIPTKKRRPTPSGYSTKEESFKLWHYLAVIWLFIRMIGNTLVDVLMFIIT  246

Query  795   LFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
             + FLKD++TPI   P SES+ +R  +RI+ L+D   +K A N TINDVALG+TQA LS Y
Sbjct  247   VIFLKDTKTPINTVPDSESRVRRIVHRIIDLDDLKLVKNAMNMTINDVALGITQAGLSKY  306

Query  975   LNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRY   + D G  E  NNLPKN+RLRSCL  NLRP+ GI+ LADMM+K   E     K
Sbjct  307   LNRRYAVDEEDKGDTERNNNLPKNIRLRSCLVINLRPSAGIEDLADMMEKGPKE-----K  361

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
              GWGN FGY +LP KI + +DPLDYV+EAKAT DRKK S+E ++T  +A  +IK FG K 
Sbjct  362   RGWGNWFGYVLLPFKIALRDDPLDYVKEAKATVDRKKRSFEALYTLIMAEVLIKIFGIKV  421

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             A  +T ++FSNA+ CFSNVVGP+E++ F GHPI+++AP+ YGQPSALM++FQSY+DKM +
Sbjct  422   ATAVTVRVFSNATVCFSNVVGPQEEIGFCGHPISYLAPSIYGQPSALMINFQSYIDKMII  481

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +++VDE  IPDP QLLDDFE SLHLIK+
Sbjct  482   VVAVDEGAIPDPQQLLDDFENSLHLIKE  509



>ref|XP_009760691.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=505

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/503 (54%), Positives = 363/503 (72%), Gaps = 24/503 (5%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHN  284
             +LKPI+T K K  ME    +  EEP+SPS+RL HEP FN+H++AIMG  S+INP V    
Sbjct  10    SLKPIQT-KTKLAME----AAEEEPLSPSARLFHEPNFNVHVIAIMGSKSRINPQVIKEK  64

Query  285   MPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
             + HTLLKHPRF+SL VVD+E+NG+MKWV T+VDL +HI V +  E +++         KF
Sbjct  65    LVHTLLKHPRFSSLQVVDEEKNGEMKWVRTKVDLDKHIVVPQVDEQKLK-----ESPDKF  119

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y++ LSK  +D S+P+WDLH+LN+KT DAEA+ V R+HH+LGDG S+ SLLLACTRQ
Sbjct  120   VENYIHNLSKTTLDKSKPMWDLHLLNVKTSDAEAVGVFRIHHSLGDGTSLISLLLACTRQ  179

Query  645   TANPKLLPTI-----STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLK  809
             TA+P  +PTI        +SS   T        K  +F +L WNT+VDV +F+AT  FLK
Sbjct  180   TAHPDKIPTIPGNKKRPNNSSEYTTKGLWQYFAKVWSFMRLFWNTIVDVLMFMATTMFLK  239

Query  810   DSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY  989
             D+ TPI   P SE  P+RF YR +SL+D   +K A N TINDVALG TQA LS+YLNRR+
Sbjct  240   DTSTPIKGKPGSEFNPRRFVYRTVSLDDLKLVKNALNMTINDVALGATQAGLSVYLNRRF  299

Query  990   G--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGN  1163
             G  K+D  + E  NNLPKN+RLRS L  NLRP+ GIQALADMM K+       ++  WGN
Sbjct  300   GVSKKDKRATEKNNNLPKNIRLRSTLLVNLRPSTGIQALADMMDKD-------TEVKWGN  352

Query  1164  RFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILT  1343
               G+ +LP KI + +DPLDY+REAKAT DRKK S E I+T+ ++   ++FFG K ++ ++
Sbjct  353   SIGFVLLPFKISLRDDPLDYIREAKATIDRKKNSLEAIYTFSISELALRFFGIKTSSSIS  412

Query  1344  NKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVD  1523
             ++I +N + CFSN+VGP+E++ F+GHP+A++AP+ YGQP ALM++FQSY +KM +++SVD
Sbjct  413   HRIITNTTMCFSNLVGPQEEIGFYGHPMAYLAPSSYGQPHALMINFQSYTNKMTIVLSVD  472

Query  1524  ENVIPDPNQLLDDFEKSLHLIKD  1592
             E+VIPDP QLLDD E+SL LIKD
Sbjct  473   ESVIPDPYQLLDDLEQSLKLIKD  495



>ref|XP_009630816.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=505

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/503 (54%), Positives = 363/503 (72%), Gaps = 24/503 (5%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHN  284
             +LKPI+T K K  ME    +  EE +SPS+RL HEP FN+H++AIMG  S+INP V    
Sbjct  10    SLKPIQT-KPKLAME----AAEEELLSPSARLFHEPNFNVHVIAIMGSKSRINPQVIKEK  64

Query  285   MPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
             + HTLLKHPRF+SL VVD+++NG+MKWV T VDL +HI V +  E  ++G        KF
Sbjct  65    LVHTLLKHPRFSSLQVVDEKKNGEMKWVRTMVDLDKHIVVPQVDEQNLQGSP-----DKF  119

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y+  LSK  +D S+PLWDLH+LN+KT DAEA+AV R+HH+LGDG S+ SLLLACTRQ
Sbjct  120   VENYIQNLSKTTLDKSKPLWDLHLLNVKTSDAEAVAVFRIHHSLGDGTSLISLLLACTRQ  179

Query  645   TANPKLLPTISTR-----SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLK  809
             TA+P  +PTI        +SS   T        K  +F +L WNT+VDV +F+AT  FLK
Sbjct  180   TAHPDKIPTIPGNKKMPINSSEYTTKGLWQYFAKVWSFMRLFWNTIVDVLMFMATTMFLK  239

Query  810   DSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY  989
             D+ TPI   P SE  P+RF YR +SL+D   +K A N TINDVALGVTQA LS+YLNRR+
Sbjct  240   DTSTPIKGKPGSEFNPRRFVYRTVSLDDLKLVKNALNMTINDVALGVTQAGLSVYLNRRF  299

Query  990   G--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGN  1163
             G  K++ G  E  NNLPKN+RLRS L  NLRP+ GIQALADMM+K+       ++  WGN
Sbjct  300   GEGKKNKGVTEKNNNLPKNIRLRSTLLVNLRPSTGIQALADMMEKD-------TEAKWGN  352

Query  1164  RFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILT  1343
               G+ +LP KI + +DPLDY+REAKAT DRKK S E I+T+ ++   ++FFG K ++ ++
Sbjct  353   WIGFVLLPFKIALRDDPLDYIREAKATIDRKKNSLEAIYTFSISELALRFFGIKTSSSIS  412

Query  1344  NKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVD  1523
             ++I +N + CFSN+VGP+E++ F+GHP+A++AP+ YGQP ALM++FQSY +KM +++SVD
Sbjct  413   HRIITNTTMCFSNLVGPQEEIGFYGHPMAYLAPSSYGQPHALMINFQSYTNKMTIVLSVD  472

Query  1524  ENVIPDPNQLLDDFEKSLHLIKD  1592
             E++IPDP QLLDD E+SL LIKD
Sbjct  473   ESMIPDPYQLLDDLEQSLKLIKD  495



>ref|XP_009615146.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=523

 Score =   534 bits (1375),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 265/505 (52%), Positives = 362/505 (72%), Gaps = 21/505 (4%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LKPI+T K+K+  E + + +  EP+SP++RL H+P FN+H++AIM   ++I+PH     +
Sbjct  18    LKPIDT-KRKAIEEYDMVPVETEPLSPTARLFHDPNFNVHVVAIMATKTRISPHPVKEKL  76

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
              HTLLKHPRFTSL+VVD+  +  MKWV+T+VDL QH+ V+E  E ++        ++KFV
Sbjct  77    EHTLLKHPRFTSLLVVDENNSAGMKWVQTKVDLEQHVIVLEVDEGQLT-----ESSEKFV  131

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             EDY+Y LSK  +D S+PLWDLHI+N+KT DAE++A+LR+HH+LGDG S+ SLLLACTRQT
Sbjct  132   EDYIYNLSKTNLDKSKPLWDLHIINVKTGDAESVALLRVHHSLGDGTSLISLLLACTRQT  191

Query  648   ANPKLLPTISTRS--------SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             A+   LPTI T+         S   ++ K      K   F  ++ NT+VD+ +FIAT+ F
Sbjct  192   ADHLKLPTIPTKKRRPTPSGYSEKERSFKLWQYLGKFWLFINMILNTMVDLLMFIATVIF  251

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
              KD++TP+   P S S  +R  +RI++L+D   +K A N TINDVALG+TQA LS YLNR
Sbjct  252   FKDTKTPMAAPPNSASNGRRIVHRIINLDDLKLVKNAMNVTINDVALGITQAGLSKYLNR  311

Query  984   RY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             RY  GK D G+ E  NNLPK++RLRSCL  NLRP+ GI+ LADM   EKG   +  K GW
Sbjct  312   RYAVGKEDKGATERNNNLPKDIRLRSCLIINLRPSAGIEDLADMT--EKG---TKQKGGW  366

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
             GN FGY +LP KI + +DPLDYV+EAKAT DRKK ++E +FT  LA  ++K FG K A +
Sbjct  367   GNWFGYVLLPFKIALRDDPLDYVKEAKATVDRKKRTFEALFTLMLAELLVKIFGAKVATL  426

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             +T + FS+ + CF+N+VGP+E++ F G+PI ++AP  YGQPSALM++ QSY++KM +++S
Sbjct  427   VTVRAFSHTTVCFTNLVGPQEEIGFCGNPITYLAPGSYGQPSALMINIQSYINKMIIVVS  486

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VDE+ IPDP QLLDDFE S +LI+D
Sbjct  487   VDESAIPDPQQLLDDFETSFNLIRD  511



>ref|XP_006362139.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=522

 Score =   532 bits (1371),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 272/508 (54%), Positives = 357/508 (70%), Gaps = 24/508 (5%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNM-SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
              LKPIET K+K G+E  +M ++ +EP+SP +RL H+  F++H +A M   ++I+P     
Sbjct  15    GLKPIET-KRKGGIEEYDMVTVEDEPLSPMARLFHDRRFDVHAIAFMACKTRISPQPVKE  73

Query  282   NMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKK  461
              + HTLLKHPRFTSLMVVD+E    MKWV+T++DL QHI +VE  E ++E  +      K
Sbjct  74    KLVHTLLKHPRFTSLMVVDEENLTDMKWVQTKIDLDQHIIIVEVDETQMESPD------K  127

Query  462   FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTR  641
             FVEDY+Y LSK  +D S+PLWDLHI+N+KTR AE++ V R+HH+LGDG S+ SLLLACTR
Sbjct  128   FVEDYIYNLSKTSLDRSKPLWDLHIINVKTRQAESVVVFRVHHSLGDGTSLISLLLACTR  187

Query  642   QTANPKLLPTISTRSSSppktlkpnnpkpkpk-nffklVW-------NTLVDVFIFIATL  797
             QTA+   LPTI T+   P           +         W       NT VDVF+FI T+
Sbjct  188   QTADDLKLPTIPTKKRRPRPNYLRGYSAKEGLWRLLGKFWLFMVMLVNTAVDVFMFIITI  247

Query  798   FFLKDSQTPITPSPASES-KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
              FLKD++TPI+  P  ES K +R  +RI+SL+D   +K A N TINDVALG+TQA LS Y
Sbjct  248   MFLKDTKTPISAPPDFESNKARRIVHRIISLDDLKFVKNAMNVTINDVALGLTQAGLSQY  307

Query  975   LNRRY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRY  G +D G+ E  NNLP  +RLRSCL FNLR + GI+ LA+MM     E+ S  K
Sbjct  308   LNRRYAIGGKDKGATERSNNLPNGIRLRSCLCFNLRSSAGIEDLANMM-----ENGSKGK  362

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
              GWGN FGYA+LP KI + ++PLDYV+EAKAT DRKK S+E + T  +A  +IKFFG K 
Sbjct  363   RGWGNWFGYALLPFKIALRDNPLDYVKEAKATVDRKKRSFEALSTLIMAELLIKFFGIKV  422

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             A  +T K FSN++ CF+N+VGP+E++ F G+PI + AP+ YGQPSALM++FQSY++KM +
Sbjct  423   ATEVTCKGFSNSTICFTNLVGPQEEIGFCGYPITYFAPSAYGQPSALMINFQSYINKMII  482

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++SVDEN IPDP+QLLDDFE SL+LIK+
Sbjct  483   VVSVDENAIPDPHQLLDDFEDSLNLIKN  510



>ref|XP_006345292.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=655

 Score =   535 bits (1378),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 272/505 (54%), Positives = 362/505 (72%), Gaps = 26/505 (5%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINP-HVFTH  281
             +LKPIE + + S       S  EE +SPSSRL HEP FN+H+LAIMG  S+IN   +   
Sbjct  10    SLKPIECKGKAS-----KASEEEEQLSPSSRLFHEPNFNVHVLAIMGSKSRINDLQLIKD  64

Query  282   NMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKK  461
             N+ HTLLKHPRF+SL VVD+++NG+MKWV+T+VDL +HI V   P+V+ +    H   +K
Sbjct  65    NLVHTLLKHPRFSSLQVVDEKKNGEMKWVQTKVDLDKHIIV---PQVDEQN--LHESPEK  119

Query  462   FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTR  641
             FVE+Y+  LSK  +D S+P+WDLH+LN+KT DAE++ + R+HH+LGDG S+ SLLLACTR
Sbjct  120   FVENYIRNLSKTTLDKSKPMWDLHLLNVKTTDAESVGIFRIHHSLGDGTSLISLLLACTR  179

Query  642   QTANPKLLPTIS------TRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             QTA+P  +PTI         SS+   T        K   F KL WNT+VDV +F+AT+ F
Sbjct  180   QTADPDKVPTIPGNKKRVIHSSAHNSTKGLRRYVMKIWFFMKLFWNTVVDVLMFMATIMF  239

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             LKD+ TPI  +P S   P+R  YRI+SL+D   +K A N T+ DVALGVTQA LS+YLNR
Sbjct  240   LKDTTTPIKGTPGSVFNPRRLVYRIVSLDDMKLVKNALNMTVTDVALGVTQAGLSVYLNR  299

Query  984   RYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             RYG  K+D G+IE  NNLPKN+RLRS +  NLRP+ GIQALADMM+K+       ++  W
Sbjct  300   RYGEGKKDKGAIEKNNNLPKNIRLRSSILVNLRPSVGIQALADMMEKD-------TEAKW  352

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
             GN  G+A+LP KI + +DPLDY+REAKAT  RKK S E  +T Y++   +KFFG K ++ 
Sbjct  353   GNWVGFALLPFKIALRHDPLDYIREAKATIHRKKNSLEAFYTCYISELALKFFGIKTSSS  412

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             ++++IF+N S CFS + GP+E++ F+GHP+A++AP  YGQP ALM++ QSY+DKM +++S
Sbjct  413   ISHRIFTNTSMCFSCLPGPQEEIGFYGHPMAYLAPGSYGQPQALMINCQSYIDKMTIVLS  472

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VDE+VIPDP QLLDD E+SL LIKD
Sbjct  473   VDESVIPDPYQLLDDLEQSLKLIKD  497



>ref|XP_009625686.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=487

 Score =   529 bits (1362),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 258/484 (53%), Positives = 344/484 (71%), Gaps = 22/484 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SPS+RL HEP FN+H+L+IMG  S+INP V    + HT +KHPRF+SL VVD++ N
Sbjct  6     EEPLSPSARLFHEPNFNVHVLSIMGSKSRINPQVIKEQLVHTFVKHPRFSSLQVVDEKNN  65

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G+MKWV T+VD+ +H+ V +  E  ++         KFV++Y++ LSK  +D S+PLWDL
Sbjct  66    GEMKWVRTKVDVEKHVVVPQVDEQNLQ-----ESPDKFVDNYIHNLSKTTLDKSKPLWDL  120

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+LN+KT DAEA+AVLR+HH+LGDG S  SLLLACTRQTA+P  LPTI      P  +  
Sbjct  121   HLLNVKTSDAEAVAVLRIHHSLGDGTSFMSLLLACTRQTAHPNKLPTIPGNKKRPINSSD  180

Query  711   pnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
               +       +   VW       NT+VDV +F+AT  FLKD+ TPI   P SE  P+R A
Sbjct  181   QYSTSKGLWPYVAKVWSFMRLFWNTIVDVLMFMATTVFLKDTNTPIKGRPGSEFNPRRLA  240

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG--KRDIGSIEGQNNLPKNL  1043
             +R +SL+D   +K   N TINDVA+GVTQA LS+YLNRRYG  K+D G+ E  NNLPKN+
Sbjct  241   HRTISLDDLKLVKNTLNMTINDVAVGVTQAGLSIYLNRRYGEGKKDKGATEKNNNLPKNI  300

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLRS L  NLR   GIQALADMM K+       ++  WGN  GY +LP KI + +DPLDY
Sbjct  301   RLRSTLLINLRSRTGIQALADMMAKD-------TEAKWGNCVGYVLLPFKIALRDDPLDY  353

Query  1224  VREAKATADRKKY-SYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             +RE KAT DRKK  S E I T+ ++   +K FG KA++ ++++I +N + CFSN+VGP+E
Sbjct  354   IREVKATIDRKKKNSLEAICTFSISKLALKLFGIKASSTISHRILTNTTLCFSNLVGPQE  413

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F+GHP+A++AP+ YGQP ALM++FQSY++KM +++S DE+VIPDP+QLLDDFE+SL 
Sbjct  414   EIGFYGHPMAYLAPSSYGQPHALMINFQSYINKMTIVLSADESVIPDPHQLLDDFEQSLK  473

Query  1581  LIKD  1592
             LIKD
Sbjct  474   LIKD  477



>ref|XP_004248081.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=515

 Score =   525 bits (1352),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 355/505 (70%), Gaps = 21/505 (4%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNM-SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
              LK IET K K G+E  +M ++ +EP+SP +RL H+  F++H +A M   ++I+P     
Sbjct  15    GLKAIET-KMKGGIEEYDMVTVEDEPLSPMARLFHDRRFDVHAVAFMASKTRISPQPVKE  73

Query  282   NMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKK  461
              + HTLLKHPRFTSLMVVD+E    MKWV+T++DL QHI +VE  E ++   +      K
Sbjct  74    KLVHTLLKHPRFTSLMVVDEENLIDMKWVQTKIDLDQHIIIVEVDETQLVSPD------K  127

Query  462   FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTR  641
             FVEDY+Y LSK  +D S+PLWDLHI+N+KTR AE++ V R+HH+LGDG S+ SLLLACTR
Sbjct  128   FVEDYIYNLSKTSLDRSKPLWDLHIINVKTRQAESVVVFRVHHSLGDGTSLISLLLACTR  187

Query  642   QTANPKLLPTISTRS-----SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFL  806
             QTA+   LPTI T+      S             K   F  +V NT +DV++FI T+ FL
Sbjct  188   QTADNLKLPTIPTKKRRPTPSGYSTKEGLWRLWGKIWLFMVMVVNTTIDVYMFIITIMFL  247

Query  807   KDSQTPITPSPASES-KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             KD++TPI+  P  ES K +R  +RI+SL+D   +K A N TINDVALG+TQA LS YLNR
Sbjct  248   KDTKTPISAPPDYESNKARRIVHRIISLDDLKFVKNAMNVTINDVALGLTQAGLSKYLNR  307

Query  984   RY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             RY  G +D G+ E  NNLP  +RLRSCL FNLR + GI+ LA+MM     E+ S  K GW
Sbjct  308   RYAIGGKDKGATERNNNLPNGIRLRSCLCFNLRSSAGIEDLANMM-----ENGSKGKRGW  362

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
             GN FGYA+LP KI + ++PLDYV+EAKAT DRKK S+E + T  +A  +IKF G K A  
Sbjct  363   GNWFGYALLPFKIALRDNPLDYVKEAKATVDRKKRSFEALSTLIMAQLLIKFLGIKVATE  422

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             +T K FSN++ CF+N+VGP+E++ F G+PI + AP+ YGQPSALM++FQSY++KM +++S
Sbjct  423   VTCKGFSNSTICFTNLVGPQEEIGFCGYPITYFAPSAYGQPSALMINFQSYINKMIIVVS  482

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VDEN IPDP+QLLDDFE SL+LIK+
Sbjct  483   VDENAIPDPHQLLDDFEDSLNLIKN  507



>ref|XP_008233155.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=523

 Score =   521 bits (1343),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 268/529 (51%), Positives = 359/529 (68%), Gaps = 43/529 (8%)
 Frame = +3

Query  90    MEMERNLK-----PIETRKQK-----------SGMENNN-----MSIAEEPVSPSSRLLH  206
             ME E  ++     PI+T++ K           +G++  N     M++ EEP+SP++RL H
Sbjct  1     METEEGVRLRKPAPIKTKRAKEQEEGRRDGGVAGVDIRNCNKEMMNVEEEPLSPAARLFH  60

Query  207   EPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDL  386
             EP FNLHI+AIMG  ++I P VF  N+PHTLL+HPRF+SL+VVD++  GKMKWV TEVDL
Sbjct  61    EPNFNLHIVAIMGGKTRIYPDVFKANLPHTLLRHPRFSSLLVVDEKNGGKMKWVRTEVDL  120

Query  387   SQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEA  566
              +HI +   P++    D       +FVEDY+Y LSK  +D S+PLWDLH+LNLKT +AE 
Sbjct  121   DKHIII---PDL----DPNTESPDQFVEDYIYNLSKTTIDKSKPLWDLHLLNLKTSEAEG  173

Query  567   LAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknff  746
               + R+HH+LGDG S+ SLLLACTRQ +NP+ LPTI             N          
Sbjct  174   TGIFRVHHSLGDGTSLMSLLLACTRQISNPEALPTIPVNKKKDDDKRVFNRGFWWCIFGA  233

Query  747   klV----WNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLA  914
               V    WNT VDVF+F+ T   L+D++TP+   P SE  P+RF Y+ LSL+D   IK A
Sbjct  234   WWVLKLFWNTFVDVFMFMLTALCLEDTKTPLKGPPGSEFNPRRFVYQTLSLDDMKLIKNA  293

Query  915   TNTTINDVALGVTQAALSMYLNRRYG---KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAK  1085
              N TINDVALGVTQA LS YLNRRYG    +D G+ E +NNLP+ +RLRS L  N+RPA 
Sbjct  294   MNLTINDVALGVTQAGLSRYLNRRYGDDENKDSGA-EKKNNLPEKIRLRSTLLINIRPAA  352

Query  1086  GIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYS  1265
             GIQALADMM+K     N+ +KWG  N  GY +LP  I + +DPLDY+REAK T DRKK+S
Sbjct  353   GIQALADMMEK-----NTEAKWG--NWIGYVLLPFTIALRDDPLDYIREAKTTIDRKKHS  405

Query  1266  YEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPT  1445
              E I+T+ +A  V+K FG K A+ L++++ S+ + CFSN+VGP E++ F+GHP+AF+AP+
Sbjct  406   LEAIYTFSIAELVLKLFGIKRASALSHRVISHTTMCFSNLVGPLEEIGFYGHPMAFLAPS  465

Query  1446  CYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              YGQP ALM++FQSY++KM +++SVDE  IPDP+ L DD  +SL+L+K+
Sbjct  466   SYGQPHALMINFQSYINKMTIVLSVDEETIPDPHLLCDDIVQSLNLVKE  514



>ref|XP_004228362.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=506

 Score =   520 bits (1340),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 358/506 (71%), Gaps = 30/506 (6%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHN  284
             +LKPIET+      E  N S  EEP+SPSSRL HEP FN+H+LAI+G  ++IN      +
Sbjct  11    SLKPIETKD-----EAINES-EEEPLSPSSRLFHEPNFNVHVLAILGMKTRINTEQAPRD  64

Query  285   -MPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK-  458
              + +TLLKHPRF+SL VVD+++ G+M+WV TEVD+ QHI V   P++    DE + K   
Sbjct  65    HLANTLLKHPRFSSLQVVDEKKGGEMRWVRTEVDIDQHIIV---PQI----DEQNLKESP  117

Query  459   -KFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLAC  635
              KFVE+Y++ LSK  +D S+P+WDLH+LN+KT DAEA+A+LR+HH+LGDG S+ SLLLAC
Sbjct  118   DKFVENYIHNLSKTTLDKSKPMWDLHLLNIKTSDAEAVAILRIHHSLGDGTSLISLLLAC  177

Query  636   TRQTANPKLLPTISTRSS-----SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLF  800
             TRQTA+P  +PTI          S   T   +    K  +F KL W T+VDV +F+AT  
Sbjct  178   TRQTADPAKVPTIPRTKKRLIDPSEHSTKGLHRYVTKTWSFMKLFWYTIVDVLMFMATTM  237

Query  801   FLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             FLKD+ TPI   P SES P+R  YR +SL+D   +K A N T+ DVALGVTQA LSMYLN
Sbjct  238   FLKDTTTPIKGRPGSESNPRRVVYRTVSLDDIKVVKNALNMTVTDVALGVTQAGLSMYLN  297

Query  981   RRYGK--RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWG  1154
             RRYG+  +D G  E  NNLPKN+RLRS +  NLRPA GIQALADMM+K+       ++  
Sbjct  298   RRYGEGEKDRGKTEKNNNLPKNIRLRSTILMNLRPAVGIQALADMMEKD-------TEAK  350

Query  1155  WGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAA  1334
             WGN  G+ + PLKI + +DPLDY+REAKAT DRKK S E  +T+ ++   +KFFG K ++
Sbjct  351   WGNWIGFVLFPLKIALRDDPLDYIREAKATIDRKKNSLEAFYTFSISELALKFFGIKTSS  410

Query  1335  ILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVII  1514
             +++++  +N + CFS + GP+E++ F+GHP+A+IAP  YGQP ALM++ QSYV+KM +++
Sbjct  411   LISHRTITNTTMCFSCLPGPQEEICFYGHPLAYIAPGSYGQPHALMINCQSYVNKMTIVL  470

Query  1515  SVDENVIPDPNQLLDDFEKSLHLIKD  1592
             SVDE+VIPDP+QLLDD   SL LIKD
Sbjct  471   SVDESVIPDPHQLLDDLVLSLKLIKD  496



>ref|XP_007219258.1| hypothetical protein PRUPE_ppa018127mg [Prunus persica]
 gb|EMJ20457.1| hypothetical protein PRUPE_ppa018127mg [Prunus persica]
Length=522

 Score =   520 bits (1340),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 342/485 (71%), Gaps = 22/485 (5%)
 Frame = +3

Query  159   MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD  338
             M++ EEP+SP++RL HEP FNLHI+AIMG  ++I P V   N+PHTLL+HPRF+SL+VVD
Sbjct  44    MNVEEEPLSPAARLFHEPNFNLHIVAIMGCKTRIYPEVCKANLPHTLLRHPRFSSLLVVD  103

Query  339   KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
             ++  GKMKWV TEVDL +HI +   P++    D       +FVEDY+Y LSK  +D S+P
Sbjct  104   EKNEGKMKWVRTEVDLDKHIII---PDL----DPNMESPDQFVEDYIYNLSKTTIDKSKP  156

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSpp  698
             LWDLH+LNLKT +AE   + R+HH+LGDG S+ SLLLACTRQ +NP+ LPTI  +     
Sbjct  157   LWDLHLLNLKTSEAEGTGIFRVHHSLGDGTSLMSLLLACTRQISNPEALPTIPVKKKKND  216

Query  699   ktlkpnnpkpkpknffklV----WNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
                  N            V    WNT  DVF+F+ T   L+D++TP+   P SE  P+RF
Sbjct  217   DKRVFNRGFWWCIFGAWWVLKFFWNTFADVFMFMLTALCLEDTKTPLKGPPGSEFNPRRF  276

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG---KRDIGSIEGQNNLPK  1037
              YR LSL+D   IK A N TINDVALGVTQA LS YLNRRYG    +D G+ E +NNLP+
Sbjct  277   VYRTLSLDDMKLIKNAMNLTINDVALGVTQAGLSRYLNRRYGDNENKDSGA-EKKNNLPE  335

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLRS L  N+RPA GIQALADMM+K     N+ +KWG  N  GY +LP  I + +DPL
Sbjct  336   KIRLRSTLLINIRPAAGIQALADMMEK-----NTEAKWG--NWIGYVLLPFTIALRDDPL  388

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             DY+REAK T DRKK+S E I+T+ +A  V+KFFG K A+ L+++I S+ + CFSN+VGP 
Sbjct  389   DYIREAKTTIDRKKHSLEAIYTFSIAELVLKFFGIKRASALSHRIISHTTMCFSNLVGPL  448

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F+GHP+AF+AP+ YGQP AL+++FQSY++KM +++SVDE  IPDP+ L DD  +SL
Sbjct  449   EEIGFYGHPMAFLAPSSYGQPHALVINFQSYINKMTIVLSVDEETIPDPHLLCDDIVQSL  508

Query  1578  HLIKD  1592
             ++IK+
Sbjct  509   NVIKE  513



>ref|XP_009793216.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=524

 Score =   518 bits (1333),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 260/505 (51%), Positives = 353/505 (70%), Gaps = 21/505 (4%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LKPI+T + K+  E   + +  EP+SP++ L H+P FN+H++AIM   ++I+P      +
Sbjct  18    LKPIDTER-KAIEEYEMVPVETEPLSPTACLFHDPTFNVHVVAIMAAKTRISPQPVKEKL  76

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
               TLLKHPRFTSL+VVDK  +  +KWV+T+VDL QH+ V+E  E ++         +KFV
Sbjct  77    ELTLLKHPRFTSLLVVDKNNSADIKWVQTKVDLEQHVIVLEVDESQLT-----ESPEKFV  131

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             EDY+Y LSK  +D S+PLWDLHI+N+KTRDAE++A LR+HH+LGDG S+ SLLLACTRQT
Sbjct  132   EDYIYNLSKTNLDKSKPLWDLHIINVKTRDAESVAFLRVHHSLGDGTSLISLLLACTRQT  191

Query  648   ANPKLLPTISTRS--------SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             A+   LPTI T+         S    + +      K   F  ++ NT+VD+ +FIAT+ F
Sbjct  192   ADDLKLPTIPTKKRRTTPSGYSEKEGSFRLWQYFGKFWLFINMILNTIVDLLMFIATVIF  251

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
              KD++TP+   P S S  +R  +RI++L+D   +K A N TINDVALG+TQA LS YLNR
Sbjct  252   FKDTKTPMAAPPNSASNGRRIVHRIINLDDLKLVKNAMNVTINDVALGITQAGLSKYLNR  311

Query  984   RY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             RY  GK D G+ E  NNLPK++RLRSCL  NLRP+ GI+ LA MM  EKG   +  K GW
Sbjct  312   RYAVGKEDKGANERNNNLPKDIRLRSCLIINLRPSAGIEDLAAMM--EKG---TKQKGGW  366

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
             GN FGY +LP KI + +DPLDYV+EAKAT DRKK ++E + T  LA  ++K FG K A  
Sbjct  367   GNWFGYVLLPFKIALRDDPLDYVKEAKATVDRKKRTFEALITMMLAEVLVKLFGAKVATP  426

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             +T + FS+ + CF+N+VGP+E++ F G+PI ++AP  YGQPSALM++ QSY++KM +++S
Sbjct  427   VTVRAFSHTTVCFTNLVGPQEEIGFCGNPITYLAPGAYGQPSALMINIQSYINKMIIVVS  486

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VDE+ IPDP QLLDDFE S +LI+D
Sbjct  487   VDESAIPDPQQLLDDFETSFNLIRD  511



>ref|XP_007051549.1| O-acyltransferase family protein, putative [Theobroma cacao]
 gb|EOX95706.1| O-acyltransferase family protein, putative [Theobroma cacao]
Length=510

 Score =   511 bits (1315),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 260/507 (51%), Positives = 349/507 (69%), Gaps = 24/507 (5%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIA-----EEPVSPSSRLLHEPAFNLHILAIMGFNSKIN  263
             ++ LKPIET+    G E N  S       EEP+SPS+RL HEP FN++I+A +G  ++I 
Sbjct  11    KQGLKPIETKTGSKGEEENKSSSGQRTAEEEPLSPSARLFHEPNFNVYIIATLGCKTRIY  70

Query  264   PHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDET  443
             P V   N+ HTLLKHPRF+SL V D++  G+MKWV TEVDL +H+ V   P+++   D  
Sbjct  71    PDVVKANLGHTLLKHPRFSSLQVEDEDNKGEMKWVRTEVDLERHVVV---PDLDPNMDLP  127

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  KF+EDY+Y LSK  +D S+PLWDLH+LNL+T  +EA+ V R+HH+LGDG S+ SL
Sbjct  128   ----DKFLEDYIYNLSKTTIDKSQPLWDLHLLNLRTSQSEAVGVFRIHHSLGDGTSLMSL  183

Query  624   LLACTRQTANPKLLPTISTRSSSppktlkpn--npkpkpknffklVWNTLVDVFIFIATL  797
             LLACTRQ  +P  LPTI  R     K  +           + F++ WN++VDVF+F+AT 
Sbjct  184   LLACTRQMNDPLALPTIPIRKKQERKNDRRGFWRIMFMLCSVFQVFWNSVVDVFMFMATA  243

Query  798   FFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
               LKD++ P    P  E  P+R  Y  +SL+D   +K A NTT+NDVALG+TQA LS Y+
Sbjct  244   LLLKDTENPFKGLPGVEFTPRRIVYGTVSLDDIKLVKNAMNTTVNDVALGITQAGLSRYI  303

Query  978   NRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             NR YG  K D  +IE  +NLPK++RLRS L  N+RP+ GIQALADMM+K+       ++ 
Sbjct  304   NRIYGGNKNDGAAIE-MDNLPKSIRLRSTLLVNIRPSAGIQALADMMEKD-------AEA  355

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  GY +LP  I + +DPLDYVR+AKAT DRKK S E I+T+ +A  V+K FG KAA
Sbjct  356   KWGNWIGYVLLPFTIAIRDDPLDYVRDAKATIDRKKRSLEAIYTFSIAELVLKLFGVKAA  415

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             + L+++I S+ + CFSN+VGP E++ F+GHPIAF+AP+ YGQP ALM++FQSY+DKM ++
Sbjct  416   SALSHRIMSHTTMCFSNLVGPLEEIGFYGHPIAFLAPSSYGQPHALMINFQSYIDKMTIV  475

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +SVDE  IP+P+QL DD  +SL LIKD
Sbjct  476   LSVDEGTIPNPHQLCDDIVESLGLIKD  502



>gb|KDP28488.1| hypothetical protein JCGZ_14259 [Jatropha curcas]
Length=523

 Score =   510 bits (1313),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 255/510 (50%), Positives = 349/510 (68%), Gaps = 27/510 (5%)
 Frame = +3

Query  105   NLKPIETRKQK--SGMENNNMSIA---EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             NLKPIET +     G E N+       EE +SP +RL HEP FN++I+AIMG  + I PH
Sbjct  16    NLKPIETERSAVGKGKEVNHYKDGDGEEEALSPVARLFHEPNFNVYIIAIMGCKTPIKPH  75

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHR  449
             +   N+ HTLLKHPRF+SL+VV+ + + +MKWV T+VDL +H+ + +  E+ ++  +   
Sbjct  76    IIKANLVHTLLKHPRFSSLLVVEDKNSKEMKWVRTKVDLDKHVIIPKLDEITIDSPD---  132

Query  450   KNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLL  629
                KFVEDY+  LSK  +  S+PLWD+H+LN+KT DAE++ VLR+HH+LGDG S+ SLLL
Sbjct  133   ---KFVEDYISNLSKTTISKSQPLWDVHLLNIKTADAESIGVLRIHHSLGDGTSLMSLLL  189

Query  630   ACTRQTANPKLLPTIST------RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIA  791
             ACTRQ +NP+ LPTI T      +        K            KL WN++VD F+F+A
Sbjct  190   ACTRQISNPEALPTIPTTIRNKKQEQETDFKGKLWRYVMAVLWAIKLFWNSIVDAFMFLA  249

Query  792   TLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSM  971
             T  FLKD+ TP+   P  E  P+RF +R +SL DF  +K A NTTINDVALGVTQA LS+
Sbjct  250   TTAFLKDTDTPLKGPPGVEFTPRRFVWRTVSLEDFKLVKNALNTTINDVALGVTQAGLSL  309

Query  972   YLNRRYGK---RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
             YL+R+Y +    D  + + +NNLPKN+RLR+ L  N+RPA GIQALADMM+K+       
Sbjct  310   YLSRKYDEIRNNDKEATQMKNNLPKNIRLRATLLVNIRPATGIQALADMMEKD-------  362

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
             +K  WGN  GY +LP KI + +DPLDYV EAKA ADRKK+S E IFT+ ++  V+K FG 
Sbjct  363   TKAKWGNWLGYVLLPFKIAIRDDPLDYVLEAKAIADRKKHSLESIFTFSISELVLKLFGT  422

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKM  1502
             K A  L+++   + + CFSN+ GP+E++ F+GHP+AF+AP+ + QP ALM++FQSY DKM
Sbjct  423   KTANALSHRSIDHTTMCFSNLAGPQEEIGFYGHPLAFLAPSSFNQPHALMINFQSYADKM  482

Query  1503  GVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              +++SVDE+ IPDP+QL+ D  +S+ LIKD
Sbjct  483   SIVLSVDESTIPDPHQLIHDIVESIKLIKD  512



>ref|XP_009760466.1| PREDICTED: LOW QUALITY PROTEIN: O-acyltransferase WSD1-like [Nicotiana 
sylvestris]
Length=512

 Score =   508 bits (1308),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 259/516 (50%), Positives = 353/516 (68%), Gaps = 43/516 (8%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHN  284
             +LKPI+T  +        +++ EEP+SPS+RL  EP FN+H+L+IMG  S+IN  V    
Sbjct  10    SLKPIQTEPK--------LAMEEEPLSPSARLFQEPNFNVHVLSIMGSKSRINRQVIKEQ  61

Query  285   MPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
             + HT +KHPRF+SL VVD+++  ++KWV T+VD+ +H+ V +  E  ++         KF
Sbjct  62    LVHTFVKHPRFSSLQVVDEKKIXEIKWVRTKVDVEKHVVVPKVDEQNLQ-----ESPDKF  116

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y++ LSK  +D S+PLWDLH+LN+KT DAEA+A+LR+HH+LGDG S  SLLLACTRQ
Sbjct  117   VENYIHNLSKTTLDKSKPLWDLHLLNVKTSDAEAVAILRIHHSLGDGTSFMSLLLACTRQ  176

Query  645   TANPKLLPTISTRSSSppktlkpnnpkpkpknffklVW--------NTLVDVFIFIATLF  800
             TA+P  LPTI      P  +    +       +   VW        NT+VDV +F+AT  
Sbjct  177   TADPDKLPTIPGNKKRPINSSDQYSTSKGLWPYVAKVWSFMRLFWKNTIVDVLMFMATTV  236

Query  801   FLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNT--------TINDVALGVTQ  956
             FLKD+ TPI   P SE  P+R A+R +SL+D   +KL  NT        TINDVA+GVTQ
Sbjct  237   FLKDTNTPIKGKPGSEFNPRRLAHRTISLDD---LKLVKNTLNMLHIFLTINDVAVGVTQ  293

Query  957   AALSMYLNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGE  1130
             A LS+YLNRRYG  K+D G+ E  +NLPKN+RLRS L  NLRP  GIQALADMM K+   
Sbjct  294   AGLSIYLNRRYGEDKKDKGATEKNSNLPKNIRLRSTLLINLRPRTGIQALADMMAKD---  350

Query  1131  SNSMSKWGWGNRFGYAILPLKIGMLNDPLDY-VREAKATADRKKY-SYEPIFTYYLANFV  1304
                 ++  WGN  G+ +LP KI + +DPLDY +R+ K   DRKK  S E I T+ ++   
Sbjct  351   ----TEAKWGNCVGFVLLPFKIALRDDPLDYYIRQVKTIVDRKKKNSLEAICTFSISKLA  406

Query  1305  IKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQ  1484
             +KFFG K ++ +++KI +N + CFSN+VGP+E++ F+GHPIA++AP+ YGQP ALM++FQ
Sbjct  407   LKFFGIKTSSTISHKILTNTTLCFSNLVGPQEEIGFYGHPIAYLAPSSYGQPHALMINFQ  466

Query  1485  SYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             SY++KM +++SVDE+VIPDPNQLLDD E+SL LIKD
Sbjct  467   SYINKMTIVLSVDESVIPDPNQLLDDLEQSLKLIKD  502



>gb|KHG19161.1| O-acyltransferase WSD1 -like protein [Gossypium arboreum]
Length=509

 Score =   505 bits (1300),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 260/509 (51%), Positives = 347/509 (68%), Gaps = 29/509 (6%)
 Frame = +3

Query  99    ERNLKPIET-------RKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSK  257
             ++ LKPIET       R ++    N   +  EEP+SPSSRL HEP FN++++AIMG  +K
Sbjct  11    KQALKPIETARSSASQRDEEVSKNNGQRTCEEEPLSPSSRLYHEPNFNVYVIAIMGCKTK  70

Query  258   INPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGD  437
             I P V   N+ H+LL+HPRF+SL V   E NG+M+WV TEVDL +H+ V   PE+    D
Sbjct  71    IYPDVVKANLGHSLLRHPRFSSLQV---ENNGEMRWVPTEVDLERHVIV---PEL----D  120

Query  438   ETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASIN  617
             +      KF+EDYVY LSK  +D S+PLWDLH+LNL+T ++EA+ + R+HH+LGDG S+ 
Sbjct  121   QNMDSPDKFLEDYVYNLSKTTIDKSQPLWDLHLLNLRTSESEAVGIFRIHHSLGDGTSLL  180

Query  618   SLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpkn--ffklVWNTLVDVFIFIA  791
             SLLLACTRQ  + K LPTI  R     K+ +    +   +     ++ WNT+VDVF+FIA
Sbjct  181   SLLLACTRQMKDSKALPTIPIRKKKDKKSDRIGIWRILLRFWFVLQVFWNTVVDVFMFIA  240

Query  792   TLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSM  971
             T  FL D+Q P+   P SES P+R  YR +SL+D   +K A NTTINDVA G+TQA LS 
Sbjct  241   TALFLTDTQNPLKGLPGSESTPRRIVYRTVSLDDIKFVKNAMNTTINDVAFGMTQAGLSR  300

Query  972   YLNR--RYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMS  1145
             Y+NR     K+D G+ E  NNLPK++RLRS L  N+RPA GIQALADMM+K+       +
Sbjct  301   YINRICSENKKDGGATE-TNNLPKSIRLRSNLLVNIRPAPGIQALADMMEKD-------A  352

Query  1146  KWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
             +  WGN  GY +LP  I +  DPLDYVR AKA  DRKK S E   T+Y+A++ +  FG K
Sbjct  353   EVKWGNWIGYVLLPFTIAVREDPLDYVRNAKAIIDRKKRSLEAFCTFYIADWALNLFGIK  412

Query  1326  AAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMG  1505
             AA+ L++K+ S  + CFSN+VGP E++ F GHP+AF+AP+ YGQP ALM++FQSY+DKM 
Sbjct  413   AASALSHKVISRTTMCFSNMVGPVEEIGFCGHPMAFLAPSSYGQPYALMINFQSYIDKMT  472

Query  1506  VIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +++SVDE  IP+P+QL DD  +SL +IKD
Sbjct  473   IVLSVDEGTIPNPHQLCDDIVESLQVIKD  501



>emb|CDP08677.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   504 bits (1299),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 264/508 (52%), Positives = 354/508 (70%), Gaps = 34/508 (7%)
 Frame = +3

Query  105   NLKPIETRKQKSGME---NNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVF  275
              LKPI+T+++   +E   N NM   EEP+SPS+RL HEP FN+H+  I+G  + ++P V 
Sbjct  14    GLKPIKTKRKSKEVEADTNKNMVEEEEPLSPSARLFHEPNFNVHVTTILGIKTPLSPQVI  73

Query  276   THNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKN  455
                + H+L+KHPRF+SL VVD E+ G+MKWV T+VD+ QH+ V   P++    D      
Sbjct  74    KEKLMHSLVKHPRFSSLQVVD-EKAGEMKWVRTKVDIDQHVVV---PDL----DRNMGSP  125

Query  456   KKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLAC  635
              KFVEDYVY LSK  +D S+PLWDLH+LN+KT DA+ +AV+R+HH+LGDG S+ SLLLAC
Sbjct  126   DKFVEDYVYNLSKSSLDKSKPLWDLHVLNVKTSDAQGVAVVRIHHSLGDGTSLMSLLLAC  185

Query  636   TRQTANPKLLPTISTRS-------SSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT  794
             TRQ A+P  LPTI  ++       S   K             F +L+WNT+ D+ IF AT
Sbjct  186   TRQVADPDKLPTIPGQNKKTTNSFSGLSKPKFWKYYLIAVWLFIQLIWNTIRDIVIFGAT  245

Query  795   LFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
               FLKD++TPI   P SE  P+R  YRI+SL+D          TINDVALG+TQA LS Y
Sbjct  246   ALFLKDTKTPIKAPPCSELNPRRVVYRIVSLDDM-------KVTINDVALGITQAGLSRY  298

Query  975   LNRRY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRY  GK+D G  + +NNLPKN+RLRS +  NLRP+ GIQ LADMM+K+       ++
Sbjct  299   LNRRYAEGKKDEGETQKRNNLPKNIRLRSTILINLRPSAGIQVLADMMEKD-------AE  351

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGN  G+ +LP KI + +DPLDYVREAKAT DRKK S E ++T+ +A+ V+KFFG KA
Sbjct  352   AKWGNWIGFVLLPYKIALRDDPLDYVREAKATIDRKKNSLEAVYTFSIADLVLKFFGVKA  411

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             ++ L+++I +  + C SN+VGP+E++ F+GHPIA++A   YGQP ALM++FQSYV+KM +
Sbjct  412   SSDLSHRIITQTTMCISNIVGPQEEIGFYGHPIAYLASGSYGQPHALMINFQSYVNKMTM  471

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++SVDE+VIPDP+QLLDD + SL LIKD
Sbjct  472   VLSVDESVIPDPHQLLDDLQLSLQLIKD  499



>ref|XP_010095758.1| O-acyltransferase WSD1 [Morus notabilis]
 gb|EXB62178.1| O-acyltransferase WSD1 [Morus notabilis]
Length=508

 Score =   501 bits (1289),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 254/501 (51%), Positives = 341/501 (68%), Gaps = 21/501 (4%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LK IET+ +KS    ++    EEPVSP+ R+ HEP FN+H++AIMG   KI P V   N 
Sbjct  14    LKAIETKVKKSKGIIDHEGELEEPVSPAGRMFHEPNFNVHVIAIMGSKYKIQPDVAKANA  73

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
             P TLLKHPRF+SL+VVD E  GKMKWV TEVDL +H+ V   P++++   E+     KFV
Sbjct  74    PKTLLKHPRFSSLLVVDDE--GKMKWVRTEVDLDKHVIV---PDIDIPNIESP---DKFV  125

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             EDY+Y L+K  +D S+PLW++HILNLKT DAE + + R+HH+LGDG S+ SLLLACTRQ 
Sbjct  126   EDYIYNLTKTSLDKSKPLWEIHILNLKTSDAEGVGIFRIHHSLGDGTSLMSLLLACTRQV  185

Query  648   ANPKLLPTI---STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQ  818
             ANP  LPT+     +          +           L WNT+VDVF+F+AT  FLKD+ 
Sbjct  186   ANPDALPTLPKHKKKDEKGGFIRSFSQCFFGVWWLLGLFWNTMVDVFMFMATSLFLKDTA  245

Query  819   TPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR  998
             TPIT  P S   P+R  ++ +SL+D   +K A N TINDVA+G+TQA LS YLNRRYG++
Sbjct  246   TPITAPPDSVRNPRRIVHKTVSLDDMKLVKNAMNMTINDVAVGITQAGLSKYLNRRYGEK  305

Query  999   ---DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRF  1169
                D G+ E +NNLPKN+RLRS L  N+RP+ GIQ LADMM+K     N+ +KWG  N  
Sbjct  306   NNNDKGATESKNNLPKNIRLRSVLLINIRPSAGIQELADMMEK-----NAEAKWG--NWV  358

Query  1170  GYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNK  1349
             GY +LP  IG+ +DPL+Y+R AK T DRKK+S E + T  +AN +++  G K A+  +++
Sbjct  359   GYILLPFDIGLRDDPLEYIRRAKNTIDRKKHSLEVLATSAIANLLLRVLGIKRASAQSHR  418

Query  1350  IFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDEN  1529
             IFSN +  FSN+ GP E++  +GH + ++APT YGQP ALM++FQSYV++M +++SVDE 
Sbjct  419   IFSNTTFVFSNLTGPLEEIGIYGHELEYLAPTSYGQPHALMINFQSYVNRMTIVLSVDER  478

Query  1530  VIPDPNQLLDDFEKSLHLIKD  1592
             V PDP +L DD  +SL  +KD
Sbjct  479   VYPDPYKLCDDIAESLKQVKD  499



>ref|XP_002523348.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39064.1| conserved hypothetical protein [Ricinus communis]
Length=506

 Score =   500 bits (1287),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 254/505 (50%), Positives = 347/505 (69%), Gaps = 26/505 (5%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEE---PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVF  275
             +LKPIE  K    ++N+   IAEE   P+SP+SRL HEP FN++++A++G  +++ PH+ 
Sbjct  10    DLKPIEITK----VDNDREGIAEEEEEPLSPASRLFHEPNFNVYVIAVIGCKTQVQPHIV  65

Query  276   THNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKN  455
               N+ HTLLKHPRF+SL V D++ N +MKWV T+VDL +H+ V   PE+    D      
Sbjct  66    KANLEHTLLKHPRFSSLQVTDEKNNKEMKWVRTKVDLDKHVIV---PELNRSMDS---PA  119

Query  456   KKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLAC  635
              KF+EDY++ L+K  +  S+PLWDLH+LN+ T DAE++ V R+HH+LGDG S+ SLLLAC
Sbjct  120   DKFIEDYIFNLTKTTISKSQPLWDLHLLNISTSDAESIGVFRIHHSLGDGTSLMSLLLAC  179

Query  636   TRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklV----WNTLVDVFIFIATLFF  803
             TRQ ++P+ LPT+ T +    K  + N    +       V    WNT+VDV +F  T  F
Sbjct  180   TRQVSDPEALPTLPTMTKKKKKKQEENGKFWRYVMAVWWVIQLFWNTVVDVLMFTVTALF  239

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             L DS+TPI   P  E  P+R  +R +SL+D   +K A NTTINDVALGVTQA LS YLNR
Sbjct  240   LNDSETPIKGRPGVEFTPRRLIWRTVSLDDIKLVKNAMNTTINDVALGVTQAGLSQYLNR  299

Query  984   RYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             +YG  K+D  + + +NNLPKN+ LR+ L  N+RPA GIQALADMM+K     NS +KWG 
Sbjct  300   KYGGRKKDEETTQFRNNLPKNISLRATLLINIRPAPGIQALADMMEK-----NSEAKWG-  353

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
              N  GY + P  IG+ +DPLDY+REAKA ADRKK S E I+T+ +A  V+K FG K A  
Sbjct  354   -NWIGYVLFPFTIGIRDDPLDYIREAKAAADRKKQSLEAIYTFSIAEIVLKLFGTKVANA  412

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             L+++   + + CFS++VGP E++EF+GHPIAF+AP+ + QP ALM++FQSY +KM +++S
Sbjct  413   LSHRTIYHTTMCFSSLVGPPEEIEFYGHPIAFLAPSSFNQPHALMINFQSYANKMTIVLS  472

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VDE  I D +QL+DD  +SL LIKD
Sbjct  473   VDEGTISDSSQLMDDIVESLKLIKD  497



>ref|XP_009777803.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=531

 Score =   498 bits (1283),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 257/508 (51%), Positives = 349/508 (69%), Gaps = 22/508 (4%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LKPIET K+K+  E       EEP+SP++++  +P  N+H++AIM   ++I+P      +
Sbjct  14    LKPIET-KRKTIEELEMDVEEEEPLSPTAKMFLDPILNIHVMAIMFCKTRISPQPTKDKL  72

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
              HTLLKHPRFTS++VVD+E  G+MKWV+T+VDL+QHI + E  E ++E        +K++
Sbjct  73    VHTLLKHPRFTSVLVVDEENGGEMKWVQTKVDLNQHIIIPEVDESKLE----LLSPEKYI  128

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             EDYV+ L+K  +D S+PLW+ H+LN+KTRDAE +++ R HH+LGDG S+ SLLLACTRQT
Sbjct  129   EDYVHNLTKTNLDKSKPLWEFHLLNIKTRDAEGVSIFRAHHSLGDGTSLISLLLACTRQT  188

Query  648   ANPKLLPTIST---RSSSppktlkpnnpkpkpknffklVW-------NTLVDVFIFIATL  797
             A+   LPTI T   R +      +          +   VW       NT+VD+F+FIATL
Sbjct  189   ADELKLPTIPTKKRRPTYDSGKSEVEGGLLGLWGYVLAVWIFIKMIGNTIVDIFMFIATL  248

Query  798   FFLKDSQTPITPSPA-SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
              FLKD++TPI    A S+SK +R  +R +SL+D   +K A N T+NDVALG+TQA LS Y
Sbjct  249   VFLKDTETPINSLAADSKSKIRRIVHRTISLDDMKLVKNALNMTVNDVALGITQAGLSKY  308

Query  975   LNRRY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRY  GK D G  E  NNLP  +RLRSCL  NLR   GIQ LADMM+K          
Sbjct  309   LNRRYAVGKEDKGDTEENNNLPLGIRLRSCLMINLRSKPGIQDLADMMEKGSKGKWGGWG  368

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
                 N FG A+LP KI + +DPLDYV+EAKAT DRKK S+E ++T  +A  + K FG KA
Sbjct  369   ----NWFGCALLPFKIALHDDPLDYVKEAKATIDRKKNSFEALYTLVMAELLSKIFGIKA  424

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
              + +T ++FS+A+ CF+N+VGP+E++EF GHP+A+ APT YGQP+AL ++FQSY++KM +
Sbjct  425   VSAMTQRVFSSATICFTNLVGPQEEIEFCGHPLAYFAPTSYGQPNALTINFQSYINKMTI  484

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++S+DE+ IPDP QLLDDFE S+ LIKD
Sbjct  485   VLSLDESAIPDPQQLLDDFEDSMKLIKD  512



>ref|XP_009598600.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=531

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 257/508 (51%), Positives = 348/508 (69%), Gaps = 23/508 (5%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LKPIET K+K+  E       EEP+SP++++  +P  N+H++AIM   ++I+P      +
Sbjct  15    LKPIET-KRKTIEELEMEVEEEEPLSPTAKMFLDPILNIHVMAIMFCKTRISPQPTKDKL  73

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
              HTLLKHPRFTS++VVD+E  G+MKWV+T+VDL+QHI + E  E ++E        +K+V
Sbjct  74    VHTLLKHPRFTSVLVVDEENGGEMKWVQTKVDLNQHIIIPEIDESKLE-----LSPEKYV  128

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             EDYV+ L+K  +D S+PLW+ H+LN++TRDAEA+++ R HH+LGDG S+ SLLLACTRQT
Sbjct  129   EDYVHNLTKTSLDKSKPLWEFHLLNIRTRDAEAVSLFRAHHSLGDGTSLISLLLACTRQT  188

Query  648   ANPKLLPTIST---RSSSppktlkpnnpkpkpknffklVW-------NTLVDVFIFIATL  797
             A+   LPTI T   R +                 +   VW       NT+VDVF+ IATL
Sbjct  189   ADELKLPTIPTKKRRPTYDSGKANVQGGLLGLWGYVLAVWIFIRMIGNTIVDVFMVIATL  248

Query  798   FFLKDSQTPITPSPA-SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
              FLKD++TPI    A S+SK +R  +R +SL+D   +K A N T+NDVALG+TQA LS Y
Sbjct  249   VFLKDTETPINSLAADSKSKIRRIVHRTISLDDMKLVKNALNMTVNDVALGITQAGLSKY  308

Query  975   LNRRY--GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRY  GK D G  E  NNLP  +RLRSCL  NLR   GIQ LADMM+K          
Sbjct  309   LNRRYAVGKEDKGDTEENNNLPLGIRLRSCLMINLRSTPGIQDLADMMEKGSKGKWGGWG  368

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
                 N FG A+LP KI + +DPLDYV+EAKAT DRKK S+E ++T  +A  + K +G KA
Sbjct  369   ----NWFGCALLPFKIALRDDPLDYVKEAKATIDRKKNSFEALYTLVMAELLSKIYGIKA  424

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
              + +T ++FS+A+ CF+N+VGP+E++EF GHP+A+ APT YGQP+AL ++FQSY++KM +
Sbjct  425   VSGMTQRVFSSATICFTNLVGPQEEIEFCGHPLAYFAPTSYGQPNALTINFQSYINKMTI  484

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++S+DE+ IPDP QLLDDFE S+ LIKD
Sbjct  485   VLSIDESAIPDPQQLLDDFEDSMKLIKD  512



>ref|XP_006444839.1| hypothetical protein CICLE_v10019739mg [Citrus clementina]
 ref|XP_006491478.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
 gb|ESR58079.1| hypothetical protein CICLE_v10019739mg [Citrus clementina]
 gb|KDO86481.1| hypothetical protein CISIN_1g039244mg [Citrus sinensis]
Length=518

 Score =   495 bits (1274),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 254/504 (50%), Positives = 349/504 (69%), Gaps = 26/504 (5%)
 Frame = +3

Query  108   LKPIETRK---QKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             LKPIET+K   +  G E   ++  EEP+SP++RL HEP+FNL+I+AIMG  ++I P V  
Sbjct  19    LKPIETKKACKKNEGKEMEMVTREEEPLSPAARLFHEPSFNLYIIAIMGCKTRICPQVVK  78

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
              N+ HTLLKHPRF SL V D E    M+WV TEV++ +H+ V   PEV+   D   +  +
Sbjct  79    ANLVHTLLKHPRFYSLQVGDGE---MMRWVATEVEIEKHVIV---PEVDQNMD--MKSAE  130

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLKTR-DAEALAVLRMHHALGDGASINSLLLAC  635
             +FVEDYVY LSK R+D S+PLWDLH+LN+KT  ++EA+ + R+HH+LGDG S+ SLLLAC
Sbjct  131   EFVEDYVYHLSKTRIDKSQPLWDLHLLNVKTSSESEAVGIFRIHHSLGDGTSLMSLLLAC  190

Query  636   TRQTANPKLLPTISTRSSSppktlkpnn-----pkpkpknffklVWNTLVDVFIFIATLF  800
             TRQ  +P+ LPTI  ++ +  +  K              +  +L WNT VD+F+F+AT F
Sbjct  191   TRQINDPEALPTIPVKNKNKKQQDKERYRGFWNVLMTFWSLLQLFWNTAVDIFMFMATAF  250

Query  801   FLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             FLKD++ P+      E  P+R  +R +SL+D   +K A N TINDVALG+TQA LS YL+
Sbjct  251   FLKDTENPLKGPAGVEFTPRRIVHRTVSLDDIKLVKNAMNATINDVALGMTQAGLSRYLS  310

Query  981   RRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             R Y K    + + +NN PKN+RLRS L  NLRP  GIQA ADMM+K+       ++  +G
Sbjct  311   RIYEKGQ--TTQKKNNFPKNMRLRSTLLINLRPTAGIQAFADMMEKD-------TEAKYG  361

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N  GY +LP  IG+ +DPLDYVREAKAT DRKK+S+E IF++ +A  V+K FG KAA+ L
Sbjct  362   NWIGYVLLPFTIGIRDDPLDYVREAKATVDRKKHSFEAIFSFSIAEIVLKLFGTKAASAL  421

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
             +++I +N + CFSNVVGP E++ ++G P++++A T YGQP ALM++FQSYV+KM  ++SV
Sbjct  422   SHRIIANTTMCFSNVVGPLEEIGYYGIPMSYLAATSYGQPHALMINFQSYVNKMTTVLSV  481

Query  1521  DENVIPDPNQLLDDFEKSLHLIKD  1592
             DE  IP+P+QL +D  +SL LIKD
Sbjct  482   DEGTIPNPHQLCEDIAESLKLIKD  505



>gb|KCW78187.1| hypothetical protein EUGRSUZ_D02376, partial [Eucalyptus grandis]
Length=505

 Score =   493 bits (1270),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 250/507 (49%), Positives = 347/507 (68%), Gaps = 21/507 (4%)
 Frame = +3

Query  93    EMERNLKPIETRK---QKSGMENNNMSIAE-EPVSPSSRLLHEPAFNLHILAIMGFNSKI  260
             ++E NLKP+ET +   +  G E +   + E EP+SPS+++ HEP FN++I+A+MG  + I
Sbjct  1     KVEPNLKPVETTRRWDETQGDEGSGGVVEEGEPLSPSAQMFHEPNFNVYIVAVMGCKTPI  60

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             +  V   N+ HTLLKHPRF+SL V D++E GK +W+ T VDL +HI V   P+++   D 
Sbjct  61    DLPVIKSNLVHTLLKHPRFSSLQVEDEKEKGKFRWIPTNVDLEKHIIV---PKIKPGMDS  117

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
               R    F+EDYV  LSK  +  ++PLWD+HILN+KT DAEA+ V R+HH+LGDG S+ S
Sbjct  118   PER----FIEDYVSNLSKTTICKTQPLWDIHILNVKTSDAEAVGVFRIHHSLGDGTSLMS  173

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpkn-ffklVWNTLVDVFIFIATL  797
             LLLACTR+ ++P+ LPTI  + S   +              F  L+WNT VD  +F AT+
Sbjct  174   LLLACTRKISDPEALPTIPVKKSKEKRDYGRIWGWLLGVCWFLVLLWNTAVDTIMFGATV  233

Query  798   FFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
              FLKDS++PI   P  E  P+RF YR +SL D   +K A N T+NDVALGVTQA LS YL
Sbjct  234   LFLKDSESPIKGPPGVELMPRRFVYRTVSLEDIKMVKNALNATVNDVALGVTQAGLSQYL  293

Query  978   NRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             + RY   K+  G+ + +N+LPKNLRLRS L  NLRP+ GIQ LA MM+K+       ++ 
Sbjct  294   HLRYAETKKRHGATKIRNDLPKNLRLRSTLLINLRPSIGIQGLAAMMEKD-------TEV  346

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGNR GY ++P+ I + ++PLDYVREAKAT +RKK+S E IFT+ +A  V+K FG KAA
Sbjct  347   KWGNRIGYVLVPITIALHSNPLDYVREAKATINRKKHSLEAIFTHSIAEAVLKLFGIKAA  406

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             + L++++ ++ + CFSN+VGP E++ F+GHP+A++AP CYGQP  LMV+FQSY +KM  +
Sbjct  407   SALSHRVITHTTMCFSNLVGPLEEIGFYGHPLAYLAPGCYGQPHGLMVNFQSYANKMTFV  466

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +S DE  IPDP++L DD  ++L L KD
Sbjct  467   VSADEGTIPDPHRLCDDIVEALKLTKD  493



>ref|XP_010054862.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
Length=517

 Score =   493 bits (1268),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 347/508 (68%), Gaps = 22/508 (4%)
 Frame = +3

Query  93    EMERNLKPIETRK---QKSGMENNNMSIAE-EPVSPSSRLLHEPAFNLHILAIMGFNSKI  260
             ++E NLKP+ET +   +  G E +   + E EP+SPS+++ HEP FN++I+A+MG  + I
Sbjct  12    KVEPNLKPVETTRRWDETQGDEGSGGVVEEGEPLSPSAQMFHEPNFNVYIVAVMGCKTPI  71

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             +  V   N+ HTLLKHPRF+SL V D++E GK +W+ T VDL +HI V   P+++   D 
Sbjct  72    DLPVIKSNLVHTLLKHPRFSSLQVEDEKEKGKFRWIPTNVDLEKHIIV---PKIKPGMDS  128

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
               R    F+EDYV  LSK  +  ++PLWD+HILN+KT DAEA+ V R+HH+LGDG S+ S
Sbjct  129   PER----FIEDYVSNLSKTTICKTQPLWDIHILNVKTSDAEAVGVFRIHHSLGDGTSLMS  184

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknf-fklVWNTLVDVFIFIATL  797
             LLLACTR+ ++P+ LPTI  + S   +             +   L+WNT VD  +F AT+
Sbjct  185   LLLACTRKISDPEALPTIPVKKSKEKRDYGRIWGWLLGVCWFLVLLWNTAVDTIMFGATV  244

Query  798   FFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
              FLKDS++PI   P  E  P+RF YR +SL D   +K A N T+NDVALGVTQA LS YL
Sbjct  245   LFLKDSESPIKGPPGVELMPRRFVYRTVSLEDIKMVKNALNATVNDVALGVTQAGLSQYL  304

Query  978   NRRYG---KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             + RY    K+  G+ + +N+LPKNLRLRS L  NLRP+ GIQ LA MM+K+       ++
Sbjct  305   HLRYAAETKKRHGATKIRNDLPKNLRLRSTLLINLRPSIGIQGLAAMMEKD-------TE  357

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGNR GY ++P+ I + ++PLDYVREAKAT +RKK+S E IFT+ +A  V+K FG KA
Sbjct  358   VKWGNRIGYVLVPITIALHSNPLDYVREAKATINRKKHSLEAIFTHSIAEAVLKLFGIKA  417

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             A+ L++++ ++ + CFSN+VGP E++ F+GHP+A++AP CYGQP  LMV+FQSY +KM  
Sbjct  418   ASALSHRVITHTTMCFSNLVGPLEEIGFYGHPLAYLAPGCYGQPHGLMVNFQSYANKMTF  477

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++S DE  IPDP++L DD  ++L L KD
Sbjct  478   VVSADEGTIPDPHRLCDDIVEALKLTKD  505



>gb|KHG26801.1| O-acyltransferase WSD1 -like protein [Gossypium arboreum]
Length=515

 Score =   492 bits (1266),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 247/477 (52%), Positives = 330/477 (69%), Gaps = 19/477 (4%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SPSSRL HEP FN++++AIMG  ++I P V   N+ HTLL+HPRF+SL V+D+   
Sbjct  45    EEPLSPSSRLFHEPNFNVYVIAIMGCKTRIYPDVVKANLGHTLLRHPRFSSLQVMDERNK  104

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G MKWV T+VDL +H+ V   P++    D      +KF+EDY+Y LSK  +D S+PLWDL
Sbjct  105   GGMKWVRTQVDLEKHVIV---PKL----DPNIYSPEKFLEDYIYNLSKTSIDESQPLWDL  157

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT--ISTRSSSppkt  704
             H+LNL+T ++EA+ V R+HH+LGDG S+ SLLLACTRQ  +P  LPT  I  +       
Sbjct  158   HLLNLRTSESEAVGVFRIHHSLGDGTSLMSLLLACTRQMNDPLALPTVPIKKKQEKKNDH  217

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                        + F++  NT+VDVF+F AT  FLKD+Q P+   P  E  P+R  YR +S
Sbjct  218   TWFWRITSMFWSTFQVFLNTVVDVFMFTATTLFLKDTQNPLKGPPGVEFTPRRIVYRTVS  277

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG--KRDIGSIEGQNNLPKNLRLRSC  1058
             L+D   +K A NTTINDVALG+TQA LS Y+NR YG   +  G+IE  +NLP  +RLRS 
Sbjct  278   LDDIKLVKNAMNTTINDVALGITQAGLSRYINRIYGGNNKAEGAIE-IDNLPNKIRLRST  336

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
             L  N+RP+ GIQALADMM+K+ GE+       WGN  GY +LP  I   +DPLDYVR+AK
Sbjct  337   LLINIRPSAGIQALADMMEKD-GEAK------WGNWIGYVLLPFTIARRDDPLDYVRDAK  389

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
             AT DRKK S E IFT+ +A   +K FG K A+ L+++I S+ + CFSN+VGP E++ F+G
Sbjct  390   ATIDRKKRSLEAIFTFSIAELALKLFGVKTASALSHRILSHTTMCFSNLVGPLEEIGFYG  449

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             HP+AF+AP+ YGQP ALM++FQSY+DKM +++S DE  +P+P+QL DD  +SL LIK
Sbjct  450   HPMAFLAPSSYGQPHALMINFQSYMDKMTIVVSADEGTVPNPHQLCDDIVESLRLIK  506



>ref|XP_010661940.1| PREDICTED: O-acyltransferase WSD1-like [Vitis vinifera]
Length=510

 Score =   489 bits (1258),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 250/510 (49%), Positives = 340/510 (67%), Gaps = 30/510 (6%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIAEE--------PVSPSSRLLHEPAFNLHILAIMGFNS  254
             ++ LKPI+T++  +     +    E+         +SP  R+ HE  FN++++AI GF  
Sbjct  11    QQALKPIQTKRSAAREVEGDGKKPEDIKEEEEGEALSPVGRIFHETCFNVYVIAIAGFKI  70

Query  255   KINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEG  434
             +IN  V   N+ HTLLKHPRF+SL V D +++G MKWV T+VDL +HI +   P +    
Sbjct  71    RINVDVVKANLEHTLLKHPRFSSLQVKDVKKDGGMKWVPTKVDLDKHIII---PSLH---  124

Query  435   DETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASI  614
               T     K VEDY+  LSK  +D S+PLW+LHILN+KT DAE++AV R+HH+LGDG S+
Sbjct  125   -HTISSPDKMVEDYISNLSKTYIDYSKPLWELHILNIKTSDAESVAVFRIHHSLGDGMSL  183

Query  615   NSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT  794
              SL+LAC+RQ +NPK LPT+  + +S P  +K        +     VWNT++DV +F+AT
Sbjct  184   MSLVLACSRQISNPKALPTLPVKKTSNPDPVKSGRIWWTIRL----VWNTIIDVLMFLAT  239

Query  795   LFFLKDSQTPITPS--PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALS  968
               FLKD+ TP++          P+RF YR +SL+D   IK    TTINDV +GV+ A LS
Sbjct  240   TLFLKDTMTPLSNGWKKGGGHVPRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLS  299

Query  969   MYLNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
              YLNRRYG  K D G+ + +NNLPKN+RLR+ L  N+RP+ G+ ALA+MM  EKG     
Sbjct  300   RYLNRRYGETKEDKGATQKKNNLPKNIRLRATLMMNIRPSPGLHALAEMM--EKG-----  352

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
             SK  WGN  G  +LP  I + +DPLDYVR+ KAT DRKK+S+E IFT ++   V+K FG 
Sbjct  353   SKAKWGNWIGSMLLPFVIALYDDPLDYVRQTKATIDRKKHSHEAIFTCFIIKTVLKLFGA  412

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKM  1502
             K AA L +++ ++ + CFSNVVGP E++ F+GHP+AF+AP+ YGQP  LM+HFQSY++KM
Sbjct  413   KVAAFLYHRVMNHTTMCFSNVVGPMEEIGFYGHPMAFLAPSVYGQPQGLMIHFQSYINKM  472

Query  1503  GVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
               I+SVDE +IPDPNQL DD E+SL  IKD
Sbjct  473   TFILSVDEEIIPDPNQLCDDLEESLKFIKD  502



>emb|CBI40540.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   489 bits (1258),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 250/510 (49%), Positives = 340/510 (67%), Gaps = 30/510 (6%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIAEE--------PVSPSSRLLHEPAFNLHILAIMGFNS  254
             ++ LKPI+T++  +     +    E+         +SP  R+ HE  FN++++AI GF  
Sbjct  32    QQALKPIQTKRSAAREVEGDGKKPEDIKEEEEGEALSPVGRIFHETCFNVYVIAIAGFKI  91

Query  255   KINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEG  434
             +IN  V   N+ HTLLKHPRF+SL V D +++G MKWV T+VDL +HI +   P +    
Sbjct  92    RINVDVVKANLEHTLLKHPRFSSLQVKDVKKDGGMKWVPTKVDLDKHIII---PSLH---  145

Query  435   DETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASI  614
               T     K VEDY+  LSK  +D S+PLW+LHILN+KT DAE++AV R+HH+LGDG S+
Sbjct  146   -HTISSPDKMVEDYISNLSKTYIDYSKPLWELHILNIKTSDAESVAVFRIHHSLGDGMSL  204

Query  615   NSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT  794
              SL+LAC+RQ +NPK LPT+  + +S P  +K        +     VWNT++DV +F+AT
Sbjct  205   MSLVLACSRQISNPKALPTLPVKKTSNPDPVKSGRIWWTIRL----VWNTIIDVLMFLAT  260

Query  795   LFFLKDSQTPITPS--PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALS  968
               FLKD+ TP++          P+RF YR +SL+D   IK    TTINDV +GV+ A LS
Sbjct  261   TLFLKDTMTPLSNGWKKGGGHVPRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLS  320

Query  969   MYLNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
              YLNRRYG  K D G+ + +NNLPKN+RLR+ L  N+RP+ G+ ALA+MM  EKG     
Sbjct  321   RYLNRRYGETKEDKGATQKKNNLPKNIRLRATLMMNIRPSPGLHALAEMM--EKG-----  373

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
             SK  WGN  G  +LP  I + +DPLDYVR+ KAT DRKK+S+E IFT ++   V+K FG 
Sbjct  374   SKAKWGNWIGSMLLPFVIALYDDPLDYVRQTKATIDRKKHSHEAIFTCFIIKTVLKLFGA  433

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKM  1502
             K AA L +++ ++ + CFSNVVGP E++ F+GHP+AF+AP+ YGQP  LM+HFQSY++KM
Sbjct  434   KVAAFLYHRVMNHTTMCFSNVVGPMEEIGFYGHPMAFLAPSVYGQPQGLMIHFQSYINKM  493

Query  1503  GVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
               I+SVDE +IPDPNQL DD E+SL  IKD
Sbjct  494   TFILSVDEEIIPDPNQLCDDLEESLKFIKD  523



>ref|XP_002263409.1| PREDICTED: O-acyltransferase WSD1 [Vitis vinifera]
Length=514

 Score =   486 bits (1251),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 343/508 (68%), Gaps = 28/508 (6%)
 Frame = +3

Query  99    ERNLKPIETRK------QKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKI  260
             ++ LKPI+T++      +  G +  ++   EEP+SP++R+ HEP FN++++AI+G  ++I
Sbjct  11    QQALKPIQTKRSAGREVEGDGEKPEDIEEEEEPLSPAARIFHEPCFNVYVIAIVGCKTRI  70

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             N  V   N+ HT LKHPRF+SL V D +++G MKWV T+VDL +H+ V   P +      
Sbjct  71    NVDVIKANLGHTFLKHPRFSSLQVKDMKKDGAMKWVRTKVDLDKHVIV---PRIH----N  123

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
             T     K VEDY+  LSK  +D S+PLW+LHILNLKT DAE++AV R HH+LGDG S+ S
Sbjct  124   TIDSPDKTVEDYISNLSKTSIDFSKPLWELHILNLKTSDAESIAVFRSHHSLGDGMSLMS  183

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLF  800
             L+LACTRQ +NP+ LPT+  + SS P  +         +      WNT+VDV +F+AT  
Sbjct  184   LVLACTRQISNPEALPTLPVKKSSNPDPVNSGGIWWTIQL----FWNTIVDVLMFVATAL  239

Query  801   FLKDSQTPIT--PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
             FLKD+ TP++           +RF YR +SL+D   IK    TTINDV +GV+ A LS Y
Sbjct  240   FLKDTVTPLSGVQKKGDGLGSRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLSRY  299

Query  975   LNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRYG  K D G+ E +NNLPKN+RLR+ L  N+RP+ GI ALADMM  EKG     SK
Sbjct  300   LNRRYGEAKEDKGATEEKNNLPKNIRLRATLLMNIRPSPGIHALADMM--EKG-----SK  352

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGN  G  +LP  I + +DPLDYVR+AKA  DRKK+S E IFT+++   V+K FG KA
Sbjct  353   AKWGNWIGSVLLPFVIVLRDDPLDYVRQAKAIIDRKKHSREAIFTFFIIKMVLKLFGIKA  412

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             AA L +++ ++ + CFSN+VGP E++ F GHP+ F+AP+ YGQP  LM+HFQSY++KM +
Sbjct  413   AAFLYHRVPNHTTMCFSNIVGPVEEVGFSGHPLVFLAPSVYGQPHGLMIHFQSYINKMTL  472

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++SV E ++PDP+QL +D E+SL LIKD
Sbjct  473   VLSVKEEIVPDPHQLCNDLEESLKLIKD  500



>ref|XP_002263252.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Vitis vinifera]
Length=508

 Score =   484 bits (1247),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 245/508 (48%), Positives = 340/508 (67%), Gaps = 28/508 (6%)
 Frame = +3

Query  99    ERNLKPIETRKQKS-----GMENNNMSIAE-EPVSPSSRLLHEPAFNLHILAIMGFNSKI  260
             ++ LKPI+T++  +     G +  ++   E E +SP  R+ HE  FN++++AI G  ++I
Sbjct  11    QQALKPIQTKRSGAREVGDGKKPGDIKEEEGEALSPVGRIFHETCFNVYVIAIAGCKTRI  70

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             N  V   N+ H+LLKHPRF+SL V D +++G MKWV T+VDL +HI +   P +      
Sbjct  71    NVDVVKANLEHSLLKHPRFSSLQVKDVKKDGGMKWVPTKVDLDKHIII---PSLH----H  123

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
             T     K VEDY+  LSK  +D S+PLW+LHILN+KT DAE++AV R+HH+LGDG S+ S
Sbjct  124   TISSPDKMVEDYISNLSKTYIDYSKPLWELHILNIKTSDAESVAVFRIHHSLGDGMSLMS  183

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLF  800
             L+LAC+RQ +NPK LPT+  + +S P  +K        +     VWNT++DV +F+AT  
Sbjct  184   LVLACSRQISNPKALPTLPVKKTSNPDPVKSGRIWWTIRL----VWNTIIDVLMFLATTL  239

Query  801   FLKDSQTPITPS--PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
             FLKD+ TP++          P+RF YR +SL+D   IK    TTINDV +GV+ A LS Y
Sbjct  240   FLKDTMTPLSNGWKKGGGHVPRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLSRY  299

Query  975   LNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRYG  K D G+ + +NNLPKN+RLR+ L  N+RP+ G+  LA+MM  EKG     SK
Sbjct  300   LNRRYGETKEDKGATQKKNNLPKNIRLRATLMMNIRPSPGLHVLAEMM--EKG-----SK  352

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGN  G  +LP  I + +DPLDY+R+ KAT DRKK+S+E IF Y++   V+K FG K 
Sbjct  353   AKWGNWIGSMLLPFAIALYDDPLDYIRQTKATIDRKKHSHEAIFAYFIIKTVLKLFGAKV  412

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             AA L  ++ ++ + CFSNVVGP E++ F+GHP+AF+AP+ YGQP  LM+HFQSY++KM  
Sbjct  413   AAFLYRRVLNHTTMCFSNVVGPMEEIGFYGHPMAFLAPSVYGQPQGLMIHFQSYINKMTF  472

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++SVDE +IPDP +L DD E+SL  IKD
Sbjct  473   VLSVDEEIIPDPTRLCDDLEESLKFIKD  500



>ref|XP_010035244.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW46541.1| hypothetical protein EUGRSUZ_K00371 [Eucalyptus grandis]
Length=505

 Score =   483 bits (1242),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 327/476 (69%), Gaps = 18/476 (4%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             E +SP++RL H P FN +ILAIMG  ++INP V    +  TLLKHPRF+S MV D + +G
Sbjct  29    EKLSPAARLFHAPRFNCYILAIMGCKTRINPGVVKAGLEETLLKHPRFSSKMVGDIKRSG  88

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             KMKWV+T+++L +H+ V   P+V+ + D   R    FVEDY+  L+K  +DMSRPLW+LH
Sbjct  89    KMKWVQTKMNLDEHVIV---PDVDPDMDTPDR----FVEDYISYLTKTPLDMSRPLWELH  141

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-STRSSSppktlk  710
             +LN+KT DAEA+A+ R+HH++GDGAS+ SLLLACTR+TA+P+ LPTI   +S+    +  
Sbjct  142   LLNVKTSDAEAVAIFRIHHSMGDGASLMSLLLACTRKTADPEALPTIPGKKSAGTQNSGG  201

Query  711   pnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                      + F+L+WNT+VD  +F+AT  FLKD+++ +   P      KRF +R +SL+
Sbjct  202   FWWFILALWSMFRLIWNTIVDFSVFVATYCFLKDTESLVKGGPGVAKTTKRFVHRTVSLD  261

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRY---GKRDIGSIEGQNNLPKNLRLRSCL  1061
             D   IK A N TINDV LGVTQA LS YLNRRY     +D  S + ++N+PKN+RLR+ +
Sbjct  262   DIKLIKSALNMTINDVVLGVTQAGLSRYLNRRYEGESGKDQNSKKKKSNIPKNMRLRATV  321

Query  1062  FFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKA  1241
               NLRP  GIQAL+DMM K        SK  WGN  GY ++P  IG  +DPL+YV +AKA
Sbjct  322   LINLRPTAGIQALSDMMIKN-------SKCKWGNWIGYILIPFSIGSEDDPLEYVHKAKA  374

Query  1242  TADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGH  1421
             T DRKK S E I T+  A  V+K FG K A+ + ++  SN +  FSNV+GP E++ F+GH
Sbjct  375   TIDRKKLSLEAIITFVCAELVLKLFGVKVASAIAHRFLSNTTVAFSNVIGPVEEISFYGH  434

Query  1422  PIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             PIAF+AP+ YG P AL +HFQSYV+KM + ++VD +VIPDP+QL DD E+SL  IK
Sbjct  435   PIAFLAPSVYGHPHALTIHFQSYVNKMTIAVAVDPDVIPDPHQLCDDIEESLKTIK  490



>ref|XP_002263137.1| PREDICTED: O-acyltransferase WSD1-like [Vitis vinifera]
Length=513

 Score =   482 bits (1241),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 345/507 (68%), Gaps = 27/507 (5%)
 Frame = +3

Query  99    ERNLKPIETR----KQKSGMENNNMSIAEE-PVSPSSRLLHEPAFNLHILAIMGFNSKIN  263
             ++ LKPI T+    +++SG +  ++   EE P+SP++R+ HEP FN++I+AIMG+ +K++
Sbjct  11    QQALKPIRTKIAGGEEESGKKPYDIEEEEEEPLSPAARIFHEPNFNVYIIAIMGWKTKMD  70

Query  264   PHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDET  443
               V   +   TLLKHPRF+SL V D ++ G M+WV T+VDL +HI +   P++    D+ 
Sbjct  71    LQVVKAHFVRTLLKHPRFSSLQVKDDDKGGAMRWVRTKVDLDKHIIM---PDL----DQK  123

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  K VEDY+ +LSK  MD+S+PLW+ HILN+KT DAE+L V R+HH+LGDG S+ SL
Sbjct  124   TESADKLVEDYISDLSKTSMDLSKPLWEFHILNIKTSDAESLGVFRIHHSLGDGVSLMSL  183

Query  624   LLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             +LACTRQ ++ + LPT+  + SS P  +K        K     VW T VDV +FIAT  F
Sbjct  184   VLACTRQVSDSEALPTLPVQKSSNPNPVKSGGVWSLIKM----VWYTFVDVLMFIATALF  239

Query  804   LKDSQTPITP--SPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
             LKD+ TP+T        S  +RFAYR +S +D   +K A NTTINDV +GV+ A LS YL
Sbjct  240   LKDTVTPLTRHRKKGVGSGSRRFAYRTVSFDDIKLVKNAMNTTINDVVMGVSLAGLSQYL  299

Query  978   NRRYGKRDIGSIEGQ--NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             NRRYG+ +  ++  Q  NN+P+N+RLR+ L  N+RP+ GI ALADMM  EKG     +K 
Sbjct  300   NRRYGEAEGEAVATQKKNNIPENIRLRATLLVNIRPSPGIHALADMM--EKG-----TKA  352

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  G  +LP  I + +DPLDYVR+AKAT DRKK S E  +T+ +   V+K FG KAA
Sbjct  353   KWGNCIGSVLLPFAIALRDDPLDYVRQAKATIDRKKQSQEAGYTFLIVKLVLKLFGIKAA  412

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             A L +++ ++ + CFSN+VGP E++ F GHP+AFIAP+CYGQP  LMVHFQSY +KM  I
Sbjct  413   AFLFHRVPNHTTLCFSNIVGPIEEIGFNGHPLAFIAPSCYGQPHGLMVHFQSYTNKMTFI  472

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +SVDE  IPDP+QL DD E+SL L+KD
Sbjct  473   LSVDEATIPDPHQLCDDIEESLKLMKD  499



>emb|CAN71951.1| hypothetical protein VITISV_024308 [Vitis vinifera]
Length=513

 Score =   481 bits (1238),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 344/507 (68%), Gaps = 27/507 (5%)
 Frame = +3

Query  99    ERNLKPIETR----KQKSGMENNNMSIAEE-PVSPSSRLLHEPAFNLHILAIMGFNSKIN  263
             ++ LKPI T+    +++SG +  ++   EE P+SP++R+ HEP FN++I+AIMG+ +K++
Sbjct  11    QQALKPIRTKIAGGEEESGKKPYDIEEEEEEPLSPAARIFHEPNFNVYIIAIMGWKTKMD  70

Query  264   PHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDET  443
               V   +   TLLKHPRF+SL V D ++ G M+WV T+VDL +HI +   P++    D+ 
Sbjct  71    LQVVKAHFVRTLLKHPRFSSLQVKDDDKGGAMRWVRTKVDLDKHIIM---PDL----DQK  123

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  K VEDY+ +LSK  MD+S+PLW+ HILN+KT DAE+L V R+HH+LGDG S+ SL
Sbjct  124   TESADKLVEDYISDLSKTSMDLSKPLWEFHILNIKTSDAESLGVFRIHHSLGDGVSLMSL  183

Query  624   LLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             +LACTRQ ++ + LPT+  + SS P  +K        K     VW T VDV +FIAT  F
Sbjct  184   VLACTRQVSDSEALPTLPVQKSSNPNPVKSGGVWSLIKM----VWYTFVDVLMFIATALF  239

Query  804   LKDSQTPITP--SPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
             LKD+ TP+T        S  +RFAYR +S +D   +K A NTTINDV +GV+ A LS YL
Sbjct  240   LKDTVTPLTRHRKKGVGSGSRRFAYRTVSFDDIKLVKNAMNTTINDVVMGVSLAGLSQYL  299

Query  978   NRRYGKRDIGSIEGQ--NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             NRRYG+    ++  Q  NN+P+N+RLR+ L  N+RP+ GI ALADMM  EKG     +K 
Sbjct  300   NRRYGEAXGEAVATQKKNNIPENIRLRATLLVNIRPSPGIHALADMM--EKG-----TKA  352

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  G  +LP  I + +DPLDYVR+AKAT DRKK S E  +T+ +   V+K FG KAA
Sbjct  353   KWGNCIGSVLLPFAIALRDDPLDYVRQAKATIDRKKQSQEAGYTFLIVKLVLKLFGIKAA  412

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             A L +++ ++ + CFSN+VGP E++ F GHP+AFIAP+CYGQP  LMVHFQSY +KM  I
Sbjct  413   AFLFHRVPNHTTLCFSNIVGPIEEIGFNGHPLAFIAPSCYGQPHGLMVHFQSYTNKMTFI  472

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +SVDE  IPDP+QL DD E+SL L+KD
Sbjct  473   LSVDEATIPDPHQLCDDIEESLKLMKD  499



>ref|XP_010266526.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nelumbo nucifera]
Length=506

 Score =   474 bits (1220),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 241/503 (48%), Positives = 332/503 (66%), Gaps = 24/503 (5%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAE----EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVF  275
             LK I T  QK+G     MS  E    +P+SP++R+  EP FN +I+AIMG  +KI+P V 
Sbjct  14    LKAIVT--QKTGGGGTEMSYGETTDEQPLSPAARIFREPNFNCYIIAIMGCKTKIDPDVI  71

Query  276   THNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKN  455
                +  TLLKHPRF+S+ V  + ++G+M WV T+VDL  H+ V   PE+    D      
Sbjct  72    KAGLETTLLKHPRFSSIQVASEGKSGEMNWVRTKVDLDNHVIV---PEL----DPNMESL  124

Query  456   KKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLAC  635
              +F+EDYV +L++  +DMS+PLW+LH+LN+KT +AEA+ V R+HH+LGDG S+ SLLLAC
Sbjct  125   DQFLEDYVSDLTRTAIDMSKPLWELHLLNVKTSEAEAVGVFRIHHSLGDGMSLISLLLAC  184

Query  636   TRQTANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLK  809
             TR++++   LPTI    R+++                   L+WN+ VD+F F+AT  F+K
Sbjct  185   TRKSSDGGALPTIPVQKRAATGTSGSWFLWVLSSVLAVLHLLWNSTVDIFKFLATSVFIK  244

Query  810   DSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY  989
             D+ TP+          KRF +R +SL+D   +K     TINDV LGVTQ  LS YLNRRY
Sbjct  245   DTDTPLKGGRGVGFTRKRFVHRTVSLDDIKLVKNELKMTINDVVLGVTQGGLSRYLNRRY  304

Query  990   G--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGN  1163
             G  K D  +   +NNLPK++RLR+ L  N+RP+ GIQALADMM       ++ S+  WGN
Sbjct  305   GESKMDEEATRKRNNLPKHIRLRAALLVNIRPSTGIQALADMM-------DNKSEAKWGN  357

Query  1164  RFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILT  1343
               GY +LP KI + +DPLDYVREAKAT DRKK S E +FT+  A  ++K  G KAAA+L 
Sbjct  358   WLGYVLLPFKIALHDDPLDYVREAKATIDRKKISLESMFTFVCATIIVKSIGQKAAALLC  417

Query  1344  NKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVD  1523
             ++I SN +  +SNVVGP E++ F GHPI ++AP+ YG P AL +HFQSY+DKM ++++VD
Sbjct  418   HRILSNTTMSYSNVVGPVEEISFCGHPIVYLAPSVYGHPHALTIHFQSYMDKMTIVLAVD  477

Query  1524  ENVIPDPNQLLDDFEKSLHLIKD  1592
             ++VIPDP +LL D E+SL LIK+
Sbjct  478   QDVIPDPQRLLGDLEESLKLIKN  500



>ref|XP_010661937.1| PREDICTED: O-acyltransferase WSD1 isoform X2 [Vitis vinifera]
Length=490

 Score =   474 bits (1219),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 234/502 (47%), Positives = 338/502 (67%), Gaps = 27/502 (5%)
 Frame = +3

Query  96    MERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVF  275
             ++  LKPI    ++   + ++     +P+SP +RL HEP  NL+++A++G  ++I+P V 
Sbjct  7     LKHALKPIRIVPKEGDDQEDH-----QPLSPMTRLFHEPDCNLYVIAMIGSKTRIDPDVV  61

Query  276   THNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVE-APEVEVEGDETHRK  452
               N+ H+LLKHPRF+SL V+++E+ G+MKWV T+VDL +H+ V +   ++E   D     
Sbjct  62    KANLVHSLLKHPRFSSLQVMEEEKGGEMKWVPTKVDLEKHVIVPDMCSDMETSSD-----  116

Query  453   NKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLA  632
               K+VEDY+  L+K  +D+S+PLWDLH+LN+KT DAEA+AV R+HH+LGDG S+ SLLLA
Sbjct  117   --KYVEDYICNLTKTTLDLSKPLWDLHLLNVKTSDAEAVAVFRIHHSLGDGTSLMSLLLA  174

Query  633   CTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKD  812
             CTR+ ++P  LP++                K         VWNT++DV + IAT+ FLKD
Sbjct  175   CTRKASDPTALPSVPMMKKPKLSVGSGKWWKAFRL-----VWNTIIDVLMVIATVLFLKD  229

Query  813   SQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY-  989
               TP+   P   S  +R  +R +SL D   IK A +TT+NDV +G+TQA LS YLNRRY 
Sbjct  230   RDTPLRGPPNVGSTGRRIIHRTISLEDVVMIKNAMSTTVNDVMVGITQAGLSRYLNRRYA  289

Query  990   -GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNR  1166
              GK++ G+ E +NNLPKNL +R+  F N+RP+ GI  LA+MM  EKG     S+  WGN 
Sbjct  290   EGKKNKGATEKKNNLPKNLSIRATHFINIRPSAGIHTLAEMM--EKG-----SEAKWGNW  342

Query  1167  FGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTN  1346
              GY +LPL I + ++PLDY+++AK   DRKK S E ++ + +A  +   FG K  ++L  
Sbjct  343   IGYVLLPLSIALRDNPLDYIQKAKEAMDRKKASLEALYIHSMAKSIPNLFGTKTGSVLCL  402

Query  1347  KIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDE  1526
             K+ S  +  FSNVVGP+E++ FFGHPIA+IAP+C+GQP+ALM+H  SYVDKM +I+SVDE
Sbjct  403   KVPSRTTIWFSNVVGPQEEIAFFGHPIAYIAPSCFGQPNALMIHVVSYVDKMNIILSVDE  462

Query  1527  NVIPDPNQLLDDFEKSLHLIKD  1592
             + +PDP+QL D+ E+S +LIK+
Sbjct  463   STVPDPHQLFDELEESFNLIKN  484



>ref|XP_011024820.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=525

 Score =   474 bits (1221),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 337/506 (67%), Gaps = 16/506 (3%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             ++ E   K  ET ++K   ++   + ++EP+SP++RL H P FN  IL  +G  + INP 
Sbjct  21    VKTETATKKWETNEEKGMADSKESTSSQEPLSPAARLFHAPQFNCTILTAIGCKTSINPG  80

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETH  446
             V    +  TL+KHPRF+  +V+D  + G K KW  T V++  H+TV   P ++   D   
Sbjct  81    VIKMGLEQTLMKHPRFSKKLVIDDNKCGSKSKWESTIVNVENHVTV---PNLDPNMDSP-  136

Query  447   RKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLL  626
                 +FVEDY+  LS   +D+S+PLW++HILN+KT DAEA+AV R+HH+LGDGAS+ SLL
Sbjct  137   ---DQFVEDYISSLSTIPLDLSKPLWEMHILNVKTSDAEAIAVFRIHHSLGDGASLISLL  193

Query  627   LACTRQTANPKLLPTI-STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             LACTR+T++P  LP+I + + +    +              +++WNT VD+ +F AT+ F
Sbjct  194   LACTRKTSDPDALPSIPAQQRAGSHFSGGFWGLFFAMWTVLRVIWNTSVDLVLFAATMLF  253

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             L+D++TP+  +   E KPKRF +R +SL+D   +K A N TIND  +GVTQA LS YLNR
Sbjct  254   LEDTKTPLKGASGVELKPKRFVHRTVSLDDIKLVKNAMNMTINDAIMGVTQAGLSRYLNR  313

Query  984   RYGKR---DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWG  1154
             +YG +   + G    +NN+PK++RLR+ +  N+RP  GIQ LAD+M  E   SN+  KWG
Sbjct  314   KYGDQSEIEDGENGKKNNIPKSIRLRASVLVNVRPTPGIQTLADLMADE---SNN-PKWG  369

Query  1155  WGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAA  1334
             WGNR GY ILP  +G+ +DPL+++R AKA  DRKK S E  F+++ A  VIK FG KA+A
Sbjct  370   WGNRIGYIILPFTVGLQDDPLEHLRRAKAMIDRKKLSLEATFSFHSAILVIKLFGAKASA  429

Query  1335  ILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVII  1514
              +  ++ SN +  FSNVVGP E++ F+GHP+A+IAP+ YG P AL +HFQSY  KM +++
Sbjct  430   AIARRVISNTTLAFSNVVGPLEEISFYGHPVAYIAPSVYGSPHALTIHFQSYCKKMTIVL  489

Query  1515  SVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +VD +VIPDP++L DD EKSL +IKD
Sbjct  490   AVDPDVIPDPHKLCDDLEKSLEIIKD  515



>ref|XP_002278404.1| PREDICTED: O-acyltransferase WSD1 isoform X1 [Vitis vinifera]
 emb|CBI40532.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   474 bits (1219),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 234/502 (47%), Positives = 338/502 (67%), Gaps = 27/502 (5%)
 Frame = +3

Query  96    MERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVF  275
             ++  LKPI    ++   + ++     +P+SP +RL HEP  NL+++A++G  ++I+P V 
Sbjct  30    LKHALKPIRIVPKEGDDQEDH-----QPLSPMTRLFHEPDCNLYVIAMIGSKTRIDPDVV  84

Query  276   THNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVE-APEVEVEGDETHRK  452
               N+ H+LLKHPRF+SL V+++E+ G+MKWV T+VDL +H+ V +   ++E   D     
Sbjct  85    KANLVHSLLKHPRFSSLQVMEEEKGGEMKWVPTKVDLEKHVIVPDMCSDMETSSD-----  139

Query  453   NKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLA  632
               K+VEDY+  L+K  +D+S+PLWDLH+LN+KT DAEA+AV R+HH+LGDG S+ SLLLA
Sbjct  140   --KYVEDYICNLTKTTLDLSKPLWDLHLLNVKTSDAEAVAVFRIHHSLGDGTSLMSLLLA  197

Query  633   CTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKD  812
             CTR+ ++P  LP++                K         VWNT++DV + IAT+ FLKD
Sbjct  198   CTRKASDPTALPSVPMMKKPKLSVGSGKWWKAFRL-----VWNTIIDVLMVIATVLFLKD  252

Query  813   SQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY-  989
               TP+   P   S  +R  +R +SL D   IK A +TT+NDV +G+TQA LS YLNRRY 
Sbjct  253   RDTPLRGPPNVGSTGRRIIHRTISLEDVVMIKNAMSTTVNDVMVGITQAGLSRYLNRRYA  312

Query  990   -GKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNR  1166
              GK++ G+ E +NNLPKNL +R+  F N+RP+ GI  LA+MM  EKG     S+  WGN 
Sbjct  313   EGKKNKGATEKKNNLPKNLSIRATHFINIRPSAGIHTLAEMM--EKG-----SEAKWGNW  365

Query  1167  FGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTN  1346
              GY +LPL I + ++PLDY+++AK   DRKK S E ++ + +A  +   FG K  ++L  
Sbjct  366   IGYVLLPLSIALRDNPLDYIQKAKEAMDRKKASLEALYIHSMAKSIPNLFGTKTGSVLCL  425

Query  1347  KIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDE  1526
             K+ S  +  FSNVVGP+E++ FFGHPIA+IAP+C+GQP+ALM+H  SYVDKM +I+SVDE
Sbjct  426   KVPSRTTIWFSNVVGPQEEIAFFGHPIAYIAPSCFGQPNALMIHVVSYVDKMNIILSVDE  485

Query  1527  NVIPDPNQLLDDFEKSLHLIKD  1592
             + +PDP+QL D+ E+S +LIK+
Sbjct  486   STVPDPHQLFDELEESFNLIKN  507



>ref|XP_010266525.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Nelumbo nucifera]
Length=507

 Score =   471 bits (1211),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 242/504 (48%), Positives = 332/504 (66%), Gaps = 25/504 (5%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAE----EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVF  275
             LK I T  QK+G     MS  E    +P+SP++R+  EP FN +I+AIMG  +KI+P V 
Sbjct  14    LKAIVT--QKTGGGGTEMSYGETTDEQPLSPAARIFREPNFNCYIIAIMGCKTKIDPDVI  71

Query  276   THNMPHTLLKHPRFTSLMVVDKE-ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRK  452
                +  TLLKHPRF+S+  V  E ++G+M WV T+VDL  H+ V   PE+    D     
Sbjct  72    KAGLETTLLKHPRFSSIQQVASEGKSGEMNWVRTKVDLDNHVIV---PEL----DPNMES  124

Query  453   NKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLA  632
               +F+EDYV +L++  +DMS+PLW+LH+LN+KT +AEA+ V R+HH+LGDG S+ SLLLA
Sbjct  125   LDQFLEDYVSDLTRTAIDMSKPLWELHLLNVKTSEAEAVGVFRIHHSLGDGMSLISLLLA  184

Query  633   CTRQTANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFL  806
             CTR++++   LPTI    R+++                   L+WN+ VD+F F+AT  F+
Sbjct  185   CTRKSSDGGALPTIPVQKRAATGTSGSWFLWVLSSVLAVLHLLWNSTVDIFKFLATSVFI  244

Query  807   KDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRR  986
             KD+ TP+          KRF +R +SL+D   +K     TINDV LGVTQ  LS YLNRR
Sbjct  245   KDTDTPLKGGRGVGFTRKRFVHRTVSLDDIKLVKNELKMTINDVVLGVTQGGLSRYLNRR  304

Query  987   YG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             YG  K D  +   +NNLPK++RLR+ L  N+RP+ GIQALADMM       ++ S+  WG
Sbjct  305   YGESKMDEEATRKRNNLPKHIRLRAALLVNIRPSTGIQALADMM-------DNKSEAKWG  357

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N  GY +LP KI + +DPLDYVREAKAT DRKK S E +FT+  A  ++K  G KAAA+L
Sbjct  358   NWLGYVLLPFKIALHDDPLDYVREAKATIDRKKISLESMFTFVCATIIVKSIGQKAAALL  417

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
              ++I SN +  +SNVVGP E++ F GHPI ++AP+ YG P AL +HFQSY+DKM ++++V
Sbjct  418   CHRILSNTTMSYSNVVGPVEEISFCGHPIVYLAPSVYGHPHALTIHFQSYMDKMTIVLAV  477

Query  1521  DENVIPDPNQLLDDFEKSLHLIKD  1592
             D++VIPDP +LL D E+SL LIK+
Sbjct  478   DQDVIPDPQRLLGDLEESLKLIKN  501



>ref|XP_011024817.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Populus euphratica]
Length=526

 Score =   471 bits (1213),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/508 (46%), Positives = 336/508 (66%), Gaps = 19/508 (4%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             ++ E   K  ET ++K   ++   + ++EP+SP++RL H P FN  IL  +G  + INP 
Sbjct  21    VKTETATKKWETNEEKGMADSKESTSSQEPLSPAARLFHAPQFNCTILTAIGCKTSINPG  80

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETH  446
             V    +  TL+KHPRF+  +V+D  + G K KW  T V++  H+TV   P ++   D   
Sbjct  81    VIKMGLEQTLMKHPRFSKKLVIDDNKCGSKSKWESTIVNVENHVTV---PNLDPNMDSP-  136

Query  447   RKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLL  626
                 +FVEDY+  LS   +D+S+PLW++HILN+KT DAEA+AV R+HH+LGDGAS+ SLL
Sbjct  137   ---DQFVEDYISSLSTIPLDLSKPLWEMHILNVKTSDAEAIAVFRIHHSLGDGASLISLL  193

Query  627   LACTRQTANPKLLPTI-STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             LACTR+T++P  LP+I + + +    +              +++WNT VD+ +F AT+ F
Sbjct  194   LACTRKTSDPDALPSIPAQQRAGSHFSGGFWGLFFAMWTVLRVIWNTSVDLVLFAATMLF  253

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             L+D++TP+  +   E KPKRF +R +SL+D   +K A N TIND  +GVTQA LS YLNR
Sbjct  254   LEDTKTPLKGASGVELKPKRFVHRTVSLDDIKLVKNAMNMTINDAIMGVTQAGLSRYLNR  313

Query  984   RYGKRDIGSIEG-----QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             +Y   D   IE      +NN+PK++RLR+ +  N+RP  GIQ LAD+M  E   SN+  K
Sbjct  314   KYAG-DQSEIEDGENGKKNNIPKSIRLRASVLVNVRPTPGIQTLADLMADE---SNN-PK  368

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
             WGWGNR GY ILP  +G+ +DPL+++R AKA  DRKK S E  F+++ A  VIK FG KA
Sbjct  369   WGWGNRIGYIILPFTVGLQDDPLEHLRRAKAMIDRKKLSLEATFSFHSAILVIKLFGAKA  428

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             +A +  ++ SN +  FSNVVGP E++ F+GHP+A+IAP+ YG P AL +HFQSY  KM +
Sbjct  429   SAAIARRVISNTTLAFSNVVGPLEEISFYGHPVAYIAPSVYGSPHALTIHFQSYCKKMTI  488

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +++VD +VIPDP++L DD EKSL +IKD
Sbjct  489   VLAVDPDVIPDPHKLCDDLEKSLEIIKD  516



>ref|XP_002318416.2| hypothetical protein POPTR_0012s02150g [Populus trichocarpa]
 gb|EEE96636.2| hypothetical protein POPTR_0012s02150g [Populus trichocarpa]
Length=519

 Score =   470 bits (1210),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 233/505 (46%), Positives = 332/505 (66%), Gaps = 20/505 (4%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             ++ E   K  ET ++K   ++   + ++EP+SP++RL H P FN  IL  +G  + INP 
Sbjct  21    IKTETATKKWETDEEKEMADSKESTSSQEPLSPAARLFHAPQFNCTILTAIGCKTSINPG  80

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHR  449
             V    +  TL+KHPRF+  +        K KW  T+V++  H+TV   P +    D    
Sbjct  81    VIKMGLKQTLMKHPRFSKKLC-----GSKSKWESTKVNVENHVTV---PNL----DPNMN  128

Query  450   KNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLL  629
                +FVEDY+  LS   +D+S+PLW++HILN+KT DAEA+AV R+HH+LGDGAS+ SLLL
Sbjct  129   SPDQFVEDYISNLSTVPLDLSKPLWEMHILNVKTLDAEAIAVFRIHHSLGDGASLISLLL  188

Query  630   ACTRQTANPKLLPTISTRS-SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFL  806
             ACTR+T++P  LP+I  +  +    +              +++WNTLVD  +F+AT+ FL
Sbjct  189   ACTRKTSDPDALPSIPVQQRAGSHFSGGFWGLFFAMWTVLRMIWNTLVDSVLFVATMLFL  248

Query  807   KDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRR  986
             +D++TP+  +   E KPKRF +R +SL+D   +K A N TIND  +GVTQA LS YLNR+
Sbjct  249   EDTKTPLKGASGVELKPKRFVHRTVSLDDIKLVKNAMNMTINDAIMGVTQAGLSRYLNRK  308

Query  987   YGKR---DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             YG +   + G    +NN+PK++RLR+ +  N+RP  GIQ LAD+M     ESN+  KWGW
Sbjct  309   YGDQSEIEDGENGKKNNIPKSIRLRASVLVNVRPTPGIQTLADLMA---NESNN-PKWGW  364

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
             GNR GY ILP  +G+ +DPL+++R AKA  DRKK S E  F+++ A  VIK FG KA+A 
Sbjct  365   GNRIGYIILPFTVGLQDDPLEHLRRAKAMIDRKKLSLEATFSFHCAILVIKLFGAKASAA  424

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             +  ++ SN +  FSNVVGP E++ F+GHP+A+IAP+ YG P AL +HFQSY  KM ++++
Sbjct  425   IARRVISNTTLAFSNVVGPLEEISFYGHPVAYIAPSVYGSPHALTIHFQSYCKKMTIVLA  484

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VD +VIPDP++L DD EKSL +IKD
Sbjct  485   VDPDVIPDPHKLCDDLEKSLEIIKD  509



>emb|CBI40547.3| unnamed protein product [Vitis vinifera]
Length=1045

 Score =   486 bits (1252),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 250/508 (49%), Positives = 343/508 (68%), Gaps = 28/508 (6%)
 Frame = +3

Query  99    ERNLKPIETRK------QKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKI  260
             ++ LKPI+T++      +  G +  ++   EEP+SP++R+ HEP FN++++AI+G  ++I
Sbjct  542   QQALKPIQTKRSAGREVEGDGEKPEDIEEEEEPLSPAARIFHEPCFNVYVIAIVGCKTRI  601

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             N  V   N+ HT LKHPRF+SL V D +++G MKWV T+VDL +H+ V   P +      
Sbjct  602   NVDVIKANLGHTFLKHPRFSSLQVKDMKKDGAMKWVRTKVDLDKHVIV---PRIH----N  654

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
             T     K VEDY+  LSK  +D S+PLW+LHILNLKT DAE++AV R HH+LGDG S+ S
Sbjct  655   TIDSPDKTVEDYISNLSKTSIDFSKPLWELHILNLKTSDAESIAVFRSHHSLGDGMSLMS  714

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLF  800
             L+LACTRQ +NP+ LPT+  + SS P  +         +      WNT+VDV +F+AT  
Sbjct  715   LVLACTRQISNPEALPTLPVKKSSNPDPVNSGGIWWTIQL----FWNTIVDVLMFVATAL  770

Query  801   FLKDSQTPIT--PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
             FLKD+ TP++           +RF YR +SL+D   IK    TTINDV +GV+ A LS Y
Sbjct  771   FLKDTVTPLSGVQKKGDGLGSRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLSRY  830

Query  975   LNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRYG  K D G+ E +NNLPKN+RLR+ L  N+RP+ GI ALADMM  EKG     SK
Sbjct  831   LNRRYGEAKEDKGATEEKNNLPKNIRLRATLLMNIRPSPGIHALADMM--EKG-----SK  883

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGN  G  +LP  I + +DPLDYVR+AKA  DRKK+S E IFT+++   V+K FG KA
Sbjct  884   AKWGNWIGSVLLPFVIVLRDDPLDYVRQAKAIIDRKKHSREAIFTFFIIKMVLKLFGIKA  943

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             AA L +++ ++ + CFSN+VGP E++ F GHP+ F+AP+ YGQP  LM+HFQSY++KM +
Sbjct  944   AAFLYHRVPNHTTMCFSNIVGPVEEVGFSGHPLVFLAPSVYGQPHGLMIHFQSYINKMTL  1003

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++SV E ++PDP+QL +D E+SL LIKD
Sbjct  1004  VLSVKEEIVPDPHQLCNDLEESLKLIKD  1031


 Score =   481 bits (1239),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 345/507 (68%), Gaps = 27/507 (5%)
 Frame = +3

Query  99    ERNLKPIETR----KQKSGMENNNMSIAEE-PVSPSSRLLHEPAFNLHILAIMGFNSKIN  263
             ++ LKPI T+    +++SG +  ++   EE P+SP++R+ HEP FN++I+AIMG+ +K++
Sbjct  27    QQALKPIRTKIAGGEEESGKKPYDIEEEEEEPLSPAARIFHEPNFNVYIIAIMGWKTKMD  86

Query  264   PHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDET  443
               V   +   TLLKHPRF+SL V D ++ G M+WV T+VDL +HI +   P++    D+ 
Sbjct  87    LQVVKAHFVRTLLKHPRFSSLQVKDDDKGGAMRWVRTKVDLDKHIIM---PDL----DQK  139

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  K VEDY+ +LSK  MD+S+PLW+ HILN+KT DAE+L V R+HH+LGDG S+ SL
Sbjct  140   TESADKLVEDYISDLSKTSMDLSKPLWEFHILNIKTSDAESLGVFRIHHSLGDGVSLMSL  199

Query  624   LLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             +LACTRQ ++ + LPT+  + SS P  +K        K     VW T VDV +FIAT  F
Sbjct  200   VLACTRQVSDSEALPTLPVQKSSNPNPVKSGGVWSLIKM----VWYTFVDVLMFIATALF  255

Query  804   LKDSQTPITP--SPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
             LKD+ TP+T        S  +RFAYR +S +D   +K A NTTINDV +GV+ A LS YL
Sbjct  256   LKDTVTPLTRHRKKGVGSGSRRFAYRTVSFDDIKLVKNAMNTTINDVVMGVSLAGLSQYL  315

Query  978   NRRYGKRDIGSIEGQ--NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             NRRYG+ +  ++  Q  NN+P+N+RLR+ L  N+RP+ GI ALADMM  EKG     +K 
Sbjct  316   NRRYGEAEGEAVATQKKNNIPENIRLRATLLVNIRPSPGIHALADMM--EKG-----TKA  368

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  G  +LP  I + +DPLDYVR+AKAT DRKK S E  +T+ +   V+K FG KAA
Sbjct  369   KWGNCIGSVLLPFAIALRDDPLDYVRQAKATIDRKKQSQEAGYTFLIVKLVLKLFGIKAA  428

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             A L +++ ++ + CFSN+VGP E++ F GHP+AFIAP+CYGQP  LMVHFQSY +KM  I
Sbjct  429   AFLFHRVPNHTTLCFSNIVGPIEEIGFNGHPLAFIAPSCYGQPHGLMVHFQSYTNKMTFI  488

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +SVDE  IPDP+QL DD E+SL L+KD
Sbjct  489   LSVDEATIPDPHQLCDDIEESLKLMKD  515



>ref|XP_010661938.1| PREDICTED: O-acyltransferase WSD1-like [Vitis vinifera]
Length=522

 Score =   467 bits (1201),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 229/476 (48%), Positives = 324/476 (68%), Gaps = 22/476 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP + L HEP  NL+++A++G  ++I+P V   N+ H+LLKHPRF SL V+++E+ G
Sbjct  60    QPLSPMACLFHEPDCNLYVIAMIGSKTRIDPDVVKANLVHSLLKHPRFFSLQVMEEEKGG  119

Query  354   KMKWVETEVDLSQHITVVE-APEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             +MKWV T+V+L +H+ V +   ++E   D       K+VEDY+  L+K  +D S+PLWDL
Sbjct  120   EMKWVPTKVNLEKHVIVPDMCSDMETSSD-------KYVEDYICNLTKTTLDFSKPLWDL  172

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+LN+KT DAEA+AV R+HH+LGDG S+ SLLLACTR+ ++P  LP++            
Sbjct  173   HLLNVKTSDAEAVAVFRIHHSLGDGTSLMSLLLACTRKASDPTALPSVPMMKKPKSSAGS  232

Query  711   pnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                 K         VWNT++DV + IAT+ FLKD  TP+   P   S  +R  +R +SL 
Sbjct  233   GKWWKAFRL-----VWNTIIDVLMVIATVLFLKDRDTPLRGPPNVGSTGRRIIHRTISLE  287

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRY--GKRDIGSIEGQNNLPKNLRLRSCLF  1064
             D   IK A +TT+NDV +G+TQA LS YLNRRY  GK++ G+ E +NNLPKNL +R+  F
Sbjct  288   DVVMIKNAMSTTVNDVMVGITQAGLSRYLNRRYAEGKKNKGATEKKNNLPKNLSIRATHF  347

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
              N+RP+ GI  LA+MM  EKG     S+  WGN  GY +LPL I + ++PLDY+++AK  
Sbjct  348   INIRPSAGIHTLAEMM--EKG-----SEAKWGNWIGYVLLPLSIALRDNPLDYIQKAKEA  400

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S E ++ + +A  +   FG K  ++L  K+ S  +  FSNVVGP+E++ FFGHP
Sbjct  401   MDRKKASLEALYIHSMAKSIPNLFGTKTGSVLCLKVPSRTTIWFSNVVGPQEEIAFFGHP  460

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             IA+IAP+C+GQP+ALM+H  SYVDKM +I+SVDE+ +PDP+QL DD E+S +LIK+
Sbjct  461   IAYIAPSCFGQPNALMIHVVSYVDKMNIILSVDESTVPDPHQLFDDLEESFNLIKN  516



>ref|XP_006441074.1| hypothetical protein CICLE_v10019854mg [Citrus clementina]
 gb|ESR54314.1| hypothetical protein CICLE_v10019854mg [Citrus clementina]
Length=494

 Score =   465 bits (1197),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 236/493 (48%), Positives = 320/493 (65%), Gaps = 25/493 (5%)
 Frame = +3

Query  138   SGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRF  317
             +G + ++  I EEP+SP++ L   P FN HI+AIMG  + INP V    + HTL+KHPRF
Sbjct  4     NGGKASSGDIYEEPLSPAALLFQAPNFNCHIIAIMGCKTSINPSVIKEGLQHTLIKHPRF  63

Query  318   TSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKE  497
             +S +VV   +  K KW    V++  H+ V   PE+    D       +FVEDY+  ++  
Sbjct  64    SSKLVV---QGRKKKWTRATVNVENHVIV---PEL----DPKMENPDQFVEDYISYITTN  113

Query  498   RMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIS  677
              MD S+PLW++H+LN+KT DAEA+ V R+HH++GDGAS+ SLLLACTR+T++P+ LPTI 
Sbjct  114   PMDYSKPLWEVHLLNVKTSDAEAVGVFRIHHSIGDGASLISLLLACTRKTSDPEALPTIP  173

Query  678   TR----SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPAS  845
              +    SS+               +  +L+WNT+ D+  F+AT+ FLKD++ P+   P  
Sbjct  174   VQKRGGSSTATAGWFCWWLLLAIWSAIRLIWNTIADLVTFLATVLFLKDTENPLKGGPGV  233

Query  846   ESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI----GSI  1013
             E  PKRF +R + L+D   +K A N TINDV LG+TQAALS YL+RRYG + +       
Sbjct  234   ELVPKRFVHRTIGLDDIKLVKNAMNMTINDVILGLTQAALSRYLHRRYGDKAMQNGGAKR  293

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
             E  N  PKNLRLR+ +  NLRP  GIQALADMM KE       SK GWGN  GY +LP  
Sbjct  294   ESNNTPPKNLRLRAAILVNLRPTTGIQALADMMAKE-------SKGGWGNWIGYILLPFT  346

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             I + NDPLDY+R AKAT DR+K+S E   T+  A FV+  FG K AA + +++ SN +  
Sbjct  347   IALQNDPLDYIRVAKATIDRRKHSLEAFCTFSTAKFVLYTFGAKVAAAIAHRVLSNTTMA  406

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSNVVGP E++ F+GHP+A++AP+ YG P AL +HFQSYV+KM   ++VD NVIPDP+ L
Sbjct  407   FSNVVGPLEEISFYGHPMAYLAPSVYGHPHALTIHFQSYVNKMTFCVAVDPNVIPDPHLL  466

Query  1554  LDDFEKSLHLIKD  1592
               D E+SL +IKD
Sbjct  467   CKDIEESLKVIKD  479



>ref|XP_010666700.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=520

 Score =   461 bits (1187),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 241/507 (48%), Positives = 341/507 (67%), Gaps = 25/507 (5%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             +R +KPI+   +  G+   +    EEP+SPSS + H+P FN+HILAIMG  + ++  +  
Sbjct  10    KRMIKPIKVIDK--GLMKFDEEEKEEPLSPSSIVFHKPNFNIHILAIMGCKTLVDLELCK  67

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
               +P TLLKHPRF+SL+V D  +  ++KWV TEVDL +HI V   P ++ E   +    +
Sbjct  68    SKIPLTLLKHPRFSSLVVGDLSKGEELKWVRTEVDLDKHIIV---PNIDSENIVSP---E  121

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLK-TRDAEALAVLRMHHALGDGASINSLLLAC  635
             K+VEDY+Y LSK  +D SRPLWD+HIL+LK   D +AL + R+HH+LGDG S+ SLLLA 
Sbjct  122   KYVEDYIYNLSKTTLDKSRPLWDIHILHLKLNEDVKALGIFRIHHSLGDGTSLISLLLAL  181

Query  636   TRQTANPKLLPTISTR----SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             TR+T++PK LPTI T+    + +  +               +L WNT  DV +F+AT  F
Sbjct  182   TRKTSDPKALPTIPTQKIMSNDNKIRKGLICRSIFVLWWVLQLFWNTFNDVLMFVATALF  241

Query  804   LKDSQTPITPSPASESK-PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             LKD+ +P+  S    S  P+R  Y+I SL+D   +K A   TINDVALG+TQA LS YL+
Sbjct  242   LKDN-SPLKSSLGRVSNTPRRIVYKIFSLDDMKLVKNAIGGTINDVALGITQAGLSRYLS  300

Query  981   RRYGKRDIG---SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             R+YG  +     S E     PKN+RLRS L  N+RP+ GIQALADMM+K+       ++ 
Sbjct  301   RKYGNDENNIEDSSEKMKKFPKNIRLRSVLLINIRPSGGIQALADMMEKD-------TEA  353

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  GY +LP  IG+ +DPLDY+REAKAT DRKK+S E  +T+++A  V+K FG K A
Sbjct  354   KWGNSLGYVLLPFTIGLRDDPLDYIREAKATVDRKKHSLEVNYTFFMAEVVMKLFGIKVA  413

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             + ++++I ++ +  FSN+VGP E++ F+GHP+AF+AP+ YGQP+ LM++FQSY++KM V+
Sbjct  414   SAISDRINAHTTIAFSNLVGPMEEIGFYGHPLAFLAPSSYGQPNELMINFQSYINKMTVV  473

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++VDE VIPDP+QL DD  +SL L+K+
Sbjct  474   LAVDEEVIPDPHQLCDDIVESLKLVKE  500



>ref|XP_006441689.1| hypothetical protein CICLE_v10019877mg [Citrus clementina]
 gb|ESR54929.1| hypothetical protein CICLE_v10019877mg [Citrus clementina]
Length=491

 Score =   451 bits (1161),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/476 (49%), Positives = 322/476 (68%), Gaps = 22/476 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP +R+ HEP  N++I+ ++GF SKINP V   N+ H+LLKH RF+SL VVD++  G
Sbjct  27    QPLSPMARMFHEPESNVYIVTMIGFKSKINPEVVKANLEHSLLKHHRFSSLQVVDEKIEG  86

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
              +KWV T+V+L  H+ V   P +E +  ++     KFVEDY   LS+  + MS P+WDLH
Sbjct  87    GLKWVPTKVNLDDHVIV---PNLEPKLIDSP---DKFVEDYTSSLSQTGIKMSMPMWDLH  140

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT DAE++AVLR+HH+LGDG S+ SLLLAC R+ ++P  +PTI + +         
Sbjct  141   LLNIKTSDAESVAVLRVHHSLGDGTSLMSLLLACCRKVSDPNEVPTIPSVTKKIDSNGHS  200

Query  714   nnpkpkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                 P       L WNTLVDV +FIAT L F++D++TP+     +   P+RF +R +SL+
Sbjct  201   KGFWPYLLFKLWLFWNTLVDVVMFIATALMFVRDTKTPLKGELGNGCLPRRFVHRSVSLD  260

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQNNLPKNLRLRSCLF  1064
             D   ++ A NTTINDV LGVTQA LS YLNR+YG+ +I  G  E  NNLP N+RLR+  F
Sbjct  261   DVKLVRNAMNTTINDVMLGVTQAGLSRYLNRKYGQLNIINGLSERNNNLPNNIRLRATFF  320

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
              NLRP+ GIQ LA+M+KK        SK  WGN+ GY I P  I + +DPLDY+REAKA 
Sbjct  321   MNLRPSAGIQELANMLKKG-------SKAKWGNQIGYLIFPFTIALRDDPLDYLREAKAA  373

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S E  F+Y+L+   +KF G KAA+       S  +  FSNV+GP+E++  +G+P
Sbjct  374   MDRKKASLEASFSYFLSKSFLKF-GNKAASFP-----SETTLWFSNVMGPQEEISLYGYP  427

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             IA++AP+C GQP+ LM+H  SY +KM  ++SVD+ +IPDP+QL DD E+SLHLIK+
Sbjct  428   IAYVAPSCCGQPNGLMIHVVSYANKMTFVLSVDDGLIPDPHQLCDDLEESLHLIKN  483



>ref|XP_011008179.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Populus euphratica]
Length=499

 Score =   450 bits (1158),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 233/502 (46%), Positives = 330/502 (66%), Gaps = 24/502 (5%)
 Frame = +3

Query  102   RNLKPIETRKQ-KSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             R +KPI+T K  ++ + +++    ++P+SP +R+ HEP  N++I+ I+GF +KINP V  
Sbjct  4     RAIKPIQTAKNVENVLSSSSADEEQQPLSPMARMFHEPDSNVYIIIIIGFQTKINPEVMR  63

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
              N+ +TLLKHPRF+SL V D++  G++KWV TEVDL  H+ +   P ++   D       
Sbjct  64    ANLGNTLLKHPRFSSLQVPDEKHGGQLKWVRTEVDLDNHVKI---PTIDPNMDFP----D  116

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACT  638
              +VEDYV  LSK ++ MS P+WDLH+LN+KT +AE++ +LR+HH++GDG S+ SL ++ T
Sbjct  117   MYVEDYVSNLSKTKISMSIPMWDLHLLNIKTSNAESVGILRVHHSIGDGTSLMSLFMSFT  176

Query  639   RQTANPKLLPT--ISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKD  812
             R+ ++P+ LPT  IS +      +        K  +   + WNTLVDV +F+ T+FFL D
Sbjct  177   RKASDPEALPTLPISKKQKPCSSSGGLLQHFIKLFSVLLIYWNTLVDVVMFLITIFFLDD  236

Query  813   SQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG  992
             ++TP+       S P+R  +R +SL D   +K A N TINDV +GVTQAALS YLNR+YG
Sbjct  237   TKTPLKGPLGVGSTPRRIVHRTVSLEDVKLVKNAMNATINDVMVGVTQAALSRYLNRKYG  296

Query  993   --KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNR  1166
               K+D G  EG +NLPKN+RLR+  F NLRP  G +++A     EK ES+S  + G  N 
Sbjct  297   ENKKDGGGAEGNSNLPKNIRLRATSFVNLRPYLGNESVA-----EKTESSSNVRLG--NL  349

Query  1167  FGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTN  1346
              GY +LP  I +  D LDYVR AKAT  RKK S E I+TY++A   +K FG K A+  T 
Sbjct  350   IGYVLLPFTIALREDALDYVRSAKATGKRKKASLEAIYTYFMAKTFLKLFGTKLASFPTQ  409

Query  1347  KIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDE  1526
                   +  FSNV GP E++  +GH +A+IAPTC+GQP+ALM+H  SY +KM +I+SVDE
Sbjct  410   -----TTLWFSNVAGPSEEITLYGHQVAYIAPTCFGQPNALMIHVVSYANKMNIILSVDE  464

Query  1527  NVIPDPNQLLDDFEKSLHLIKD  1592
              ++PDP+QL  D E+SL LIKD
Sbjct  465   GIVPDPHQLCHDLEESLKLIKD  486



>ref|XP_010662973.1| PREDICTED: O-acyltransferase WSD1 [Vitis vinifera]
Length=493

 Score =   447 bits (1151),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 222/480 (46%), Positives = 316/480 (66%), Gaps = 22/480 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP++RL     FN  I+AI+G  +  N HV    + HTL+KHPRF+SLMV DK   
Sbjct  14    EEPLSPAARLFQTRQFNCCIIAIIGCKTVFNSHVIKAGLEHTLIKHPRFSSLMVADKM-G  72

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G+M+W+ T+V++  HI +   P V    D       +F+E Y+  ++K  +D S+PLWD+
Sbjct  73    GEMRWIRTKVNVEDHIII---PNV----DPNMGSPDQFIESYISNMTKTYLDDSKPLWDI  125

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+LN+KT +AE+ A+ R+HH++GDG SI SL+LACTR+T++   LPTI T+         
Sbjct  126   HLLNVKTSEAESTAIFRIHHSIGDGMSIMSLVLACTRKTSDLNALPTIPTKKRQRSSNSG  185

Query  711   pnnpkpkpk-nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSL  887
                          +++ NTLVDV +FIAT  FL+D++TP+  +P  E  PK F ++ +SL
Sbjct  186   RFIRLVSYIWFVLQVICNTLVDVVMFIATSAFLRDTRTPLKGAPGVELSPKWFVHKTISL  245

Query  888   NDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIE------GQNNLPKNLRL  1049
             +D   +K A + TINDV LGVTQA LS YLNR+YG+   G+ E       +NNLP+ LR 
Sbjct  246   DDIKLVKNAMDMTINDVILGVTQAGLSRYLNRQYGRTGEGNAEEDAAKQKRNNLPRKLRF  305

Query  1050  RSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVR  1229
             R+ L FN+RP+  I+ALADMM+++       SK  WGN  GYA+LP+ I + +DPLDYVR
Sbjct  306   RAALIFNIRPSMAIEALADMMERK-------SKTKWGNYIGYALLPITIALRDDPLDYVR  358

Query  1230  EAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLE  1409
             EAKAT DRKK S E   T+  A +++   G K AA ++ K+FSN +  FSNVVGP +++ 
Sbjct  359   EAKATVDRKKRSLEAKCTFLSAKYIVNLLGAKVAAAISYKVFSNTTMSFSNVVGPVDEIS  418

Query  1410  FFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             F+GHP+A++AP+ YG P AL VHFQSY++ M + ++VD + +PDP+QL +D  +SL LIK
Sbjct  419   FYGHPMAYLAPSVYGHPHALTVHFQSYMNMMTISLAVDRDAVPDPHQLCNDLAESLKLIK  478



>ref|XP_006478431.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=491

 Score =   447 bits (1151),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 233/475 (49%), Positives = 319/475 (67%), Gaps = 22/475 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP +R+ HEP  N++I+ ++GF SKINP V   N+ H+LLKH RF+SL VVD++  G
Sbjct  27    QPLSPMARMFHEPESNVYIVTMIGFKSKINPEVVKANLEHSLLKHRRFSSLQVVDEKIEG  86

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
              +KWV T+V+L  H+ V   P +E +  ++     KFVEDY   LS+  + MS P+WDLH
Sbjct  87    GLKWVPTKVNLDDHVIV---PNLEPKLIDSP---DKFVEDYTSSLSQTGIKMSMPMWDLH  140

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT DAE++AVLR+HH+LGDG S+ SLLLAC R+ ++P  +PTI + +         
Sbjct  141   LLNIKTSDAESVAVLRVHHSLGDGTSLMSLLLACCRKVSDPNEVPTIPSVTKKIDSNGHS  200

Query  714   nnpkpkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                 P       L WNTLVDV +FIAT L F++D++TP+     +   P+RF +R +SL+
Sbjct  201   KGFWPYLLFKLWLFWNTLVDVVMFIATALMFVRDTKTPLKGELGNGCLPRRFVHRSVSLD  260

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQNNLPKNLRLRSCLF  1064
             D   +K A NTTINDV LGVTQA LS YLNR+YG+ +I  G  E  NNLP N+RLR+  F
Sbjct  261   DVKLVKNAMNTTINDVMLGVTQAGLSRYLNRKYGQLNIINGLSERNNNLPNNIRLRATFF  320

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
              NLRP+ GIQ LA+M+KK        SK  WGN+ GY I P  I + +DPLDY+REAK  
Sbjct  321   MNLRPSAGIQELANMLKKG-------SKAKWGNQIGYIIFPFTIALRDDPLDYLREAKVA  373

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S E  F+Y+L+   +KF G KAA+       S  +  FSNV+GP+E++   G+P
Sbjct  374   MDRKKASLEASFSYFLSKSFLKF-GNKAASFP-----SETTLWFSNVMGPKEEISLHGYP  427

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             IA++AP+C GQP+ LM+H  SY +KM  ++SVD+ +IPDP++L DD E+SLHLIK
Sbjct  428   IAYVAPSCSGQPNGLMIHVVSYANKMTFVLSVDDGLIPDPHKLCDDLEESLHLIK  482



>gb|KDO38719.1| hypothetical protein CISIN_1g041931mg [Citrus sinensis]
Length=491

 Score =   446 bits (1147),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 231/475 (49%), Positives = 319/475 (67%), Gaps = 22/475 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP +R+ HEP  N++I+ ++GF SKINP V   N+ H+LLKH RF+SL VVD++  G
Sbjct  27    QPLSPMARMFHEPESNVYIVTMIGFKSKINPEVVKANLEHSLLKHRRFSSLQVVDEKIEG  86

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
              +KWV T+V+L  H+ V   P +E +  ++     KFVEDY   LS+  + MS P+WDLH
Sbjct  87    GLKWVPTKVNLDDHVIV---PNLEPKLIDSP---DKFVEDYTSSLSQTGIKMSMPMWDLH  140

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT DAE++AVLR+HH+LGDG S+ SLLLAC R+ ++P  +PTI + +         
Sbjct  141   LLNIKTSDAESVAVLRVHHSLGDGTSLMSLLLACCRKVSDPNEVPTIPSVTKKIDSNGHS  200

Query  714   nnpkpkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                 P       L WNTLVDV +FIAT L F++D++TP+     +   P+RF +R +SL+
Sbjct  201   KGFWPYLLFKLWLFWNTLVDVVMFIATALMFVRDTKTPLKGELGNGCLPRRFVHRSVSLD  260

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQNNLPKNLRLRSCLF  1064
             D   ++ A NTTINDV LGVTQA LS YLNR+YG+ +I  G  E  NNLP N+RLR+  F
Sbjct  261   DVKLVRNAMNTTINDVMLGVTQAGLSRYLNRKYGQLNIINGLSERNNNLPNNIRLRATFF  320

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
              NLRP+ GIQ LA+M+KK        SK  WGN+ GY I P  I + +DPLDY+REAK  
Sbjct  321   MNLRPSAGIQELANMLKKG-------SKAKWGNQIGYIIFPFTIALRDDPLDYLREAKVA  373

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S E  F+Y+L+   +KF   KAA+       S  +  FSNV+GP+E++  +G+P
Sbjct  374   MDRKKASLEASFSYFLSKSFLKFCN-KAASFP-----SETTLWFSNVMGPQEEISLYGYP  427

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             IA++AP+C GQP+ LM+H  SY +KM  ++SVD+ +IPDP++L DD E+SLHLIK
Sbjct  428   IAYVAPSCCGQPNGLMIHVVSYANKMTFVLSVDDGLIPDPHKLCDDLEESLHLIK  482



>emb|CBI23136.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   446 bits (1147),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/477 (46%), Positives = 316/477 (66%), Gaps = 19/477 (4%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP++RL     FN  I+AI+G  +  N HV    + HTL+KHPRF+SLMV DK   
Sbjct  14    EEPLSPAARLFQTRQFNCCIIAIIGCKTVFNSHVIKAGLEHTLIKHPRFSSLMVADKM-G  72

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G+M+W+ T+V++  HI +   P V    D       +F+E Y+  ++K  +D S+PLWD+
Sbjct  73    GEMRWIRTKVNVEDHIII---PNV----DPNMGSPDQFIESYISNMTKTYLDDSKPLWDI  125

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+LN+KT +AE+ A+ R+HH++GDG SI SL+LACTR+T++   LPTI T+         
Sbjct  126   HLLNVKTSEAESTAIFRIHHSIGDGMSIMSLVLACTRKTSDLNALPTIPTKKRQRSSNSG  185

Query  711   pnnpkpkpk-nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSL  887
                          +++ NTLVDV +FIAT  FL+D++TP+  +P  E  PK F ++ +SL
Sbjct  186   RFIRLVSYIWFVLQVICNTLVDVVMFIATSAFLRDTRTPLKGAPGVELSPKWFVHKTISL  245

Query  888   NDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK---RDIGSIEGQNNLPKNLRLRSC  1058
             +D   +K A + TINDV LGVTQA LS YLNR+YG+    +  + + +NNLP+ LR R+ 
Sbjct  246   DDIKLVKNAMDMTINDVILGVTQAGLSRYLNRQYGEGNAEEDAAKQKRNNLPRKLRFRAA  305

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
             L FN+RP+  I+ALADMM+++       SK  WGN  GYA+LP+ I + +DPLDYVREAK
Sbjct  306   LIFNIRPSMAIEALADMMERK-------SKTKWGNYIGYALLPITIALRDDPLDYVREAK  358

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
             AT DRKK S E   T+  A +++   G K AA ++ K+FSN +  FSNVVGP +++ F+G
Sbjct  359   ATVDRKKRSLEAKCTFLSAKYIVNLLGAKVAAAISYKVFSNTTMSFSNVVGPVDEISFYG  418

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             HP+A++AP+ YG P AL VHFQSY++ M + ++VD + +PDP+QL +D  +SL LIK
Sbjct  419   HPMAYLAPSVYGHPHALTVHFQSYMNMMTISLAVDRDAVPDPHQLCNDLAESLKLIK  475



>emb|CBI40536.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   445 bits (1145),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 235/520 (45%), Positives = 319/520 (61%), Gaps = 81/520 (16%)
 Frame = +3

Query  99    ERNLKPIETRK------QKSGM--ENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNS  254
             ++ LKPI+T++      +  G   E+       E +SP  R+ HE  FN++++AI GF  
Sbjct  11    QQALKPIQTKRLAAREVEGDGKKPEDIKEEEEGEALSPVGRIFHETCFNVYVIAIAGFKI  70

Query  255   KINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEG  434
             +IN  V   N+ HTLLKHPRF+SL V D +++G MKWV T+VDL +HI +   P +    
Sbjct  71    RINVDVVKANLEHTLLKHPRFSSLQVKDVKKDGGMKWVPTKVDLDKHIII---PSLH---  124

Query  435   DETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASI  614
               T     K VEDY+  LSK  +D S+PLW+LHILN+KT DAE++AV R+HH+LGDG S+
Sbjct  125   -HTISSPDKMVEDYISNLSKTYIDYSKPLWELHILNIKTSDAESVAVFRIHHSLGDGMSL  183

Query  615   NSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT  794
              SL+L+C+RQ +NPK LPT+  + +S                                  
Sbjct  184   MSLVLSCSRQISNPKALPTLPAKKTS----------------------------------  209

Query  795   LFFLKDSQTPITPSPASESK------------PKRFAYRILSLNDFFSIKLATNTTINDV  938
                         P P +  +            P+RF YR +SL+D   IK    TTINDV
Sbjct  210   -----------NPDPVNSGRICNGWKKGGGHVPRRFVYRTVSLDDIKLIKNGMKTTINDV  258

Query  939   ALGVTQAALSMYLNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMM  1112
              +GV+ A LS YLNRRYG  K D G+ + +NNLPKN+RLR+ L  N+RP+ G+ ALA+MM
Sbjct  259   VMGVSLAGLSRYLNRRYGETKEDKGATQKKNNLPKNIRLRATLMMNIRPSPGLHALAEMM  318

Query  1113  KKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYL  1292
               EKG     SK  WGN  G  +LP  I + +DPLDYVR+ KAT DRKK+S+E IFT ++
Sbjct  319   --EKG-----SKAKWGNWIGSMLLPFAIALYDDPLDYVRQTKATIDRKKHSHEAIFTCFI  371

Query  1293  ANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALM  1472
                V+K FG K AA L +++ ++ + CFSNVVGP E++ F+GHP+AF+AP+ YGQP  LM
Sbjct  372   IKTVLKLFGAKVAAFLYHRVMNHTTMCFSNVVGPMEEIGFYGHPMAFLAPSVYGQPQGLM  431

Query  1473  VHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +HFQSY++KM  I+SVDE +IPDPN+L DD E+SL  IKD
Sbjct  432   IHFQSYINKMTFILSVDEEIIPDPNRLCDDLEESLKFIKD  471



>ref|XP_004309135.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score =   444 bits (1143),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 220/483 (46%), Positives = 315/483 (65%), Gaps = 23/483 (5%)
 Frame = +3

Query  171   EEP---VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK  341
             E+P   +SP+ RL H P F+ +I+  MG ++ INP VF+  +   L  HPRF+S+MV D+
Sbjct  16    EDPRPSLSPTGRLFHSPKFSCYIVVRMGCSTWINPQVFSAGLKEHLPMHPRFSSIMVKDR  75

Query  342   EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPL  521
                GK +W++  V++  H+ V   P ++ + ++      KFV DY+  L+   +D+S+PL
Sbjct  76    NLCGKKRWIQVSVNMEDHVIV---PNMDSDMEDA----DKFVRDYISHLTTSPLDLSKPL  128

Query  522   WDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----SS  689
             W++HI+N+KT DAEA+ V+R+HH++GDGAS+ SLLLACTR+T++P  LP++  +     S
Sbjct  129   WEVHIVNVKTSDAEAVVVIRIHHSMGDGASLMSLLLACTRKTSDPDALPSVPNQRKHQGS  188

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S               +   L+ NT VD+ +F+AT+ FLKD++TPI   P  E   KRF 
Sbjct  189   SSSDLSVFWWLLLAIWSAVTLIGNTFVDLVLFVATILFLKDTKTPIKGPPGVELTAKRFL  248

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK--RDIGSIEGQNNLPKNL  1043
             +R +SL+    +K A N TINDV LGVTQA LS YLN +YG+  +D G+ +  NNLPK++
Sbjct  249   HRTVSLDHIKQVKNAMNMTINDVVLGVTQAGLSQYLNYKYGENEKDEGAKKKGNNLPKSI  308

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLR+ +  NLR A GIQ LADMM K+       SK  WGNR GY ++P  I + +DPLDY
Sbjct  309   RLRANILVNLRSAAGIQDLADMMAKK-------SKTKWGNRIGYVLVPFIIALQDDPLDY  361

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             VR AK+  DRKK+S E   TY  AN + K  G K A  + +++  N++  F+N++GP E+
Sbjct  362   VRGAKSHLDRKKHSLEAFCTYLCANVLTKLIGAKGAGAVAHRVLCNSTLAFTNLIGPLEE  421

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + ++GHP+ +IAP  YG P AL +HFQSYVDKM + ++VD NVIPDP +LLDD E+SL L
Sbjct  422   ISYYGHPVTYIAPNVYGHPHALHIHFQSYVDKMTISLAVDPNVIPDPEKLLDDLEESLQL  481

Query  1584  IKD  1592
             I D
Sbjct  482   IHD  484



>emb|CBI40544.3| unnamed protein product [Vitis vinifera]
Length=531

 Score =   444 bits (1141),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 229/508 (45%), Positives = 317/508 (62%), Gaps = 65/508 (13%)
 Frame = +3

Query  99    ERNLKPIETRKQKS-----GMENNNMSIAE-EPVSPSSRLLHEPAFNLHILAIMGFNSKI  260
             ++ LKPI+T++  +     G +  ++   E E +SP  R+ HE  FN++++AI G  ++I
Sbjct  71    QQALKPIQTKRSGAREVGDGKKPGDIKEEEGEALSPVGRIFHETCFNVYVIAIAGCKTRI  130

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             N  V   N+ H+LLKHPRF+SL V D +++G MKWV T+VDL +HI +   P +      
Sbjct  131   NVDVVKANLEHSLLKHPRFSSLQVKDVKKDGGMKWVPTKVDLDKHIII---PSLH----H  183

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
             T     K VEDY+  LSK  +D S+PLW+LHILN+KT DAE++AV R+HH+LGDG    +
Sbjct  184   TISSPDKMVEDYISNLSKTYIDYSKPLWELHILNIKTSDAESVAVFRIHHSLGDGMIWWT  243

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLF  800
             + L                                         VWNT++DV +F+AT  
Sbjct  244   IRL-----------------------------------------VWNTIIDVLMFLATTL  262

Query  801   FLKDSQTPITPS--PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
             FLKD+ TP++          P+RF YR +SL+D   IK    TTINDV +GV+ A LS Y
Sbjct  263   FLKDTMTPLSNGWKKGGGHVPRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLSRY  322

Query  975   LNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRYG  K D G+ + +NNLPKN+RLR+ L  N+RP+ G+  LA+MM  EKG     SK
Sbjct  323   LNRRYGETKEDKGATQKKNNLPKNIRLRATLMMNIRPSPGLHVLAEMM--EKG-----SK  375

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGN  G  +LP  I + +DPLDY+R+ KAT DRKK+S+E IF Y++   V+K FG K 
Sbjct  376   AKWGNWIGSMLLPFAIALYDDPLDYIRQTKATIDRKKHSHEAIFAYFIIKTVLKLFGAKV  435

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             AA L  ++ ++ + CFSNVVGP E++ F+GHP+AF+AP+ YGQP  LM+HFQSY++KM  
Sbjct  436   AAFLYRRVLNHTTMCFSNVVGPMEEIGFYGHPMAFLAPSVYGQPQGLMIHFQSYINKMTF  495

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++SVDE +IPDP +L DD E+SL  IKD
Sbjct  496   VLSVDEEIIPDPTRLCDDLEESLKFIKD  523



>ref|XP_007219046.1| hypothetical protein PRUPE_ppa004668mg [Prunus persica]
 gb|EMJ20245.1| hypothetical protein PRUPE_ppa004668mg [Prunus persica]
Length=497

 Score =   442 bits (1136),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 319/475 (67%), Gaps = 19/475 (4%)
 Frame = +3

Query  180   VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKM  359
             +SP+SRL H P FN +I+ ++GF ++INP V    +  TL  HPRF+S +  D  + GK 
Sbjct  25    LSPASRLFHSPQFNCYIVIVIGFQTEINPDVVKAGLKETLYHHPRFSSKLNKD-SKGGKK  83

Query  360   KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHIL  539
             +W+   V+   H+ V   P ++   D       +FVEDY+  L+   +D+S+PLW++H+L
Sbjct  84    RWIRVSVNEEDHVFV---PNLDSNIDHP----DQFVEDYISNLTTAPLDLSKPLWEVHLL  136

Query  540   NLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppktlkp  713
             N+KT  AEA+AV R+HH++GDGAS+ SLLLACTR+T++P  LPT+   TR+ S   +   
Sbjct  137   NVKTSYAEAVAVFRLHHSMGDGASLMSLLLACTRKTSDPDALPTVPTKTRADSSSNSSWF  196

Query  714   nnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLND  893
                     +   L+WNTLVD+ +FIATL FL+D++TPI  +P  E   KRF +R +SL+ 
Sbjct  197   CWFIFAIWSGLTLIWNTLVDMMLFIATLVFLQDTKTPIKGAPGVELTAKRFVHRTVSLDH  256

Query  894   FFSIKLATNTTINDVALGVTQAALSMYLNRRYGK--RDIGSIEGQNNLPKNLRLRSCLFF  1067
                +K A   TINDV  GVTQA LS YL RRYG+  +D GS + ++NLPKN+RLR+ +  
Sbjct  257   IKQVKNAMGMTINDVVFGVTQAGLSQYLIRRYGQNEKDEGSKQKRSNLPKNIRLRANVLS  316

Query  1068  NLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATA  1247
             NLRP  GIQALADMM ++       SK  WGNRFGY ++P  I + + PLDYVR+AKA  
Sbjct  317   NLRPTVGIQALADMMARK-------SKARWGNRFGYILIPFTIALRDGPLDYVRQAKAVI  369

Query  1248  DRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPI  1427
             DRKK+S E   TY +AN +IK  G KAA  + +++ S+++  FSN+VGP E++ F+GHPI
Sbjct  370   DRKKHSLEAFCTYLIANVLIKIIGAKAAGAIAHRVISHSTLSFSNLVGPLEEISFYGHPI  429

Query  1428  AFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              F+AP  YG P AL +HFQSYVDKM + +++D +VIPDPN+LLDD E+SL LI D
Sbjct  430   TFMAPYVYGHPHALHMHFQSYVDKMTICLTIDPDVIPDPNKLLDDLEESLKLICD  484



>ref|XP_008234742.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
 ref|XP_008234744.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=520

 Score =   441 bits (1135),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 234/508 (46%), Positives = 327/508 (64%), Gaps = 30/508 (6%)
 Frame = +3

Query  117   IETRKQKSGMENNN----MSIAEEPV--------SPSSRLLHEPAFNLHILAIMGFNSKI  260
             I T +++  ME         I +EP+        SP+SRL H P FN +I+ +MG  + I
Sbjct  14    INTIRKQQDMEPETKVAATCIHDEPITNEDRLSLSPASRLFHSPQFNCYIVIVMGCQTGI  73

Query  261   NPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             NP V    +  TL  HPRF+S +     + GK +W+   V+   H+ V   P ++   D 
Sbjct  74    NPDVVKAGLKETLYHHPRFSSKLENKDIKGGKKRWIRVSVNEEDHVFV---PNLDSNIDH  130

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
                   +FVEDY+  L+   +D+S+PLW++H+LN+KT  A+A+AV R+HH++GDGAS+ S
Sbjct  131   P----DQFVEDYISNLTTAPLDLSKPLWEVHLLNVKTSYAKAVAVFRLHHSMGDGASLMS  186

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpk--nffklVWNTLVDVFIFIAT  794
             LLLACTR+T++P  LPT+ TR+ +   +             +   L+WNTLVD+ +FI T
Sbjct  187   LLLACTRKTSDPDALPTVPTRTRADSSSNSSWFWWFILAIWSGITLMWNTLVDMMLFITT  246

Query  795   LFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
             L FL+D++TPI  +P  E   KRF +R +SL+    +K A   TINDV  GVTQA LS Y
Sbjct  247   LVFLQDTKTPIKGAPGVELTAKRFVHRTVSLDHIKQVKNAMGMTINDVVFGVTQAGLSQY  306

Query  975   LNRRYGK--RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             LNRRYG+  +D GS + ++NLPKN+RLR+ +  NLRP  GIQALADMM K+       SK
Sbjct  307   LNRRYGQNEKDEGSKQKRSNLPKNIRLRANVLANLRPTVGIQALADMMAKK-------SK  359

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGNRFGY ++P  I + + PLDYVR+AK   DRKK+S E + TY +AN +IK  G KA
Sbjct  360   ARWGNRFGYILIPFTIALQDGPLDYVRQAKVVIDRKKHSLEALCTYVIANVLIKIIGAKA  419

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             A  + +++ S+++  FSN+VGP E++ F+GHPI F+AP  YG P AL +HFQSYVDKM +
Sbjct  420   AGAIAHRVISHSTLSFSNLVGPLEEISFYGHPINFMAPYVYGHPHALHMHFQSYVDKMTI  479

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              +++D +VIPDPN+LLDD E+SL LI D
Sbjct  480   CLTIDPDVIPDPNKLLDDLEESLKLICD  507



>gb|KDP24675.1| hypothetical protein JCGZ_26453 [Jatropha curcas]
Length=498

 Score =   439 bits (1128),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/490 (46%), Positives = 314/490 (64%), Gaps = 31/490 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EE +SP++ L H P FN HI+A+MG    I+P +    + HTL+KHPRF+S +V+   ++
Sbjct  14    EETLSPAALLFHAPHFNCHIIAVMGCKIPIDPTIVKLGLEHTLIKHPRFSSKLVI---KS  70

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              KMKW  T V++  H+ V   P +    D       +F+EDY+  L+   MD S+PLW+L
Sbjct  71    RKMKWTPTTVNVQDHVIV---PNL----DNKIESPNQFIEDYISHLTTIPMDSSKPLWEL  123

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+LNLK+  AEA+ + ++HH++GDGAS+ SLLLACTR+T++P+ LPTI  +  +      
Sbjct  124   HLLNLKSSYAEAIGIFKIHHSIGDGASLMSLLLACTRKTSDPEALPTIPMQKRASASNSS  183

Query  711   pnnpkpkpk--------------nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASE  848
               +                       KLVWNTLVD+ +F++T+ FLKD++TP       +
Sbjct  184   TASASASASASSNGLQKLFWNIFMILKLVWNTLVDLILFVSTILFLKDTKTPFKGESGVD  243

Query  849   SKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK--RDIGSIEGQ  1022
              KPKRF YR +SL+D   +K   N TINDV LG+TQA LS YLN ++GK  +D      +
Sbjct  244   LKPKRFVYRSVSLDDIKLVKNKMNMTINDVILGITQAGLSRYLNHQFGKNEKDGDRKHKK  303

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
              +L K++RLR+ +  NLRP  GIQ LA++M KE     S  KWGWGN  GY ++P  I +
Sbjct  304   ISLQKSIRLRATVLVNLRPVVGIQTLAELMGKE-----SKGKWGWGNSIGYIMVPFTIAL  358

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
              +DPLDY+R+AKAT DRKK S E IFT+ +A  VI  FG K A  + ++  SN +  FSN
Sbjct  359   QDDPLDYIRKAKATIDRKKLSLEAIFTFQIAKLVIMTFGHKVAGAIAHRFLSNTTLAFSN  418

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             VVGP ED+ F+GHPI F+AP+ YG P AL +HFQSY +KM ++I+VD +VI +P++L D 
Sbjct  419   VVGPLEDISFYGHPIDFLAPSVYGHPHALTIHFQSYSNKMTIVIAVDPDVISNPHKLCDH  478

Query  1563  FEKSLHLIKD  1592
              E+SL++IKD
Sbjct  479   LEESLNIIKD  488



>ref|XP_010671458.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=519

 Score =   437 bits (1124),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/503 (44%), Positives = 323/503 (64%), Gaps = 27/503 (5%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LKPI TR +             EP+SP+SRL H P  N  I+A++G  + IN  V    +
Sbjct  26    LKPINTRSRTKDE-------VVEPLSPASRLFHAPQLNCCIIAMVGCKTMINVEVIKDGI  78

Query  288   PHTLLKHPRFTSLMVVDKEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
               T++KHPR +S +V   +++GK + W+ T+V++  H+ V   P +    +       KF
Sbjct  79    NQTMVKHPRISSKLVFHPKKHGKPVGWIRTKVNVDDHVIV---PNLHSHINSP----DKF  131

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VEDYV  L++  MD+++PLW++HILN+KT+DA ++A+ R+HH++GDG S+ SL+LACTR+
Sbjct  132   VEDYVTNLTQTPMDLTKPLWEIHILNIKTKDANSIAIFRIHHSIGDGVSLMSLVLACTRK  191

Query  645   TANPKLLPTISTRSSSppktlkpnnpkpkpkn------ffklVWNTLVDVFIFIATLFFL  806
             T++P  +PT  T      K  + ++               K++WNT+VD+  F+AT+ FL
Sbjct  192   TSDPNAVPTFPTEDKKKKKLFENSSSFWLLSCFLWLWFALKMLWNTIVDLCFFLATMIFL  251

Query  807   KDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRR  986
             KD+ TP+  S  +E  PK+F YRILSL+D   +K   N TINDV +G+TQA LS YLNR+
Sbjct  252   KDTNTPVKASRGTEKGPKKFVYRILSLDDIKLVKNVMNVTINDVIVGITQAGLSRYLNRK  311

Query  987   YGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNS-MSKWGWGN  1163
             YG+        QN+LP+++RLRS L  N+RP   IQ LA+ M     ESN    KW WGN
Sbjct  312   YGESKGDQNVQQNHLPQHIRLRSTLLVNIRPTSKIQDLAEQM-----ESNDPKRKWEWGN  366

Query  1164  RFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILT  1343
               GY +LP  I + ++PLDY+R+AK T D+KK S E +FT+  A F++K  G    A +T
Sbjct  367   SIGYILLPFDIALRDNPLDYIRKAKTTIDKKKQSLEAVFTFICAEFILKALGLGVTATIT  426

Query  1344  NKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVD  1523
             ++  SNA+  FSNVVGP+E++ F+GHP+ F+AP+ YG P AL VHFQSY+D+M ++++VD
Sbjct  427   HRALSNATLSFSNVVGPKEEISFYGHPMTFLAPSVYGHPHALTVHFQSYMDQMTLVLAVD  486

Query  1524  ENVIPDPNQLLDDFEKSLHLIKD  1592
             +NVIP+P++L DD E+ L   K+
Sbjct  487   QNVIPEPHRLCDDIEEFLAFAKE  509



>ref|XP_009392540.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   435 bits (1118),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/477 (47%), Positives = 307/477 (64%), Gaps = 17/477 (4%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP++RL H P FN HI+AIMG   +I+  V    +  TL +HPRF S+ V+D+ E 
Sbjct  4     EEPMSPAARLFHAPHFNCHIIAIMGSGKEIDIDVLKAGIRATLARHPRFCSIQVLDETEG  63

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              K +WV T+V++ +H+ +   P++   G +T   ++  +EDYV  L +  MD SRP+W+ 
Sbjct  64    KKARWVRTDVEVEKHLVI---PDLHPNGGDTSAADR-LLEDYVASLGRSTMDASRPMWEF  119

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             HILN  T +A A+AV R+HH+LGDGAS+ SLLLAC R+T++P  LP++      P    +
Sbjct  120   HILNFPTSEAAAVAVFRVHHSLGDGASLMSLLLACFRKTSDPDALPSLPGPHRPPRSPPR  179

Query  711   pnnpkpkpk---nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRIL  881
                P    +       LVWNTLVDV  F+AT  FLKD+ TP   + ++E  PKRF +R +
Sbjct  180   ALRPLALLRRLWVTLVLVWNTLVDVAYFVATSIFLKDTPTPFKGAESTEFHPKRFVHRTI  239

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCL  1061
             SL+D  +IK A + TINDV +GVT A+LS YL+R+YGK   G       LP+N+R+RS L
Sbjct  240   SLHDVKAIKNAMHCTINDVLVGVTSASLSCYLSRKYGKISTG-----QQLPENIRMRSTL  294

Query  1062  FFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKA  1241
               N+RP   I ALA  M     E  + S   WGN  GY +LP  + +  DPLDYVR+ K+
Sbjct  295   LVNMRPTPTIHALAGAM-----EEGNTSGDKWGNLLGYLLLPFPVALYKDPLDYVRKGKS  349

Query  1242  TADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGH  1421
              ADRKK S E +FTY     V K+ G KAAA L++++ SN +  FSN+VGP E++EF+GH
Sbjct  350   MADRKKNSMEALFTYRSGAVVFKYCGFKAAAALSHRVLSNTTLSFSNIVGPIEEIEFYGH  409

Query  1422  PIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             P+ ++APT YG P AL V   SY++ M V+++VDE  IPDP+QLLDDF  SL LIK+
Sbjct  410   PMVYLAPTVYGHPHALTVTLMSYMNTMKVVLAVDELAIPDPHQLLDDFADSLELIKE  466



>ref|XP_008376728.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Malus domestica]
Length=506

 Score =   436 bits (1121),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 326/517 (63%), Gaps = 43/517 (8%)
 Frame = +3

Query  90    MEMERNLKP-IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINP  266
             ME E  ++    T ++ S  E+++  I    +SP+SRL H P FN +I+ IMGF ++I+ 
Sbjct  1     MEPEATMEATCSTHEESSTKEDHHRLI----LSPASRLFHSPRFNCYIVIIMGFKTRIDS  56

Query  267   HVFTHNMPHTLLKHPRFT-------SLMVVDKEENGKMKWVETEVDLSQHITV------V  407
             ++  + +   L  HPRF+       S ++   +  GK +W++  V+   H+ V      +
Sbjct  57    NIVKNGLK-VLHNHPRFSCRLLMIYSFLLYKDDRGGKKRWIQVSVNQEDHVFVPTLNSKI  115

Query  408   EAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMH  587
             E PE             +FVE+Y+  L+   +D+S+PLW++H+LN+KT +AE LAV+RMH
Sbjct  116   EHPE-------------EFVENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGLAVIRMH  162

Query  588   HALGDGASINSLLLACTRQTANPKLLPTIST--RSSSppktlkpnnpkpkpknffklVWN  761
             H++GDGAS+ SLLLACTR+T++P  LP++ T  R+ S                   L+ N
Sbjct  163   HSMGDGASLMSLLLACTRKTSDPNALPSVPTQKRADSSSDLGWFWRFILAIWYGITLIAN  222

Query  762   TLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVA  941
             TLVD+ +FIATL FL D++TPI  S       KRF +R +S+N    +K A  TT+NDV 
Sbjct  223   TLVDIMLFIATLLFLNDTETPIKGSSDVHLTTKRFLHRTVSMNHIKQVKNAMGTTVNDVV  282

Query  942   LGVTQAALSMYLNRRYGK--RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMK  1115
             LGVTQA LS YLNRRYG+  +D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM 
Sbjct  283   LGVTQAGLSCYLNRRYGQNVKDVGTKQEGSNLPKNMHVRANILVNLRPTVGIQDLADMMA  342

Query  1116  KEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLA  1295
             K+       SK  WGN  GY ++P  I + +DPLDYVR AKA  DRKK+S E  FTY  A
Sbjct  343   KK-------SKVRWGNCIGYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLEAFFTYLTA  395

Query  1296  NFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMV  1475
             N +IK  G KAA +L ++I S+++  FSN+VGP+E++ F+GH I F++P  YG P AL +
Sbjct  396   NLLIKIIGAKAAGVLAHRIISHSTFSFSNLVGPQEEISFYGHQITFMSPHVYGHPHALHM  455

Query  1476  HFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             H+QSY D+M V ++VD NVIPDP +LLDD E+SL LI
Sbjct  456   HWQSYADEMTVCLTVDPNVIPDPEKLLDDLEESLKLI  492



>ref|XP_010666751.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   436 bits (1120),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 234/507 (46%), Positives = 329/507 (65%), Gaps = 43/507 (8%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             +R +KPI+   +  G+   +    EEP+SPSS + H+P FN+HILAIMG  + ++  +  
Sbjct  10    KRMIKPIKVIDK--GLMKFDEEEKEEPLSPSSIVFHKPNFNIHILAIMGCKTLVDLELCK  67

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
               +P TLLKHPRF+SL+V D  +  ++KWV TEVDL +HI V   P ++ E   +    +
Sbjct  68    SKIPLTLLKHPRFSSLVVGDLSKGEELKWVRTEVDLDKHIIV---PNIDSENIVSP---E  121

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLK-TRDAEALAVLRMHHALGDGASINSLLLAC  635
             K+VEDY+Y LSK  +D SRPLWD+HIL+LK   D +AL + R+HH+LGDG S+ SLLLA 
Sbjct  122   KYVEDYIYNLSKTTLDKSRPLWDIHILHLKLNEDVKALGIFRIHHSLGDGTSLISLLLAL  181

Query  636   TRQTANPKLLPTISTR----SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             TR+T++PK LPTI T+    + +  +               +L WNT  DV +F+AT  F
Sbjct  182   TRKTSDPKALPTIPTQKIMSNDNKIRKGLICRSIFVLWWVLQLFWNTFNDVLMFVATALF  241

Query  804   LKDSQTPITPSPASESK-PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             LKD+ +P+  S    S  P+R  Y+I SL+D   +K A   TINDVALG+TQA LS YL+
Sbjct  242   LKDN-SPLKSSLGRVSNTPRRIVYKIFSLDDMKLVKNAIGGTINDVALGITQAGLSRYLS  300

Query  981   RRYGKRDIG---SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             R+YG  +     S E     PKN+RLRS L  N+RP+ GIQALADMM+K+       ++ 
Sbjct  301   RKYGNDENNIEDSSEKMKKFPKNIRLRSVLLINIRPSGGIQALADMMEKD-------TEA  353

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  GY +LP  IG+ +DPLDY+REAKAT DRKK+S E                   A
Sbjct  354   KWGNSLGYVLLPFTIGLRDDPLDYIREAKATVDRKKHSLE------------------VA  395

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
             + ++++I ++ +  FSN+VGP E++ F+GHP+AF+AP+ YGQP+ LM++FQSY++KM V+
Sbjct  396   SAISDRINAHTTIAFSNLVGPMEEIGFYGHPLAFLAPSSYGQPNELMINFQSYINKMTVV  455

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             ++VDE VIPDP+QL DD  +SL L+K+
Sbjct  456   LAVDEEVIPDPHQLCDDIVESLKLVKE  482



>ref|XP_003588522.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES58773.1| O-acyltransferase (WSD1-like) family protein [Medicago truncatula]
Length=483

 Score =   435 bits (1118),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 214/479 (45%), Positives = 310/479 (65%), Gaps = 23/479 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP++RL H P+FN +++AI+G  + INP V    +  T+LKHPRFTS +V   ++  
Sbjct  10    EPLSPAARLFHSPSFNCYVIAIIGCKTSINPQVIRDGLCQTILKHPRFTSKLV---KKGR  66

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K +W ET +DL  HI V   P+++ + D   R    FVEDY+   +K  +D+S+PLW+LH
Sbjct  67    KTRWTETTIDLDNHIIV---PQIDSKIDFPDR----FVEDYISNFTKTPLDISKPLWELH  119

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----SSSppk  701
             +LN+KT +AE++ + R+HH+LGDG S+ SLL+A TR+T++P  LPT+ T      S+   
Sbjct  120   LLNIKTSNAESIGIFRIHHSLGDGTSLISLLIAATRKTSDPNALPTVPTTRKRDDSNVHN  179

Query  702   tlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRIL  881
                  +         +L+WNT+VDV + + T+ F KD+ TP+  +   E   KRF Y ++
Sbjct  180   CSIIVSFWLSILWGLRLIWNTIVDVLLLVLTILFFKDTHTPLKGAHGVELNTKRFVYLMV  239

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQNNLPKNLRLRS  1055
             S++D   +K    TTINDV LG+TQA L+ YLNR YG ++   G+   ++ +PKN+RLR+
Sbjct  240   SMDDIKLVKAEMKTTINDVLLGLTQAGLARYLNREYGVKNANDGAAMSKSGIPKNIRLRA  299

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              +  N+R + GIQ LADMM  EKG++       WGN+ GY I P  I +  DPL+YVR+A
Sbjct  300   SILVNIRASPGIQDLADMMA-EKGKAR------WGNKMGYIIFPFNIALQEDPLEYVRQA  352

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFF  1415
             KAT DRKK S E I +Y  A  V+  FG K A ++T ++  + +  FSNV GP E++ F+
Sbjct  353   KATIDRKKQSLEAICSYACAKLVLNLFGVKIAGVITRRVLFHTTMAFSNVAGPVEEISFY  412

Query  1416  GHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             GHP+AFIAP+ YG P AL +HFQSY ++M + ++VD  +IPDP  L DDFE+SL LI D
Sbjct  413   GHPVAFIAPSVYGHPHALTIHFQSYANQMTISMAVDPTIIPDPYLLCDDFEESLKLICD  471



>ref|XP_009601405.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=514

 Score =   434 bits (1115),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/515 (43%), Positives = 317/515 (62%), Gaps = 34/515 (7%)
 Frame = +3

Query  105   NLKPIETRK--------QKSGMENNNMSIAEE---------PVSPSSRLLHEPAFNLHIL  233
              LKPI+T+           +G +N+ + + EE         P SP++RL H  + + HI+
Sbjct  5     GLKPIDTKTTIELSKMGMTNGQKNSTVVVVEEEQKKQVQLEPASPATRLFHTKSLSCHII  64

Query  234   AIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEA  413
             AI+G  +KIN  +    +  TLL HPRFTS+ VVD E+ G  KW +T V++  H+     
Sbjct  65    AILGCTTKINVDLIKKGLESTLLNHPRFTSIPVVD-EKKGVRKWKQTTVNVGNHMV---C  120

Query  414   PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHA  593
             P+++ + D       +FVE+Y   L+   MDM++PLW++HILN+KT +AEA  +L++HH+
Sbjct  121   PDLDPDMDSP----DEFVENYTSSLTTIPMDMTKPLWEVHILNVKTSEAEATGILKLHHS  176

Query  594   LGDGASINSLLLACTRQTANPKLLPTISTRS--SSppktlkpnnpkpkpknffklVWNTL  767
             +GDG SI SL+LACTR+ ++P+ LPTI T S   S  +                + WNT 
Sbjct  177   IGDGMSIISLILACTRKASDPEALPTIPTGSKKESSDEAGFCRRFCFSVWVLSMVFWNTF  236

Query  768   VDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALG  947
             VD  +F+AT+ FLKD++TPI      E  PKR  +R +SL+D   +K A N TINDV +G
Sbjct  237   VDAILFLATILFLKDTETPIKGGAGVEHNPKRLVHRTISLDDMKIVKNALNLTINDVVMG  296

Query  948   VTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKG  1127
             + QA +S YLNRRYG +        NNLPKN+RLR  + FN+RP+ GI+ LA+MM+K+  
Sbjct  297   IAQAGISRYLNRRYGNKKGRGSSKTNNLPKNIRLRGSIVFNIRPSAGIKVLAEMMEKK--  354

Query  1128  ESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVI  1307
                  SK  WGN+ GY + PL I + ++PLDY+ +AKA  D+K  S E  F++  A    
Sbjct  355   -----SKAKWGNKIGYVLTPLPISLPDNPLDYIHQAKAIIDKKNLSLESRFSFAAAKLTQ  409

Query  1308  KFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQS  1487
               FG   AA LTN++ S+ +   SNVVGP+E++ FFGH +A+ APT  G P AL++HFQS
Sbjct  410   DIFGSNVAAKLTNRVLSHTTILLSNVVGPQEEITFFGHKLAYAAPTICGLPHALIMHFQS  469

Query  1488  YVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             Y +KM + +SVD  VIPDP QL DDFE SL + K+
Sbjct  470   YCNKMTISMSVDPLVIPDPYQLCDDFEDSLQMFKN  504



>ref|XP_010095756.1| O-acyltransferase WSD1 [Morus notabilis]
 gb|EXB62176.1| O-acyltransferase WSD1 [Morus notabilis]
Length=654

 Score =   438 bits (1126),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 233/443 (53%), Positives = 302/443 (68%), Gaps = 28/443 (6%)
 Frame = +3

Query  306   HPRF-TSLMVVD-KEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKN--KKFVE  470
             H +F  S+ +VD KE +GK MKWV TEVDL++HI     PE+    D  + K+   KF+E
Sbjct  217   HVKFDESIKIVDEKEGDGKIMKWVRTEVDLNKHII---TPEI----DLANYKDCPDKFLE  269

Query  471   DYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTA  650
             DY+Y L+K  +D SRPLWDLHILN+KT  AE + + R+HH+LGDG S+ SLLLACTRQT+
Sbjct  270   DYIYNLTKTSLDKSRPLWDLHILNVKTSQAEGVGIFRVHHSLGDGISLMSLLLACTRQTS  329

Query  651   NPKLLPTISTRSSSppktlkpnnpkpkpknff-----klVWNTLVDVFIFIATLFFL-KD  812
             NP+ LPTI T   S  +             F      KL+WN++VDVF+F+AT F L KD
Sbjct  330   NPEALPTIPTAKISKDEKKGGFVSMFLLGLFGLWWIFKLLWNSVVDVFMFMATAFLLIKD  389

Query  813   SQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG  992
             ++TPI   P S + PKR  ++I+SL+D   +K A NTTINDVALGVTQA LS YLNRRYG
Sbjct  390   TKTPIKGPPGSGNNPKRIVFKIVSLDDMKMVKDAMNTTINDVALGVTQAGLSKYLNRRYG  449

Query  993   ---KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGN  1163
                K+D G  E +NNLPKN+RLRS  F N+RP+ GIQALADMMKK        +K  WGN
Sbjct  450   LENKKDEGGAEKKNNLPKNIRLRSIFFINIRPSAGIQALADMMKKN-------TKAKWGN  502

Query  1164  RFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILT  1343
              FGY +    I + +DPLDYVREAKAT DRKK+S E +F+ ++A  + K FG K A+   
Sbjct  503   LFGYVLFRFTIDLKDDPLDYVREAKATIDRKKHSLEALFSLFIAGLIFKLFGVKTASSFF  562

Query  1344  NKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVD  1523
              ++F+  +  FSNVVGP E++ F+GHP+A++  T YGQ S L+V  QSY++ M + +SVD
Sbjct  563   ERLFTGTTMAFSNVVGPLEEIGFYGHPMAYLTATTYGQASELLVCLQSYMNNMSISLSVD  622

Query  1524  ENVIPDPNQLLDDFEKSLHLIKD  1592
             EN IPDP+QL+DD  +SL LIKD
Sbjct  623   ENTIPDPHQLMDDIVESLKLIKD  645


 Score = 79.3 bits (194),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 6/82 (7%)
 Frame = +3

Query  99   ERNLKPIET--RKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHV  272
            ++ L+PIET  R   S   + ++   EEP+SP+ RL HEP FN+++LAIMG  ++I+P V
Sbjct  12   KQGLRPIETKFRNGSSSSGSEDIKEEEEPLSPAGRLFHEPNFNVNVLAIMGCKTRIDPDV  71

Query  273  ----FTHNMPHTLLKHPRFTSL  326
                   N+PHTLLKHPRF+S+
Sbjct  72   ALANAKANLPHTLLKHPRFSSV  93



>ref|XP_008376729.1| PREDICTED: O-acyltransferase WSD1-like isoform X3 [Malus domestica]
Length=497

 Score =   432 bits (1111),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 227/511 (44%), Positives = 322/511 (63%), Gaps = 40/511 (8%)
 Frame = +3

Query  90    MEMERNLKP-IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINP  266
             ME E  ++    T ++ S  E+++  I    +SP+SRL H P FN +I+ IMGF ++I+ 
Sbjct  1     MEPEATMEATCSTHEESSTKEDHHRLI----LSPASRLFHSPRFNCYIVIIMGFKTRIDS  56

Query  267   HVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITV------VEAPEVEV  428
             ++  + +   L  HPRF+  +    +  GK +W++  V+   H+ V      +E PE   
Sbjct  57    NIVKNGLK-VLHNHPRFSCRL---DDRGGKKRWIQVSVNQEDHVFVPTLNSKIEHPE---  109

Query  429   EGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGA  608
                       +FVE+Y+  L+   +D+S+PLW++H+LN+KT +AE LAV+RMHH++GDGA
Sbjct  110   ----------EFVENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGLAVIRMHHSMGDGA  159

Query  609   SINSLLLACTRQTANPKLLPTIST--RSSSppktlkpnnpkpkpknffklVWNTLVDVFI  782
             S+ SLLLACTR+T++P  LP++ T  R+ S                   L+ NTLVD+ +
Sbjct  160   SLMSLLLACTRKTSDPNALPSVPTQKRADSSSDLGWFWRFILAIWYGITLIANTLVDIML  219

Query  783   FIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAA  962
             FIATL FL D++TPI  S       KRF +R +S+N    +K A  TT+NDV LGVTQA 
Sbjct  220   FIATLLFLNDTETPIKGSSDVHLTTKRFLHRTVSMNHIKQVKNAMGTTVNDVVLGVTQAG  279

Query  963   LSMYLNRRYGK---RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGES  1133
             LS YLNRRY     +D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM K+    
Sbjct  280   LSCYLNRRYAGQNVKDVGTKQEGSNLPKNMHVRANILVNLRPTVGIQDLADMMAKK----  335

Query  1134  NSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKF  1313
                SK  WGN  GY ++P  I + +DPLDYVR AKA  DRKK+S E  FTY  AN +IK 
Sbjct  336   ---SKVRWGNCIGYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLEAFFTYLTANLLIKI  392

Query  1314  FGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYV  1493
              G KAA +L ++I S+++  FSN+VGP+E++ F+GH I F++P  YG P AL +H+QSY 
Sbjct  393   IGAKAAGVLAHRIISHSTFSFSNLVGPQEEISFYGHQITFMSPHVYGHPHALHMHWQSYA  452

Query  1494  DKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             D+M V ++VD NVIPDP +LLDD E+SL LI
Sbjct  453   DEMTVCLTVDPNVIPDPEKLLDDLEESLKLI  483



>ref|XP_008376727.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Malus domestica]
Length=507

 Score =   432 bits (1112),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 228/518 (44%), Positives = 324/518 (63%), Gaps = 44/518 (8%)
 Frame = +3

Query  90    MEMERNLKP-IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINP  266
             ME E  ++    T ++ S  E+++  I    +SP+SRL H P FN +I+ IMGF ++I+ 
Sbjct  1     MEPEATMEATCSTHEESSTKEDHHRLI----LSPASRLFHSPRFNCYIVIIMGFKTRIDS  56

Query  267   HVFTHNMPHTLLKHPRFT-------SLMVVDKEENGKMKWVETEVDLSQHITV------V  407
             ++  + +   L  HPRF+       S ++   +  GK +W++  V+   H+ V      +
Sbjct  57    NIVKNGLK-VLHNHPRFSCRLLMIYSFLLYKDDRGGKKRWIQVSVNQEDHVFVPTLNSKI  115

Query  408   EAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMH  587
             E PE             +FVE+Y+  L+   +D+S+PLW++H+LN+KT +AE LAV+RMH
Sbjct  116   EHPE-------------EFVENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGLAVIRMH  162

Query  588   HALGDGASINSLLLACTRQTANPKLLPTIST--RSSSppktlkpnnpkpkpknffklVWN  761
             H++GDGAS+ SLLLACTR+T++P  LP++ T  R+ S                   L+ N
Sbjct  163   HSMGDGASLMSLLLACTRKTSDPNALPSVPTQKRADSSSDLGWFWRFILAIWYGITLIAN  222

Query  762   TLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVA  941
             TLVD+ +FIATL FL D++TPI  S       KRF +R +S+N    +K A  TT+NDV 
Sbjct  223   TLVDIMLFIATLLFLNDTETPIKGSSDVHLTTKRFLHRTVSMNHIKQVKNAMGTTVNDVV  282

Query  942   LGVTQAALSMYLNRRYGK---RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMM  1112
             LGVTQA LS YLNRRY     +D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM
Sbjct  283   LGVTQAGLSCYLNRRYAGQNVKDVGTKQEGSNLPKNMHVRANILVNLRPTVGIQDLADMM  342

Query  1113  KKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYL  1292
              K+       SK  WGN  GY ++P  I + +DPLDYVR AKA  DRKK+S E  FTY  
Sbjct  343   AKK-------SKVRWGNCIGYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLEAFFTYLT  395

Query  1293  ANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALM  1472
             AN +IK  G KAA +L ++I S+++  FSN+VGP+E++ F+GH I F++P  YG P AL 
Sbjct  396   ANLLIKIIGAKAAGVLAHRIISHSTFSFSNLVGPQEEISFYGHQITFMSPHVYGHPHALH  455

Query  1473  VHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             +H+QSY D+M V ++VD NVIPDP +LLDD E+SL LI
Sbjct  456   MHWQSYADEMTVCLTVDPNVIPDPEKLLDDLEESLKLI  493



>ref|XP_011008175.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=496

 Score =   432 bits (1111),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 228/501 (46%), Positives = 319/501 (64%), Gaps = 29/501 (6%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEE--PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
             +KPI+T K      +N  S AEE  P+SP +R+ HE    ++I+ I+GF +++NP V   
Sbjct  6     MKPIKTTKNV----DNTSSGAEEEQPLSPVARMFHESDSTVYIIVIIGFETQLNPEVIKA  61

Query  282   NMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKK  461
             N+ HTLL  PRF SL V D++  G++KWV T VDL  H+ V   P ++   D       K
Sbjct  62    NLGHTLLSQPRFCSLQVPDEKRGGELKWVRTVVDLDNHVKV---PTLDPNMDSP----DK  114

Query  462   FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTR  641
             FVEDYV  LSK  + MS P+WDLH+LN+KT DAE++ +LR+HH+LGDG S+ +L ++CTR
Sbjct  115   FVEDYVCNLSKTGVSMSIPMWDLHLLNIKTSDAESVGILRVHHSLGDGTSLMTLFMSCTR  174

Query  642   QTANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDS  815
             + ++P+ LP++  + +      +        K  +   + WNT VDV +F  T F+L D+
Sbjct  175   KLSDPEALPSLPMNMKKKHGSSSGGFLQYFIKLFSVLLIYWNTFVDVVMFFITTFYLDDT  234

Query  816   QTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK  995
             +TP+       S P+R  +R +SL D   +K A N T+NDV +GVT+AALS  LNR+YGK
Sbjct  235   KTPLKGPLGVGSTPRRIVHRTVSLEDIKLVKNAMNATVNDVMVGVTEAALSRNLNRKYGK  294

Query  996   --RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRF  1169
               +D G  EG NNLPKN+RLR+  F NLRP    + +++M+K       S SK   GN  
Sbjct  295   MKKDTGGAEGHNNLPKNIRLRATHFVNLRPFLVNEDVSEMIK-------SSSKVKLGNLI  347

Query  1170  GYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNK  1349
             GY I P  IG+  D LD+VR AKAT  RKK + E ++TY +A F IKFF  K A+  T  
Sbjct  348   GYVIFPFTIGLREDVLDHVRSAKATGKRKKATLEALYTYLMAKFFIKFFSAKWASFPTQ-  406

Query  1350  IFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDEN  1529
                  +  +SNV GP+E++  FGH +A++APTCYGQP+ALM+H  SYV+KM +I+SVDE 
Sbjct  407   ----TTLWYSNVPGPQEEVTCFGHQVAYVAPTCYGQPNALMIHAVSYVNKMKIIVSVDEG  462

Query  1530  VIPDPNQLLDDFEKSLHLIKD  1592
             V+PDP+Q+ DD E+SL LIK+
Sbjct  463   VVPDPHQICDDIEESLKLIKN  483



>ref|XP_002325936.2| hypothetical protein POPTR_0019s09920g [Populus trichocarpa]
 gb|EEF00318.2| hypothetical protein POPTR_0019s09920g [Populus trichocarpa]
Length=495

 Score =   431 bits (1107),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 230/504 (46%), Positives = 319/504 (63%), Gaps = 32/504 (6%)
 Frame = +3

Query  102   RNLKPIETRKQKSGMENNNMSIAEE---PVSPSSRLLHEPAFNLHILAIMGFNSKINPHV  272
             R +KPI+T K       N +SI +E   P+SP +R+ HEP  N++I+ I+GF +KINP V
Sbjct  4     RAIKPIQTAKNVE----NVLSITDEEQQPLSPMARMFHEPDSNVYIIIIIGFQTKINPEV  59

Query  273   FTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRK  452
                N+ +TLLKHPRF+SL        G++KWV TEVDL  H   V+ P ++   D     
Sbjct  60    MRANLGNTLLKHPRFSSLQA--SSNGGQLKWVRTEVDLDNH---VKFPTIDPNMDFP---  111

Query  453   NKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLA  632
                +VEDYV  LSK ++ MS P+WDLH+LN+KT +AE++ +LR+HH++GDG S+ SL ++
Sbjct  112   -DMYVEDYVSNLSKTKIRMSIPMWDLHLLNIKTSNAESVGILRVHHSIGDGTSLMSLFMS  170

Query  633   CTRQTANPKLLPT--ISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFL  806
              TR+ ++P+ LPT  IS +      +        K  +   + WNTLVD+ +F+ T+FFL
Sbjct  171   FTRKASDPEALPTFPISKKQKPCSSSGGLLQHFIKLFSVLLIYWNTLVDIVMFLITIFFL  230

Query  807   KDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRR  986
              D++TP+       S P+R  +R +SL D   +K A N TINDV +GVTQ ALS YLNR+
Sbjct  231   DDTKTPLKGPLGVGSTPRRIVHRTVSLEDVKLVKNAMNATINDVMVGVTQGALSRYLNRK  290

Query  987   YGK--RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             YGK  +D G  E  +NLPKN+RLR+  F NLRP      L +    EK +S+S  + G  
Sbjct  291   YGKNKKDGGVAEANSNLPKNIRLRATSFVNLRPH-----LVNESAAEKTKSSSNVRLG--  343

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N  GY + P  I +  D LDYVR AKAT  RKK S E ++TY++A   +K FG K A+  
Sbjct  344   NLIGYVLFPFTIALREDALDYVRSAKATGKRKKASLEAVYTYFMAKTFLKLFGTKLASFP  403

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
             T       +  FSNV GP E++  +GH +A+IAPTC+GQP+ALM+H  SY +KM +I+SV
Sbjct  404   TQ-----TTLWFSNVAGPSEEITLYGHQVAYIAPTCFGQPNALMIHVVSYANKMNIILSV  458

Query  1521  DENVIPDPNQLLDDFEKSLHLIKD  1592
             DE ++PDP+QL DD E+SL LIKD
Sbjct  459   DEGIVPDPHQLCDDLEESLKLIKD  482



>ref|XP_009378763.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Pyrus x bretschneideri]
Length=506

 Score =   429 bits (1103),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 224/505 (44%), Positives = 318/505 (63%), Gaps = 42/505 (8%)
 Frame = +3

Query  123   TRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             T ++ S  E+++  I    +SP+SRL H P FN +I+ +MG  ++I+ +V  + +   L 
Sbjct  13    THEESSTKEDHHRLI----LSPASRLFHSPRFNCYIVIVMGLKTRIDSNVVKNGLK-VLH  67

Query  303   KHPRFT-------SLMVVDKEENGKMKWVETEVDLSQHITV------VEAPEVEVEGDET  443
              HPRF+       S ++   +  GK +W++  V+   H+ V      +E PE        
Sbjct  68    NHPRFSCRLLIIYSFLLYKDDRGGKKRWIQVSVNQEDHVFVPTLNSKIEHPE--------  119

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  +FVE+Y+  L+   +D+S+PLW++H+LN+KT +AE  AV+RMHH++GDGAS+ SL
Sbjct  120   -----EFVENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGFAVIRMHHSMGDGASLMSL  174

Query  624   LLACTRQTANPKLLPTIST--RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATL  797
             LLACTR+T++P  LP++ T  R+ S                   L+ NTLVD+ +FIATL
Sbjct  175   LLACTRKTSDPNELPSVPTQKRADSSSDLGWFCRFMLAIWYGITLIANTLVDIMLFIATL  234

Query  798   FFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
              FLKD++TPI  S       KRF +R +S+N    +K A  TT+NDV LGV QA LS YL
Sbjct  235   LFLKDTETPIKGSSDVHLTTKRFLHRNVSMNHIKQVKNAMGTTVNDVVLGVAQAGLSRYL  294

Query  978   NRRYGK--RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             NRRYG+  +D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM K+       SK 
Sbjct  295   NRRYGQNVQDVGTKQKGSNLPKNIHVRANILVNLRPTVGIQDLADMMAKK-------SKV  347

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  GY ++P  I + +DPLDYVR AKA  DRKK+S E  FTY  AN VIK  G KAA
Sbjct  348   RWGNWIGYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLESFFTYLTANLVIKIIGAKAA  407

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
              ++ ++I S+++  FSN+VGP E++ F+GH I F++P  YG P AL +H+QSY D+M V 
Sbjct  408   GVIAHRIISHSTFSFSNLVGPLEEISFYGHQITFMSPHVYGHPHALHMHWQSYADEMTVC  467

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLI  1586
             ++VD NVIPDP +LLDD E+SL LI
Sbjct  468   LTVDPNVIPDPEKLLDDLEESLKLI  492



>ref|XP_010666825.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=526

 Score =   428 bits (1100),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 225/526 (43%), Positives = 337/526 (64%), Gaps = 32/526 (6%)
 Frame = +3

Query  96    MERNL-KPIETRKQKS-GMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             M+R + +P+E    +   M +N+  I  E +SP+S   H+P FN+H+LAIMG    +N  
Sbjct  13    MKRGIIQPLEINCNRELMMLDNDERI--ELLSPASAAFHKPDFNIHVLAIMGVKVPVNVE  70

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHR  449
             +     P TL KHPRF+S++  +  +  K++W  TEV+L +HI V   P++ +E  ++  
Sbjct  71    LLKAKFPSTLCKHPRFSSVVEGNPCKGEKLRWTRTEVNLDKHIIV---PKINLESIDSP-  126

Query  450   KNKKFVEDYVYELSKERMDMSRPLWDLHILNLK-TRDAEALAVLRMHHALGDGASINSLL  626
               +K+VEDY+Y LSK  +D SRPLWD+H+LNLK + D +A+ V R+HH+LGDG S+ SLL
Sbjct  127   --EKYVEDYIYNLSKTTLDKSRPLWDIHVLNLKLSEDVKAVTVFRVHHSLGDGTSLISLL  184

Query  627   LACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpk----------nffklVWNTLVDV  776
             LA TR+T++P+ LPTI             NN   +               KL WNT +D+
Sbjct  185   LALTRKTSDPEALPTIPASKLCNDDNNNNNNNNTRKGLFWKWAIALWMILKLFWNTSIDI  244

Query  777   FIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQ  956
              +F+AT  FLKD+  P   SP   + P+R  Y+I SL+D   +K A   TINDVA+G+TQ
Sbjct  245   LLFVATTLFLKDN-CPFKSSPEGANAPRRVVYKIFSLDDMKFVKNAIGGTINDVAVGITQ  303

Query  957   AALSMYLNRRYGKRDIGSIEGQNNLPK---NLRLRSCLFFNLRPAKGIQALADMMKKEKG  1127
             A LS YL R+YG +   + + +  + +   N+RLRS L  N+RP+ G+QALADMM+K+  
Sbjct  304   AGLSQYLYRKYGNKGDTNEDTRGKMKRFLSNIRLRSVLLVNIRPSGGVQALADMMEKD--  361

Query  1128  ESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVI  1307
                  ++  WGN  G+ +LP  +G+ +DPLDY+R+AK   D+KK+S+E I+T+++A  V+
Sbjct  362   -----AEVKWGNSVGFMLLPFTLGLHDDPLDYIRDAKTRVDKKKHSFEAIYTFFMAEIVM  416

Query  1308  KFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQS  1487
             KFFG K A++++++I S+ +  FSN+ GP ED+ F+G P+AF+AP+ YGQP A++++FQS
Sbjct  417   KFFGSKVASVISDRINSHTTMGFSNLPGPVEDVAFYGLPLAFVAPSSYGQPHAVLINFQS  476

Query  1488  YVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKDaaaaaaTSSPT  1625
             Y DKM ++++VDE  +PDP+QL DD   SL LIKDA        P+
Sbjct  477   YSDKMTIVLAVDEYTVPDPHQLCDDIVDSLKLIKDAVIKQGIVKPS  522



>ref|XP_009357297.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Pyrus x bretschneideri]
Length=506

 Score =   426 bits (1095),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 223/505 (44%), Positives = 317/505 (63%), Gaps = 42/505 (8%)
 Frame = +3

Query  123   TRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             T ++ S  E+++  I    +SP+S L H P FN +I+ IMG  ++I+ +V  + +   L 
Sbjct  13    THEESSTKEDHHRLI----LSPASCLFHSPRFNCYIVIIMGLKTRIDSNVVKNGLK-VLH  67

Query  303   KHPRFT-------SLMVVDKEENGKMKWVETEVDLSQHITV------VEAPEVEVEGDET  443
              HPRF+       S ++   +  GK +W++  V+   H+ V      +E PE        
Sbjct  68    NHPRFSCRLLIIYSFLLYKDDRGGKKRWIQVSVNQEDHVFVPTLNSKIEHPE--------  119

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  +FVE+Y+  L+   +D+S+PLW++H+LN+KT +AE LAV+RMHH++GDGAS+ SL
Sbjct  120   -----EFVENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGLAVIRMHHSMGDGASLMSL  174

Query  624   LLACTRQTANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATL  797
             LLACTR+T++P  LP++    R+ S                   L+ NTLVD+ +FIATL
Sbjct  175   LLACTRKTSDPNELPSVPAQKRADSSSDLGWFWRFMLAIWYGITLIANTLVDIMLFIATL  234

Query  798   FFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
              FLKD++TPI  S       KRF +R +S+N    +K A  TT+NDV LGV QA LS YL
Sbjct  235   LFLKDTETPIKGSSDVHLTTKRFLHRTVSMNHIKQVKNAMGTTVNDVVLGVAQAGLSRYL  294

Query  978   NRRYGK--RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKW  1151
             NRRYG+  +D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM K+       SK 
Sbjct  295   NRRYGQNVQDVGTKQKGSNLPKNIHVRANILVNLRPTVGIQDLADMMAKK-------SKV  347

Query  1152  GWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAA  1331
              WGN  GY ++P  I + +DPLDYVR AKA  DRKK+S +  FTY  AN VIK  G KAA
Sbjct  348   RWGNWIGYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLDAFFTYLTANLVIKIIGAKAA  407

Query  1332  AILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVI  1511
              ++ ++I S+++  FSN+VGP E++ F+GH I F++P  YG P AL +H+QSY D+M V 
Sbjct  408   GVIAHRIISHSTFSFSNLVGPLEEISFYGHQITFMSPHVYGHPHALHMHWQSYADEMTVC  467

Query  1512  ISVDENVIPDPNQLLDDFEKSLHLI  1586
             ++VD NVIPDP +LLDD E+SL LI
Sbjct  468   LTVDPNVIPDPEKLLDDLEESLKLI  492



>ref|XP_002325937.2| hypothetical protein POPTR_0019s09950g [Populus trichocarpa]
 gb|EEF00319.2| hypothetical protein POPTR_0019s09950g [Populus trichocarpa]
Length=496

 Score =   426 bits (1094),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 223/499 (45%), Positives = 316/499 (63%), Gaps = 25/499 (5%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             +KPI+T K      ++  +  E+P+SP +R+ HE    ++I+ I+GF +++NP V   N+
Sbjct  6     IKPIKTTKNVDITSSS--AEEEQPLSPVARMFHESDSTVYIIVIIGFETQLNPEVIKANL  63

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
              HTLL  PRF SL + D++  G++KWV T VDL  H+ V   P ++   D        FV
Sbjct  64    GHTLLSQPRFCSLQLPDEKRGGELKWVRTVVDLDNHVKV---PTLDPNMDSP----DMFV  116

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             EDYV  LSK  + MS P+WDLH+LN+KT DAE++ VLR+HH+LGDG S+ +L ++CTR+ 
Sbjct  117   EDYVSNLSKTGISMSIPMWDLHLLNIKTSDAESVGVLRVHHSLGDGTSLMTLFMSCTRKV  176

Query  648   ANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQT  821
             ++P+ LP++  + +      +        K  +   L WNT VDV +F  T F+L D++T
Sbjct  177   SDPEALPSLPMNMKKKHGSSSGGFLQYFIKLFSVLLLYWNTFVDVVMFFITTFYLDDTKT  236

Query  822   PITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK--  995
             P+       S P+R  +R +SL D   +K A N T+NDV +GVT+AAL+  LNR+YGK  
Sbjct  237   PLKGPLGVASTPRRIVHRTVSLEDVKLVKNAMNVTVNDVMVGVTEAALTRNLNRKYGKIK  296

Query  996   RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGY  1175
              + G  EG NNLPKN+RLR+  F NLRP    + +++M+K       S SK   GN  GY
Sbjct  297   EEAGGAEGHNNLPKNIRLRATHFVNLRPYLVNEDVSEMIK-------SSSKVKLGNLIGY  349

Query  1176  AILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIF  1355
              I P  IG+  D LD+VR AKAT  RKK S E ++TY +A F IKFF  K A+  T    
Sbjct  350   VIFPFTIGLREDVLDHVRSAKATGKRKKASLEALYTYLMAKFFIKFFSAKWASFPTQ---  406

Query  1356  SNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVI  1535
                +  +SNV GP+E++  FGH +A++APTCYGQP+ALM+H  SYV+KM +I+SVDE V+
Sbjct  407   --TTLWYSNVPGPQEEVTCFGHQVAYVAPTCYGQPNALMIHVVSYVNKMKIIVSVDEGVV  464

Query  1536  PDPNQLLDDFEKSLHLIKD  1592
             PDP+Q+ DD E+SL LIK+
Sbjct  465   PDPHQICDDIEESLKLIKN  483



>ref|XP_009357299.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Pyrus x bretschneideri]
Length=496

 Score =   425 bits (1093),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 222/498 (45%), Positives = 315/498 (63%), Gaps = 38/498 (8%)
 Frame = +3

Query  123   TRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             T ++ S  E+++  I    +SP+S L H P FN +I+ IMG  ++I+ +V  + +   L 
Sbjct  13    THEESSTKEDHHRLI----LSPASCLFHSPRFNCYIVIIMGLKTRIDSNVVKNGLK-VLH  67

Query  303   KHPRFTSLMVVDKEENGKMKWVETEVDLSQHITV------VEAPEVEVEGDETHRKNKKF  464
              HPRF+  +    +  GK +W++  V+   H+ V      +E PE             +F
Sbjct  68    NHPRFSCRL---DDRGGKKRWIQVSVNQEDHVFVPTLNSKIEHPE-------------EF  111

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y+  L+   +D+S+PLW++H+LN+KT +AE LAV+RMHH++GDGAS+ SLLLACTR+
Sbjct  112   VENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGLAVIRMHHSMGDGASLMSLLLACTRK  171

Query  645   TANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQ  818
             T++P  LP++    R+ S                   L+ NTLVD+ +FIATL FLKD++
Sbjct  172   TSDPNELPSVPAQKRADSSSDLGWFWRFMLAIWYGITLIANTLVDIMLFIATLLFLKDTE  231

Query  819   TPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK-  995
             TPI  S       KRF +R +S+N    +K A  TT+NDV LGV QA LS YLNRRYG+ 
Sbjct  232   TPIKGSSDVHLTTKRFLHRTVSMNHIKQVKNAMGTTVNDVVLGVAQAGLSRYLNRRYGQN  291

Query  996   -RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFG  1172
              +D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM K+       SK  WGN  G
Sbjct  292   VQDVGTKQKGSNLPKNIHVRANILVNLRPTVGIQDLADMMAKK-------SKVRWGNWIG  344

Query  1173  YAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKI  1352
             Y ++P  I + +DPLDYVR AKA  DRKK+S +  FTY  AN VIK  G KAA ++ ++I
Sbjct  345   YILIPFTIALQDDPLDYVRGAKAVIDRKKHSLDAFFTYLTANLVIKIIGAKAAGVIAHRI  404

Query  1353  FSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENV  1532
              S+++  FSN+VGP E++ F+GH I F++P  YG P AL +H+QSY D+M V ++VD NV
Sbjct  405   ISHSTFSFSNLVGPLEEISFYGHQITFMSPHVYGHPHALHMHWQSYADEMTVCLTVDPNV  464

Query  1533  IPDPNQLLDDFEKSLHLI  1586
             IPDP +LLDD E+SL LI
Sbjct  465   IPDPEKLLDDLEESLKLI  482



>ref|XP_009378764.1| PREDICTED: O-acyltransferase WSD1-like isoform X3 [Pyrus x bretschneideri]
Length=497

 Score =   425 bits (1092),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 222/499 (44%), Positives = 314/499 (63%), Gaps = 39/499 (8%)
 Frame = +3

Query  123   TRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             T ++ S  E+++  I    +SP+SRL H P FN +I+ +MG  ++I+ +V  + +   L 
Sbjct  13    THEESSTKEDHHRLI----LSPASRLFHSPRFNCYIVIVMGLKTRIDSNVVKNGLK-VLH  67

Query  303   KHPRFTSLMVVDKEENGKMKWVETEVDLSQHITV------VEAPEVEVEGDETHRKNKKF  464
              HPRF+  +    +  GK +W++  V+   H+ V      +E PE             +F
Sbjct  68    NHPRFSCRL---DDRGGKKRWIQVSVNQEDHVFVPTLNSKIEHPE-------------EF  111

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y+  L+   +D+S+PLW++H+LN+KT +AE  AV+RMHH++GDGAS+ SLLLACTR+
Sbjct  112   VENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGFAVIRMHHSMGDGASLMSLLLACTRK  171

Query  645   TANPKLLPTIST--RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQ  818
             T++P  LP++ T  R+ S                   L+ NTLVD+ +FIATL FLKD++
Sbjct  172   TSDPNELPSVPTQKRADSSSDLGWFCRFMLAIWYGITLIANTLVDIMLFIATLLFLKDTE  231

Query  819   TPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR  998
             TPI  S       KRF +R +S+N    +K A  TT+NDV LGV QA LS YLNRRY  +
Sbjct  232   TPIKGSSDVHLTTKRFLHRNVSMNHIKQVKNAMGTTVNDVVLGVAQAGLSRYLNRRYAGQ  291

Query  999   ---DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRF  1169
                D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM K+       SK  WGN  
Sbjct  292   NVQDVGTKQKGSNLPKNIHVRANILVNLRPTVGIQDLADMMAKK-------SKVRWGNWI  344

Query  1170  GYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNK  1349
             GY ++P  I + +DPLDYVR AKA  DRKK+S E  FTY  AN VIK  G KAA ++ ++
Sbjct  345   GYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLESFFTYLTANLVIKIIGAKAAGVIAHR  404

Query  1350  IFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDEN  1529
             I S+++  FSN+VGP E++ F+GH I F++P  YG P AL +H+QSY D+M V ++VD N
Sbjct  405   IISHSTFSFSNLVGPLEEISFYGHQITFMSPHVYGHPHALHMHWQSYADEMTVCLTVDPN  464

Query  1530  VIPDPNQLLDDFEKSLHLI  1586
             VIPDP +LLDD E+SL LI
Sbjct  465   VIPDPEKLLDDLEESLKLI  483



>ref|XP_009378762.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Pyrus x bretschneideri]
Length=507

 Score =   425 bits (1093),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 223/506 (44%), Positives = 316/506 (62%), Gaps = 43/506 (8%)
 Frame = +3

Query  123   TRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             T ++ S  E+++  I    +SP+SRL H P FN +I+ +MG  ++I+ +V  + +   L 
Sbjct  13    THEESSTKEDHHRLI----LSPASRLFHSPRFNCYIVIVMGLKTRIDSNVVKNGLK-VLH  67

Query  303   KHPRFT-------SLMVVDKEENGKMKWVETEVDLSQHITV------VEAPEVEVEGDET  443
              HPRF+       S ++   +  GK +W++  V+   H+ V      +E PE        
Sbjct  68    NHPRFSCRLLIIYSFLLYKDDRGGKKRWIQVSVNQEDHVFVPTLNSKIEHPE--------  119

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                  +FVE+Y+  L+   +D+S+PLW++H+LN+KT +AE  AV+RMHH++GDGAS+ SL
Sbjct  120   -----EFVENYISNLTASPLDLSKPLWEVHLLNVKTSNAEGFAVIRMHHSMGDGASLMSL  174

Query  624   LLACTRQTANPKLLPTIST--RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATL  797
             LLACTR+T++P  LP++ T  R+ S                   L+ NTLVD+ +FIATL
Sbjct  175   LLACTRKTSDPNELPSVPTQKRADSSSDLGWFCRFMLAIWYGITLIANTLVDIMLFIATL  234

Query  798   FFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
              FLKD++TPI  S       KRF +R +S+N    +K A  TT+NDV LGV QA LS YL
Sbjct  235   LFLKDTETPIKGSSDVHLTTKRFLHRNVSMNHIKQVKNAMGTTVNDVVLGVAQAGLSRYL  294

Query  978   NRRYGKR---DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             NRRY  +   D+G+ +  +NLPKN+ +R+ +  NLRP  GIQ LADMM K+       SK
Sbjct  295   NRRYAGQNVQDVGTKQKGSNLPKNIHVRANILVNLRPTVGIQDLADMMAKK-------SK  347

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
               WGN  GY ++P  I + +DPLDYVR AKA  DRKK+S E  FTY  AN VIK  G KA
Sbjct  348   VRWGNWIGYILIPFTIALQDDPLDYVRGAKAVIDRKKHSLESFFTYLTANLVIKIIGAKA  407

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGV  1508
             A ++ ++I S+++  FSN+VGP E++ F+GH I F++P  YG P AL +H+QSY D+M V
Sbjct  408   AGVIAHRIISHSTFSFSNLVGPLEEISFYGHQITFMSPHVYGHPHALHMHWQSYADEMTV  467

Query  1509  IISVDENVIPDPNQLLDDFEKSLHLI  1586
              ++VD NVIPDP +LLDD E+SL LI
Sbjct  468   CLTVDPNVIPDPEKLLDDLEESLKLI  493



>ref|XP_008793154.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Phoenix dactylifera]
Length=509

 Score =   425 bits (1092),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 222/485 (46%), Positives = 313/485 (65%), Gaps = 18/485 (4%)
 Frame = +3

Query  150   NNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLM  329
             N  ++  EEPVSP+ RL  +P FN HI++++G   +++       +  +L +HPRF+S+ 
Sbjct  34    NGEITEEEEPVSPAGRLFLQPRFNCHIVSVIGCGKRMDVDAVKAGLEASLARHPRFSSIQ  93

Query  330   VVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDM  509
             V D++   K++WV T+V++  H+ V +     ++ D       K VEDYV  LS   MD 
Sbjct  94    VSDEK---KLRWVRTKVNVEDHVIVPD-----LDPDAASVNPDKVVEDYVAALSGAPMDH  145

Query  510   SRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STR  683
             SRPLW+LHILN+ T +A A+AVLR+HH+LGDG S+ SLLLACTRQ + P  LP+I  + R
Sbjct  146   SRPLWELHILNVATAEAAAVAVLRVHHSLGDGISLMSLLLACTRQCSEPDRLPSIPDARR  205

Query  684   SSSppktlkpnnpkpkpknffklV--WNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
             S+S     +          +  LV  W+TLVD  IF ATL F+KD++TP+      E  P
Sbjct  206   STSAAANSRSGLLALLLWIWADLVLAWHTLVDAIIFAATLAFVKDTRTPLMGMEGVEFHP  265

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
             KRF +R +SL+D   IK A N T+NDV +G+T A LS YL+RRYG+ D    + +  LP 
Sbjct  266   KRFVHRTVSLDDIKDIKKAMNCTVNDVLVGITSAGLSRYLDRRYGEGDDMKKKEKKGLPG  325

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
             N+RLR+ L  N+R   GI ALA+MM+K KG +       WGN+ GY +L   I +  DPL
Sbjct  326   NIRLRTALLVNIRRTPGIHALAEMMEKGKGGAK------WGNKLGYMVLRFPIAVFEDPL  379

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             +Y+R  KA A+RKK S E +FTY+ A  ++K FG KAAA L +++  + +  FSN+VGP 
Sbjct  380   EYIRRGKAIAERKKNSLEAVFTYWSAWVIVKIFGIKAAAALCHRMVIHTTLSFSNIVGPV  439

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E + F+GHP+ +IAP+ YG P AL +HFQSY++ M ++++VDE  IP+PNQLLDDF +SL
Sbjct  440   EKIGFYGHPVVYIAPSVYGHPHALTLHFQSYMNTMKIVLAVDELSIPNPNQLLDDFAESL  499

Query  1578  HLIKD  1592
              LIKD
Sbjct  500   RLIKD  504



>ref|XP_008793153.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Phoenix dactylifera]
Length=511

 Score =   423 bits (1088),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 222/485 (46%), Positives = 312/485 (64%), Gaps = 16/485 (3%)
 Frame = +3

Query  150   NNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLM  329
             N  ++  EEPVSP+ RL  +P FN HI++++G   +++       +  +L +HPRF+S+ 
Sbjct  34    NGEITEEEEPVSPAGRLFLQPRFNCHIVSVIGCGKRMDVDAVKAGLEASLARHPRFSSIQ  93

Query  330   VVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDM  509
             V   +E  K++WV T+V++  H+ V +     ++ D       K VEDYV  LS   MD 
Sbjct  94    VPVSDEK-KLRWVRTKVNVEDHVIVPD-----LDPDAASVNPDKVVEDYVAALSGAPMDH  147

Query  510   SRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STR  683
             SRPLW+LHILN+ T +A A+AVLR+HH+LGDG S+ SLLLACTRQ + P  LP+I  + R
Sbjct  148   SRPLWELHILNVATAEAAAVAVLRVHHSLGDGISLMSLLLACTRQCSEPDRLPSIPDARR  207

Query  684   SSSppktlkpnnpkpkpknffklV--WNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
             S+S     +          +  LV  W+TLVD  IF ATL F+KD++TP+      E  P
Sbjct  208   STSAAANSRSGLLALLLWIWADLVLAWHTLVDAIIFAATLAFVKDTRTPLMGMEGVEFHP  267

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
             KRF +R +SL+D   IK A N T+NDV +G+T A LS YL+RRYG+ D    + +  LP 
Sbjct  268   KRFVHRTVSLDDIKDIKKAMNCTVNDVLVGITSAGLSRYLDRRYGEGDDMKKKEKKGLPG  327

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
             N+RLR+ L  N+R   GI ALA+MM+K KG +       WGN+ GY +L   I +  DPL
Sbjct  328   NIRLRTALLVNIRRTPGIHALAEMMEKGKGGAK------WGNKLGYMVLRFPIAVFEDPL  381

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             +Y+R  KA A+RKK S E +FTY+ A  ++K FG KAAA L +++  + +  FSN+VGP 
Sbjct  382   EYIRRGKAIAERKKNSLEAVFTYWSAWVIVKIFGIKAAAALCHRMVIHTTLSFSNIVGPV  441

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E + F+GHP+ +IAP+ YG P AL +HFQSY++ M ++++VDE  IP+PNQLLDDF +SL
Sbjct  442   EKIGFYGHPVVYIAPSVYGHPHALTLHFQSYMNTMKIVLAVDELSIPNPNQLLDDFAESL  501

Query  1578  HLIKD  1592
              LIKD
Sbjct  502   RLIKD  506



>ref|XP_006478432.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=509

 Score =   422 bits (1085),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 318/487 (65%), Gaps = 32/487 (7%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             ++P+SP SRL HEP  NL+I+ ++GF SKINP     N+ H+LLKH RF+SL V D++  
Sbjct  25    DQPLSPMSRLFHEPESNLYIVVMIGFKSKINPDFVKANLGHSLLKHHRFSSLQVEDEKIK  84

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR-PLWD  527
             G +KWV T+V+L  H+ V   P +E +  ++     KFVEDYV  LSK  + MS+ P+WD
Sbjct  85    GGLKWVPTKVNLDNHVIV---PNLEPKSIDSA---DKFVEDYVSNLSKTGIKMSKQPMWD  138

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LH+LN+KT DAE++AVLR+HH+LGDG S+ SL L+CTR+ +NP+ LP+ S   +S     
Sbjct  139   LHLLNIKTSDAESVAVLRVHHSLGDGTSLVSLFLSCTRKVSNPEELPSNSIPPTSKEGDS  198

Query  708   kpnnpk--------pkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSPASESKPK  860
             +    K              F L +NTLVD  + IAT L F+KDS+TP+       S P+
Sbjct  199   RSYGVKGFWPYFFFKYFWFVFSLFYNTLVDAVMVIATILMFVKDSETPLKGIVGKASGPR  258

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNL  1031
             R  +R LSL+DF  +K A NTTIND  + VTQA LS YLNR+YG+    + G+ E  NNL
Sbjct  259   RIVHRSLSLDDFKFVKNAMNTTINDAVVAVTQAGLSRYLNRKYGELLLVNKGASERNNNL  318

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
             PKN+RLR+ +  +LR +  +Q LAD++K       +  K   GN+ G+ I P  I + +D
Sbjct  319   PKNIRLRAAIMKDLRSSSEVQELADIVK-------NGYKTKSGNKIGFVIFPFSIALRDD  371

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PLDY+REAKA  DRKK S E  F+Y L+ + +K FG K A        S  +  FSNV G
Sbjct  372   PLDYLREAKARMDRKKASLEAEFSYLLSQYTVK-FGIKGA-----NCPSKTTLLFSNVNG  425

Query  1392  PREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEK  1571
             P+E++ F+GHPIA++AP+CYGQ + L +HF SY +KM  I+SVD+++IPDP+QL DD E+
Sbjct  426   PQEEISFYGHPIAYVAPSCYGQTNGLTIHFVSYANKMTFILSVDDDLIPDPHQLRDDLEE  485

Query  1572  SLHLIKD  1592
             SLHL+K+
Sbjct  486   SLHLMKN  492



>ref|XP_010519416.1| PREDICTED: O-acyltransferase WSD1-like [Tarenaya hassleriana]
Length=500

 Score =   422 bits (1084),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 208/483 (43%), Positives = 311/483 (64%), Gaps = 22/483 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++RL H P FN +I++++G  +KI+  V T  +  TL++HPRF+S +V+D ++  
Sbjct  19    QPLSPAARLFHSPEFNCYIISVIGCKTKIDTDVITQGLKETLIRHPRFSSKLVIDGDKRQ  78

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               +WV T+V++  H+ V   P++      T   ++ F+E+YV  L+   +D+SRPLW+LH
Sbjct  79    NQRWVRTKVNVEDHVVV---PDMVASRRMTENPDE-FLENYVSNLTSTPLDVSRPLWELH  134

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +L++KT DAE +AVL++HH++GDG S+ SL+LACTR+T+NP  +P++  ++ S  +    
Sbjct  135   VLDIKTSDAENVAVLKVHHSIGDGMSLMSLVLACTRKTSNPMEIPSLPVKNRSKSRLTGL  194

Query  714   nnpkp------kpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPAS--ESKPKRFA  869
              +            +   LV+NT  D F F+AT  FLKD++TPI        E KP+RF 
Sbjct  195   RSQSRFWWLVLALWSSVLLVFNTFCDAFEFVATTLFLKDTETPIKGKRGGLMEEKPRRFV  254

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG---KRDIGSIEGQNNLPKN  1040
             +R +S +D   IK   N T+NDV LG+T A LS YLNR+YG   ++       Q+NLPK 
Sbjct  255   HRTMSFDDIKLIKNTMNMTVNDVLLGITLAGLSRYLNRKYGDTEEKQEAKERNQDNLPKR  314

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +RLR+ +  NLRP  GIQALADMM K        SK  WGN  GY ++P  I   +DPL+
Sbjct  315   IRLRAAVLVNLRPDAGIQALADMMSKG-------SKCKWGNWIGYVVIPFSIATRDDPLE  367

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             ++R AK T DRKK+S E   T+ +  F+++ FG KAAA +  +  SN +  FSN++GP E
Sbjct  368   HLRRAKDTIDRKKHSLEAFLTFSVGKFILETFGVKAAADIIGRAVSNTTMSFSNMMGPVE  427

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F+GHPI ++AP+ YG P AL +HFQSY++KM + ++VD  VI DP++L DD E+SL 
Sbjct  428   EISFYGHPITYLAPSAYGHPHALTMHFQSYMNKMTMSLTVDSTVITDPHRLCDDLEESLR  487

Query  1581  LIK  1589
              IK
Sbjct  488   TIK  490



>ref|XP_006587545.1| PREDICTED: O-acyltransferase WSD1 [Glycine max]
Length=480

 Score =   421 bits (1082),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 221/480 (46%), Positives = 306/480 (64%), Gaps = 26/480 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP+ +L HEP+ N +++AIMG  + INP V    +  TLLKHPRFTS +V   ++  
Sbjct  9     EPLSPTGKLFHEPSLNCYVIAIMGCKTSINPQVIREGLCQTLLKHPRFTSKLV---KKGR  65

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K KW+ T+VDL  HI V   PE+    D       +FVEDYV   +K  +D S+PLW+LH
Sbjct  66    KTKWIPTKVDLDNHIIV---PEI----DSNLEYPDRFVEDYVSHFTKTPLDQSKPLWELH  118

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT--ISTRSSSppktl  707
             +LN+KT DAEA++V R+HH++GDGAS+ SLLLA TR+T++P  LPT  I  + +S  ++ 
Sbjct  119   LLNIKTSDAEAVSVFRIHHSIGDGASLISLLLAATRKTSDPNALPTVPIPKKDTSHQRSS  178

Query  708   kpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSP-ASESKPKRFAYRILS  884
              P            L+W+T VD+ +F  T+FF+KD+ TP+       E   KR  +R +S
Sbjct  179   SPFRWLFVIWWALLLIWHTFVDMLLFTFTIFFIKDTPTPLKAGALGVELHNKRIVHRTVS  238

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS----IEGQNNLPKNLRLR  1052
             ++D   +K    TTINDV LGVTQAAL+ YLNR Y   D+G+    ++ ++++ K +RLR
Sbjct  239   MDDIKLVKNEMKTTINDVLLGVTQAALTRYLNRAYA--DVGANSNGVKQRSSVLKKIRLR  296

Query  1053  SCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVRE  1232
             + +  N+RP  GIQ LADMM ++       SK  WGN  GY ILP  I +  DPL+YVR 
Sbjct  297   ASILVNIRPVGGIQELADMMAEK-------SKVKWGNCMGYIILPFSIVLYKDPLEYVRH  349

Query  1233  AKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEF  1412
             AKAT DRKK+S E I +Y  A  V+   G K AA +T ++  N +  FSNV GP E++ F
Sbjct  350   AKATIDRKKHSLEAICSYACAKLVLNLLGVKVAAAITRRVLFNTTVAFSNVPGPVEEISF  409

Query  1413  FGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +GHP+A+IAP+ YG P AL +HFQSY + M + ++VD  VI DP  L DD E+SL LI+D
Sbjct  410   YGHPVAYIAPSVYGHPLALTIHFQSYANNMTISLAVDPLVISDPYLLCDDLEQSLKLIRD  469



>gb|KHN38854.1| O-acyltransferase WSD1 [Glycine soja]
Length=479

 Score =   421 bits (1081),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 221/480 (46%), Positives = 306/480 (64%), Gaps = 27/480 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP+ +L HEP+ N +++AIMG  + INP V    +  TLLKHPRFTS +V   ++  
Sbjct  9     EPLSPTGKLFHEPSLNCYVIAIMGCKTSINPQVIREGLCQTLLKHPRFTSKLV---KKGR  65

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K KW+ T+VDL  HI V   PE+    D       +FVEDYV   +K  +D S+PLW+LH
Sbjct  66    KTKWIPTKVDLDNHIIV---PEI----DSNLEYPDRFVEDYVSHFTKTPLDQSKPLWELH  118

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT--ISTRSSSppktl  707
             +LN+KT DAEA++V R+HH++GDGAS+ SLLLA TR+T++P  LPT  I  + +S  ++ 
Sbjct  119   LLNIKTSDAEAVSVFRIHHSIGDGASLISLLLAATRKTSDPNALPTVPIQKKDTSHQRSS  178

Query  708   kpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSP-ASESKPKRFAYRILS  884
              P            L+W+T VD+ +F  T+FF+KD+ TP+       E   KR  +R +S
Sbjct  179   SPFRWLFVIWWALLLIWHTFVDMLLFTFTIFFIKDTPTPLKAGALGVELHNKRIVHRTVS  238

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS----IEGQNNLPKNLRLR  1052
             ++D   +K    TTINDV LGVTQAAL+ YLNR Y   D+G+    ++ ++++ K +RLR
Sbjct  239   MDDIKLVKNEMKTTINDVLLGVTQAALTRYLNRAY---DVGANSNGVKQRSSVLKKIRLR  295

Query  1053  SCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVRE  1232
             + +  N+RP  GIQ LADMM ++       SK  WGN  GY ILP  I +  DPL+YVR 
Sbjct  296   ASILVNIRPVGGIQELADMMAEK-------SKVKWGNCMGYIILPFSIVLYKDPLEYVRH  348

Query  1233  AKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEF  1412
             AKAT DRKK+S E I +Y  A  V+   G K AA +T ++  N +  FSNV GP E++ F
Sbjct  349   AKATIDRKKHSLEAICSYACAKLVLNLLGVKVAAAITRRVLFNTTVAFSNVPGPVEEISF  408

Query  1413  FGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +GHP+A+IAP+ YG P AL +HFQSY + M + ++VD  VI DP  L DD E+SL LI+D
Sbjct  409   YGHPVAYIAPSVYGHPLALTIHFQSYANNMTISLAVDPLVISDPYLLCDDLEQSLKLIRD  468



>emb|CDY54346.1| BnaC03g14900D [Brassica napus]
Length=489

 Score =   420 bits (1080),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 217/491 (44%), Positives = 312/491 (64%), Gaps = 25/491 (5%)
 Frame = +3

Query  141   GMENNNM--SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPR  314
             G E N    ++ EEP+SP SRL + P FN  I+ IMG   K NP      + HTL+ HPR
Sbjct  2     GGEKNKARETVGEEPLSPCSRLFNSPDFNCAIIVIMGCKVKGNPPAIIDGLKHTLVNHPR  61

Query  315   FTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSK  494
             F+S++ ++  + GK  WV TEV +  H+ V   P++    D       +++EDY+ +L+ 
Sbjct  62    FSSILEMNNGKKGKPSWVRTEVRVEDHVIV---PDI----DPNIESPDQYLEDYISKLTT  114

Query  495   ERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI  674
               MD S+PLW++H+L LKT +AE++ +L++HH+LGDG S+ SL LACTR+T++P+ LPT+
Sbjct  115   VPMDFSKPLWEIHLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTV  174

Query  675   STR------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS  836
             S +      SS+     K            +LV+NT VDV IF  T+ FL+D++TP+   
Sbjct  175   SVQKKQFGPSSNTGFFNKIWWLFVGLWFILRLVFNTFVDVLIFALTICFLRDTETPLLAK  234

Query  837   PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIE  1016
             P +E  PKRF +RI+S +D   +K A   T+NDV LGVTQA LS YL+RRY +    + +
Sbjct  235   PRTELVPKRFVHRIISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQE--ATPK  292

Query  1017  GQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKI  1196
              + ++ K  RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +
Sbjct  293   SKESMGK-FRLRSAIMINLRPNTGIEALADMMAKK-------SKCRWGNLFGYILLPFSV  344

Query  1197  GMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCF  1376
             G+  DPL+YVR+AK T DRKK+S E +F+      ++K  G KA+ +L  K+  N +  F
Sbjct  345   GLETDPLEYVRQAKVTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTF  404

Query  1377  SNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLL  1556
             SNVVGP+E++ F GHP+++IAP+ +G P AL VHFQSY  K+ + ++ D  VIPDP+++ 
Sbjct  405   SNVVGPKEEITFHGHPLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVIPDPHKMC  464

Query  1557  DDFEKSLHLIK  1589
             DDF +SL LIK
Sbjct  465   DDFVESLKLIK  475



>ref|XP_010537088.1| PREDICTED: O-acyltransferase WSD1 isoform X1 [Tarenaya hassleriana]
Length=477

 Score =   419 bits (1077),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 214/481 (44%), Positives = 309/481 (64%), Gaps = 21/481 (4%)
 Frame = +3

Query  159   MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD  338
             M+  EEP+SP SRL + P FN  I+  +G  ++ NP+     + +TL+ HPRF+S + ++
Sbjct  1     MATEEEPLSPGSRLFNSPEFNCSIIVTLGCKTRGNPNAIIDGLKNTLINHPRFSSKLEMN  60

Query  339   KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
             +   GK  WV T+V +  H+ V   P+++ + +E      KF+EDY+  L+   MDMS+P
Sbjct  61    RGNGGKPTWVRTKVRVEDHVVV---PDIDPDMEEP----DKFLEDYISNLTTLPMDMSKP  113

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIST---RSS  689
             LW++H+ NLKT DAE++ VL++HH+LGDG S+ SL LACTR+T+NP+ LPTI++   R  
Sbjct  114   LWEIHLFNLKTSDAESVGVLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTIASKKKRIG  173

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASES-KPKRF  866
               P          +     +L++NT VDV+ F ATLFFL+D++TPI   PA+ +  P+R 
Sbjct  174   PSPSLNSIFRFFVRVWFMIRLIFNTFVDVYKFAATLFFLRDTETPIMSKPAAMAPNPRRC  233

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +RI+S  D   +K A   TINDV LGVTQA +S YL+RRY +   G+ + +  + + +R
Sbjct  234   VHRIISFEDVKLVKNAMKMTINDVLLGVTQAGISRYLSRRYDQE--GTPKSKKFMGR-IR  290

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             L S +  NLRP  GI+ALADMM K        SK  WGN  GY +LP  +G+ NDPL+YV
Sbjct  291   LHSAIMINLRPNTGIEALADMMAKG-------SKCRWGNLIGYVLLPFSVGLENDPLEYV  343

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R AK+T DRKK S E + +Y +  F I   G KA   L  ++F N +  FSN+VGP+E++
Sbjct  344   RRAKSTIDRKKLSLEAVLSYAIFKFTINVLGFKAGEALVKRVFGNTTMTFSNLVGPKEEI  403

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
              F+GHPI++IA + +G P AL +HFQSY DK+ + ++VD  VIPDP++L DDF +S   I
Sbjct  404   SFYGHPISYIASSAFGHPHALSLHFQSYADKIIIAMAVDPTVIPDPHRLCDDFSESFETI  463

Query  1587  K  1589
             K
Sbjct  464   K  464



>ref|XP_009766774.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=514

 Score =   420 bits (1079),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 221/514 (43%), Positives = 310/514 (60%), Gaps = 34/514 (7%)
 Frame = +3

Query  108   LKPIETRKQ----KSGMENNN-------------MSIAEEPVSPSSRLLHEPAFNLHILA  236
             LKPI+T+      K GM N                 +  EP SP++RL H  + + HI+A
Sbjct  6     LKPIDTKTNIEPCKLGMTNGQKNSTVVVVEEEQKEQVQFEPASPATRLFHTKSLSCHIIA  65

Query  237   IMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAP  416
             I+G  +KIN  +    +  TLL HPRFTS+ VVD E+ G  KW +T V++  H+     P
Sbjct  66    ILGCTTKINVDLIKKGLESTLLNHPRFTSIPVVD-EKKGVRKWKQTTVNVGNHMV---CP  121

Query  417   EVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHAL  596
             +++ + D       +F+E+Y   L+   MDM++PLW++HILN+KT +AEA  +L++HH++
Sbjct  122   DLDPDMDSP----DEFIENYTSSLTTIPMDMTKPLWEVHILNVKTSEAEATGILKLHHSI  177

Query  597   GDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpkn--ffklVWNTLV  770
             GDG SI SL+LACTR+ ++ + LPTI T S            +          + WNTLV
Sbjct  178   GDGMSIISLILACTRKASDSEALPTIPTSSKKECSDEAGFCRRFCFSVWFLLMVFWNTLV  237

Query  771   DVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGV  950
             D  +F AT+ FLKD+ TPI      E  PKR  +R +SL+D   +K A N TINDV +G+
Sbjct  238   DAIMFFATVLFLKDTNTPIKGGAGVEHNPKRLVHRTISLDDMKIVKNALNLTINDVVMGI  297

Query  951   TQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGE  1130
              QA +S YLNRRYG ++       NNLPKN+RLR  + FN+RP+ GI+ LA+MM+K+   
Sbjct  298   AQAGISRYLNRRYGNKNGRGSSKTNNLPKNIRLRGSIVFNIRPSAGIKVLAEMMEKK---  354

Query  1131  SNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIK  1310
                 SK  WGN+ GY +  L I +  +PLDY+ +AKA  D+KK S E   ++  A     
Sbjct  355   ----SKAKWGNKIGYVLTSLPISLPENPLDYIHQAKAIIDKKKLSLESRLSFAAAKLTQD  410

Query  1311  FFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSY  1490
              FG   AA LTN++ S+ +   SNVVGP+E++ FFGH +A+ APT  G P AL++HFQSY
Sbjct  411   IFGSNVAAKLTNRVLSHTTILLSNVVGPQEEITFFGHKLAYAAPTICGLPHALIMHFQSY  470

Query  1491  VDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              +KM + +SVD  VIPDP QL DDFE SL + K+
Sbjct  471   CNKMTISMSVDPLVIPDPYQLCDDFEDSLQMFKN  504



>ref|XP_006401711.1| hypothetical protein EUTSA_v10013378mg [Eutrema salsugineum]
 gb|ESQ43164.1| hypothetical protein EUTSA_v10013378mg [Eutrema salsugineum]
Length=489

 Score =   416 bits (1070),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 207/482 (43%), Positives = 306/482 (63%), Gaps = 22/482 (5%)
 Frame = +3

Query  162   SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK  341
             ++ EEP+SP SRL + P FN  I+  MG   K NP      + HTL+ HPRF+S++ +DK
Sbjct  11    TVEEEPLSPCSRLFNSPEFNCAIIVTMGCKVKGNPAAIIDGLKHTLVNHPRFSSILEMDK  70

Query  342   EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPL  521
              + GK  WV T+V++ +H+ V   P+++ +  E H    +++EDY+ +L+   MD+S+PL
Sbjct  71    GKKGKPSWVRTKVNVEEHVIV---PDIDPDNIENH---DQYLEDYISKLTTIPMDLSKPL  124

Query  522   WDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppk  701
             W++H+L LKT +AE++ +L++HH+LGDG S+ SL LACTR++++P+ LPT++ +      
Sbjct  125   WEIHLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKSSDPEALPTVAVQKKRFGP  184

Query  702   tlkpnnpkpk------pknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKR  863
                                  +L +NT VDV +F  T+ FL+D++TP+   P SE  PKR
Sbjct  185   RCYSGFFNKIWWFFLGLWCILRLFFNTFVDVLMFALTICFLRDTETPLLAKPGSELIPKR  244

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNL  1043
             F +RI+S +D   +K A   T+NDV LGVTQA LS YLNRRY   D  +        + +
Sbjct  245   FVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLNRRY---DQEATPKSKESMRRI  301

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL+Y
Sbjct  302   RLRSAIMINLRPNTGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGLETDPLEY  354

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             VR AK T DRKK+S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+E+
Sbjct  355   VRRAKDTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEE  414

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + F GHP+++IAP+ +G P AL +HFQSY +K+ + ++ D  VIPDP+++ DD  +SL L
Sbjct  415   ITFHGHPLSYIAPSVFGHPHALTLHFQSYENKVIISVTADPTVIPDPHKMCDDLVESLKL  474

Query  1584  IK  1589
             IK
Sbjct  475   IK  476



>emb|CDX96219.1| BnaC02g14320D [Brassica napus]
Length=490

 Score =   414 bits (1065),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 207/479 (43%), Positives = 305/479 (64%), Gaps = 23/479 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP SRL + P FN  I+  MG   K NP      + HTL  HPRF+S++ +   + 
Sbjct  16    EEPLSPCSRLFNSPDFNCAIIVTMGCKVKGNPPAIIDGLKHTLANHPRFSSILDMKNGKK  75

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             GK +WV T+V + +H+ V   P++E   +       +++EDY+ +L+   +D+S+PLW++
Sbjct  76    GKPRWVRTKVRVEEHVIV---PDIEPNTENP----DQYLEDYISKLTTVPLDLSKPLWEI  128

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR------SSS  692
             H+L LKT +AE++ +L++HH+LGDG S+ SL LACTR+T++P+ LPT++ +      S  
Sbjct  129   HVLCLKTSNAESIGILKIHHSLGDGMSLMSLFLACTRKTSDPEALPTVAVQKKQFGPSCY  188

Query  693   ppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAY  872
                  K            +LV+NT +DV +F  T+ FL D++TP+   P SE KPK+F Y
Sbjct  189   TGFFNKIWWLFVGLWFILRLVFNTFIDVLMFALTICFLGDTETPLLAKPGSELKPKKFVY  248

Query  873   RILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLR  1052
             RI+S +D   +K A N T+NDV LGVTQA LS YL+RRY   D  +     +L + +RLR
Sbjct  249   RIISFDDVKLVKNAVNMTVNDVLLGVTQAGLSRYLSRRY---DQAATPKSKDLMRRIRLR  305

Query  1053  SCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVRE  1232
             S +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL+Y+R 
Sbjct  306   SAIMINLRPNTGIEALADMMAKK-------SKCRWGNLFGYILLPFSLGLETDPLEYLRR  358

Query  1233  AKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEF  1412
             AK T DRKK+S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+E++ F
Sbjct  359   AKVTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITF  418

Query  1413  FGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
              GHP+++IAP+ +G P AL +HFQSY +K+ + ++ D  VIPDP+++ DD  +SL LIK
Sbjct  419   HGHPLSYIAPSVFGHPHALTLHFQSYENKVIISVTADPTVIPDPHKMCDDLVESLKLIK  477



>ref|XP_011024821.1| PREDICTED: O-acyltransferase WSD1-like isoform X3 [Populus euphratica]
Length=493

 Score =   412 bits (1060),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 301/464 (65%), Gaps = 19/464 (4%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             ++ E   K  ET ++K   ++   + ++EP+SP++RL H P FN  IL  +G  + INP 
Sbjct  21    VKTETATKKWETNEEKGMADSKESTSSQEPLSPAARLFHAPQFNCTILTAIGCKTSINPG  80

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETH  446
             V    +  TL+KHPRF+  +V+D  + G K KW  T V++  H+TV   P ++   D   
Sbjct  81    VIKMGLEQTLMKHPRFSKKLVIDDNKCGSKSKWESTIVNVENHVTV---PNLDPNMDSP-  136

Query  447   RKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLL  626
                 +FVEDY+  LS   +D+S+PLW++HILN+KT DAEA+AV R+HH+LGDGAS+ SLL
Sbjct  137   ---DQFVEDYISSLSTIPLDLSKPLWEMHILNVKTSDAEAIAVFRIHHSLGDGASLISLL  193

Query  627   LACTRQTANPKLLPTI-STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             LACTR+T++P  LP+I + + +    +              +++WNT VD+ +F AT+ F
Sbjct  194   LACTRKTSDPDALPSIPAQQRAGSHFSGGFWGLFFAMWTVLRVIWNTSVDLVLFAATMLF  253

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             L+D++TP+  +   E KPKRF +R +SL+D   +K A N TIND  +GVTQA LS YLNR
Sbjct  254   LEDTKTPLKGASGVELKPKRFVHRTVSLDDIKLVKNAMNMTINDAIMGVTQAGLSRYLNR  313

Query  984   RYGKRDIGSIEG-----QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             +Y   D   IE      +NN+PK++RLR+ +  N+RP  GIQ LAD+M  E   SN+  K
Sbjct  314   KYAG-DQSEIEDGENGKKNNIPKSIRLRASVLVNVRPTPGIQTLADLMADE---SNN-PK  368

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKA  1328
             WGWGNR GY ILP  +G+ +DPL+++R AKA  DRKK S E  F+++ A  VIK FG KA
Sbjct  369   WGWGNRIGYIILPFTVGLQDDPLEHLRRAKAMIDRKKLSLEATFSFHSAILVIKLFGAKA  428

Query  1329  AAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQP  1460
             +A +  ++ SN +  FSNVVGP E++ F+GHP+A+IAP+ YG P
Sbjct  429   SAAIARRVISNTTLAFSNVVGPLEEISFYGHPVAYIAPSVYGSP  472



>ref|XP_007039033.1| O-acyltransferase (WSD1-like) family protein, putative [Theobroma 
cacao]
 gb|EOY23534.1| O-acyltransferase (WSD1-like) family protein, putative [Theobroma 
cacao]
Length=540

 Score =   414 bits (1064),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 220/513 (43%), Positives = 316/513 (62%), Gaps = 25/513 (5%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNN-MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHN  284
             ++ I+  + K G E  + +S  E P+S  S + HEP  N  I+AIMG+ SK++P V    
Sbjct  26    IQEIDQVEAKIGTEEASPVSKDEVPLSTGSLIFHEPGINCCIIAIMGYKSKLDPAVIKEG  85

Query  285   MPHTLLKHPRFTS--LMVVDKEEN-GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKN  455
             +  TL+KHP F+S  L  +D+  N GK KW+ T+V++  H+ +   PEV    D      
Sbjct  86    LKQTLIKHPCFSSKLLSAIDQMMNSGKKKWIRTQVNVDNHVIL---PEV----DTVTESP  138

Query  456   KKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLAC  635
              +F+EDYV  L+   +D+S+PLW+LH++NLKT +AEA+ + R+HH++GDG S+ SLLLAC
Sbjct  139   SQFIEDYVTYLTGIPIDLSKPLWELHLVNLKTPEAEAVGIFRIHHSIGDGMSLISLLLAC  198

Query  636   TRQTANPKLLPTISTRSSSppkt---lkpnnpkpkpknffklVWNTLVDVFIFIATLFFL  806
              R++++PK LPT+  +  +  +               +  +L+ NTLVD+ +F+AT+ FL
Sbjct  199   CRKSSDPKALPTLPKQKQADSRYPHPHGFFRLFLAIWSVLRLILNTLVDLLLFVATVVFL  258

Query  807   KDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRR  986
             KD++TP+  S   E   K+  +R +SL+D   +K A   T+NDV LGVT+A LS YLNR+
Sbjct  259   KDTKTPLKGSSGVEQNAKKIVHRTVSLDDIKLVKDAMGMTVNDVILGVTEAGLSRYLNRK  318

Query  987   YGKRDIGSIEGQ--NNLPKNLRLRSCLFFNLRPAKGIQA-----LADMMKKEKGESNSM-  1142
             YG+ D G    Q  N+LP+N+RLR+    N+R   GIQ       +   +K +  S S  
Sbjct  319   YGEVDRGKEAEQKSNHLPRNIRLRATALVNIRQTAGIQVSFLSPFSRASEKVEYASQSFL  378

Query  1143  ---SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKF  1313
                SK  WGN+ GY  +P  I + NDPLDY+R AKA  DRKK S E I T+     V+K 
Sbjct  379   VFKSKVKWGNQIGYICIPFTIALRNDPLDYLRGAKAAGDRKKLSLEAICTHLTNKCVVKL  438

Query  1314  FGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYV  1493
             FG K +A L  ++  N +   SNVVGP E++  +GHPIAFIAP+ YG P AL  HFQSY+
Sbjct  439   FGSKLSAALVYRVIFNTTMTLSNVVGPVEEISLYGHPIAFIAPSVYGHPQALTCHFQSYM  498

Query  1494  DKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +KM ++++VD NVIPDP  L DD E+SL + KD
Sbjct  499   NKMSIVLAVDPNVIPDPRLLCDDLEESLKIFKD  531



>emb|CDY47071.1| BnaA03g12270D [Brassica napus]
Length=490

 Score =   412 bits (1059),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 215/493 (44%), Positives = 307/493 (62%), Gaps = 27/493 (5%)
 Frame = +3

Query  141   GMENNNM--SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPR  314
             G E N    ++ EEP+SP SRL + P FN  I+ IMG   K NP      + HTL+ HPR
Sbjct  2     GGEKNTARETVGEEPLSPCSRLFNSPDFNCAIIVIMGCKVKGNPPAIIDGLKHTLVNHPR  61

Query  315   FTSLMVVDKE--ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYEL  488
             F+S+++ + +  + GK  WV TEV +  H+ V   P++    D       +++E Y+ +L
Sbjct  62    FSSILIQEMKNGKKGKPSWVRTEVRVEDHVIV---PDI----DPNIENPDQYLEHYISKL  114

Query  489   SKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLP  668
             +   MD S+PLW++H+L LKT +AE++ +L++HH+LGDG S+ SL LACTR+T++P+ LP
Sbjct  115   TTVPMDFSKPLWEIHLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALP  174

Query  669   TISTR------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPIT  830
             T+S +      SS      K        +   +LV+NT VDV +F  T+ FL+D++TP+ 
Sbjct  175   TVSVQRKQFGPSSYNGFFNKIWWLFVGLRFILRLVFNTFVDVLMFALTICFLRDTETPLL  234

Query  831   PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS  1010
               P +E  PKRF +RI+S +D   +K A   T+NDV LGVTQA LS YL+RRY   D  +
Sbjct  235   AKPGTELVPKRFVHRIISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRY---DQEA  291

Query  1011  IEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPL  1190
                     +  RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP 
Sbjct  292   TPKSKESMRKFRLRSAIMINLRPNTGIEALADMMAKK-------SKCRWGNLFGYILLPF  344

Query  1191  KIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAST  1370
              +G+  DPL+YVR AK T DRKK+S E +F+      ++K  G KA+ +L  K+  N + 
Sbjct  345   SVGLETDPLEYVRRAKVTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTL  404

Query  1371  CFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQ  1550
              FSNVVGP+E++ F GHP+++IAP+ +G P AL VHFQSY  K+ + ++ D  VIPDP++
Sbjct  405   TFSNVVGPKEEITFHGHPLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVIPDPHK  464

Query  1551  LLDDFEKSLHLIK  1589
             + DDF +SL LIK
Sbjct  465   MCDDFVESLKLIK  477



>ref|XP_009127172.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
 emb|CDY49169.1| BnaA02g10280D [Brassica napus]
Length=489

 Score =   412 bits (1059),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 209/492 (42%), Positives = 309/492 (63%), Gaps = 26/492 (5%)
 Frame = +3

Query  141   GMENN---NMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHP  311
             G E N   +M   EEP+SP SRL + P FN  I+  MG   K NP      + HTL  HP
Sbjct  2     GGEKNKTRDMVEEEEPLSPCSRLFNSPDFNCAIIVTMGCKVKGNPPAIIEGLKHTLANHP  61

Query  312   RFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELS  491
             RF+S++ +   + G  +WV T++ + +H+ V   P++E   +       +++EDY+ +L+
Sbjct  62    RFSSILDMKNGKKGTPRWVRTKIRVEEHVIV---PDIEPNTENP----DQYLEDYISKLT  114

Query  492   KERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT  671
                +D+S+PLW++H+L LKT +AE++ +L++HH+LGDG S+ SL LACTR+T++P+ LPT
Sbjct  115   TVPLDLSKPLWEIHVLCLKTSNAESIGILKIHHSLGDGMSLMSLFLACTRKTSDPEALPT  174

Query  672   ISTR------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITP  833
             ++ +      S       K            +LV+NT +DV +F  T+ FL+D++TP+  
Sbjct  175   VAVQKKQFGPSCYTGFFNKIWWLFVGLWFILRLVFNTFIDVLMFALTICFLRDTETPLLA  234

Query  834   SPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSI  1013
              P SE KPK+F YRI+S +D   +K A N T+NDV LGVTQA LS YL+RRY   D  + 
Sbjct  235   KPGSELKPKKFVYRIISFDDVKLVKNAMNMTVNDVLLGVTQAGLSRYLSRRY---DQEAT  291

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
                 +L + +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  
Sbjct  292   PKSKDLMRRIRLRSAIMINLRPNTGIEALADMMAKK-------SKCKWGNLFGYILLPFS  344

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             +G+  DPL+Y+R AK T DRKK S E +F+      ++K  G KA+ +L  K+  + +  
Sbjct  345   LGLETDPLEYLRRAKVTVDRKKQSLEAVFSMAFFKLILKVMGLKASVVLVRKVIHSTTLS  404

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSNVVGP+E++ F GHP+++IAP+ +G P AL +HFQSY +K+ + ++ D  VIPDP+++
Sbjct  405   FSNVVGPKEEITFHGHPLSYIAPSVFGHPHALTLHFQSYENKVIISVTADPTVIPDPHKM  464

Query  1554  LDDFEKSLHLIK  1589
              DD  +SL LIK
Sbjct  465   CDDLVESLKLIK  476



>ref|XP_009132482.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=490

 Score =   412 bits (1058),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 215/493 (44%), Positives = 306/493 (62%), Gaps = 27/493 (5%)
 Frame = +3

Query  141   GMENNNM--SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPR  314
             G E N    ++ EEP+SP SRL + P FN  I+ IMG   K NP      + HTL+ HPR
Sbjct  2     GGEKNTARETVGEEPLSPCSRLFNSPDFNCAIIVIMGCKVKGNPPAIIDGLKHTLVNHPR  61

Query  315   FTSLMVVDKE--ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYEL  488
             F+S+++ + +  + GK  WV TEV +  H+ V   P++    D       +++E Y+ +L
Sbjct  62    FSSILIQEMKNGKKGKPSWVRTEVRVEDHVIV---PDI----DPNIENPDQYLEHYISKL  114

Query  489   SKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLP  668
             +   MD S+PLW++H+L LKT +AE++ +L++HH+LGDG S+ SL LACTR+T++P+ LP
Sbjct  115   TTVPMDFSKPLWEIHLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALP  174

Query  669   TISTR------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPIT  830
             T+S +      SS      K            +LV+NT VDV +F  T+ FL+D++TP+ 
Sbjct  175   TVSVQRKQFGPSSYNGFFNKIWWLFVGLWFILRLVFNTFVDVLMFALTICFLRDTETPLL  234

Query  831   PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS  1010
               P +E  PKRF +RI+S +D   +K A   T+NDV LGVTQA LS YL+RRY   D  +
Sbjct  235   AKPGTELVPKRFVHRIISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRY---DQEA  291

Query  1011  IEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPL  1190
                     +  RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP 
Sbjct  292   TPKSKESMRKFRLRSAIMINLRPNTGIEALADMMAKK-------SKCRWGNLFGYILLPF  344

Query  1191  KIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAST  1370
              +G+  DPL+YVR AK T DRKK+S E +F+      ++K  G KA+ +L  K+  N + 
Sbjct  345   SVGLETDPLEYVRRAKVTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTL  404

Query  1371  CFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQ  1550
              FSNVVGP+E++ F GHP+++IAP+ +G P AL VHFQSY  K+ + ++ D  VIPDP++
Sbjct  405   TFSNVVGPKEEITFHGHPLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVIPDPHK  464

Query  1551  LLDDFEKSLHLIK  1589
             + DDF +SL LIK
Sbjct  465   MCDDFVESLKLIK  477



>ref|XP_002865972.1| hypothetical protein ARALYDRAFT_918418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42231.1| hypothetical protein ARALYDRAFT_918418 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   411 bits (1056),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 308/483 (64%), Gaps = 25/483 (5%)
 Frame = +3

Query  162   SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK  341
             ++ EEP+SP SRL + P FN  I+  MG   K +     H + HTL+ HPRF+S++ ++ 
Sbjct  11    TVEEEPLSPCSRLFNSPDFNCAIIVTMGSRVKGDTPAIIHGLEHTLVNHPRFSSILEMNN  70

Query  342   EENGKMKWVETEVDLSQHITVVEA-PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
              + GK +WV T+V + +H+ V +  P++E           +++EDY+ +L+   MD+S+P
Sbjct  71    GKKGKPRWVRTKVKVEEHVIVPDIDPDIE--------NPDQYLEDYISKLTTIPMDLSKP  122

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR-----  683
             LW++H+L LKT +AE+ A+L++HH+LGDG S+ SLLLACTR+T++P+ LPT++ +     
Sbjct  123   LWEMHLLGLKTLNAESFAILKIHHSLGDGMSLMSLLLACTRKTSDPQALPTVAVQKKRFG  182

Query  684   -SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPK  860
              S +     K            +L++NT VD+ +F  T+FFL+D++TP+   P SE  PK
Sbjct  183   PSCNSGFFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIFFLRDTETPLLAKPGSELTPK  242

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKN  1040
             RF +RI+S +D   +K A   T+NDV LGVTQA LS YL+RRY   D  +        + 
Sbjct  243   RFIHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRRY---DQEATPKSKESMRK  299

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL+
Sbjct  300   IRLRSAIMINLRPNTGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGLEADPLE  352

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             YVR+AKAT DRKK S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+E
Sbjct  353   YVRQAKATIDRKKNSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTFSNVVGPKE  412

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F GHP+ +I+P  +G P AL +HFQSY +K+ + ++ D  VIPDP+++ DD  +SL 
Sbjct  413   EITFHGHPLNYISPCVFGHPHALTLHFQSYANKVIISVTADPTVIPDPHKMCDDLVESLK  472

Query  1581  LIK  1589
             +IK
Sbjct  473   IIK  475



>ref|XP_010426433.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=514

 Score =   412 bits (1058),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 212/491 (43%), Positives = 303/491 (62%), Gaps = 28/491 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++R+ H P FN +++A++G   KI   V T  +  TL++HPRF+S +V    +  
Sbjct  23    QPLSPTARIFHAPEFNCYVIAVIGLKKKIEADVITEGLKQTLIRHPRFSSKLVSHGNKKR  82

Query  354   KMK-WVETEVDLSQHITVVEAPEVEVEGDETHRKNK-KFVEDYVYELSKERMDMSRPLWD  527
             + + WV T V  S H+ V   P++E +  E    N   F+E Y+  L+   +D+S+PLW 
Sbjct  83    QTQSWVRTNVVASDHVVV---PDIETQNTENGNVNADAFLESYISNLTTVPLDISKPLWQ  139

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR--------  683
             LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+NP  LP+   +        
Sbjct  140   LHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPDELPSQPNQNRSSSTSS  199

Query  684   --SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESK  854
               +++     +         +   LVWNT+ D   FIAT  FLKD++TPI     + +SK
Sbjct  200   RLTAASRGDSRFLWLVMILWSALMLVWNTVCDALEFIATAMFLKDTETPIKGDFRSGKSK  259

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG-KRDIGSIE----G  1019
                  +R +SL D   IK A N T+NDV LGVTQA LS YL +RYG K+ +G  E     
Sbjct  260   RMCLVHRTVSLEDIKQIKNAMNMTVNDVVLGVTQAGLSQYLEKRYGEKKKVGKDEESKSN  319

Query  1020  QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIG  1199
              N++PK +RLRS L  NLRP  GIQ LADMM K+       S   WGN  GY + P  IG
Sbjct  320   SNDMPKLIRLRSALLVNLRPTTGIQDLADMMAKK-------SNCKWGNWIGYIVFPFSIG  372

Query  1200  MLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFS  1379
             + +DPL+++R AK   DRKK S+E   T+   NF+IK FG + AA + N+  SN +  FS
Sbjct  373   LRDDPLEHLRRAKRIIDRKKNSFEAALTFIAGNFIIKSFGVQVAAKIINRALSNTTMSFS  432

Query  1380  NVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLD  1559
             N++GP E++ F+GHPI ++AP+ YG P AL +HFQSY+++M + ++VD   I DP++LLD
Sbjct  433   NLIGPIEEISFYGHPITYMAPSVYGHPHALTIHFQSYMNQMTISLTVDPTAISDPHRLLD  492

Query  1560  DFEKSLHLIKD  1592
             D+EKSL  IKD
Sbjct  493   DWEKSLQSIKD  503



>ref|XP_006282349.1| hypothetical protein CARUB_v10028646mg [Capsella rubella]
 gb|EOA15247.1| hypothetical protein CARUB_v10028646mg [Capsella rubella]
Length=496

 Score =   410 bits (1055),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 306/477 (64%), Gaps = 23/477 (5%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP SRL + P FN  I+  MG   K NP      + HTL+ HPRF+S++ ++  + GK
Sbjct  24    PLSPCSRLFNSPDFNCAIIVTMGCRVKANPPAIVDGLKHTLVNHPRFSSILEMNNGKKGK  83

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
               WV T+V +  H+ V   P++    D       K++EDY+ +L+   MD+S+PLW++HI
Sbjct  84    PCWVRTKVRVEDHVIV---PDI----DPKIENPDKYLEDYISKLTTIPMDLSKPLWEMHI  136

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR------SSSpp  698
             LNLKT +AE++A+L++HH+LGDG S+ SL LACTR+T+NP+ LPT++ +      S +  
Sbjct  137   LNLKTSNAESIAILKIHHSLGDGMSLMSLFLACTRKTSNPEALPTVAVQKKRLVPSCNSG  196

Query  699   ktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRI  878
                K            +L++NT VD+ +F  T+ F++D++TP+   P SE  PKRF +RI
Sbjct  197   FFNKIWWLFVVLWFILRLLFNTFVDILMFALTILFVRDTETPLLAKPGSELIPKRFVHRI  256

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSC  1058
             +S +D   +K A   T+NDV LGVT+A L+ YL+RRY +    + + + ++ + +RLRS 
Sbjct  257   ISFDDVKLVKNALKMTVNDVLLGVTEAGLTRYLSRRYDQE--ATPKSKESM-RKIRLRSA  313

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
             +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G   DPL+YVR AK
Sbjct  314   IMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGQETDPLEYVRRAK  366

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
             AT DRKK+S E +F+      ++K FG KA+ +L  K+  + +  FSNVVGP+E++ F G
Sbjct  367   ATVDRKKHSLEAVFSMAFFKVILKVFGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHG  426

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             HP+++IAP  +G P AL +HFQSY +K+ + ++ D  +IPDP+++ DD  +SL +IK
Sbjct  427   HPLSYIAPCVFGHPHALTLHFQSYANKVIISVTADPTIIPDPHKMCDDLVESLKIIK  483



>ref|XP_010671460.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=458

 Score =   409 bits (1051),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/466 (43%), Positives = 302/466 (65%), Gaps = 32/466 (7%)
 Frame = +3

Query  237   IMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK-MKWVETEVDLSQHITV---  404
             ++G  + IN  V    +  T++KHPR +S +V   +++GK + W+ T+V++  H+ V   
Sbjct  1     MVGCKTMINVEVIKDGINQTMVKHPRISSKLVFHPKKHGKPVGWIRTKVNVDDHVIVPNL  60

Query  405   ---VEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAV  575
                + +P+             KFVEDYV  L++  MD+++PLW++HILN+KT+DA ++A+
Sbjct  61    HSHINSPD-------------KFVEDYVTNLTQTPMDLTKPLWEIHILNIKTKDANSIAI  107

Query  576   LRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpkn-----  740
              R+HH++GDG S+ SL+LACTR+T++P  +PT  T      K  + ++            
Sbjct  108   FRIHHSIGDGVSLMSLVLACTRKTSDPNAVPTFPTEDKKKKKLFENSSSFWLLSCFLWLW  167

Query  741   -ffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLAT  917
                K++WNT+VD+  F+AT+ FLKD+ TP+  S  +E  PK+F YRILSL+D   +K   
Sbjct  168   FALKMLWNTIVDLCFFLATMIFLKDTNTPVKASRGTEKGPKKFVYRILSLDDIKLVKNVM  227

Query  918   NTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQA  1097
             N TINDV +G+TQA LS YLNR+YG+        QN+LP+++RLRS L  N+RP   IQ 
Sbjct  228   NVTINDVIVGITQAGLSRYLNRKYGESKGDQNVQQNHLPQHIRLRSTLLVNIRPTSKIQD  287

Query  1098  LADMMKKEKGESNS-MSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEP  1274
             LA+ M     ESN    KW WGN  GY +LP  I + ++PLDY+R+AK T D+KK S E 
Sbjct  288   LAEQM-----ESNDPKRKWEWGNSIGYILLPFDIALRDNPLDYIRKAKTTIDKKKQSLEA  342

Query  1275  IFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYG  1454
             +FT+  A F++K  G    A +T++  SNA+  FSNVVGP+E++ F+GHP+ F+AP+ YG
Sbjct  343   VFTFICAEFILKALGLGVTATITHRALSNATLSFSNVVGPKEEISFYGHPMTFLAPSVYG  402

Query  1455  QPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              P AL VHFQSY+D+M ++++VD+NVIP+P++L DD E+ L   K+
Sbjct  403   HPHALTVHFQSYMDQMTLVLAVDQNVIPEPHRLCDDIEEFLAFAKE  448



>ref|XP_004235106.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=500

 Score =   410 bits (1055),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 212/502 (42%), Positives = 313/502 (62%), Gaps = 22/502 (4%)
 Frame = +3

Query  108   LKPIETRKQKSG-----MENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHV  272
             LKPI T  QK+               +EP SP++RL H    N HI+AI+G  +KINP V
Sbjct  6     LKPINTNGQKNSTVVVIEPEQEQEQEQEPASPATRLFHTKNLNCHIIAILGCTTKINPDV  65

Query  273   FTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRK  452
                 +  TLL HPRF+S+ VVD E+ G   W +T+V++ +HI     P+++ + D     
Sbjct  66    IKKGLESTLLNHPRFSSIPVVD-EKKGVRNWKKTKVNVEEHIV---CPDLDPDMDSPD--  119

Query  453   NKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLA  632
               +++E+Y   L+   +DM++PLW++HILN+KT +A A+ +L++HH++GDG SI SL+LA
Sbjct  120   --EYLENYTSNLTTIPLDMTKPLWEVHILNIKTSEANAIGILKLHHSIGDGMSIVSLILA  177

Query  633   CTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklV-WNTLVDVFIFIATLFFLK  809
             CTR+ ++P+ LPT+ + +      +           F  +V W T+VDV +F+AT+ FLK
Sbjct  178   CTRKASDPEALPTLPSSTKKEKNDVGLLRRFCYYVWFLCMVFWYTIVDVVLFLATILFLK  237

Query  810   DSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY  989
             D++TP+      E  PKR  +   SL+D   +K A N TINDV +G+ QA  S YLNRRY
Sbjct  238   DTETPMKGGVGVEHSPKRLVHTTASLDDMKIVKNALNLTINDVVMGMAQAGFSRYLNRRY  297

Query  990   GKRDIGSIEGQ-NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNR  1166
             G ++ G    + NNLPKN+RLR  + FN+RP+ GI+ALA+MM+K+       SK  WGN+
Sbjct  298   GNKNGGKGSNKTNNLPKNIRLRGSIVFNIRPSTGIKALAEMMEKK-------SKARWGNK  350

Query  1167  FGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTN  1346
              GY +  L I + +DPLDY+R+AK   DRKK S E  F++  A      FG K A+ +T 
Sbjct  351   IGYVLTRLPISLPDDPLDYIRQAKNIIDRKKLSLESRFSFTAAKLTQDIFGSKVASKVTR  410

Query  1347  KIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDE  1526
             ++ S+ +   SNVVGP+E++ F+GH +A++APT +G P A+ +HFQSY +KM + ++VD 
Sbjct  411   RVLSSTTVLISNVVGPQEEITFYGHKLAYVAPTTFGLPYAVTIHFQSYCNKMTISMAVDS  470

Query  1527  NVIPDPNQLLDDFEKSLHLIKD  1592
              VI DP QL DD   SL + K+
Sbjct  471   QVIQDPYQLCDDLRDSLRMFKE  492



>gb|KDP45597.1| hypothetical protein JCGZ_17204 [Jatropha curcas]
Length=501

 Score =   410 bits (1055),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 216/512 (42%), Positives = 318/512 (62%), Gaps = 38/512 (7%)
 Frame = +3

Query  102   RNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
             + LKPI  RK++            EP+SP +R+ HE   N +I   MGF + +N  +F  
Sbjct  2     QGLKPIRVRKEEE----EEKKEEGEPLSPVARIFHESHSNAYITVFMGFKTPVNLTIFKA  57

Query  282   NMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKK  461
             N+  TLLKHPR +SL V+D++  G+MKWV+TE++L  HI V       ++  +      K
Sbjct  58    NITKTLLKHPRLSSLQVMDEKRGGEMKWVKTEINLDDHIIVPVIDHQNIDCPD------K  111

Query  462   FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTR  641
             FVEDY   LSK ++  S+P+WD H LN+KT +AE+  + R+HH++GDG S+ SLL++ +R
Sbjct  112   FVEDYASNLSKTQISKSKPMWDFHFLNIKTSEAESTVIFRVHHSIGDGISLMSLLISFSR  171

Query  642   QTANPKLLPTISTRSSSppktlkpnnpkpkpknffklV--WNTLVDVFIFIATLFFLKDS  815
             + ++ + LPTI T      K       +   + +  LV  WNT V + + IAT+ FL+D+
Sbjct  172   KASDLESLPTIPTVKKRYEKNSGGGFRQFLERLWRFLVLCWNTFVGLVMIIATVLFLEDT  231

Query  816   QTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK  995
             +TPI  S    S P+RF +R +SL+D  S+K A  TT+NDV +G+TQA LS YLNRRY K
Sbjct  232   ETPIKGS-GDGSVPRRFVHRTISLDDVKSVKNAMGTTVNDVMVGITQAGLSQYLNRRYAK  290

Query  996   -------------RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESN  1136
                          ++  + + ++ LPKN+R+R+    NLR   GIQAL +MM+K      
Sbjct  291   LLNVKDTYAEEDKKEGEATKSKSYLPKNIRMRASFIVNLRKDSGIQALDEMMRKG-----  345

Query  1137  SMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFF  1316
               +K  WGN+ GY + P  I + +DPLDYVR+AK   +RKK S E ++ Y    F+++FF
Sbjct  346   --TKAKWGNKVGYVLYPFTIKLRDDPLDYVRDAKVVGERKKASLEALYAYLGNRFLLRFF  403

Query  1317  GPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVD  1496
             G K   +      S  + CFS+V GP+E++ F+ HP+++IAPTCYGQP+AL++H  SYV+
Sbjct  404   GIKKFGLP-----SQTTLCFSSVPGPQEEISFYEHPMSYIAPTCYGQPNALLIHVVSYVN  458

Query  1497  KMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             KM +++SVDEN+IPDP+QL DD + SL LIK+
Sbjct  459   KMKIVLSVDENIIPDPHQLCDDIQNSLKLIKN  490



>ref|XP_010924517.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Elaeis guineensis]
Length=519

 Score =   409 bits (1051),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 212/474 (45%), Positives = 300/474 (63%), Gaps = 16/474 (3%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             PVSP+ RL  +P FN HI+++MG   +++       +  TL++HPRF+S+ V D++    
Sbjct  55    PVSPAGRLFLQPRFNCHIVSVMGCGKRLDVDAVKAGLEVTLVRHPRFSSIQVSDEK---P  111

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
             ++WV T+V++  H+ + +     ++ + T     K VEDYV  LS   MD SRPLWDLHI
Sbjct  112   LRWVRTKVNVEDHVIIPD-----LDPNATSANPDKVVEDYVASLSSTTMDHSRPLWDLHI  166

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpn  716
             LN  T +A A+A+LR+HH+LGDG S+ SL LACTRQ ++P  LP++    SS     +  
Sbjct  167   LNFVTSEAAAVAILRIHHSLGDGISLMSLFLACTRQCSDPDRLPSLPDARSSTAANSRSG  226

Query  717   npkpkpknffklV--WNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
               +     +  LV  W+TLVDV +F ATL F+KD++TP+      E  PKRF +R +SL+
Sbjct  227   ILELLLWVWAGLVLAWHTLVDVVLFTATLAFVKDTRTPLVGMEGVEFHPKRFLHRTVSLD  286

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFN  1070
             D   IK A N T+NDV +G+T A LS YL+RRYG+ D    E +  LP N+RLR+ L  N
Sbjct  287   DIKDIKKAMNCTVNDVLVGITSAGLSRYLDRRYGEGDDVKKE-KKRLPANIRLRTALLVN  345

Query  1071  LRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATAD  1250
             +R   GI ALA+MM+K KG            + GY +L   I +  DPL+Y+R  KA A+
Sbjct  346   IRRTPGIHALAEMMEKGKGGGAKWGN-----KLGYMVLQFPIAIFEDPLEYIRRGKAIAE  400

Query  1251  RKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIA  1430
             RKK S E +FTY+ A  ++K FG +AAA L  ++ ++ +  FSN+VGP E + F GHP+ 
Sbjct  401   RKKNSLEAVFTYWSAWVIVKIFGIEAAAALCRRMVTHTTVSFSNIVGPIEKIGFCGHPVV  460

Query  1431  FIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             +IAP+ YG P AL +HFQSY + M ++++VDE  IP+PNQLLDD  +SL LIKD
Sbjct  461   YIAPSVYGHPHALTLHFQSYTNTMKIVVAVDELTIPNPNQLLDDLTESLRLIKD  514



>ref|XP_011075993.1| PREDICTED: O-acyltransferase WSD1-like [Sesamum indicum]
Length=492

 Score =   408 bits (1048),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 206/487 (42%), Positives = 317/487 (65%), Gaps = 21/487 (4%)
 Frame = +3

Query  159   MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD  338
             MS+ EEP SP++RL+  P+FNL ILA++G+++KI+ ++F   +  TLLKHPRF+SL+VV+
Sbjct  1     MSLKEEPASPTARLMQAPSFNLCILALLGYSTKIDVNLFKKCLERTLLKHPRFSSLLVVN  60

Query  339   KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
              ++ GK  W  T VDL  H+ V   P++    D       +FVED+   LS+  +D ++P
Sbjct  61    DKKRGKCSWRRTRVDLENHVYV---PDL----DPDMENPDEFVEDFTSGLSRIPLDYAKP  113

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSpp  698
             LW++HILN+KT DA ++ + ++HH++GDG S+ SL+LAC+++ ++P+ LP + ++     
Sbjct  114   LWEVHILNVKTSDANSVVIFKIHHSMGDGVSMISLVLACSKKLSDPESLPVMPSKKQKQK  173

Query  699   ktlkpnnpk---pkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
              +      K           +++NTL+D  +F+AT+ FL+DS+TPI      +  PKRF 
Sbjct  174   PSGVGGLMKRWFVSVWIILVVIFNTLIDSALFLATILFLEDSKTPIKGGGRVDGGPKRFV  233

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK----RDIGS--IEGQNNL  1031
             +RI+SL+D   +K A N +INDV LGVT+A L+ YL   Y      R+ G+  ++    L
Sbjct  234   HRIVSLDDVKLVKNAMNVSINDVVLGVTEAGLTRYLKTTYDTEQKHRENGAHVMKKTRAL  293

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
             P++LRLRS + FNLR    IQ LA++M+KEK E N M    WGN     +LP+ I + +D
Sbjct  294   PRHLRLRSAVVFNLRSTPAIQDLAEIMEKEK-ELNGM----WGNLVAIVLLPMTIALQDD  348

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PL YVR AKAT +RKK S E  F +     +IK FG K AA +T+ +F N +  FSNV G
Sbjct  349   PLSYVRRAKATMNRKKLSLESKFVFTALKLLIKLFGIKTAAAVTSAVFRNTTFGFSNVAG  408

Query  1392  PREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEK  1571
             P++++  FGHP+ +IAP+ +G P AL++H Q+Y +K+ + ++ DEN+IP+P+QL DD ++
Sbjct  409   PQDEISLFGHPLCYIAPSVHGFPHALIIHCQTYANKLIICLAADENLIPNPHQLCDDLQQ  468

Query  1572  SLHLIKD  1592
             SL +IK+
Sbjct  469   SLQIIKE  475



>ref|XP_010442900.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   408 bits (1048),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/494 (42%), Positives = 310/494 (63%), Gaps = 26/494 (5%)
 Frame = +3

Query  126   RKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLK  305
             +K+ + ME     + EEP+SP SRL + P FN  I+  MG   K N       +  TL+ 
Sbjct  5     KKKNTVMET---VVEEEPLSPCSRLFNSPDFNCAIIVTMGCRVKGNTPAIIDGLKRTLVN  61

Query  306   HPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYE  485
             HPRF+S++ ++  + GK  WV T+V +  H+ V   PE+    D       +++EDY+ +
Sbjct  62    HPRFSSILEMNNGKKGKPCWVRTKVKVEDHVIV---PEI----DPKIENPDQYLEDYISK  114

Query  486   LSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL  665
             L+   MD+S+PLW++HI++LKT +AE++A+L++HH+LGDG S+ SL LACTR+T+NP+ L
Sbjct  115   LTTIPMDLSKPLWEIHIIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNPEAL  174

Query  666   PTISTR------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPI  827
             PT++ +      S +     K            +L++NT VD+ +F  T+F ++D++TP+
Sbjct  175   PTVAVQKKRFGPSCNSGFFNKIWWLCVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPL  234

Query  828   TPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIG  1007
                P SE  PKRF +RI+S +D   +K A   T+NDV LGVT+A LS YL+RRY +    
Sbjct  235   LAKPGSELNPKRFVHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATP  294

Query  1008  SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILP  1187
              ++      + +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP
Sbjct  295   KLKESM---RRIRLRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLP  344

Query  1188  LKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAS  1367
               +G+  DPL+YVR AKAT DRKK+S E +F+      ++K  G KA+ IL  K+  + +
Sbjct  345   FSVGLETDPLEYVRRAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVILVRKVIHSTT  404

Query  1368  TCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPN  1547
               FSNVVGP+E++ F GHP+++IAP  +G P AL +HFQSY +K+ + ++ D  VIPDP+
Sbjct  405   LTFSNVVGPKEEITFHGHPLSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVIPDPH  464

Query  1548  QLLDDFEKSLHLIK  1589
             ++ DD  +SL +IK
Sbjct  465   KMCDDLVESLKIIK  478



>ref|XP_010105248.1| O-acyltransferase WSD1 [Morus notabilis]
 gb|EXC04169.1| O-acyltransferase WSD1 [Morus notabilis]
Length=418

 Score =   404 bits (1038),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 210/420 (50%), Positives = 288/420 (69%), Gaps = 21/420 (5%)
 Frame = +3

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
             MKWV T+VDL +H+ V +      E  +      KF+EDY+Y L+K  ++  +P+WDLHI
Sbjct  1     MKWVRTKVDLDKHVIVADIDSNYTESPD------KFLEDYIYNLTKTSLNKLKPMWDLHI  54

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR-----SSSppk  701
             LN+KT +AE++ +LR+HH+LGDG S+ SLLLAC+RQ ANP+ LPT+ T+     +++P  
Sbjct  55    LNVKTSNAESVLILRVHHSLGDGISLMSLLLACSRQIANPQALPTLPTKKNLENNNNPSF  114

Query  702   tlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRIL  881
               +            +L+WNT+VDV +FIA+ FFLKD++TPI   P  E  P+R  +RI+
Sbjct  115   IRRFTLRFIGLWWLLQLLWNTIVDVSLFIASAFFLKDTKTPIRAPPGCEYNPRRIVFRIV  174

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK-RD--IGSIEGQNNLPKNLRLR  1052
             SL+DF  +K A   TINDVALGVTQA LS YLNRRYG+ RD  +GS   +NNLPK +RLR
Sbjct  175   SLDDFKLVKNAMKLTINDVALGVTQAGLSRYLNRRYGENRDDGLGSNVHRNNLPKKIRLR  234

Query  1053  SCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVRE  1232
             + L  N+RP+ GIQ LADMM+K     NS +KWG  N  GY  +P  I + +DPLDY+R+
Sbjct  235   ANLLVNVRPSPGIQDLADMMEK-----NSEAKWG--NWLGYVFVPFTIALKDDPLDYIRD  287

Query  1233  AKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEF  1412
             AKAT DRKK+S E + T+ ++  +   FG K+   L ++IFS+ +  FSNVVGP E++ F
Sbjct  288   AKATIDRKKHSLEALCTFSISGLLFSLFGIKSTTALLHRIFSSTTMAFSNVVGPSEEIAF  347

Query  1413  FGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             + H + ++A T YGQP+ LMV+FQSYV+KM +++SVDE  IPDP QL DD  +SL LIKD
Sbjct  348   YNHSMTYLAATTYGQPNELMVNFQSYVNKMTMVLSVDETTIPDPLQLCDDIAESLKLIKD  407



>ref|XP_006292398.1| hypothetical protein CARUB_v10018611mg [Capsella rubella]
 gb|EOA25296.1| hypothetical protein CARUB_v10018611mg [Capsella rubella]
Length=508

 Score =   405 bits (1041),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/486 (44%), Positives = 304/486 (63%), Gaps = 25/486 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++RL H P FN +I++++G  +KI P+V    + HTL++HPRF+S +V     N 
Sbjct  24    QPLSPAARLFHAPEFNCNIISVIGLKTKIEPYVIIQGLKHTLIRHPRFSSNLVNSWSNNR  83

Query  354   K-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             +  KWV T V +  H+ +   P++E +  E    +  F+E YV +L+   +D S+PLW++
Sbjct  84    QEQKWVRTNVVVEDHVII---PKIETQNIENADADA-FLESYVSDLTTIPLDTSKPLWEV  139

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI----------ST  680
             H+L+LKT DAE +A+LRMHH++GDG S+ SL+LACTR+T++P  LP++          S 
Sbjct  140   HLLDLKTSDAENVAILRMHHSVGDGMSMMSLVLACTRKTSDPNELPSLPYNYGMPSGSSP  199

Query  681   RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKP  857
               +S     +         + F LV NT+ D   FIAT  FLKDS+TPI       +SK 
Sbjct  200   LKTSSRCCSRLFWLVMFLWSAFVLVSNTVCDALEFIATALFLKDSETPIKGDFWLKKSKR  259

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIE--GQNNL  1031
              R  +R +SL+D   IK A   T+NDV LGV+QA LS YL RRYG+   G  +   ++N+
Sbjct  260   MRLVHRSVSLDDIKLIKTAMKMTVNDVVLGVSQAGLSQYLKRRYGEEKKGGDQEVSKSNM  319

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
             PK LRLR+ L  N+RPA GIQ LADMM K        SK  WGN  GY + P  I    D
Sbjct  320   PKRLRLRAALLVNIRPATGIQELADMMTKG-------SKCRWGNWIGYIVFPFSIASCKD  372

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PL+++R AK+  DRKK S E +FT+ L   ++K FG + AA + N+  SN +  FSN+VG
Sbjct  373   PLEHLRRAKSIIDRKKNSLEAVFTFALGKLLLKTFGVQRAAYVINRALSNTTMSFSNLVG  432

Query  1392  PREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEK  1571
             P E++ F+GH + ++AP+ YG P AL +HFQSY++KM + ++VD  VI DP++L DD E+
Sbjct  433   PVEEISFYGHTVTYMAPSVYGHPHALTMHFQSYMNKMTISLTVDPTVISDPHRLCDDLEE  492

Query  1572  SLHLIK  1589
             SL  IK
Sbjct  493   SLRSIK  498



>ref|NP_190488.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 emb|CAB66398.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42239.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63856.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78509.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=522

 Score =   405 bits (1041),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 223/503 (44%), Positives = 311/503 (62%), Gaps = 32/503 (6%)
 Frame = +3

Query  117   IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHT  296
             IETR   SG E       E+P+SP++RL H P FN +I++++GF SK++P VF      +
Sbjct  3     IETRPHISGDEKEE----EQPLSPAARLFHAPEFNCNIISVIGFKSKLDPCVFIRGFKES  58

Query  297   LLKHPRFTSLMVVDKEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVED  473
              ++HPRF+S +V D  ENG+  +WV T V +  H  V   P+++ +  E    +  F+ED
Sbjct  59    FIRHPRFSSKLVTD--ENGQNQRWVRTNVVVEDHFIV---PKIKPQNIEN---SNAFLED  110

Query  474   YVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTAN  653
             YV +L K  +D SRPLW+LH+L+LKT DAE +AVL++HH++GDG SI SL+LAC R+T+N
Sbjct  111   YVSDLMKIPLDTSRPLWELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSN  170

Query  654   PKLLPTISTR---SSSppktlkpnnpkpkpknffklVW-------NTLVDVFIFIATLFF  803
             P  LP++  +   SS        +    +     K++W       NT+ D   FI T  F
Sbjct  171   PDELPSLPYQYRSSSRSSLLTTGSRSDSRLLWLVKVIWTAVILGLNTVCDALEFIVTTLF  230

Query  804   LKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             +KD++TPI     +++SK  R  +R +SL+D    K A N TINDV LGVTQA LS YL 
Sbjct  231   VKDTETPIKGDFLSTKSKQLRLVHRTVSLDDIKLTKNAMNMTINDVVLGVTQAGLSRYLA  290

Query  981   RRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             RRYG+ +  +   Q  LPK +RLRS L  NLRP  GIQ LADMM  EKG     SK  WG
Sbjct  291   RRYGEEETKN-RKQKKLPKRIRLRSALLVNLRPTTGIQDLADMM--EKG-----SKCRWG  342

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N FGY + P  I + +DPL+++  A+ T  RKK SY  + TY     ++K  G K AA +
Sbjct  343   NWFGYVVFPFSIALRDDPLEHLEIAQKTISRKKNSYGAMLTYIFCRIIVKLLGIKVAASI  402

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
              N++ SN +  FSN+VGP E++ F+GHPI + A + YG P AL +H QSY++KM + + V
Sbjct  403   INRMVSNTTMTFSNMVGPVEEVSFYGHPITYFASSAYGHPHALTIHCQSYMNKMTITLIV  462

Query  1521  DENVIPDPNQLLDDFEKSLHLIK  1589
             D  VI DP++L DD+E+SL  IK
Sbjct  463   DPTVISDPHRLCDDWEESLRSIK  485



>ref|XP_009396534.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=515

 Score =   404 bits (1039),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 207/477 (43%), Positives = 294/477 (62%), Gaps = 16/477 (3%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP+++L H+P F+  I+AIMG     +  V    +  TL++HPRF+S+ V+++    +
Sbjct  44    PLSPAAQLFHQPGFDCCIVAIMGLGKPADVDVIRSGLAATLVRHPRFSSVPVLEESGGAE  103

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              +WV T+V +  HI +   P +E +         + VEDYV  L+   +D SRPLWDLH+
Sbjct  104   PRWVRTKVVVENHIVI---PALE-DQRRAAASPDQVVEDYVASLTSAPLDRSRPLWDLHV  159

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRS-----SSppk  701
             LN  T +A A+AVLR+HH+LGDG S+ SLLLACTR+ ++P  LPTI  +S     S    
Sbjct  160   LNFPTSEAAAVAVLRVHHSLGDGTSLMSLLLACTRKASDPHSLPTIPHQSRRPLVSRKLH  219

Query  702   tlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRIL  881
                          F  L WNTL+DV  F AT  F KD+ TP+T     E  PKR  +R +
Sbjct  220   AGGAFTLLLWLWAFLILAWNTLLDVLRFTATSAFSKDTTTPLTGPKGVEYHPKRIVHRTV  279

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCL  1061
             SL+D   +K A + T+NDV +GVT A LS YL+RRYG+ ++     +  LP N+RL+S L
Sbjct  280   SLDDIKDVKNAMHCTVNDVLVGVTSAGLSRYLSRRYGQ-NVDEHGKKTQLPSNIRLQSTL  338

Query  1062  FFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKA  1241
               N+RP+ G+ ALA++M+     +       WGN  GY ILP  I    DP+DY+R+ K 
Sbjct  339   LVNIRPSPGVHALAELMEGRHSGTK------WGNYIGYIILPFSIFKYKDPMDYIRKGKE  392

Query  1242  TADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGH  1421
              A RKK S E IFTY     ++K  G KA A L +++ SN +  FSN++GP E++ F+ H
Sbjct  393   IAGRKKNSLEAIFTYKSGELIVKCLGIKAGAALCHRVLSNTTLSFSNMIGPVEEVAFYDH  452

Query  1422  PIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             PI ++AP+ YG P AL VHFQSY++ M ++++VD+ VIPD +QLLDDF +SL LIK+
Sbjct  453   PIVYLAPSVYGHPQALTVHFQSYMNMMKMVVTVDDKVIPDAHQLLDDFAESLKLIKE  509



>ref|XP_010482729.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   403 bits (1036),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 204/494 (41%), Positives = 309/494 (63%), Gaps = 26/494 (5%)
 Frame = +3

Query  126   RKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLK  305
             +K+ + ME     + EEP+SP SRL + P FN  I+  MG   K N       +  TL+ 
Sbjct  5     KKKNTVMET---VVEEEPLSPCSRLFNSPDFNCAIIVTMGCRVKGNTPAIIDGLKRTLVN  61

Query  306   HPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYE  485
             HPRF+S++ ++  + GK  WV T+V +  H+ V   PE+    D       +++EDY+ +
Sbjct  62    HPRFSSILEMNNGKKGKPCWVRTKVKVEDHVIV---PEI----DPKIENPDQYLEDYISK  114

Query  486   LSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL  665
             L+   MD+S+PLW++HI++LKT +AE++A+L++HH+LGDG S+ SL LACTR+T+NP+ L
Sbjct  115   LTTIPMDLSKPLWEIHIIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNPEAL  174

Query  666   PTISTRS------SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPI  827
             PT++ +        +     K            +L++NT VD+ +F  T+F ++D++TP+
Sbjct  175   PTVAVQKKRFGPICNSGFFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPL  234

Query  828   TPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIG  1007
                P SE  PKRF +RI+S +D   +K A   T+NDV LGVT+A LS YL+RRY +    
Sbjct  235   LAKPGSEFNPKRFVHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATP  294

Query  1008  SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILP  1187
              ++      + +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP
Sbjct  295   KLKESM---RRIRLRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLP  344

Query  1188  LKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAS  1367
               +G+  DPL+YVR AK+T DRKK+S E +F+      ++K  G KA+ +L  K+  + +
Sbjct  345   FSVGLETDPLEYVRRAKSTIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTT  404

Query  1368  TCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPN  1547
               FSNVVGP+E++ F GHP+++IAP  +G P AL +HFQSY +K+ + ++ D  VIPDP+
Sbjct  405   LTFSNVVGPKEEITFHGHPLSYIAPCVFGHPYALTIHFQSYANKVIISVTADPTVIPDPH  464

Query  1548  QLLDDFEKSLHLIK  1589
             ++ DD  +SL +IK
Sbjct  465   KMCDDLVESLKIIK  478



>ref|XP_010537089.1| PREDICTED: O-acyltransferase WSD1 isoform X2 [Tarenaya hassleriana]
Length=470

 Score =   402 bits (1034),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 209/481 (43%), Positives = 303/481 (63%), Gaps = 28/481 (6%)
 Frame = +3

Query  159   MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD  338
             M+  EEP+SP SRL + P FN  I+  +G  ++ NP+     + +TL+ HPRF+S + ++
Sbjct  1     MATEEEPLSPGSRLFNSPEFNCSIIVTLGCKTRGNPNAIIDGLKNTLINHPRFSSKLEMN  60

Query  339   KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
             +   GK  WV T+V +  H+ V   P+++ + +E      KF+EDY+  L+   MDMS+P
Sbjct  61    RGNGGKPTWVRTKVRVEDHVVV---PDIDPDMEEP----DKFLEDYISNLTTLPMDMSKP  113

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIST---RSS  689
             LW++H+ NLKT DAE++ VL++HH+LGDG S+ SL LACTR+T+NP+ LPTI++   R  
Sbjct  114   LWEIHLFNLKTSDAESVGVLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTIASKKKRIG  173

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASES-KPKRF  866
               P          +     +L++NT VDV+ F ATLFFL+D++TPI   PA+ +  P+R 
Sbjct  174   PSPSLNSIFRFFVRVWFMIRLIFNTFVDVYKFAATLFFLRDTETPIMSKPAAMAPNPRRC  233

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +RI+S  D   +K A   TINDV LGVTQA +S YL+RRY +   G+ + +  + + +R
Sbjct  234   VHRIISFEDVKLVKNAMKMTINDVLLGVTQAGISRYLSRRYDQE--GTPKSKKFMGR-IR  290

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             L S +  NLRP  GI+ALADMM K        SK  WGN  GY +LP  +G+ NDPL+YV
Sbjct  291   LHSAIMINLRPNTGIEALADMMAKG-------SKCRWGNLIGYVLLPFSVGLENDPLEYV  343

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R AK+T DRKK S E + +Y +  F I   G KA   L  ++F N +  FSN+VGP+E++
Sbjct  344   RRAKSTIDRKKLSLEAVLSYAIFKFTINVLGFKAGEALVKRVFGNTTMTFSNLVGPKEEI  403

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
              F+GHPI++IA + +G P        SY DK+ + ++VD  VIPDP++L DDF +S   I
Sbjct  404   SFYGHPISYIASSAFGHP-------HSYADKIIIAMAVDPTVIPDPHRLCDDFSESFETI  456

Query  1587  K  1589
             K
Sbjct  457   K  457



>ref|XP_004231223.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=505

 Score =   404 bits (1037),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 231/527 (44%), Positives = 320/527 (61%), Gaps = 36/527 (7%)
 Frame = +3

Query  90    MEMERNL--KPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKIN  263
             ME +R +  KP+      S +  N    A   +SPSSR+ HEP++N+++LAIMG+   +N
Sbjct  1     MEGKRKMSVKPLRIISNTSNL--NGEKEAAMLLSPSSRMFHEPSYNVYVLAIMGWKVTMN  58

Query  264   PHVFTHNMPHTLLKHPRFTSLMVVDKEEN-GKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
                    +   +LKHPRF+SL V+D+ +  G M+WV T V++  H+ V +  +  ++ DE
Sbjct  59    IDSIKAELQSKMLKHPRFSSLQVMDESDGVGNMRWVPTTVNIDDHVIVPQFADNNMDNDE  118

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
                     VE+Y+ +LS   +DMS+PLWD HILN+KT  AEA +V R+HH++GDGA++ S
Sbjct  119   -------LVENYISDLSTTNVDMSKPLWDFHILNVKTSHAEATSVFRIHHSIGDGAALMS  171

Query  621   LLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklV---------WNTLVD  773
              LL C R T++P  LP +   SSS  K+    N   K   +  LV         +NT+VD
Sbjct  172   FLLFCFRTTSDPTCLPKLPVFSSSNDKSNSSPNKNRKKNLWQYLVKLWFLIKLLFNTMVD  231

Query  774   VFIFIATLFFLKDSQTPITPSPA-SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGV  950
             V +FIAT  FLKDSQTP T + A + S  +R+ YR +SL+D   IK  TN  +NDV LG+
Sbjct  232   VLLFIATALFLKDSQTPFTTTQAFNASARQRYIYRSVSLDDIKFIKDVTNAKLNDVVLGI  291

Query  951   TQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGE  1130
              QAALS Y +R YGK    S+EG       +R R+ +  NLRPA G+QA+A+M++K    
Sbjct  292   VQAALSRYFHRTYGKAGKFSVEG-------MRCRANVIVNLRPALGVQAIAEMIEKNVAV  344

Query  1131  SNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIK  1310
                      GN FG+ ++PL IG L++PLDYV +AK   DRKK+S E  F++Y + F + 
Sbjct  345   IQ-------GNCFGFVLVPLSIGQLDNPLDYVVKAKTLMDRKKHSLESQFSFYASQFFLN  397

Query  1311  FFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSY  1490
              FG K AA LT ++ S  +   SNV+GPRE +   GHP+ FIAPTC G P+ +MVH  SY
Sbjct  398   LFGYKGAAKLTQRVTSQTTLALSNVIGPREQISCAGHPVEFIAPTCSGYPTGIMVHVCSY  457

Query  1491  VDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKDaaaaaaTSSPTNL  1631
             V+K+   I+VDE +IPD NQ  DDF KS  LIK+AA A  T   T L
Sbjct  458   VNKLTFTIAVDEGIIPDLNQFGDDFIKSFMLIKEAAHAHHTKLATKL  504



>ref|XP_009395725.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=535

 Score =   404 bits (1039),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 220/482 (46%), Positives = 299/482 (62%), Gaps = 20/482 (4%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG-  353
             PVSP  RL H+  F+ +I+AIMG+   I+  V    +  TL++HPRF S+ VV  E  G 
Sbjct  58    PVSPGGRLFHQRGFDCYIVAIMGYAKPIDVGVVKSGLEKTLVRHPRFCSIPVVLDETGGT  117

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K  WV  +V +  HI +   P++  +         + VEDY+  L+   MD SRPLW+LH
Sbjct  118   KSTWVPAKVVVDDHIVI---PDL-ADPRRITTSPDQLVEDYIASLTCIPMDHSRPLWELH  173

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN  T DA A+AVLR+HH+LGDG S+ SLLLACTR++++P  LPT+ +  S  P   K 
Sbjct  174   VLNFPTSDAAAVAVLRLHHSLGDGVSLMSLLLACTRKSSHPDSLPTVPSHYSRRPPAPKR  233

Query  714   nnpkpkpknf-----fklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRI  878
              + +             L WNTLVDV  F AT  FLKD+ TP+  S   E +PKR  +R 
Sbjct  234   LHARVFTLLLWLWAFLILTWNTLVDVVCFTATSIFLKDTPTPLMGSQGVEQRPKRIVHRS  293

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQN----NLPKNLR  1046
             +SL+D   +K A + TINDV +GVT A LS YL+RR  +      + +N     LP NLR
Sbjct  294   VSLDDIKDVKNAMHCTINDVLVGVTSAGLSRYLSRRQEQNSNDDDKNKNKKKKELPSNLR  353

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             LRS L  N+RPA GI ALA++M+     +       WGN  GY ILP +I    DPLDYV
Sbjct  354   LRSTLLVNIRPAPGIHALAELMEGRDDGTK------WGNLIGYIILPFEIFNHKDPLDYV  407

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R  KA ADRKK S E IFTY  A  V+K  G KAAA L +++ ++ +  FSN+VGP E++
Sbjct  408   RRGKAIADRKKNSLEAIFTYKSAELVVKCLGIKAAAKLCHRMLTHTTLSFSNMVGPVEEI  467

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             EFFGHP+ ++AP+ YG P AL +HFQSY++ M ++++VD+ VI DP+QLL DF +SL +I
Sbjct  468   EFFGHPLVYLAPSAYGHPQALTIHFQSYMNTMKIVLAVDDKVISDPHQLLVDFAESLKII  527

Query  1587  KD  1592
             ++
Sbjct  528   RE  529



>ref|XP_010445768.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 205/494 (41%), Positives = 309/494 (63%), Gaps = 26/494 (5%)
 Frame = +3

Query  126   RKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLK  305
             +K+ + ME     + EEP+SP SRL + P FN  I+  MG   K N       +  TL+ 
Sbjct  5     KKKNTVMET---VVEEEPLSPCSRLFNSPDFNCAIIVTMGCRVKGNTPAIIDGLKRTLVN  61

Query  306   HPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYE  485
             HPRF+S++ ++  + GK  WV T+V +  H+ V   PE+    D       +++EDY+ +
Sbjct  62    HPRFSSILEMNNGKKGKPCWVRTKVKVEDHVIV---PEI----DPKIENPDQYLEDYISK  114

Query  486   LSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL  665
             L+   MD+S+PLW++HI++LKT +AE++A+L++HH+LGDG S+ SL LACTR+T+N + L
Sbjct  115   LTTIPMDLSKPLWEIHIIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNLEAL  174

Query  666   PTISTR------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPI  827
             PT++ +      S +     K            +L++NT VD+ +F  T+F ++D++TP+
Sbjct  175   PTVAVQKKRFGPSCNSGFFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPL  234

Query  828   TPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIG  1007
                P SE  PKRF +RI+S +D   +K A   T+NDV LGVT+A LS YL+RRY +    
Sbjct  235   LAKPGSEFNPKRFVHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATP  294

Query  1008  SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILP  1187
              ++      + +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP
Sbjct  295   KLKESM---RRIRLRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLP  344

Query  1188  LKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAS  1367
               +G+  DPL+YVR AKAT DRKK+S E +F+      ++K  G KA+ +L  K+  + +
Sbjct  345   FSVGLETDPLEYVRRAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTT  404

Query  1368  TCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPN  1547
               FSNVVGP+E++ F GHP+++IAP  +G P AL +HFQSY +K+ + ++ D  VIPDP+
Sbjct  405   LTFSNVVGPKEEITFHGHPLSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVIPDPH  464

Query  1548  QLLDDFEKSLHLIK  1589
             ++ DD  +SL +IK
Sbjct  465   KMCDDLVESLKIIK  478



>ref|XP_006404165.1| hypothetical protein EUTSA_v10010299mg [Eutrema salsugineum]
 gb|ESQ45618.1| hypothetical protein EUTSA_v10010299mg [Eutrema salsugineum]
Length=512

 Score =   402 bits (1032),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 210/492 (43%), Positives = 304/492 (62%), Gaps = 29/492 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEE  347
             AE+P+SP++R+ H P FN +++ ++G   KI P      +  +L++HPRF+S +V  + +
Sbjct  21    AEQPLSPAARVFHAPEFNCYVITVIGVKRKIEPDAIIEGLKQSLIRHPRFSSKLVNKRNK  80

Query  348   NGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               +  +WV T V  + H+ V   P+++ +  E    +  F+E YV +L+   +D S+PLW
Sbjct  81    KRQTQRWVRTNVSANDHVIV---PDIQTQNIEDANADA-FLESYVSDLTLVPLDTSKPLW  136

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             +LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+NP+ LPT+  ++ S  ++
Sbjct  137   ELHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPEELPTLPYQNRSSSRS  196

Query  705   lkpnnpkp----------kpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASES  851
              +                   +   LVWNT+ D   FIAT  FLKD++TPI      S+ 
Sbjct  197   SRLTAGSRGNFRFLWLILVLWSAIMLVWNTVCDALEFIATAIFLKDTETPIKGDFRLSKR  256

Query  852   KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG--KRDIG----SI  1013
             K     +R +SL+D   IK     T+NDV LGVTQAALS YL RRYG  K+ IG    S 
Sbjct  257   KRMSLVHRTVSLDDIKLIKNTMKMTVNDVVLGVTQAALSQYLERRYGQKKKKIGEDQESK  316

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
                N++PK +RLRS +  NLRP  GIQ LADMM K        SK  WGN  GY + P  
Sbjct  317   RNSNDMPKKIRLRSAILVNLRPTTGIQDLADMMAKG-------SKCRWGNWIGYIVFPFS  369

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             I + +DPL+++R+AK   DRKK S E   T+ +   +I  FG K  A + N+  SN +  
Sbjct  370   ISLRDDPLEHLRKAKKIIDRKKNSLEAALTFIVGKLMIHSFGVKVTANIINRALSNTTMS  429

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSN++GP E++ FFGHPI ++AP+ YG P AL +HFQSY++KM + ++VD  VI DP+QL
Sbjct  430   FSNLIGPIEEISFFGHPITYMAPSVYGHPHALTMHFQSYMNKMTISVTVDPMVISDPHQL  489

Query  1554  LDDFEKSLHLIK  1589
             LDD+E+SL +IK
Sbjct  490   LDDWEESLRMIK  501



>ref|XP_009151884.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=511

 Score =   401 bits (1031),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 214/508 (42%), Positives = 312/508 (61%), Gaps = 26/508 (5%)
 Frame = +3

Query  111   KPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMP  290
             + +E +  ++ M  +     E+P+SP++R+ H P FN ++++++G   KI P V    + 
Sbjct  5     QAMEIKIPETTMRKDEEEEDEQPLSPAARVFHAPEFNCYVISVIGVKKKIEPDVIMEGLK  64

Query  291   HTLLKHPRFTSLMVVDKEENGKMK-WVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
              TL++HPRF+S MV  + ENG+ + WV T V +S H+ V   P+++ +  E    +K F+
Sbjct  65    QTLIRHPRFSSKMVSKRNENGQTQIWVRTNVVVSDHVIV---PDIQTQNIENANADK-FL  120

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             E YV +L+   +D S+PLW+LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T
Sbjct  121   ESYVSDLTLIPLDTSKPLWELHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKT  180

Query  648   ANPKLLPTISTRSSSppktlkpnnpk----------pkpknffklVWNTLVDVFIFIATL  797
             +NP  LPT+  ++ S  ++ +                   +   LV NT+ D   FIAT 
Sbjct  181   SNPDELPTLPNQNRSSSRSSRLKAGSRGDFRFLWLIMALWSAIMLVLNTMCDALEFIATA  240

Query  798   FFLKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
              FLKD++TPI      S+ K     +R +SL+D   IK   N T+NDV LGVTQA LS Y
Sbjct  241   MFLKDTETPIKGDFRLSKHKRMSLVHRTVSLDDIKLIKNTMNMTVNDVVLGVTQAGLSQY  300

Query  975   LNRRYGKRDIGSIEGQ---NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMS  1145
             L  RYG++     E Q   N++PK +RLRS +  NLRP  GIQ L+DMM K        S
Sbjct  301   LETRYGEKKKKLGEDQRNSNHMPKIIRLRSAILVNLRPTTGIQDLSDMMAKG-------S  353

Query  1146  KWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
             K  WGN  GY + P  IG+  DPL+++R AK   DRKK S E   T+ +   +IK FG K
Sbjct  354   KCRWGNWIGYIVFPFSIGLRKDPLEHLRSAKRIIDRKKNSLEAALTFIVGKLMIKSFGVK  413

Query  1326  AAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMG  1505
               A + N+  SN +  FSN++GP E++ FFGHPIA++AP+ YG P AL +HFQSY++KM 
Sbjct  414   MTANIINRALSNTTMSFSNLIGPIEEISFFGHPIAYMAPSVYGHPHALTMHFQSYMNKMT  473

Query  1506  VIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             + ++VD  VI D ++LLD++E+SL  IK
Sbjct  474   ISLTVDPTVISDTHRLLDNWEESLKNIK  501



>ref|NP_200151.2| bifunctional wax ester synthase/diacylglycerol acyltransferase 
[Arabidopsis thaliana]
 dbj|BAD83884.1| FOLDED PETALS [Arabidopsis thaliana]
 gb|AED96347.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=486

 Score =   400 bits (1028),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 307/484 (63%), Gaps = 29/484 (6%)
 Frame = +3

Query  162   SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK  341
             ++ EEP+SP SRL + P FN  I+  MG   K +     H + HTL+ HPRF+S++ ++ 
Sbjct  11    TVEEEPLSPCSRLFNSPDFNCAIIVTMGSKVKGDTPAIIHGLEHTLVNHPRFSSILEMN-  69

Query  342   EENGKM-KWVETEVDLSQHITVVEA-PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR  515
               NGK  +WV T+V + +H+ V +  P++E           +++EDY+ +L+   MD+S+
Sbjct  70    --NGKKPRWVRTKVKVEEHVIVPDVDPDIE--------NPDQYLEDYISKLTTIPMDLSK  119

Query  516   PLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----  683
             PLW++H+L +KT +AE+ A+L++HH+LGDG S+ SLLLACTR+T++P+ LPT++      
Sbjct  120   PLWEMHLLGVKTSNAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRF  179

Query  684   --SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
               S +     K            +L++NT VD+ +F  T+F L+D++TP+   P SE  P
Sbjct  180   GPSCNSGFFNKIWWLFVGLWFILRLLFNTFVDILMFALTIFVLRDTETPLLAKPGSELIP  239

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
             KRF +RI+S +D   +K A   T+NDV LGVTQA LS YL+R+Y   D  +        +
Sbjct  240   KRFVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKY---DQEATPKSKESMR  296

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL
Sbjct  297   RIRLRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGLETDPL  349

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             +YVR+AKAT DRKK+S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+
Sbjct  350   EYVRQAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPK  409

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F GHP+ +I+P  +G P AL +HFQ+Y +K+ + ++ D  VIPDP+++ DD  +SL
Sbjct  410   EEITFHGHPLNYISPCVFGHPHALTLHFQTYANKVIISVTADPTVIPDPHKMCDDLVESL  469

Query  1578  HLIK  1589
              +IK
Sbjct  470   KMIK  473



>ref|XP_006339804.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=487

 Score =   400 bits (1028),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 221/505 (44%), Positives = 308/505 (61%), Gaps = 40/505 (8%)
 Frame = +3

Query  105   NLKPIETRKQKSGMENNNMSIAEEP--VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             +LKP+       G+ + N+   EE   +SPSSR+ HEP +N++ILAIMG+   IN     
Sbjct  2     SLKPL-------GIISKNIDEGEETMLLSPSSRMFHEPNYNVYILAIMGWKVPINVDSIK  54

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
               +   +LKHPRF+SL V+D  + G M+WV T +++  H+ V    +  V+ DE      
Sbjct  55    AELQSKMLKHPRFSSLQVMD--DGGNMRWVPTTMNIDDHVIVPHLADNNVDKDE------  106

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACT  638
               VEDY+  LS   +DMS+PLWD HILN+KT  AEA +V R+HH++GDG ++ S LL+C 
Sbjct  107   -LVEDYISNLSTTNVDMSKPLWDFHILNVKTCHAEATSVFRIHHSIGDGVALMSFLLSCF  165

Query  639   RQTANPKLLPTISTRSSSppktlkpnnpkpkpknff------klVWNTLVDVFIFIATLF  800
             R T++P  LP +   SSS  K  K                  +L++NT+VDV +FIAT  
Sbjct  166   RTTSDPTCLPKLPVFSSSKSKPTKNRKKNLWQYYLVKLWFFIQLLFNTIVDVLLFIATAL  225

Query  801   FLKDSQTPITPSPA-SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYL  977
             FLKDSQTP T +P  + S  +R+ YR +SL+D   IK  TN  +NDV LG+TQAALS Y+
Sbjct  226   FLKDSQTPFTTTPGFNASARQRYIYRTVSLDDIKFIKDVTNAKVNDVVLGITQAALSRYI  285

Query  978   NRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGW  1157
             +RR GK    S+EG       +R R+ +  NLRPA G+QA+A+M++K             
Sbjct  286   HRRCGKGKF-SLEG-------MRCRANVIVNLRPALGVQAIAEMIEKNVAVIQ-------  330

Query  1158  GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAI  1337
             GN FG+ ++PL IG   +PLDYV +AK + DRKK+S E   T+Y +   +K FG K AA 
Sbjct  331   GNCFGFVLIPLSIGESENPLDYVHKAKTSMDRKKHSLESQCTFYASQLFLKLFGFKGAAK  390

Query  1338  LTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIIS  1517
             LT ++ S  +   SNV+GPRE++   GHP+ F+APTC G P+ +MVH  SY +K+   I+
Sbjct  391   LTQRVTSQTTVALSNVIGPREEISCAGHPLEFVAPTCSGYPTGIMVHVCSYANKLTFTIA  450

Query  1518  VDENVIPDPNQLLDDFEKSLHLIKD  1592
             VDE +IPD  QL DDF +S  LIK+
Sbjct  451   VDEGIIPDLKQLGDDFIQSFMLIKE  475



>ref|XP_010515262.1| PREDICTED: O-acyltransferase WSD1 [Camelina sativa]
Length=514

 Score =   401 bits (1030),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 216/511 (42%), Positives = 306/511 (60%), Gaps = 29/511 (6%)
 Frame = +3

Query  117   IETRKQKSGME-NNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPH  293
             I+TR++ S           E+P+SP++R+ H P FN +++A++G   KI   V T  +  
Sbjct  3     IKTRRETSETTVRKEEEEEEQPLSPTARIFHAPEFNCYVIAVIGLKKKIEADVITEGLKQ  62

Query  294   TLLKHPRFTSLMVV-DKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK-KFV  467
             TL++HPRF+S +V   K++     WV T          V  P++E +       N   F+
Sbjct  63    TLIRHPRFSSKLVSHGKKKRQTQSWVRTN---VVVSDHVVVPDIETQNTLNGNANADAFL  119

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             E YV  L+   +D+S+PLW LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T
Sbjct  120   ESYVSNLTTVPLDISKPLWQLHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKT  179

Query  648   ANPKLLPTISTR----------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATL  797
             +NP  LP+   +          +++     +         +   LVWNT+ D   FIAT 
Sbjct  180   SNPDELPSQPNQNRSSSTSSRLTAASRGDSRFLWLVMILWSALMLVWNTVCDALEFIATA  239

Query  798   FFLKDSQTPITPSPAS-ESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
              FLKD++TPI     S +SK     +R +SL D   IK A N T+NDV LGVTQA LS Y
Sbjct  240   MFLKDTKTPIKGDFGSGKSKRMSIVHRTVSLEDIKLIKNAMNMTVNDVVLGVTQAGLSQY  299

Query  975   LNRRYG-KRDIG----SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNS  1139
             L +RYG K+ +G    S    N++PK +RLRS L  NLRP  GIQ LADMM K+      
Sbjct  300   LEKRYGEKKKVGKDQESKSNSNDMPKLIRLRSALLVNLRPTTGIQDLADMMAKK------  353

Query  1140  MSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFG  1319
              S   WGN  GY + P  IG+ +DPL+++R AK   DRKK S+E   T+   NF+IK FG
Sbjct  354   -SNCRWGNWIGYIVFPFSIGLRDDPLEHLRSAKRIIDRKKNSFEAALTFIAGNFIIKSFG  412

Query  1320  PKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDK  1499
              + AA + N+  SN +  FSN++GP E++ F+GHPI ++AP+ YG P AL +HFQSY+++
Sbjct  413   VQVAAKIINRALSNTTMSFSNLIGPIEEISFYGHPITYMAPSVYGHPHALTIHFQSYMNQ  472

Query  1500  MGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             M + ++VD   I DP++LLDD+EKSL  IKD
Sbjct  473   MTISLTVDPTAISDPHRLLDDWEKSLQSIKD  503



>dbj|BAB09801.1| unnamed protein product [Arabidopsis thaliana]
Length=485

 Score =   400 bits (1027),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/484 (42%), Positives = 310/484 (64%), Gaps = 30/484 (6%)
 Frame = +3

Query  162   SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK  341
             ++ EEP+SP SRL + P FN  I+  MG   K +     H + HTL+ HPRF+S+++   
Sbjct  11    TVEEEPLSPCSRLFNSPDFNCAIIVTMGSKVKGDTPAIIHGLEHTLVNHPRFSSILM---  67

Query  342   EENGKM-KWVETEVDLSQHITVVEA-PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR  515
               NGK  +WV T+V + +H+ V +  P++E           +++EDY+ +L+   MD+S+
Sbjct  68    -NNGKKPRWVRTKVKVEEHVIVPDVDPDIE--------NPDQYLEDYISKLTTIPMDLSK  118

Query  516   PLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----  683
             PLW++H+L +KT +AE+ A+L++HH+LGDG S+ SLLLACTR+T++P+ LPT++      
Sbjct  119   PLWEMHLLGVKTSNAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRF  178

Query  684   --SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
               S +     K            +L++NT VD+ +F  T+F L+D++TP+   P SE  P
Sbjct  179   GPSCNSGFFNKIWWLFVGLWFILRLLFNTFVDILMFALTIFVLRDTETPLLAKPGSELIP  238

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
             KRF +RI+S +D   +K A   T+NDV LGVTQA LS YL+R+Y +    + + + ++ +
Sbjct  239   KRFVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQE--ATPKSKESM-R  295

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL
Sbjct  296   RIRLRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGLETDPL  348

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             +YVR+AKAT DRKK+S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+
Sbjct  349   EYVRQAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPK  408

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F GHP+ +I+P  +G P AL +HFQ+Y +K+ + ++ D  VIPDP+++ DD  +SL
Sbjct  409   EEITFHGHPLNYISPCVFGHPHALTLHFQTYANKVIISVTADPTVIPDPHKMCDDLVESL  468

Query  1578  HLIK  1589
              +IK
Sbjct  469   KMIK  472



>ref|XP_002877655.1| condensation domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53914.1| condensation domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   401 bits (1030),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 215/503 (43%), Positives = 311/503 (62%), Gaps = 31/503 (6%)
 Frame = +3

Query  117   IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHT  296
             +E + Q+   EN      E+P+SP++RL H P FN +I++++G  SK++P V       T
Sbjct  1     MEIKTQRHISENEKEE--EQPLSPAARLFHSPEFNCNIISVIGLKSKLDPCVIIRGFKET  58

Query  297   LLKHPRFTSLMVVDKEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVED  473
              ++HPRF+S +V D  ENG+  +WV T V +  H+ V   PE++++  E       F+ED
Sbjct  59    FIRHPRFSSKLVTD--ENGQNQRWVRTNVVVEDHVIV---PEIKLQNIEN---TDSFLED  110

Query  474   YVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTAN  653
             YV +L K  +D+SRPLW+LH+L+LKT DAE +AVL++HH++GDG SI SL+LAC R+T+N
Sbjct  111   YVSDLMKIPLDISRPLWELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSN  170

Query  654   PKLLPTISTRSSSppktlkpnnpkpkpknffklV---W-------NTLVDVFIFIATLFF  803
             P  LP++  +  S   +               LV   W       NT+ D   FI T  F
Sbjct  171   PDELPSLPYQYRSSSGSSLLTTGSRSDSRLLWLVKVLWTAVILGLNTICDTLEFIVTTLF  230

Query  804   LKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             +KD++TPI     +++SK  R  +R +SL+D   IK A N T+NDV LGVTQA+LS YL 
Sbjct  231   VKDTETPIKGDFRSTKSKRLRLVHRTVSLDDIKLIKNAMNMTVNDVVLGVTQASLSQYLE  290

Query  981   RRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             RRYG+R+  +   + NLPK +RLRS L  NLRP  GIQ +ADMM  E G     SK  WG
Sbjct  291   RRYGERE--TKRKRKNLPKRIRLRSALLVNLRPTTGIQDIADMM--ENG-----SKCRWG  341

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N FGY + P  I + +DPL++++ A+    RKK S+  + TY     ++KF G + AA +
Sbjct  342   NWFGYIVFPFSIALRDDPLEHLKRAQKIITRKKNSFGAMLTYIFCRIIVKFLGIQLAATI  401

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
              N++ SN +  FSN+VGP E + F+GHPI + A + YG P AL ++ QSY++KM + + V
Sbjct  402   INRMVSNTTMTFSNMVGPVEQVSFYGHPITYFASSGYGHPHALTINCQSYMNKMTITLIV  461

Query  1521  DENVIPDPNQLLDDFEKSLHLIK  1589
             D  VI DP++L DD+++SL  IK
Sbjct  462   DSTVISDPHRLCDDWQESLRSIK  484



>dbj|BAC42871.1| unknown protein [Arabidopsis thaliana]
Length=486

 Score =   400 bits (1027),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 202/484 (42%), Positives = 310/484 (64%), Gaps = 29/484 (6%)
 Frame = +3

Query  162   SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK  341
             ++ EEP+SP SRL + P FN  I+  MG   K +     H + HTL+ HPRF+S++ ++ 
Sbjct  11    TVEEEPLSPCSRLFNSPDFNCAIIVTMGSKVKGDTPAIIHGLEHTLVNHPRFSSILEMN-  69

Query  342   EENGKM-KWVETEVDLSQHITVVEA-PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR  515
               NGK  +WV T+V + +H+ V +  P++E           +++EDY+ +L+   MD+S+
Sbjct  70    --NGKKPRWVRTKVKVEEHVIVPDVDPDIE--------NPDQYLEDYISKLTTIPMDLSK  119

Query  516   PLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----  683
             PLW++H+L +KT  AE+ A+L++HH+LGDG S+ SLLLACTR+T++P+ LPT++      
Sbjct  120   PLWEMHLLGVKTSSAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRF  179

Query  684   --SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
               S +     K            +L++NT VD+ +F  T+F L+D++TP+   P SE  P
Sbjct  180   GPSCNSGFFNKIWWLFVGLWFILRLLFNTFVDILMFALTIFVLRDTETPLLAKPGSELIP  239

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
             KRF +RI+S +D   +K A   T+NDV LGVTQA LS YL+R+Y +    + + + ++ +
Sbjct  240   KRFVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQE--ATPKSKESM-R  296

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL
Sbjct  297   RIRLRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGLETDPL  349

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             +YVR+AKAT DRKK+S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+
Sbjct  350   EYVRQAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPK  409

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F GHP+ +I+P  +G P AL +HFQ+Y +K+ + ++ D  VIPDP+++ DD  +SL
Sbjct  410   EEITFHGHPLNYISPCVFGHPHALTLHFQTYANKVIISVTADPTVIPDPHKMCDDLVESL  469

Query  1578  HLIK  1589
              +IK
Sbjct  470   KMIK  473



>ref|XP_010520974.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Tarenaya hassleriana]
Length=507

 Score =   400 bits (1027),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 219/477 (46%), Positives = 301/477 (63%), Gaps = 30/477 (6%)
 Frame = +3

Query  180   VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKM  359
             +SP++RL H P FN  ILA++G  +KINPHV    + HTL+KHPRF+S +  D E+ GK 
Sbjct  41    LSPAARLFHAPRFNCCILAVIGCKTKINPHVVIEGLKHTLIKHPRFSSKLEDDGEKRGKK  100

Query  360   -KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              +WV T V++  H+ V   PE+++EG +     ++F + YV  L+   ++ S+PLW++HI
Sbjct  101   PRWVRTNVNVQDHVIV---PEIDLEGIQ---DTEQFTDHYVTNLTTVPLNTSKPLWEIHI  154

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpn  716
             LN+KT DAE++AV+R HH+LGDG S+ SL+LACTR+T++P+ LPT+             N
Sbjct  155   LNVKTSDAESIAVIRSHHSLGDGLSLMSLVLACTRKTSDPEALPTVPVMKRHQLFRSDRN  214

Query  717   npkpkpknf---fklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSL  887
                          +L+ NT+VDV +F+AT  FLKD++TP+         PKRFA+RI+ L
Sbjct  215   LFIRSVLAVWLVMRLILNTVVDVLLFLATTLFLKDTETPLKGGADVGLNPKRFAHRIVPL  274

Query  888   NDFFSIKLATNTTINDVALGVTQAALSMYLNRRY---GKRDIGSIEGQNNLPKNLRLRSC  1058
             +D   IK A   TINDV LGVTQAALS YLNRRY    K D  +   +NNLP+ +RLR+ 
Sbjct  275   DDIKLIKNAMKMTINDVLLGVTQAALSRYLNRRYDNNNKEDEITRGNRNNLPRRIRLRAT  334

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
             +           +LADMM K        SK+ WGNR GY ILP  I +  +PLD++ +AK
Sbjct  335   VL----------SLADMMGKG-------SKFRWGNRIGYVILPFSITLRTNPLDHLSKAK  377

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
             AT DRKK S E   TY+ A  V+   G K AA + ++  SN +  FSN+VGP E++ F+G
Sbjct  378   ATIDRKKLSLEAALTYFSAKLVLNTLGVKVAAKIVHRALSNTTMSFSNIVGPVEEISFYG  437

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             HPI++ AP+ YG P AL VHFQSY +KM +  +VD   I DP +L DDFE+SL  IK
Sbjct  438   HPISYFAPSVYGHPQALTVHFQSYANKMTISTAVDPKAISDPRKLCDDFEESLKAIK  494



>ref|XP_009149757.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=538

 Score =   400 bits (1028),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 217/492 (44%), Positives = 306/492 (62%), Gaps = 31/492 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP++R+ H PAFN +++ ++G   KI P V    +  TL++HPRF+S MV    +N
Sbjct  48    EQPLSPAARVFHAPAFNCYVITVIGVKKKIEPDVVIEGLKQTLIRHPRFSSKMVNKTNKN  107

Query  351   GK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
              +  +WV T V  + H+ V   P+++ +  E    +K F++ YV +L+   +D S+PLW+
Sbjct  108   KQTQRWVRTNVVANNHVIV---PDIQTQNIENANADK-FLDSYVSDLTLVPLDTSKPLWE  163

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppk  701
             LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+N   LPT+    R+SS   
Sbjct  164   LHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNLNELPTLPYQNRTSSGSS  223

Query  702   tlkpnnpk--------pkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
              L   +              +   LV NT+ D   FIAT  FLKD++TPI       SKP
Sbjct  224   RLTGGSWSGFRFLWLFMVLWSTIMLVLNTICDALKFIATAMFLKDTKTPIK-GDYRLSKP  282

Query  858   KRFA--YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR------DIGSI  1013
             KR +  +  +SL+D   IK     T+NDV +GVTQA LS YL RRYG++      D  S 
Sbjct  283   KRMSLVHLTVSLDDIKLIKTNMKMTVNDVVIGVTQAGLSKYLERRYGEKKNVVGDDQKSK  342

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
             +  N++PK +RLRS L  NLRP  GIQ LADMM  +KG     SK  WGN  GY + P  
Sbjct  343   KNSNDMPKRIRLRSALLVNLRPTTGIQDLADMM--DKG-----SKCRWGNMIGYIVFPFS  395

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             IG+  DPL+++  AK   DRKK S E   T+ +  F+IK FG K  A L N++ SN +  
Sbjct  396   IGLRKDPLEHLGTAKRIIDRKKNSLEAALTFIVGKFMIKAFGVKVTANLLNRMLSNTTMS  455

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSN++GP E++ FFGHPI ++AP+ YG P AL +HFQSY++KM + ++VD  VI +P+QL
Sbjct  456   FSNLIGPIEEISFFGHPITYMAPSVYGHPHALTMHFQSYMNKMTISLTVDPTVIINPHQL  515

Query  1554  LDDFEKSLHLIK  1589
             LDD+E+SL  IK
Sbjct  516   LDDWEESLRTIK  527



>ref|XP_010503571.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=514

 Score =   399 bits (1025),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 209/491 (43%), Positives = 298/491 (61%), Gaps = 28/491 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++R+ H P FN +++A++G   KI   V T  +  TL++HPRF+S +V    +  
Sbjct  23    QPLSPTARIFHAPEFNCYVIAVIGLKKKIEADVITEGLKQTLIRHPRFSSKLVSHGNKKR  82

Query  354   KMK-WVETEVDLSQHITVVEAPEVEVEGDETHRKNK-KFVEDYVYELSKERMDMSRPLWD  527
             + + WV T          V  P++E +  E    N   F+E YV  L+   +D+S+PLW 
Sbjct  83    QTQSWVRTN---VVVSDHVVVPDIETQYTENGNVNADAFLESYVSNLTTVPLDISKPLWQ  139

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR--------  683
             LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+NP  LPT   +        
Sbjct  140   LHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPDELPTQPNQNRSSSTSS  199

Query  684   --SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESK  854
               +++     +         +   LVWNT+ D   FIAT  FLKD++TPI     + +SK
Sbjct  200   RLTAASRGDSRFLWLVMILWSALMLVWNTVCDALEFIATAMFLKDTETPIKGDFRSGKSK  259

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG-KRDIG----SIEG  1019
                  +R +SL D   IK A N T+NDV LGVTQA LS YL +RYG K+ +G    S   
Sbjct  260   RMSLVHRTVSLEDIKLIKNAMNMTVNDVVLGVTQAGLSQYLEKRYGEKKKVGKDQESKSN  319

Query  1020  QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIG  1199
              N++PK +RLRS L  NLRP  GIQ LADMM K+       S   WGN  GY + P  IG
Sbjct  320   SNDMPKLIRLRSALLVNLRPTTGIQDLADMMAKK-------SNCRWGNWIGYIVFPFSIG  372

Query  1200  MLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFS  1379
             + +DPL+++R AK   DRKK S+E   T+    F+I+ FG + AA + N+  SN +  FS
Sbjct  373   LRDDPLEHLRRAKGIIDRKKNSFEAALTFIAGKFIIRSFGVQVAAKIINRALSNTTMSFS  432

Query  1380  NVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLD  1559
             N++GP E++ F+GHPI ++AP+ YG P AL +HFQSY+++M + ++VD   I DP++LLD
Sbjct  433   NLIGPIEEISFYGHPITYMAPSVYGHPHALTIHFQSYMNQMTISLTVDPTAISDPHRLLD  492

Query  1560  DFEKSLHLIKD  1592
             D+EKSL  IKD
Sbjct  493   DWEKSLQSIKD  503



>emb|CDY08116.1| BnaA06g16100D [Brassica napus]
Length=538

 Score =   399 bits (1025),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 217/492 (44%), Positives = 305/492 (62%), Gaps = 31/492 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP++R+ H PAFN +++ ++G   KI P V    +  TL++HPRF+S MV    +N
Sbjct  48    EQPLSPAARVFHAPAFNCYVITVIGVKKKIEPDVVIEGLKQTLIRHPRFSSKMVNKTNKN  107

Query  351   GK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
              +  +WV T V  + H+ V   P+++ +  E    +K F++ YV +L+   +D S+PLW+
Sbjct  108   KQTQRWVRTNVVANNHVIV---PDIQTQNIENANADK-FLDSYVSDLTLVPLDTSKPLWE  163

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppk  701
             LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+N   LPT+    R+SS   
Sbjct  164   LHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNLNELPTLPYQNRTSSGSS  223

Query  702   tlkpnnpk--------pkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
              L   +              +   LV NT+ D   FIAT  FLKD++TPI       SKP
Sbjct  224   RLTGGSWSGFRFLWLFMVLWSTIMLVLNTICDALKFIATAMFLKDTKTPIK-GDYRLSKP  282

Query  858   KRFA--YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR------DIGSI  1013
             KR +  +  +SL+D   IK     T+NDV +GVTQA LS YL RRYG++      D  S 
Sbjct  283   KRMSLVHLTVSLDDIKLIKTNMKMTVNDVVIGVTQAGLSKYLERRYGEKKNVVGDDQKSK  342

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
             +  N++PK +RLRS L  NLRP  GIQ LADMM  +KG     SK  WGN  GY + P  
Sbjct  343   KNSNDMPKRIRLRSALLVNLRPTTGIQDLADMM--DKG-----SKCRWGNMIGYIVFPFS  395

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             IG+  DPL+++  AK   DRKK S E   T+ +  F+IK FG K  A L N++ SN +  
Sbjct  396   IGLRKDPLEHLGTAKRIIDRKKNSLEAALTFIVGKFMIKAFGVKVTANLLNRMLSNTTMS  455

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSN++GP E++ FFGHPI ++AP+ YG P AL +HFQSY++KM + ++VD  VI +P QL
Sbjct  456   FSNLIGPIEEISFFGHPITYMAPSVYGHPHALTMHFQSYMNKMTISLTVDPTVIINPYQL  515

Query  1554  LDDFEKSLHLIK  1589
             LDD+E+SL  IK
Sbjct  516   LDDWEESLRTIK  527



>ref|XP_010503567.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=520

 Score =   398 bits (1023),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 210/482 (44%), Positives = 300/482 (62%), Gaps = 24/482 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-EE  347
             E+P+SP++RL H P FN +I++++G  SK++P V       T ++HPRF+S +V ++  +
Sbjct  17    EQPLSPAARLFHAPEFNCNIISVIGIKSKMDPDVIMRGFKQTFIRHPRFSSKLVSERWRQ  76

Query  348   NGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
                 +WV T+V + +H+ V   PE++ +  E       F+EDYV +L K  +D SRPLW+
Sbjct  77    WTNQRWVRTDVVVEEHVIV---PEIKPQNIEN---TDAFLEDYVSDLMKIPLDTSRPLWE  130

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LHIL+LKT DAE +AV ++HH++GDG SI SL+LAC R+T+NP  LP++  +  S     
Sbjct  131   LHILDLKTSDAENVAVFKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQKRSSSLLT  190

Query  708   kpnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPS-PASESKPKR  863
                    +     KL+W       NT+ DV  F+ T  F+KD++TPI     + +S+  R
Sbjct  191   TATRSDSRLLWLVKLLWTAVILGLNTVCDVLEFLVTTLFVKDTETPIKGDFRSKKSEQLR  250

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNL  1043
               +R +SL+D   IK A N TIN V LGVTQA+LS YL RRYG+ +  +     NL K +
Sbjct  251   LVHRTVSLDDIKLIKNAMNMTINGVVLGVTQASLSRYLERRYGEDE--TKRKPKNLLKRI  308

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLRS L  NLRP  GIQ LADMM  EKG     SK  WGNRFGY + P  I + NDPL++
Sbjct  309   RLRSALLVNLRPTTGIQDLADMM--EKG-----SKCWWGNRFGYLVFPFSIALRNDPLEH  361

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             ++ A  T +RKK S+  + TY     ++K  G + AA + N++ SN +  FSN+VGP E+
Sbjct  362   LKTAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTFSNMVGPVEE  421

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + F+GHPI  IA + YG P AL +H QSY++KM + + VD  VI DP +L +D+E+SL  
Sbjct  422   VSFYGHPITCIASSAYGHPHALTIHCQSYMNKMTITLLVDPTVISDPQRLCEDWEESLRS  481

Query  1584  IK  1589
             IK
Sbjct  482   IK  483



>ref|XP_002877657.1| hypothetical protein ARALYDRAFT_485279 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53916.1| hypothetical protein ARALYDRAFT_485279 [Arabidopsis lyrata subsp. 
lyrata]
Length=519

 Score =   397 bits (1021),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 214/521 (41%), Positives = 313/521 (60%), Gaps = 34/521 (7%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             ME++      ET  +K G E       E+P+SP++R+ H P FN ++++++G   KI P 
Sbjct  1     MEIKTRRDTSETTVRKDGEE---EDEEEQPLSPAARVFHSPEFNCYVISVIGVKKKIEPD  57

Query  270   VFTHNMPHTLLKHPRFTSLMV---VDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
             V    +  +L++HPRF+S +V   V  ++     WV T V ++ H+ V   P+++ +  E
Sbjct  58    VIIEGLKQSLIRHPRFSSKLVSTYVGNKKRQTQSWVRTNVVVNDHVIV---PDIQTQNIE  114

Query  441   THRKNKK-FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASIN  617
                 N   F+E YV  L+   +D+S+PLW LH+L+LKT DAE +AVL+ HH+LGDG S+ 
Sbjct  115   NGNANADVFLESYVSNLTTVSLDISKPLWQLHLLDLKTSDAENVAVLKFHHSLGDGMSLM  174

Query  618   SLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpkn---ffklVW-------NTL  767
             +L+LAC R+T+NP  LP++  ++ S  ++ +                ++W       NT+
Sbjct  175   ALVLACMRKTSNPDELPSLPNQNRSSSRSSRLMTGSRGDSRFLWLVMVIWSAIILVLNTV  234

Query  768   VDVFIFIATLFFLKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVAL  944
              D   FIAT  FLKD++TPI      S+SK     +R +SL+D   IK A   T+NDV L
Sbjct  235   CDALEFIATTMFLKDTETPIKGDFRLSKSKRMCLVHRTVSLDDIKLIKTAMKMTVNDVVL  294

Query  945   GVTQAALSMYLNRRYGKR------DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALAD  1106
             GV+QA LS YL RRYG+R      D  S +   ++PK +RLRS L  NLRP  GIQ LAD
Sbjct  295   GVSQAGLSQYLERRYGERKKKVGEDKESKKNSTDMPKAIRLRSALLVNLRPNTGIQDLAD  354

Query  1107  MMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTY  1286
             MM K        SK  WGN  GY + P  IG+ +DPL++++ AK   DRKK S E   T+
Sbjct  355   MMAKG-------SKCRWGNWIGYIVFPFSIGLRDDPLEHLQRAKRIIDRKKNSLEAALTF  407

Query  1287  YLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSA  1466
                 F++K FG + AA + N+  SN +  FSN++GP E++ F+GHPI ++AP+ YG P A
Sbjct  408   VAGQFILKTFGVEVAAKIINRALSNTTMSFSNLIGPIEEISFYGHPITYMAPSVYGHPHA  467

Query  1467  LMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             L +HFQSY+++M + ++VD  VI DP++LLDD+EKSL  IK
Sbjct  468   LTMHFQSYMNQMTISLTVDPTVISDPHRLLDDWEKSLQSIK  508



>ref|XP_010515263.1| PREDICTED: O-acyltransferase WSD1 [Camelina sativa]
Length=523

 Score =   397 bits (1019),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 214/503 (43%), Positives = 310/503 (62%), Gaps = 29/503 (6%)
 Frame = +3

Query  117   IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHT  296
             +E + +++ +E++     E+P+SP++RL H P FN +I++++G  SK++P V       T
Sbjct  1     MEIKTRRNILEDDKED--EQPLSPAARLFHSPEFNCNIISVIGIKSKMDPDVIMRGFKQT  58

Query  297   LLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDY  476
              ++HPRF+S +V D +     +WV T V +  H+ V   PE++ +  E       F+EDY
Sbjct  59    FIRHPRFSSKLVSDGDNGLNQRWVRTNVVVEDHVIV---PEIKPQNIEN---TDAFLEDY  112

Query  477   VYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANP  656
             V +L K  +D SRPLW+LHIL+LKT DAE +AV ++HH++GDG SI SL+LAC R+T+NP
Sbjct  113   VSDLMKIPLDTSRPLWELHILDLKTSDAENVAVFKIHHSVGDGMSIMSLVLACMRKTSNP  172

Query  657   KLLPTISTRSSSppktlkpnnpkpkpknf----fklVW-------NTLVDVFIFIATLFF  803
               LP++  +  S            +  +      KL+W       NT  D   F+ T+ F
Sbjct  173   DELPSLPYQKRSSSSGSSLLTTGSRGDSRLLWLVKLLWMAVILGLNTFCDALDFLLTMLF  232

Query  804   LKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             +KD++TPI     +S+SK  R  +R +SL+D   IK A + TINDV LGVTQA+ S YL 
Sbjct  233   VKDTETPIKGDFRSSKSKQLRLVHRTVSLDDIKLIKNAMDMTINDVVLGVTQASFSRYLE  292

Query  981   RRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             RRYG+++  +     NL K +RLRS L  NLRP  GIQ LADMM  E G     SK  WG
Sbjct  293   RRYGEKE--TKRKPKNLLKRIRLRSALLVNLRPTTGIQDLADMM--ETG-----SKCWWG  343

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             NRFGY + P  I + NDPL+++R A  T +RKK S+  + TY     ++K  G + AA +
Sbjct  344   NRFGYVVFPFSIALRNDPLEHLRIAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATI  403

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
              N++ SN +  FSN+VGP E++ F+GHPI +IA + YG P AL +H QSY++KM + + V
Sbjct  404   INRLMSNTTMTFSNMVGPVEEVSFYGHPITYIASSAYGHPHALTLHCQSYMNKMTITLLV  463

Query  1521  DENVIPDPNQLLDDFEKSLHLIK  1589
             D  VI DP++L DD+E+SL  IK
Sbjct  464   DPTVINDPHRLCDDWEESLRSIK  486



>ref|XP_010426423.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=523

 Score =   396 bits (1018),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/485 (43%), Positives = 301/485 (62%), Gaps = 27/485 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP++RL H P FN +I++++G  SKI+P V       T ++HPRF+S +V D +  
Sbjct  17    EQPLSPAARLFHAPEFNCNIISVIGSKSKIDPDVIIRGFQQTFIRHPRFSSKLVSDGDNG  76

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
                +WV T V +  H+ V   PE++ +  E       F+EDYV +L K  +D S+PLW++
Sbjct  77    QNQRWVRTNVVVEDHVIV---PEIKPQNIEN---TDAFLEDYVSDLMKIPLDTSKPLWEV  130

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             HIL+LKT DAE +AV ++HH++GDG S+ SL+LAC R+T+NP  LP++  +  S      
Sbjct  131   HILDLKTSDAENVAVFKVHHSVGDGMSMMSLVLACMRKTSNPDELPSLPYQKRSSSSGSS  190

Query  711   pnnpkpkpknf----fklVW-------NTLVDVFIFIATLFFLKDSQTPITPS-PASESK  854
                   +  +      KL+W       NT  D    + T+ F+KD++TPI     +S+SK
Sbjct  191   LLTTGSRGDSRLLWLVKLLWMAVILGLNTFCDSLDILLTMLFVKDTETPIKGDFRSSKSK  250

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLP  1034
               R  +R +SL+D   IK A + T+NDV LGVTQA+LS YL RRYG+++  +     NL 
Sbjct  251   QLRLVHRTVSLDDIKLIKNAMDMTVNDVVLGVTQASLSRYLERRYGEKE--TKRKPKNLL  308

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
             K +RLRS L  NLRP  GIQ LADMM  EKG     SK  WGNRFGY + P  I + NDP
Sbjct  309   KRIRLRSALLVNLRPTTGIQDLADMM--EKG-----SKCWWGNRFGYVVFPFSIALRNDP  361

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             L++++ A  T +RKK S+  + TY     ++K  G + AA + N++ SN +  FSN+VGP
Sbjct  362   LEHLKTAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTFSNMVGP  421

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F+GHPI +IA + YG P AL +H QSY++KM + + VD  VI DP+QL DD+E+S
Sbjct  422   VEEVSFYGHPITYIASSAYGHPHALTIHCQSYMNKMTITLLVDPTVISDPHQLCDDWEES  481

Query  1575  LHLIK  1589
             L  IK
Sbjct  482   LRSIK  486



>ref|XP_006399759.1| hypothetical protein EUTSA_v10013397mg [Eutrema salsugineum]
 gb|ESQ41212.1| hypothetical protein EUTSA_v10013397mg [Eutrema salsugineum]
Length=485

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/480 (43%), Positives = 303/480 (63%), Gaps = 25/480 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP +R+   P  +   + IMGF +KINP V    + H + KHPRF++    +  ENG
Sbjct  14    QPLSPMARVFQSPGVDYCAVTIMGFKTKINPDVLLDALKHNVSKHPRFST----NLSENG  69

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               KW+ET+V++  H+ V   P ++ E  E     + FV++Y+  L+   +D SRPLWD+H
Sbjct  70    A-KWIETQVNVEDHVVV---PYIDQE--EVGEDGQGFVDEYISRLTMIPLDRSRPLWDMH  123

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANP--KLLPTISTRSSSppktl  707
             ILN++T DAEA+ V+R HH+LGDG S+ SL+LACT +T++P    +P++  R+ S     
Sbjct  124   ILNVRTADAEAVGVIRSHHSLGDGMSLISLMLACTHKTSDPDNTAIPSLKRRTVSHGLRN  183

Query  708   kp--nnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRIL  881
             K           +  +L+WNT+VD+ + +ATL FLKD++TP+       S PKRF +RI+
Sbjct  184   KGWFLRSILTVGSTTRLIWNTVVDMLLLMATLTFLKDTKTPLKGGAEVGSNPKRFYHRII  243

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQ-NNLPKNLRL  1049
             +L+D   IK A N TINDV LG+TQA+LS YLN++YGK+   + G++    N+LP  LR 
Sbjct  244   NLDDVKFIKNAMNMTINDVLLGITQASLSSYLNQQYGKKNEEEGGALTSYPNHLPSKLRF  303

Query  1050  RSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVR  1229
             R     NLR   G + L DMM K+       SK  WGN F + ILP  IG+  DPL Y++
Sbjct  304   RVGCTVNLRSDIGFKPLEDMMVKD-------SKCRWGNYFSFIILPFSIGLQTDPLVYLK  356

Query  1230  EAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLE  1409
             ++K+T  RKK+SY     Y++   V+K FG KAAA L N+   N +TC SNV+GP E++ 
Sbjct  357   KSKSTMARKKHSYHAALVYFIIKIVLKVFGAKAAATLFNRPVMNITTCVSNVIGPMEEIS  416

Query  1410  FFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             F GHPIA+IAP+ YG   AL+VH+ SY  KM + ++VD ++IP+P ++ D+ E+SL  +K
Sbjct  417   FRGHPIAYIAPSSYGHSQALLVHYLSYAGKMIISLAVDPSIIPEPEKICDEMEESLKAMK  476



>ref|XP_006339705.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=496

 Score =   394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 218/499 (44%), Positives = 306/499 (61%), Gaps = 37/499 (7%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPV--SPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
             LKPI T K+ +  +       EE +  SP SR+ HEP +N+HI+AIMG+   ++ +    
Sbjct  10    LKPIRTSKKLNDGDE------EEAILLSPGSRMFHEPNYNIHIVAIMGWKIPLDINSLKA  63

Query  282   NMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKK  461
              +   LLKHPRF+SL V+D  E+G+M+WV T V++  H+ V +   +    D       K
Sbjct  64    QILSKLLKHPRFSSLQVMD--ESGEMRWVPTTVNIDDHVIVPQLDTINNTMD-----TDK  116

Query  462   FVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTR  641
              VE Y+  LS   +D+S+PLWD+HILN+KT  AEA ++ R HH+LGDG ++ SLLL+C R
Sbjct  117   LVEQYMSNLSTTTIDISKPLWDIHILNVKTSHAEATSIFRFHHSLGDGIALMSLLLSCFR  176

Query  642   QTANPKLLPTISTRSSSppktlkpnnpkpkpknf----fklVWNTLVDVFIFIATLFFLK  809
             +T++P  LPT+   S +   +    +   +         +L++NT+VDV +FIAT  FLK
Sbjct  177   KTSDPTSLPTLPVSSKNKSNSKNIRSLIWQYIVKLWLFIRLLFNTVVDVLLFIATALFLK  236

Query  810   DSQTPITPSPA---SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLN  980
             DSQ+P T +       S  +RF YR +SL+D   IK ATN TINDV LG+TQAALS Y+N
Sbjct  237   DSQSPFTVAKGFNKKHSTGQRFIYRTVSLDDIKFIKNATNATINDVILGITQAALSRYIN  296

Query  981   RRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWG  1160
             R++       +EG+  + + +R R+ +  NLRPA G+QA+A+M++K             G
Sbjct  297   RKF------DVEGK--MKEQMRCRATVLVNLRPALGVQAVAEMIEKNAIVIQ-------G  341

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N FG+ I+PL I  L +PLDYV +AK + DRKK S E   T+Y+    +  FG K A  L
Sbjct  342   NCFGFVIIPLDIAQLQNPLDYVHKAKISMDRKKRSLESQCTFYILQLFLNLFGFKGATKL  401

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
              N++ S  +  FSNV GP E++ F GHP+AF+APTCYGQP+ LMVH  SY  K+   I+V
Sbjct  402   ANRVPSQTTLAFSNVAGPLEEVSFSGHPLAFLAPTCYGQPTGLMVHACSYAKKLTFAITV  461

Query  1521  DENVIPDPNQLLDDFEKSL  1577
             DE +I DPNQL DDF  S 
Sbjct  462   DEGMISDPNQLGDDFVHSF  480



>ref|XP_006290854.1| hypothetical protein CARUB_v10016964mg, partial [Capsella rubella]
 gb|EOA23752.1| hypothetical protein CARUB_v10016964mg, partial [Capsella rubella]
Length=547

 Score =   395 bits (1016),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 208/502 (41%), Positives = 300/502 (60%), Gaps = 30/502 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++R+ H P FN +++A++G   KI P V    +  TL++HPRF+S +V    +  
Sbjct  54    QPLSPTARIFHAPEFNCYVIAVIGLKKKIEPDVIMEGLKQTLIRHPRFSSKLVSHGNKKR  113

Query  354   KMK-WVETEVDLSQHITVVEAPEVEVEGDETHRKNK-KFVEDYVYELSKERMDMSRPLWD  527
             + + WV T V +S H+ V   P+++ +  E    N   F+E YV  L+   +D+S+PLW 
Sbjct  114   QTQSWVRTNVVVSDHVIV---PDIKTQKSENGNVNADAFLESYVSNLTTVPLDLSKPLWQ  170

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LH+L+LKT DAE + VL+ HH+LGDG S+ +L+LAC R+T+NP  LP+   ++ S     
Sbjct  171   LHLLDLKTSDAENVGVLKFHHSLGDGMSLMALVLACMRKTSNPNELPSQPNQNRSSRSRS  230

Query  708   kpnnp-----------kpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPAS-ES  851
                                  +   LV NT+ D   F+AT  FLKD++TPI     S +S
Sbjct  231   SRLASASRGDSRFLWLVMALWSAIMLVLNTVCDALEFVATTMFLKDTETPIKGDFRSRKS  290

Query  852   KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR------DIGSI  1013
             K     +R +SL D   IK     T+NDV LGVTQA LS YL++RYG++      D  S 
Sbjct  291   KRMCLVHRTVSLEDIKLIKHTMKMTVNDVVLGVTQAGLSQYLDKRYGEKKKIVGEDQESK  350

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
                N +PK +RLRS L  NLRP  GIQ LADMM K+       S   WGN  GY + P  
Sbjct  351   SNSNGMPKIIRLRSALLVNLRPTNGIQDLADMMAKK-------SNCRWGNWIGYIVFPFS  403

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             IG+ +DPL+++R AK   DRKK S+E   T+    F++K FG + AA +  +  SN +  
Sbjct  404   IGLRDDPLEHLRRAKTIIDRKKNSFEAALTFIAGKFIVKSFGVEVAAKIVTRALSNTTMS  463

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSN++GP E++ FFGHPI ++AP+ YG P AL +HFQSY+++M + ++VD   I DP++L
Sbjct  464   FSNLIGPIEEISFFGHPITYMAPSVYGHPHALTIHFQSYMNQMTISLTVDPTAISDPHRL  523

Query  1554  LDDFEKSLHLIKDaaaaaaTSS  1619
             LDD+EKSL +IKDA     ++S
Sbjct  524   LDDWEKSLQIIKDAVQERGSAS  545



>ref|XP_010492003.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=478

 Score =   392 bits (1008),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 207/481 (43%), Positives = 295/481 (61%), Gaps = 25/481 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEPVSP +R+   P  +L  + I+GF +KINP V    +   + KHPRF+S++     EN
Sbjct  6     EEPVSPMARVFQSPRIDLCAVTIVGFETKINPDVVLDALKQNVSKHPRFSSIL----SEN  61

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V      E+ GD      + FV+DY+  L+   +D SRPLWD+
Sbjct  62    GA-KWIETEVNVEDHVIVPYIDPEEIGGD-----GQSFVDDYMSRLTMIPLDRSRPLWDI  115

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKL----LPTISTR-SSSp  695
             HILN+KT DAEA++ +R HH+LGDG S+ SL+LACT +T++P +    +PT+  R   + 
Sbjct  116   HILNVKTYDAEAVSFIRSHHSLGDGMSLVSLILACTHKTSDPDMFSNAIPTMKRRPKHNL  175

Query  696   pktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYR  875
                           +  +L+WNT+VD+ + +AT+  LKD++TP+     + + PKRF +R
Sbjct  176   QTKGWFLRSIITIGSTMRLIWNTIVDMVLLLATVLCLKDTKTPLKADVNTRNNPKRFYHR  235

Query  876   ILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR--DIGSIEGQ-NNLPKNLR  1046
             I+SL+D   IK A + TINDV  G++QA+ S YLNRRY KR  + G++    NNLP  +R
Sbjct  236   IISLDDIKHIKNAMDMTINDVLFGMSQASFSRYLNRRYDKRNEENGALTSYPNNLPDGIR  295

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
              R     NLR   G + LADMM K+       SK  WGN F +  LP  IG+  DPL ++
Sbjct  296   FRVACTVNLRSDIGFKPLADMMVKD-------SKCRWGNYFSFIFLPFSIGLQTDPLVHL  348

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R+ K+   RKK+SY     Y++   V+K FG K AA L ++   N +TC SNV+GP E++
Sbjct  349   RKCKSMMARKKHSYHAALVYFIIKIVLKVFGAKVAAELFDRPVRNLTTCVSNVIGPMEEI  408

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
              F GHPIA+IAP+ YG   AL+VH  SY DKM + ++ D  VIPDP+ + DD E+SL  +
Sbjct  409   SFLGHPIAYIAPSSYGHAQALLVHLMSYADKMIISMAFDPTVIPDPHMICDDMEESLKEM  468

Query  1587  K  1589
             K
Sbjct  469   K  469



>ref|XP_010453319.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=479

 Score =   391 bits (1004),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 207/481 (43%), Positives = 294/481 (61%), Gaps = 25/481 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEPVSP +R+   P  +L  + I+GF +KINP V    +   + KHPRF+S++     EN
Sbjct  7     EEPVSPMARVFQSPGIDLCAVTIVGFETKINPDVVLDALKQNVSKHPRFSSIL----SEN  62

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V      E+ GD      + FV+DY+  L+   +D SRPLWD+
Sbjct  63    GA-KWIETEVNVEDHVIVPYIDPEEIGGD-----GQSFVDDYMSRLTMIPLDRSRPLWDI  116

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKL----LPTISTR-SSSp  695
             HILN+KT DAEA+  +R HH+LGDG S+ SL+LACT +T++P +    +PT+  R   + 
Sbjct  117   HILNVKTYDAEAVGFIRSHHSLGDGMSLVSLILACTHKTSDPDMFSNAIPTMKRRPKHNL  176

Query  696   pktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYR  875
              K            +  +L+WNT+VD+ +  AT+ +LKD++TP+     + + PK F +R
Sbjct  177   QKKGWFLRSIVTIGSTMRLIWNTIVDMVLLFATVLYLKDTKTPLKADVNTRNNPKSFYHR  236

Query  876   ILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR--DIGSIEG-QNNLPKNLR  1046
             I+SL+D   IK A + TINDV  G++QA+ S YLNRRY KR  + G++    NNLP  +R
Sbjct  237   IISLDDIKHIKNAMDMTINDVLFGMSQASFSRYLNRRYDKRNEENGALTSCPNNLPDGIR  296

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
              R     NLR   G + LADMM K+       SK  WGN F +  LP  IG+  DPL ++
Sbjct  297   FRVACTVNLRSDIGFKPLADMMVKD-------SKCRWGNYFSFIFLPFSIGLQTDPLVHL  349

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             ++ K+   RKK+SY     Y++   V+K FG K AA L ++   N +TC SNV+GP E++
Sbjct  350   KKCKSMMARKKHSYHAALVYFIIKIVLKVFGAKVAAELFDRPVRNITTCVSNVIGPMEEI  409

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
              F GHPIA+IAP+ YG   AL+VH  SY DKM + ++ D  VIPDP+ + DD E+SL  I
Sbjct  410   SFLGHPIAYIAPSSYGHSHALLVHLMSYADKMIISMAFDPTVIPDPHMICDDMEESLKEI  469

Query  1587  K  1589
             K
Sbjct  470   K  470



>ref|XP_006293222.1| hypothetical protein CARUB_v10019546mg [Capsella rubella]
 gb|EOA26120.1| hypothetical protein CARUB_v10019546mg [Capsella rubella]
Length=522

 Score =   392 bits (1008),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 208/484 (43%), Positives = 296/484 (61%), Gaps = 26/484 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             ++P+SP++RL H P FN +I++++G  SKI+P V       T ++HPRF+S+MV + +  
Sbjct  17    DQPLSPAARLFHAPEFNCNIVSVIGLKSKIDPDVIIRGSKQTFIRHPRFSSIMVSEGDNG  76

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
                +WV T V +  H+ + E     +E  +       F+EDYV +L K  +D SRPLW+L
Sbjct  77    QNQRWVRTNVVVEDHVIIPEIKPQNIENADA------FLEDYVSDLMKIPLDTSRPLWEL  130

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppkt  704
             H+L+LKT DAE +AVL++HH++GDG SI SL+LAC R+T+NP  LP++    RSSS P  
Sbjct  131   HLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQKRSSSGPAL  190

Query  705   l-kpnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPSPASESKPK  860
             L   +    +     KL+W       NT+ D   F+ T  F+KD+ TPI     S+   +
Sbjct  191   LPTGSRSDSRLLWLVKLLWTAVILGLNTVCDALEFLVTTLFVKDTDTPIKGDLRSKKSTQ  250

Query  861   -RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
              R  +R +S +D   IK A + T+NDV LGVT+A LS YL RRYG+ +  +   Q +LPK
Sbjct  251   LRLVHRTVSFDDIKLIKNAMDMTVNDVVLGVTEAGLSRYLERRYGEEN--TKMKQKHLPK  308

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLRS L  NLRP  GIQ LADMM K        SK  WGN FGY + P  I + +DPL
Sbjct  309   RIRLRSALLVNLRPTTGIQDLADMMAKG-------SKCRWGNWFGYVVFPFSIALRDDPL  361

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
             +++  A  T +RKK S+  + TY     ++K  G K AA + N+  SN +  FSN+VGP 
Sbjct  362   EHLERAHKTINRKKNSFGAMLTYIFCRIIVKSLGTKVAATIINRFVSNTTMTFSNMVGPV  421

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F+GHPI + A + YG P AL +H QSY++KM + + VD  VI DP++L DD+E+SL
Sbjct  422   EEVSFYGHPITYFASSAYGHPHALTIHCQSYMNKMTITLIVDPTVISDPHRLCDDWEESL  481

Query  1578  HLIK  1589
               IK
Sbjct  482   RNIK  485



>ref|NP_190490.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 emb|CAB66400.1| putative protein [Arabidopsis thaliana]
 gb|AEE78511.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=518

 Score =   392 bits (1006),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 205/492 (42%), Positives = 296/492 (60%), Gaps = 31/492 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++R+ H P FN ++++++G   KI+P V    +  TL++HPRF+S MV     N 
Sbjct  26    QPLSPAARVFHAPEFNCYVISVIGIKKKIDPDVIIEGLKQTLIRHPRFSSKMVSTSVGNK  85

Query  354   KMK---WVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             K +   WV T V ++ H+ V +     +E          F+E YV  L+   +D+S+PLW
Sbjct  86    KRQTQSWVRTNVVVTDHVIVSDIQTQNIENGNA----DAFLETYVSNLTTVPLDISKPLW  141

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
              LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+NP  LP++  ++ S  ++
Sbjct  142   QLHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPDELPSLPNQNRSSSRS  201

Query  705   lkpnnpkpkpkn---ffklVW-------NTLVDVFIFIATLFFLKDSQTPITPS-PASES  851
              +                ++W       NT+ D   FIAT  FLKD++TPI      S+S
Sbjct  202   SRLMAGSRGDSRFLWLVMVIWSAIMLVLNTVCDALEFIATTMFLKDTETPIKGDFRFSKS  261

Query  852   KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR------DIGSI  1013
             K     +R +SL+D   IK     T+NDV LGV+QA LS YL+RRYG++      D  S 
Sbjct  262   KRMCLVHRTVSLDDIKLIKNTMKMTVNDVVLGVSQAGLSQYLDRRYGEKKKKVGEDQDSK  321

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
                 ++PK +RLRS L  NLRP  GIQ LADMM K        S   WGN  GY + P  
Sbjct  322   RKATDMPKRIRLRSALLVNLRPNTGIQDLADMMAKG-------STCRWGNWIGYIVFPFS  374

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             IG+ +DPL ++R AK   DRKK S E   T+    F++K FG + AA + N+  SN +  
Sbjct  375   IGLRDDPLQHLRRAKRIIDRKKNSLEAALTFVAGKFILKTFGVQVAAKIINRALSNTTMS  434

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSN++GP E++ F+GHPI ++AP+ YG P AL +HFQSY+++M + ++VD  VI DP++L
Sbjct  435   FSNLIGPIEEISFYGHPITYMAPSVYGHPHALTMHFQSYMNQMTISLTVDPTVISDPHRL  494

Query  1554  LDDFEKSLHLIK  1589
             LDD+EKSL  IK
Sbjct  495   LDDWEKSLQSIK  506



>emb|CDY05910.1| BnaC08g20870D [Brassica napus]
Length=547

 Score =   392 bits (1008),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 214/492 (43%), Positives = 302/492 (61%), Gaps = 31/492 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP++R+ H PAFN +++ ++G   KI P V    +  TL++HPRF+S MV    +N
Sbjct  57    EQPLSPAARVFHAPAFNCYVITVIGVKKKIEPDVIIEGLKQTLIRHPRFSSKMVNKTNKN  116

Query  351   GK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
              +  +WV T V  + H+ V   P+++ +  E    +K F++ YV +L+   +D S+PLW+
Sbjct  117   KQTQRWVRTNVVTNNHVIV---PDIQTQHIENANADK-FLDSYVSDLTLVPLDTSKPLWE  172

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppk  701
             LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+N   LPT+    R+SS   
Sbjct  173   LHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNLNELPTLPYQNRTSSGSS  232

Query  702   tlkpnn--------pkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP  857
              L   +              +   LV NT+ D   FIAT  FLKD++TPI       S P
Sbjct  233   RLTGGSWRGFRFLWLFMVLWSTIMLVLNTICDALRFIATAMFLKDTKTPIK-GDYRLSMP  291

Query  858   KRFA--YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR------DIGSI  1013
              R +  +  +SL+D   IK     T+NDV +GVTQA LS YL RRYG++      D  S 
Sbjct  292   TRMSLVHLTVSLDDIKLIKTNMKMTVNDVVIGVTQAGLSKYLERRYGEKKNVVGDDQKSK  351

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
             +  N +PK +RLRS L  NLRP  GIQ LADMM  +KG     SK  WGN  GY + P  
Sbjct  352   KNSNEMPKRIRLRSALLVNLRPTTGIQDLADMM--DKG-----SKCRWGNMIGYIVFPFS  404

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             I +  DPL+++  AK   DRKK S E   T+ +  F+IK FG K  A L N++ SN +  
Sbjct  405   ISLRKDPLEHLGTAKGIIDRKKNSLEAALTFIVGKFMIKAFGVKVTANLLNRMLSNTTMS  464

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
             FSN++GP E++ FFGHPI ++AP+ YG P AL +HFQSY++KM + ++VD  VI +P+QL
Sbjct  465   FSNLIGPIEEISFFGHPITYMAPSVYGHPHALTMHFQSYMNKMTISLTVDPTVISNPHQL  524

Query  1554  LDDFEKSLHLIK  1589
             LDD+E+SL  IK
Sbjct  525   LDDWEESLRNIK  536



>ref|XP_009150159.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=504

 Score =   391 bits (1004),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 213/510 (42%), Positives = 304/510 (60%), Gaps = 31/510 (6%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMEN--NNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKIN  263
             +E+ER      T K K+G +         +EP++P++RL   P FN +I A++G  SKIN
Sbjct  6     VEIERVKNTNSTMKIKTGRQEPAGQGEHDDEPLTPTARLFTAPEFNCYITAVIGLKSKIN  65

Query  264   PHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDET  443
               VF   +  TLLKHPRF+S++V D  +  + KWV T+V    H+ +   P++E+E    
Sbjct  66    RDVFIEGLEQTLLKHPRFSSILVNDSSQ--EQKWVRTKVVAEDHVII---PKIELEDANA  120

Query  444   HRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSL  623
                   F+E YV +L+   +D S+PLW++H+L+LKT DA+ + VL++HH++GDG S+ SL
Sbjct  121   ----DAFLESYVSDLTTIPLDTSKPLWEVHLLDLKTSDAQTVVVLKIHHSVGDGMSLMSL  176

Query  624   LLACTRQTANPKLLPTI--STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATL  797
             + ACTR+T+N + LP++    R SS                    VWNTL D   FIAT 
Sbjct  177   VHACTRKTSNHEELPSLPNENRLSSKSMAGYSRLIWMVML-----VWNTLCDALKFIATT  231

Query  798   FFLKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMY  974
              FLKD+ TPI      S+SK     +R + L D   IK A   T+NDV LGV QAALS Y
Sbjct  232   MFLKDTDTPIKGDFRLSKSKRMCLVHRTVDLEDIKLIKNAMKMTVNDVLLGVAQAALSEY  291

Query  975   LNRRYGKRDIGSIEGQN-----NLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNS  1139
             L RRYG+++  + E ++     N+ K +RLR+CL  N+RP  G+Q LA+MM K       
Sbjct  292   LERRYGEKEKKAGEHESKRNSSNMLKEIRLRACLLVNIRPTTGVQDLANMMAKG------  345

Query  1140  MSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFG  1319
              SK  WGN  GY + PL + + +DPL+++R  K+   RKK S E + T+     +IK  G
Sbjct  346   -SKCKWGNWIGYMLFPLSLALHDDPLEHLRRVKSIIQRKKNSLEALLTFTSTKILIKMLG  404

Query  1320  PKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDK  1499
                AA LT++  SN +  FSN+VGP E++  +GHPI +IAP+ YG P AL +HFQSY++K
Sbjct  405   VVRAASLTSRTISNTTMSFSNLVGPTEEVSLYGHPITYIAPSAYGHPHALTMHFQSYMNK  464

Query  1500  MGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             M + ++VD   I DP+QL DD E+SL  IK
Sbjct  465   MTISLTVDPTAICDPHQLCDDLEESLRSIK  494



>ref|XP_006404166.1| hypothetical protein EUTSA_v10011067mg [Eutrema salsugineum]
 gb|ESQ45619.1| hypothetical protein EUTSA_v10011067mg [Eutrema salsugineum]
Length=509

 Score =   391 bits (1004),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 199/485 (41%), Positives = 298/485 (61%), Gaps = 23/485 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP++RL H P FN +I++++G  +KI P      +  TL+KHPRF+S +V     N
Sbjct  26    EQPLSPAARLFHAPEFNCYIISVIGLKNKIKPDEIIQGIKQTLIKHPRFSSKLVNSGSNN  85

Query  351   GK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
              +  KWV T V    H+ +   P+ E +  E    +  F+E YV +L+   ++ S+PLW+
Sbjct  86    RQEQKWVRTNVVAEDHVII---PKFETQDIENANADA-FLESYVSDLTTTPLNTSKPLWE  141

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI---STRSSSpp  698
             +H+L+LKT DAE +A+L++HH++GDG S+ SL+LACTR+T+NP   P++   +  SS   
Sbjct  142   VHLLDLKTSDAENVAILKIHHSVGDGMSLMSLVLACTRKTSNPDEFPSLPYQNQSSSGSS  201

Query  699   ktlkpnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPS-PASESK  854
             + +  +    +       +W       NT+ D   FIAT  FLKD+ TPI       + K
Sbjct  202   RLMPGSVGDSRLLWLLMALWSAIMVVLNTVCDALEFIATTLFLKDTSTPIKGDFRLRKCK  261

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLP  1034
                  +R +S +D   IK A   T+NDV LGV+QA LS YL RRYG++   +++ + ++P
Sbjct  262   RMCLVHRTVSFDDIKLIKNAMKMTVNDVILGVSQAGLSQYLKRRYGEKKKKTVDQEESIP  321

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
             K +RLR+ +  N+RP  GIQ LADMM K        SK  WGN  GY + P+ I + NDP
Sbjct  322   KEIRLRAAVLVNIRPTTGIQDLADMMTKG-------SKCRWGNWIGYIVFPVSIALHNDP  374

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             LD++R AK+  DRKK S E   T+ +   +IK  G + AA + ++  SN +  FSN+VGP
Sbjct  375   LDHIRRAKSIIDRKKNSLEAALTFIVGKMIIKSLGVQRAANILHRALSNTTMTFSNLVGP  434

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F+GHP+ ++AP+ YG P AL +HFQSY++KM + +SVD  VI DP++L DD+E+S
Sbjct  435   MEEISFYGHPVTYMAPSVYGHPHALTMHFQSYMNKMTISLSVDPTVISDPHRLCDDWEES  494

Query  1575  LHLIK  1589
             L  IK
Sbjct  495   LRSIK  499



>ref|XP_006287621.1| hypothetical protein CARUB_v10000833mg [Capsella rubella]
 gb|EOA20519.1| hypothetical protein CARUB_v10000833mg [Capsella rubella]
Length=486

 Score =   389 bits (999),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 211/483 (44%), Positives = 295/483 (61%), Gaps = 30/483 (6%)
 Frame = +3

Query  180   VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKM  359
             +SP +R+   P  ++  +   GF +KINP V    + H + KHPRF+S +     ENG  
Sbjct  12    LSPMARVFQSPVVDICAIIDFGFKTKINPDVVLDALRHNVYKHPRFSSKL----SENGA-  66

Query  360   KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHIL  539
             KW+ETEV++  H+ V   P ++ E  E     + FV+DY+  L+   +D SRPLWD+HIL
Sbjct  67    KWIETEVNVEDHVIV---PYIDPE--EIGESGQSFVDDYISRLTTMPLDRSRPLWDIHIL  121

Query  540   NLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL----PTISTRSS---Spp  698
             N+KT DAEA+ VLR +HAL DG S  SL+LACT +T+NP +L    P++  R++   +  
Sbjct  122   NVKTTDAEAVGVLRFNHALADGMSFFSLVLACTHKTSNPDVLSTSNPSVKRRTTMPHNVE  181

Query  699   ktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRI  878
             KT           +  +L+WNT VD+ +  AT+ FLKD++TP+T      + PKRF +R 
Sbjct  182   KTGWFPRTMFTIGSTMRLIWNTFVDLLLLSATMLFLKDTKTPLTGGVDVRTNPKRFYHRN  241

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ------NNLPKN  1040
             +SL+D   IK A N TINDV LG+TQAALS Y+NRRY +      +G       NNLP  
Sbjct  242   ISLDDVKLIKNAMNMTINDVLLGITQAALSSYMNRRYEQDKKNEKDGALLTPFPNNLPDG  301

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +R R+    NLR   G + LA+MM K+       SK  WGN F + ILPL IG+  DPL 
Sbjct  302   IRFRAGCTVNLRSDIGFKPLAEMMAKD-------SKCKWGNYFSFIILPLSIGLETDPLV  354

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             Y+++AKA   RKK+SY     Y+    ++K FG KAAA + N+   N +TC SNV+GP E
Sbjct  355   YLKKAKAMMARKKHSYHAPLVYFFIKIILKVFGAKAAASVFNQYVMNITTCVSNVMGPME  414

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F GHPIA+I+P+ YG   AL+VH+ SY  +M + + VD  VIPDP+++ DD E+SL 
Sbjct  415   EVSFHGHPIAYISPSSYGHSQALLVHYTSYAGEMTITMMVDPTVIPDPHKICDDMEESLK  474

Query  1581  LIK  1589
              IK
Sbjct  475   TIK  477



>gb|ABF59162.1| hypothetical protein At3g49200 [Arabidopsis thaliana]
Length=507

 Score =   389 bits (1000),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 204/484 (42%), Positives = 299/484 (62%), Gaps = 24/484 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++RL H P FN +I++++G  +KI P +    +  TL++HPRF+S +V +   N 
Sbjct  26    QPLSPAARLFHAPEFNCYIISVVGLKNKIEPDMIIEGIKQTLMRHPRFSSKLVNNCNNNR  85

Query  354   K-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             +  KWV T V +  H+ +   P+++ E  E    +  F+E YV +L+   +D S+PLW++
Sbjct  86    QEQKWVRTNVVVEDHVII---PKIQTEHIENANADV-FLESYVSDLTTIPLDTSKPLWEV  141

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+L+LKT DAE +AVLR+HH+LGDG S+ SL+LACTR+T+NP  LP++  ++     +  
Sbjct  142   HLLDLKTSDAENVAVLRIHHSLGDGMSMMSLVLACTRKTSNPNELPSLPYQNRPSSGSSS  201

Query  711   pnnpkpkpk----------nffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKP  857
                                +   LV NT+ D   FIAT  FLKD++TPI      S+ K 
Sbjct  202   LKTSSRCYSRFFWLVMVLWSAALLVLNTVCDALEFIATALFLKDTETPIKGDFKLSKGKR  261

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
                 +R +SL+D   IK A   T+NDV LGV+QA LS YL RRYG+++  S    +N+PK
Sbjct  262   MCMVHRTVSLDDIKLIKNAMKMTVNDVVLGVSQAGLSQYLKRRYGEQE-ESKRNSSNIPK  320

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLR+ L  NLRP  GIQ LADMM K        SK  WGN  GY I P  I + +DPL
Sbjct  321   GIRLRAALLVNLRPTTGIQDLADMMTKG-------SKCRWGNWIGYIIFPFSIALCDDPL  373

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
              ++R AK+T DRKK S E + T+ +   ++   G + AA + N+  SN +  FSN+VGP 
Sbjct  374   KHLRRAKSTIDRKKNSLEAVLTFVVGKILLNTLGVQRAANVLNRALSNTTMSFSNLVGPV  433

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F+GH + +IAP+ YG P AL +HFQSY++K+ + ++VD  VI DP++L DD+E+SL
Sbjct  434   EEISFYGHTVTYIAPSVYGHPHALTMHFQSYMNKLTISLTVDPTVISDPHKLCDDWEESL  493

Query  1578  HLIK  1589
               IK
Sbjct  494   RSIK  497



>ref|XP_007019909.1| O-acyltransferase family protein [Theobroma cacao]
 gb|EOY17134.1| O-acyltransferase family protein [Theobroma cacao]
Length=514

 Score =   389 bits (1000),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 212/512 (41%), Positives = 312/512 (61%), Gaps = 43/512 (8%)
 Frame = +3

Query  111   KPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMP  290
             + +E  +  SG +N       EP+SP +R+ HEP  N++I+ I+GF + I P+ F  N+ 
Sbjct  21    REMEEGRSVSGEDN-------EPLSPMARMFHEPDSNVYIITIVGFKNPIEPNSFKANLV  73

Query  291   HTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVE  470
             HTLLKHPRF+S+ V D+   G++KWV+TEV+L +H+ V   P+V+ E   +     KF+E
Sbjct  74    HTLLKHPRFSSVQVADENNGGELKWVQTEVELEKHVIV---PKVD-EEMASQGAADKFIE  129

Query  471   DYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTA  650
             DY+  +SK ++ MS P+WD HILNLKT DAE++ VLR+HH+LGDG S+ SLL++C+R+  
Sbjct  130   DYISNMSKTKISMSIPMWDCHILNLKTSDAESVLVLRVHHSLGDGTSLMSLLISCSRKLF  189

Query  651   NPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPIT  830
             +P  LPT       P  T        K  +FF L+WNTLVD+ + +ATL+F KD+ TP+ 
Sbjct  190   DPLALPTFPAMKKKPIATTTWLCFWIKLWSFFLLIWNTLVDMLMCVATLYFYKDTPTPLK  249

Query  831   -PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR--------  983
              PS +    PKR   R  SL+D   +K ATNT I  + + +   A+  +++R        
Sbjct  250   PPSRSVACTPKRIVRRTFSLDDVKLVKNATNTLIWLIRVYLKCFAIGPFVDRQRCRPSNH  309

Query  984   --RYGKRDIGSI--------EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGES  1133
               R    DI ++        E ++NLP N+RLR+ LF NLR + GI AL +M+KK     
Sbjct  310   SSRLISLDISTVNMRHEAGKEWEDNLPNNIRLRATLFINLRSSPGIYALGEMLKKN----  365

Query  1134  NSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKF  1313
                SK  WGN+ GY + P  I + ++PL+Y+R+ K   DRKK S E  F + +A   ++F
Sbjct  366   ---SKAEWGNKIGYVLFPFTIALKDNPLEYIRDVKEAMDRKKASLEAKFRHLMATVFVRF  422

Query  1314  FGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYV  1493
             +  + A       F + +  FSNV GP++++  FG+ + +IAP+ YGQP AL +H  SY 
Sbjct  423   YRTRLAK------FPSTTMWFSNVAGPQDEITIFGNQVTYIAPSLYGQPVALTIHVVSYA  476

Query  1494  DKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
              KM +++SVD+N+IPDP QL DD E+SL LIK
Sbjct  477   KKMSMVLSVDDNIIPDPYQLCDDLEESLKLIK  508



>ref|XP_010503570.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=512

 Score =   389 bits (1000),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 208/513 (41%), Positives = 308/513 (60%), Gaps = 35/513 (7%)
 Frame = +3

Query  117   IETRKQKSGMENNNMSIAE-----EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
             I+TR+++  M    +   E     + +SP++RL H P FN +I++++G   KI P+V   
Sbjct  3     IKTRRRRQNMSETTVENEEEKEEEQLLSPTARLFHAPEFNCYIISVIGLKKKIEPYVIIE  62

Query  282   NMPHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
              M  TL++HPRF+S +V     N  + KWV+T V +  H+ +   P++E +  E      
Sbjct  63    GMKQTLIRHPRFSSKLVNSWNNNRPEQKWVQTNVVVEDHVII---PKIETQNIE---NAD  116

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACT  638
              F+E Y+ +L+   +D S+PLW++H+L+LKT DAE + V ++HH++GDG S+ SL+LACT
Sbjct  117   AFLESYLSDLTTIHLDTSKPLWEVHLLDLKTSDAENVVVFKIHHSVGDGMSMMSLVLACT  176

Query  639   RQTANPKLLPTI----------STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFI  788
             R+T++P  LP++          S   +S     +         +   LVWNT+ D   FI
Sbjct  177   RKTSDPNELPSLPYHNRLSSGSSPLKTSSSCCPRLFWLVMVLWSPVVLVWNTVCDALEFI  236

Query  789   ATLFFLKDSQTPITPS-PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAAL  965
             AT  FLKD++TPI  +   S SK  R  +R +SL+D   IK A N T+NDV LGV+QA L
Sbjct  237   ATTLFLKDTETPIKGNFRLSTSKQMRLVHRTVSLDDIKLIKNAMNMTVNDVVLGVSQAGL  296

Query  966   SMYLNRRYGKRDIG-----SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGE  1130
             S YLNRRYG++        S +  +N+PK +RLR+ L  N+RP  GIQ LADMM K    
Sbjct  297   SKYLNRRYGEKTKAGEQEESKKNSSNMPKKIRLRAVLLVNIRPTTGIQDLADMMAKG---  353

Query  1131  SNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIK  1310
                 SK  WGN  GY   P  I + +DPL+++   K+  DRKK S E + T+ + N +IK
Sbjct  354   ----SKCRWGNWIGYIFFPFSIALCDDPLEHLLGVKSIIDRKKNSLEAVLTFAVGNLLIK  409

Query  1311  FFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSY  1490
               G + AA +T +  SN +  FSN+VGP E++  +G+ + +IAP+ YG P AL +HFQSY
Sbjct  410   LLGVQRAAHMTKRTLSNTTMAFSNLVGPIEEVSLYGNTVTYIAPSAYGHPHALTMHFQSY  469

Query  1491  VDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             ++KM + ++VD  VI DP++L DD E+SL  IK
Sbjct  470   MNKMTMSLTVDPTVISDPHKLCDDLEESLRSIK  502



>gb|KEH39732.1| O-acyltransferase (WSD1-like) family protein [Medicago truncatula]
Length=439

 Score =   386 bits (992),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/446 (43%), Positives = 282/446 (63%), Gaps = 23/446 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP++RL H P+FN +++AI+G  + INP V    +  T+LKHPRFTS +V   ++  
Sbjct  10    EPLSPAARLFHSPSFNCYVIAIIGCKTSINPQVIRDGLCQTILKHPRFTSKLV---KKGR  66

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K +W ET +DL  HI V   P+++ + D   R    FVEDY+   +K  +D+S+PLW+LH
Sbjct  67    KTRWTETTIDLDNHIIV---PQIDSKIDFPDR----FVEDYISNFTKTPLDISKPLWELH  119

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----SSSppk  701
             +LN+KT +AE++ + R+HH+LGDG S+ SLL+A TR+T++P  LPT+ T      S+   
Sbjct  120   LLNIKTSNAESIGIFRIHHSLGDGTSLISLLIAATRKTSDPNALPTVPTTRKRDDSNVHN  179

Query  702   tlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRIL  881
                  +         +L+WNT+VDV + + T+ F KD+ TP+  +   E   KRF Y ++
Sbjct  180   CSIIVSFWLSILWGLRLIWNTIVDVLLLVLTILFFKDTHTPLKGAHGVELNTKRFVYLMV  239

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQNNLPKNLRLRS  1055
             S++D   +K    TTINDV LG+TQA L+ YLNR YG ++   G+   ++ +PKN+RLR+
Sbjct  240   SMDDIKLVKAEMKTTINDVLLGLTQAGLARYLNREYGVKNANDGAAMSKSGIPKNIRLRA  299

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              +  N+R + GIQ LADMM  EKG++       WGN+ GY I P  I +  DPL+YVR+A
Sbjct  300   SILVNIRASPGIQDLADMMA-EKGKAR------WGNKMGYIIFPFNIALQEDPLEYVRQA  352

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFF  1415
             KAT DRKK S E I +Y  A  V+  FG K A ++T ++  + +  FSNV GP E++ F+
Sbjct  353   KATIDRKKQSLEAICSYACAKLVLNLFGVKIAGVITRRVLFHTTMAFSNVAGPVEEISFY  412

Query  1416  GHPIAFIAPTCYGQPSALMVHFQSYV  1493
             GHP+AFIAP+ YG P   +   QS +
Sbjct  413   GHPVAFIAPSVYGHPHVSLNFLQSLL  438



>ref|XP_009760114.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Nicotiana 
sylvestris]
Length=505

 Score =   389 bits (998),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 218/510 (43%), Positives = 310/510 (61%), Gaps = 36/510 (7%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             +KPI T K+   ++ N        +SP+SR  HEP +NL++LAI+G+   IN       +
Sbjct  11    IKPIRTTKK---LDANGGEEEALLMSPTSRTFHEPNYNLYVLAILGWKVPINVDAMKAEI  67

Query  288   PHTLLKHPRFTSLMVVDKEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
                LLKHPRF+SL V+D+ ++ + MKW+ T V+L  H+ V +     ++ +  +    K 
Sbjct  68    QSKLLKHPRFSSLQVIDESDDSRNMKWIPTTVNLDDHVIVPD-----LKPNPNNMDTDKL  122

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VEDY+  LS   +DMS+PLWDLHILN+KT  AEA  + R+HH++GDG S+ SLLL+C R+
Sbjct  123   VEDYISNLSAVSIDMSKPLWDLHILNVKTSHAEATCIFRLHHSIGDGVSLVSLLLSCFRK  182

Query  645   TANPKLLPTISTR------------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFI  788
             +++P  LPT+               ++             K  +   L++NT+VDV +F+
Sbjct  183   SSDPTSLPTLLVSSSSSSKGKSNLSNNRGSIWSLMWQYLVKLWSCISLLFNTVVDVPMFV  242

Query  789   ATLFFLKDSQTPIT-PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAAL  965
             AT  FLKDSQ+P T P     S   RF YR +SL+D   IK  TN+T+NDV LG+TQAAL
Sbjct  243   ATALFLKDSQSPFTVPQGFKSSTRLRFVYRTVSLDDIKFIKNLTNSTVNDVILGITQAAL  302

Query  966   SMYLNRRYGKRDIGSIEGQNNL-PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
             S Y++R+Y       IEG+    P+ +R R+ +  NLRP  G+QA+A+M++K        
Sbjct  303   SRYVHRKY------EIEGKRKFSPQKMRCRASVVMNLRPLLGVQAVAEMIEKNTVVIQ--  354

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
                  GN FG  I+PL I   ++PLDYVR+AK T DRKK+S E   T+YL+  + K FG 
Sbjct  355   -----GNCFGIVIIPLSISQFDNPLDYVRKAKTTMDRKKHSLESRCTFYLSQLLTKLFGF  409

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKM  1502
             K AA L  +  S+ +  FSNV+GP E++ +  HP+AFIAPTCYGQ + +MVH  SY   +
Sbjct  410   KGAAALAPRALSHTTLFFSNVLGPLEEVSWSRHPLAFIAPTCYGQSTGIMVHGCSYAKNL  469

Query  1503  GVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
                ++VDE +IPDPNQL DDF +S  LIK+
Sbjct  470   TFAVAVDEGIIPDPNQLGDDFVESFRLIKE  499



>gb|KDP45599.1| hypothetical protein JCGZ_17206 [Jatropha curcas]
Length=476

 Score =   387 bits (995),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 216/476 (45%), Positives = 305/476 (64%), Gaps = 21/476 (4%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP S    +    ++++AI+GF ++INP  F  N+ HTL+++PRF+SL V+D +++
Sbjct  6     EEPLSPWSSAFVKSESGVYVIAILGFKNRINPSFFKDNLMHTLMRNPRFSSLQVID-DKD  64

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVE-GDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
             GK+KW+ T V++  H+ V   P++  E G   H     F+EDY+  LSK  +D+S+PLWD
Sbjct  65    GKVKWIRTSVNVEDHVIV---PQLNQEMGLSPH----AFLEDYISNLSKTNLDISKPLWD  117

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
              HILNLKT DAE++ +LR+HHALGDG S+ SLLL+ T + ++P+  P+   +        
Sbjct  118   FHILNLKTDDAESVCILRVHHALGDGFSLISLLLSSTHKVSDPEAFPSFPMKKKKEKYEE  177

Query  708   kpnnpkpkpk-nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             + N          F+  WN++VDV + IATLFF KDS+TPIT S    S  +R  Y+I S
Sbjct  178   QNNLSYFAKCWLIFRFYWNSMVDVIMLIATLFFFKDSKTPITNSTCRGSFGRRIVYKIFS  237

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K ATNTT+NDV   V QA+LS YLNR YG  +  + E  NNLPK L +R+ + 
Sbjct  238   LDDIKLVKNATNTTVNDVITAVLQASLSRYLNRLYGDNNRAT-EENNNLPKRLNVRAAVP  296

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
               L    G+ AL D +++        S  G  N FG+  +PL+I + +DPLDYVR AKA 
Sbjct  297   VALD--LGLNALRDRVEQN-------SNMG-SNNFGFVFIPLRIAIKDDPLDYVRSAKAA  346

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S E I +  +   +I FFG K A+ +  KI S  +   SN+ GP E++ ++GHP
Sbjct  347   MDRKKNSLEAIASATILKLLIYFFGIKGASFMARKIPSQTTMLLSNLPGPTEEIAWYGHP  406

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             I+FIAPT YG P AL +HFQSY +KM +++SVDE+ IP+P+QL  DFE+SL LIKD
Sbjct  407   ISFIAPTVYGAPKALTMHFQSYFNKMAIVLSVDESAIPNPHQLCTDFEESLKLIKD  462



>ref|NP_190489.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 emb|CAB66399.1| putative protein [Arabidopsis thaliana]
 gb|AEE78510.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=507

 Score =   388 bits (997),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 299/484 (62%), Gaps = 24/484 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++RL H P FN +I++++G  +KI P +    +  TL++HPRF+S +V +   N 
Sbjct  26    QPLSPAARLFHAPEFNCYIISVVGLKNKIEPDMIIEGIKQTLMRHPRFSSKLVNNCNNNR  85

Query  354   K-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             +  KWV T V +  H+ +   P+++ +  E    +  F+E YV +L+   +D S+PLW++
Sbjct  86    QEQKWVRTNVVVEDHVII---PKIQTQHIENANADV-FLESYVSDLTTIPLDTSKPLWEV  141

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+L+LKT DAE +AVLR+HH+LGDG S+ SL+LACTR+T+NP  LP++  ++     +  
Sbjct  142   HLLDLKTSDAENVAVLRIHHSLGDGMSMMSLVLACTRKTSNPNELPSLPYQNRPSSGSSS  201

Query  711   pnnpkpkpk----------nffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKP  857
                                +   LV NT+ D   FIAT  FLKD++TPI      S+ K 
Sbjct  202   LKTSSRCYSRFFWLVMVLWSAALLVLNTVCDALEFIATALFLKDTETPIKGDFKLSKGKR  261

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
                 +R +SL+D   IK A   T+NDV LGV+QA LS YL RRYG+++  S    +N+PK
Sbjct  262   MCMVHRTVSLDDIKLIKNAMKMTVNDVVLGVSQAGLSQYLKRRYGEQE-ESKRNSSNIPK  320

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +RLR+ L  NLRP  GIQ LADMM K        SK  WGN  GY I P  I + +DPL
Sbjct  321   GIRLRAALLVNLRPTTGIQDLADMMTKG-------SKCRWGNWIGYIIFPFSIALCDDPL  373

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
              ++R AK+T DRKK S E + T+ +   ++   G + AA + N+  SN +  FSN+VGP 
Sbjct  374   KHLRRAKSTIDRKKNSLEAVLTFVVGKILLNTLGVQRAANVLNRALSNTTMSFSNLVGPV  433

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ F+GH + +IAP+ YG P AL +HFQSY++K+ + ++VD  VI DP++L DD+E+SL
Sbjct  434   EEISFYGHTVTYIAPSVYGHPHALTMHFQSYMNKLTISLTVDPTVISDPHKLCDDWEESL  493

Query  1578  HLIK  1589
               IK
Sbjct  494   RSIK  497



>ref|XP_010426427.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=511

 Score =   388 bits (996),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/489 (42%), Positives = 300/489 (61%), Gaps = 28/489 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN-  350
             +P+SP++RL H   FN +I++++G   KI P V    M  TL++HPRF+S +V     N 
Sbjct  24    QPLSPTARLFHAREFNCYIISVIGLKKKIEPDVIIEGMKQTLIRHPRFSSKLVNSWNNNR  83

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              + KWV T V +  H+ +   P++E +  E    +  F+E Y+ +L+   +D S+PLW++
Sbjct  84    EEQKWVRTNVVVEDHVII---PKIETQNIENANADA-FLESYLSDLTTIHLDTSKPLWEV  139

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI----------ST  680
             H+L+LKT DAE + V ++HH++GDG S+ SL+LACTR+T++P  LP++          S 
Sbjct  140   HLLDLKTSDAENVVVFKIHHSVGDGMSMMSLVLACTRKTSDPNELPSLPYHNRLSSGSSP  199

Query  681   RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKP  857
               +S     +   P     +   LVWNT+ D   FIAT  FLKD++TPI  +   S+SK 
Sbjct  200   LKTSSRCYSRLFWPVMVLWSAVVLVWNTVCDALEFIATTLFLKDTETPIKGNFRLSKSKQ  259

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIG-----SIEGQ  1022
              R  +R +SL+D   IK A N T+NDV LGV+QA LS YLNRRYG++        S +  
Sbjct  260   MRLVHRTVSLDDIKLIKNAMNMTVNDVVLGVSQAGLSKYLNRRYGEKTKAGEQEESKKNS  319

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
             +N+PK +RLR+ L  N+RP  GIQ LADMM K        SK  WGN  GY   P  I +
Sbjct  320   SNMPKKIRLRAVLLVNIRPTTGIQDLADMMAKG-------SKCRWGNWIGYIFFPFSIAL  372

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
              +DPL+++   K+  D+KK S+E + T+ + N +IK  G + AA +T +  SN +  FSN
Sbjct  373   CDDPLEHLVGVKSIIDQKKNSFEAVLTFAVGNLLIKLLGVQRAAQMTIRTLSNTTMAFSN  432

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             +VGP E++  +G+ + +IAP+ YG P AL +HFQSY++KM + ++VD  VI DP++L DD
Sbjct  433   LVGPIEEVSLYGNTVTYIAPSAYGHPHALTMHFQSYMNKMTMSLTVDPTVISDPHRLCDD  492

Query  1563  FEKSLHLIK  1589
              E+SL  IK
Sbjct  493   LEESLRSIK  501



>gb|KFK34209.1| hypothetical protein AALP_AA5G115000 [Arabis alpina]
Length=511

 Score =   388 bits (996),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/487 (42%), Positives = 294/487 (60%), Gaps = 29/487 (6%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN-G  353
             P+SP++R+ + P  N +++A++G   KI P+        +L++HPRF+S +V    +N  
Sbjct  28    PLSPAARVFNAPKLNCYVIAVLGVKKKIEPYAVMEGFKQSLIRHPRFSSKLVNSGNKNRQ  87

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K +WV T V +  H+ V   PE++    E       F+E Y+ +L+   +D S+PLW+LH
Sbjct  88    KQRWVRTNVVIDDHVIV---PEIQTHNIENA---DAFLESYLSDLTTVSLDTSKPLWELH  141

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +L+LKT DAE +AVL+ HH+LGDG S+ SL+ AC R+T+NP  LPT+  ++         
Sbjct  142   LLDLKTSDAENVAVLKFHHSLGDGMSLMSLVFACMRKTSNPDELPTLPYQNRPSSGLPAG  201

Query  714   nnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPS-PASESKPKRFA  869
             +    +      + W       NT+ D   FIAT+ FLKD++TPI  +   S+ K     
Sbjct  202   STCGYRFLWLVMITWSAIMLVLNTVSDGLEFIATILFLKDTETPIKGNYQLSKCKRMCLV  261

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG--KRDIGSIEGQ-----NN  1028
             +R +SL+D   IK     T+NDV LGV+QA LS YL RRYG  K+ +G  E +     NN
Sbjct  262   HRTVSLDDIKLIKNTMKMTVNDVVLGVSQACLSQYLERRYGGKKKKVGEEEVESKRNLNN  321

Query  1029  LPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLN  1208
             LPK +RLRS L  NLRP  GIQ LA+MM K        SK  WGN  GY + PL I + +
Sbjct  322   LPKRIRLRSTLLVNLRPTTGIQDLANMMAKG-------SKCKWGNWIGYIVFPLSIALRD  374

Query  1209  DPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVV  1388
             DPL+++R+AK   DRKK S+    T+   NF++K FG +  A + N+  SN +  FSN++
Sbjct  375   DPLEHLRKAKWIVDRKKNSFGAALTFIFGNFIMKLFGVEVTANIVNRALSNTTMSFSNLI  434

Query  1389  GPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFE  1568
             GP E++ F+GHPI +IAP+ YG   AL +HFQSY++KM + ++VD  VI DP+ L DD+E
Sbjct  435   GPLEEISFYGHPITYIAPSVYGHSHALTMHFQSYMNKMTISLTVDPTVISDPHCLCDDWE  494

Query  1569  KSLHLIK  1589
             +SL  IK
Sbjct  495   ESLRTIK  501



>ref|XP_010550528.1| PREDICTED: O-acyltransferase WSD1-like [Tarenaya hassleriana]
Length=488

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 201/482 (42%), Positives = 300/482 (62%), Gaps = 33/482 (7%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP++R  H P FN +I+++MG   +I+  V    +  TL++HPRF+S +VVD  +  K
Sbjct  19    PLSPAARFFHAPEFNCYIISMMGCKIRIDVDVIIQGLKQTLIRHPRFSSKLVVDGNKTQK  78

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              +WV TEV++  H+ V   P++  +  E      +F+E+YV  L+   +D+SRPLW LHI
Sbjct  79    HRWVRTEVNVEDHVIV---PDITPDNIE---NPNEFLENYVSNLTTVPLDISRPLWQLHI  132

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI------STRSSSpp  698
             L++KT +AE+  V ++HH++GDG S+ SL+LACTR+T++P  +P++       +R +   
Sbjct  133   LDIKTEEAESFGVFKIHHSIGDGMSLMSLILACTRKTSDPDEIPSLPFRNRFKSRFTGLR  192

Query  699   ktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPA--SESKPKRFAY  872
             +  +         +   LV NT+ DV  FIAT  FLKD++TPI       +E+K +R  +
Sbjct  193   REHRFWWFVSVMWSVILLVLNTIRDVLEFIATALFLKDTETPIKGRRGGLTENKRRRLVH  252

Query  873   RILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK---RDIGSIEGQNNLPKNL  1043
             R +SL+D   IK A   T+NDV LGVTQA LS YLNR+YG+   ++      Q+NLPK +
Sbjct  253   RTVSLDDIKLIKNALKMTVNDVVLGVTQAGLSRYLNRKYGETETKEEAKDCNQDNLPKRI  312

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLR+ +  N+RP  GIQ LADMM K        SK  WGN  GY ++P  I M +DPL++
Sbjct  313   RLRAAILVNIRPNTGIQDLADMMSKG-------SKCRWGNWIGYVVVPFYIAMCSDPLEH  365

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
                      RKK+S E   T+ +  F ++  G KAAA + ++  SN +  FSN++GP E+
Sbjct  366   ---------RKKHSLEAFLTFTVGQFFLETIGVKAAADIMSRTMSNTTMSFSNMMGPVEE  416

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + F+GHP+A++AP+ YG P AL +HFQSY+DKM + ++VD  VI DP++L DD E+SL  
Sbjct  417   ISFYGHPMAYLAPSVYGHPHALTMHFQSYLDKMTISLTVDPTVITDPHRLCDDLEESLRS  476

Query  1584  IK  1589
              K
Sbjct  477   FK  478



>ref|XP_010453795.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=487

 Score =   386 bits (991),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/489 (42%), Positives = 301/489 (62%), Gaps = 34/489 (7%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  ++  +  +GF +KINP V    + H + KHPRF+S +     EN
Sbjct  8     EEPLSPMARVFQSPDIDICAIINIGFKTKINPDVVLDALRHNVYKHPRFSSKL----SEN  63

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V   P +++E  ET    ++ V+DY   L+   +D SRPLWD+
Sbjct  64    GA-KWIETEVNVEDHVVV---PYIDLE--ETCEGGQRLVDDYCSRLTMTPLDRSRPLWDI  117

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL----PTISTRSS---  689
             HILN+KT DAEA+ V+R +HAL DG S  SL+LACT +T+NP +L    P +  R++   
Sbjct  118   HILNVKTSDAEAVGVIRFNHALADGMSFISLVLACTHKTSNPNMLSTATPLVKRRTTVPH  177

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S  KT           +  +L+WNT+VDV + +AT+ FLKD++TP+  +      P+RF 
Sbjct  178   SLEKTGWFLRAIFTIGSTMRLIWNTIVDVLLLVATVLFLKDTKTPLKGNANVRRNPRRFY  237

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY---------GKRDIGSIEGQ  1022
             +R +SL+D   IK A N TINDV LG+TQAALS Y+NR+Y          + + GS+   
Sbjct  238   HRTISLDDIKLIKNAMNMTINDVLLGITQAALSSYMNRQYLVSQEQDKNDELEDGSVL-T  296

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
             + LP  +R R+    NLRP  G + LA+MM K+       SK  WGN F + ILPL I +
Sbjct  297   SYLPDGIRFRAGCTVNLRPDIGFKPLAEMMVKD-------SKCRWGNYFSFIILPLSIAL  349

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
               DPL Y+ ++KA   RKK+SY+    Y+  N ++K  G KAA++  N+   N +TC SN
Sbjct  350   ETDPLVYLEKSKAIMARKKHSYQAALAYFFINIILKVLGAKAASLAFNQHLKNITTCVSN  409

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             V+GP E++ F GHPIA+I+P+ YG   AL++H+ SY  ++ + + V+  V+PDP+++ DD
Sbjct  410   VMGPMEEISFHGHPIAYISPSSYGHSQALLIHYTSYAGEVTITVGVNPTVVPDPHKICDD  469

Query  1563  FEKSLHLIK  1589
              E+SL  +K
Sbjct  470   MEESLKTMK  478



>ref|XP_010507342.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=502

 Score =   386 bits (992),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 297/483 (61%), Gaps = 27/483 (6%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP++RL H P FN +I++++G N KI P V    +  TL++HPRF+S +V    +N +
Sbjct  25    PLSPAARLFHAPEFNCNIISVIGLNRKIEPDVIIEGIKQTLIRHPRFSSKLVNSWNKNRQ  84

Query  357   -MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               KWV T V +  H+ +   P++E +  E    +  F+E YV +L+   +D S+PLW++H
Sbjct  85    EQKWVRTNVVVEDHVII---PKIETQNIENANADT-FLESYVSDLTTFPLDTSKPLWEVH  140

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI----------STR  683
             +L+LKT DAE +A+LR+HH++GDG S+ SL+LACTR+T++P  LP++          S  
Sbjct  141   LLDLKTSDAENVAILRIHHSVGDGMSMMSLVLACTRKTSDPNELPSLPYNNRLASESSPL  200

Query  684   SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKPK  860
              +S     +         +   LV NT+ D   FIAT  FLKDS+TPI       +SK  
Sbjct  201   KTSSRCCPRLFWLVMVLWSVVVLVSNTVCDALEFIATALFLKDSETPIKGDFRLKKSKQM  260

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKN  1040
             R  +R +SL+D   IK A   T+NDV LGV+QA LS YL RR+G++D+     ++++P  
Sbjct  261   RLVHRTVSLDDIKLIKNAMKMTVNDVVLGVSQAGLSQYLKRRFGEQDVS----KSDMPNG  316

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +RLR  L  N+RP  GIQ +ADMM        + SK  WGN  GY I P  I + +DPL+
Sbjct  317   IRLRGALLVNIRPTSGIQEIADMMA-------TGSKCRWGNWIGYIIFPFSIALCDDPLE  369

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             ++R AK+  DRKK S E + T+ +   ++K  G +  A + N+  SN +  FSN+VGP E
Sbjct  370   HLRRAKSIIDRKKNSLEAVLTFVVGKILLKLLGVQRTAHVINRALSNTTMSFSNLVGPIE  429

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F+GH + ++AP+ YG P AL +HFQSY++KM + ++VD  VI DP+ L DD E+SL 
Sbjct  430   EISFYGHTVTYMAPSVYGHPHALTMHFQSYMNKMTISLAVDPTVISDPHTLCDDLEESLR  489

Query  1581  LIK  1589
              IK
Sbjct  490   SIK  492



>ref|NP_197139.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 dbj|BAB09602.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42125.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04136.1| unknown protein [Arabidopsis thaliana]
 gb|AED92282.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=488

 Score =   386 bits (991),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 213/486 (44%), Positives = 293/486 (60%), Gaps = 31/486 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  +L  +  +GF +KINP V    +   + KHPRF+S +     EN
Sbjct  6     EEPLSPMARVFQSPDIDLCAIINIGFKTKINPDVVLDALKQNVYKHPRFSSKL----SEN  61

Query  351   GKMKWVETEVDLSQHITV-VEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
             G+ KW+ETEV++  H+ V    PE   EG ++      FV+DY+  L+   +D SRPLWD
Sbjct  62    GE-KWIETEVNVEDHVIVPYIDPEDICEGGQS------FVDDYISRLTLIPLDRSRPLWD  114

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------STRS  686
             +HILN+KT  AEA+ V+R +HAL DG S  SL+LACT +T+NP +L T        ST S
Sbjct  115   IHILNVKTSYAEAVGVIRFNHALADGMSFISLVLACTHKTSNPDMLSTAIPSVKRRSTVS  174

Query  687   SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
              S  KT           +  +L+WNTLVD+F+  AT+ FLKD++TP+       S PK F
Sbjct  175   HSLKKTGWFLTAIFTIGSTMRLIWNTLVDMFLLFATMLFLKDTKTPLKGGANVRSNPKTF  234

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG-----QNNL  1031
              +R +SL+D   IK A N TINDV LG+TQAALS YLNRRY   +    +G      NNL
Sbjct  235   YHRNISLDDIKLIKNAMNMTINDVLLGITQAALSSYLNRRYEHENNNEEDGVLTSYTNNL  294

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
             P  +R R+    NLR   G + LA+MM K+       SK  WGN F + ILPL I +  D
Sbjct  295   PDRIRFRAGCTVNLRSDIGFKPLAEMMVKD-------SKCRWGNYFSFIILPLSISLETD  347

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PL Y+ ++KA   R K+SY+   TY+L    +K  G KA   L N+   N +TC SNV+G
Sbjct  348   PLVYLNKSKAMMARTKHSYQAALTYFLIKISLKVLGAKATTSLFNQHLMNITTCVSNVMG  407

Query  1392  PREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEK  1571
             P E++ F GHP+A+I+P+ YG   AL++H+ SY  +M + I+VD  VIPDP+++ DD E+
Sbjct  408   PMEEISFNGHPVAYISPSSYGHSHALLIHYTSYAGEMTITITVDPTVIPDPHKICDDMEE  467

Query  1572  SLHLIK  1589
             SL  +K
Sbjct  468   SLKTMK  473



>ref|XP_010494561.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=492

 Score =   386 bits (991),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 210/487 (43%), Positives = 293/487 (60%), Gaps = 31/487 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +RL   P   +  +  +GF SK+NP V  H + H + KHPRF S +     EN
Sbjct  14    EEPLSPMARLFQSPDTGMCNIINIGFKSKMNPDVVLHALRHNVYKHPRFCSKL----SEN  69

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V   P ++ E  E     + FV+DY+  L+   +D SRPLWD+
Sbjct  70    GA-KWIETEVNVEDHVIV---PSIDPE--EICDGGQSFVDDYISRLTMIPLDRSRPLWDI  123

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------STRSS  689
             HILN+KT DA+A+ ++R +HALGDG S  SL+LACT +T+NP +LPT        ST S 
Sbjct  124   HILNVKTLDAKAVGIIRFNHALGDGMSFFSLVLACTHKTSNPDMLPTAIPSVKRRSTVSH  183

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
                K            +  +L+WNT+VD+F+  AT+FFLKD++TP+       S PKR  
Sbjct  184   RLKKNDWFLRAIFTIGSTLRLIWNTIVDMFLLFATMFFLKDTETPLKGRANVRSNPKRCY  243

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ-------NN  1028
             +R +SL+D   IK A N TINDV LG+TQAALS Y+NR+Y ++D  + E         N+
Sbjct  244   HRNISLDDIKLIKNAMNMTINDVLLGITQAALSSYINRQYEQQDKNNEEDGALLTSYPNS  303

Query  1029  LPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLN  1208
             LP  +R R+    NLRP  G + LA+MM K+       SK  WGN F + +LPL I +  
Sbjct  304   LPDGIRFRAGCTVNLRPDIGFKPLAEMMVKD-------SKCRWGNYFSFIVLPLSIRLET  356

Query  1209  DPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVV  1388
             DPL +++++KA   RKK+SY     YYL    +K FG K  + L N    N + C SNV+
Sbjct  357   DPLVHLKKSKAMLARKKHSYHAALAYYLVKIGLKVFGAKVVSSLVNLHGMNITACVSNVM  416

Query  1389  GPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFE  1568
             GP E++ F GHPIA+I+P  YG P AL + + SY  +M + I+VD  +IPDP+ + DD E
Sbjct  417   GPTEEISFHGHPIAYISPISYGHPYALFIIYTSYAGEMTITITVDPTIIPDPHTICDDME  476

Query  1569  KSLHLIK  1589
             +SL  +K
Sbjct  477   ESLKTMK  483



>ref|XP_010537087.1| PREDICTED: O-acyltransferase WSD1-like [Tarenaya hassleriana]
Length=481

 Score =   385 bits (989),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 204/480 (43%), Positives = 296/480 (62%), Gaps = 20/480 (4%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             +EP+SP +RLLH P  +  I++++G  + IN  V  + +  T++KHPRF+S +    E  
Sbjct  2     DEPLSPVARLLHAPGMDCCIISVVGCKTNINTEVIINGLKETIVKHPRFSSKLEDGCERR  61

Query  351   GKM-KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
             GK  +W+ T V++  H+TV   P+++    E     ++F+EDYV +L+   +D SRPLWD
Sbjct  62    GKEPRWIPTNVNVEDHVTV---PDID---PERIPNPEQFIEDYVAQLTTIPLDTSRPLWD  115

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIST---RSSSpp  698
             +HILNLKT +AEA  ++R HH+LGDG S+ SL+LA TR+T++P+ LP +     R     
Sbjct  116   IHILNLKTSEAEAFGIVRSHHSLGDGMSLMSLILAFTRKTSDPEALPRVPVLKRRPPPDR  175

Query  699   ktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRI  878
                   +      +  +LVWNT+ DVF+F+AT +FL D++T +     +    K+FA+RI
Sbjct  176   NKNWFLSLALSVWSGIRLVWNTVEDVFLFLATAWFLTDTETSLKGGADTARNLKKFAHRI  235

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNN---LPKNLRL  1049
             ++++D   IK A   TINDV LGVTQAA+S YLNR Y K++        N   LP   RL
Sbjct  236   VAMDDIILIKNAMKMTINDVLLGVTQAAVSSYLNRLYDKKNEEVRVSAGNSKILPGKTRL  295

Query  1050  RSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVR  1229
             R+ +  NLRP  GIQ LADMM K        SK  WGN   Y +LPL I + N PLD++ 
Sbjct  296   RASVLVNLRPETGIQPLADMMAKG-------SKCRWGNYISYILLPLSISLQNTPLDHLL  348

Query  1230  EAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLE  1409
             +AK+  DRKK S +    Y   +F I   G K  + LT+++ SN +   SN+VGP E++ 
Sbjct  349   KAKSAMDRKKNSLQASLMYSSIDFFIHVLGFKVVSALTHRVVSNTTMSISNIVGPVEEIS  408

Query  1410  FFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             F+GHPI F AP+ YG P AL +HFQSY +KM + I+VD  V+PDP++L D+  ++L+ IK
Sbjct  409   FYGHPIEFFAPSVYGHPQALTIHFQSYANKMIISIAVDPTVVPDPHELCDEMMEALNTIK  468



>gb|KFK34210.1| hypothetical protein AALP_AA5G115100 [Arabis alpina]
Length=513

 Score =   385 bits (990),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 209/489 (43%), Positives = 299/489 (61%), Gaps = 29/489 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             ++P+SP++R+ H P FN +++ ++G   KI P V    +  TL++HPRF+S +V +  ++
Sbjct  25    DQPLSPAARVFHAPEFNCYVITVIGIKRKIEPDVIIEGLNQTLVRHPRFSSKLVNNGSKD  84

Query  351   GK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
              +  +WV T V +  HI V   P +E +  E       F+E YV  L+   +D S+PLW+
Sbjct  85    RQTQRWVRTNVVVEDHIIV---PNIEPQNKE---NADAFLESYVSNLTTVSLDTSKPLWE  138

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LH+L+L+T DAE +AVL+ HH+LGDG S+ +L+LAC R+T+NP  LPT+  ++ S  ++ 
Sbjct  139   LHLLDLETSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPDELPTLPYQNRSSSRSS  198

Query  708   kpnnpkpkpknffklV---W-------NTLVDVFIFIATLFFLKDSQTPITPS-PASESK  854
             + +        F  LV   W       NT+ D   FIAT  F KD++TPI       +SK
Sbjct  199   RLSAGSRGDSRFLWLVMVLWSAIGLVLNTVCDALEFIATAMFFKDTETPIKGDFRLRKSK  258

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIG----SIEGQ  1022
                  +R +SL+D   IK     T+NDV LGVTQA LS YL RRY ++  G    S    
Sbjct  259   RMCLVHRTVSLDDIKLIKSTMKMTVNDVVLGVTQAGLSQYLKRRYEEKKKGGEEESKRNL  318

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
             N +PK +RLRS L  NLRP  GIQ LADMM K+       SK  WGN  GY + P  IG+
Sbjct  319   NVMPKRIRLRSALLVNLRPTTGIQDLADMMAKK-------SKCRWGNWIGYIVFPFSIGL  371

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
               DPL+++R AK+  DRKK S+E   T+ L  F++  FG + AA + N+  SN +  FSN
Sbjct  372   RVDPLEHLRRAKSIIDRKKNSFEAALTFILGKFIVNSFGVQVAANIINRALSNTTMSFSN  431

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             ++GP E++ F+GHPI +IAP+ YG P AL +HFQSY+DKM + ++VD  VI DP++L DD
Sbjct  432   LIGPIEEISFYGHPITYIAPSVYGHPHALTMHFQSYMDKMTISLTVDPTVISDPHRLCDD  491

Query  1563  FEKSLHLIK  1589
             +E+SL  IK
Sbjct  492   WEESLRTIK  500



>ref|XP_009151870.1| PREDICTED: O-acyltransferase WSD1 [Brassica rapa]
Length=494

 Score =   385 bits (988),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/477 (42%), Positives = 301/477 (63%), Gaps = 23/477 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMV-VDKEEN  350
             +P+SP++RL H P FN +I++++G  SKI P V    +  TL++HPRF+  +V     + 
Sbjct  26    QPLSPAARLFHAPEFNCNIISVVGLKSKIKPAVIIDGIKQTLIRHPRFSCKLVESGNNQR  85

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              + KWV+T+V    H+ +   P++++   E    +  F++ YV +L+   +D S+PLW++
Sbjct  86    REQKWVQTKVVAEDHVVI---PKIDMHNIENANADA-FLDSYVSDLTTIPLDTSKPLWEV  141

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+L+L+T DAE +A+L++HH++GDG S+ SL+LACTR+T+NP  LP++  + SS   +  
Sbjct  142   HLLDLRTSDAENVAILKIHHSVGDGMSLMSLVLACTRKTSNPDELPSLPNQKSSLSGSRS  201

Query  711   pnnp---kpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKPKRFAYRI  878
              +          +   LV NT+ D   FIAT  FLKD++TPI  +   S SK     +R 
Sbjct  202   YSRLFWLVMALWSVAMLVLNTVCDALEFIATAMFLKDTETPIKGNFRLSTSKRMCCVHRT  261

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSC  1058
             +S +D   IK A   T+NDV LGV+QA LS YL RRYG       E +  +PK +RLR+ 
Sbjct  262   VSFDDLKLIKNAMQMTVNDVILGVSQAGLSQYLKRRYG-------EQEEPMPKGIRLRAA  314

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
             L  N+RPA GIQ LAD+M  E G     S   WGN  GY I P  I + +DPL+++R AK
Sbjct  315   LLVNIRPATGIQDLADIM--ENG-----SNCTWGNWIGYIIFPFSISLCDDPLEHLRRAK  367

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
                DRKK S+E + T+ + NF++K FG + AA +  +  SN +  FSN+VGP E++ F+G
Sbjct  368   FIIDRKKNSFEALLTFIVGNFILKSFGVQRAANILKRALSNTTMSFSNMVGPIEEISFYG  427

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             HP+ ++AP+ YG P AL +HFQSY++KM V ++VD  VI DP++L DD+E+SL  IK
Sbjct  428   HPVTYMAPSVYGHPHALTMHFQSYMNKMTVSLTVDPTVISDPHRLCDDWEESLRSIK  484



>ref|XP_002877656.1| hypothetical protein ARALYDRAFT_906195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53915.1| hypothetical protein ARALYDRAFT_906195 [Arabidopsis lyrata subsp. 
lyrata]
Length=503

 Score =   385 bits (988),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 297/483 (61%), Gaps = 26/483 (5%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP++RL H P FN +I++++G   KI P V    +  TL++HPRF+S +V +++E  
Sbjct  26    QPLSPAARLFHAPEFNCYIISVVGLKKKIQPDVIIEGIKQTLIRHPRFSSKLVNNRKEQ-  84

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               KWV T V +  H+ +   P++E +  +    +  F+E YV +L+   +D S+PLW++H
Sbjct  85    --KWVRTNVVVEDHVII---PKIETKIIKNANADA-FLESYVSDLTTIPLDTSKPLWEVH  138

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +L+LKT DAE + VLR+HH+LGDG S+ SL+LACTR+T+NP  LP++  ++     +   
Sbjct  139   LLDLKTSDAENVVVLRVHHSLGDGMSMMSLVLACTRKTSNPNELPSLPYQNRPSSGSSSL  198

Query  714   nnp----------kpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKPK  860
                                   LV NT+ D   FIAT  FLKD++TPI  +   S  K  
Sbjct  199   KTSSRYYSRFFWLVTVLWTATMLVLNTVCDALEFIATTLFLKDTETPIKGNFGLSTRKRM  258

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKN  1040
                +R +SL+D   IK A   T+NDV LGV+QA LS YL RRYG+++  S    +N+ K 
Sbjct  259   CMVHRTVSLDDIKLIKKAMKMTVNDVVLGVSQAGLSQYLKRRYGEQE-ESKRNSSNILKG  317

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +RLR  L  N+RP  GIQ LADMM K        SK  WGN  GY + P  I + +DPL+
Sbjct  318   IRLRGALLVNIRPTTGIQDLADMMAKG-------SKCRWGNWIGYIVFPFSIALCDDPLE  370

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             ++R AK+T DRKK S E + T+ +   ++K  G + AA + N+  SN +  FSN+VGP E
Sbjct  371   HLRRAKSTIDRKKNSLEAVLTFVVGKILLKSLGVQRAAYVLNRALSNTTMSFSNLVGPIE  430

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F+GH + ++AP+ YG P AL +HFQSY++K+ + ++VD  VI DP++L DD+E+SL 
Sbjct  431   EISFYGHTVTYMAPSVYGHPHALTMHFQSYMNKLTISLTVDPTVISDPHKLCDDWEESLR  490

Query  1581  LIK  1589
              IK
Sbjct  491   SIK  493



>ref|XP_010441804.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=492

 Score =   384 bits (986),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 210/487 (43%), Positives = 291/487 (60%), Gaps = 31/487 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEPVSP +RL   P   +  +  +GFNSK+NP V  H + H + KHPRF S +     EN
Sbjct  14    EEPVSPMARLFQSPDTGICNIINIGFNSKMNPDVVLHALRHNVHKHPRFCSKL----SEN  69

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V   P ++ E  E     + FV+DY+  L+   +D SRPLWD+
Sbjct  70    GA-KWIETEVNVEDHVIV---PSIDPE--EICDGGQSFVDDYISRLTMIPLDRSRPLWDI  123

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------STRSS  689
             HILN+KT DA+A+ ++R +HALGDG S  SL+LACT +T+NP +LPT+       ST S 
Sbjct  124   HILNVKTLDAKAVGIIRFNHALGDGMSFFSLVLACTHKTSNPDMLPTVIPSVKRRSTVSH  183

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
                K            +  +L+WNT+VD+F+  AT+FFLKD++TP+       S PKR  
Sbjct  184   RLEKNDWFLWAIFTIGSTLRLIWNTVVDMFLLFATMFFLKDTETPLKGGANVRSNPKRCY  243

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ-------NN  1028
             +R +SL+D   IK A N TINDV LG+TQAALS Y+NR+Y ++D  + E         N+
Sbjct  244   HRNISLDDIKLIKNAMNMTINDVLLGITQAALSSYMNRQYEQQDKNNEEDGALLTSYPNS  303

Query  1029  LPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLN  1208
             LP  +R R+    NLRP  G + LA+MM K+       SK  WGN F   +LPL I + N
Sbjct  304   LPDGIRFRAGCTVNLRPDIGFKPLAEMMVKD-------SKCRWGNYFSLIVLPLSIRLEN  356

Query  1209  DPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVV  1388
             DPL ++++ KA   RKK+SY     YY     +K FG K  + L N    N + C SNV+
Sbjct  357   DPLVHLKKTKAMLARKKHSYHAALAYYFIKICLKVFGAKVVSSLYNLHAMNTTACVSNVM  416

Query  1389  GPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFE  1568
             GP E++ F GHPI +I+P  YG   AL + + SY  +M + I+VD  +IPDP+ + DD E
Sbjct  417   GPTEEISFHGHPITYISPISYGHQYALFIIYTSYAGEMTITITVDPTIIPDPHTICDDME  476

Query  1569  KSLHLIK  1589
             +SL  +K
Sbjct  477   ESLKTMK  483



>ref|XP_006401714.1| hypothetical protein EUTSA_v10015406mg [Eutrema salsugineum]
 gb|ESQ43167.1| hypothetical protein EUTSA_v10015406mg [Eutrema salsugineum]
Length=472

 Score =   382 bits (982),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 205/474 (43%), Positives = 292/474 (62%), Gaps = 25/474 (5%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP +R+   P  +  I+  +GF +KIN  V   ++ H + KHPRF+S +     +NG 
Sbjct  10    PLSPMARVFQSPGIDNCIVITIGFKAKINVEVILDDLKHNVSKHPRFSSKL----SDNGA  65

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              +W++T+V++  H   V AP V++E  E       FV+DY+  L+   +D SRPLWD+HI
Sbjct  66    -RWIKTKVNVEDH---VFAPNVDLE--EIGEDGDDFVDDYISRLTVVPLDRSRPLWDIHI  119

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpn  716
             LN+KT DAEA+ V+R HH+LGDG S+ SLLLA TR+T+N +  PT++T  SS  + +  +
Sbjct  120   LNVKTSDAEAVTVIRSHHSLGDGMSLMSLLLASTRKTSNLEEFPTMTT--SSKRRKMVFH  177

Query  717   npkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLNDF  896
                       K++WNT+ D F+   T+ FLKD++TP+       S  KRF++RI+SL+D 
Sbjct  178   GLILTIFYASKMIWNTIADFFLLFVTILFLKDTETPLK---GGVSIQKRFSHRIISLDDL  234

Query  897   FSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI---GSIEGQNNLPKNLRLRSCLFF  1067
               IK A + TINDV LGVTQAALS YLNR YGK+++    S   +NNLP  LR R+ +  
Sbjct  235   KLIKNAMDMTINDVLLGVTQAALSGYLNRLYGKQNVENGASTSNRNNLPSKLRFRAGVAV  294

Query  1068  NLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATA  1247
             NLRP  G + +ADMM K        SK  WGN   + + P+ IG+  D L Y+ +AK+T 
Sbjct  295   NLRPNIGFKPMADMMAKG-------SKCRWGNYISFIVFPMSIGLETDALVYISKAKSTM  347

Query  1248  DRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPI  1427
             DRKK+S+     Y +  FV K FG K  A L  +   + +   SN+VGP E++ F G+PI
Sbjct  348   DRKKHSFHSALVYIVTGFVFKTFGAKVGAALFKRPVLHTTASISNIVGPMEEISFHGYPI  407

Query  1428  AFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             A+IAP+ YG    L++HF SY  KM + I VD  VIPDP++L D+ E+SL  +K
Sbjct  408   AYIAPSSYGHSQPLVIHFLSYAKKMVISIGVDPTVIPDPHKLFDEMEESLQAMK  461



>ref|XP_010492001.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=480

 Score =   382 bits (981),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 293/485 (60%), Gaps = 31/485 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  +   + IMGF +KINP V    + H +  H RF+S +     +N
Sbjct  6     EEPLSPMARIFQSPGIDYCAVTIMGFKTKINPDVVLDALRHNVYNHSRFSSKL----SDN  61

Query  351   GKMKWVETEVDLSQHITV--VEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             G  KW+ETEV++  H+ V  ++  E+  +G+        FV+DY+  L+   +D SRPLW
Sbjct  62    GA-KWIETEVNVEDHVVVPYIDPKEIGEDGES-------FVDDYISHLTMIPLDRSRPLW  113

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKL----LPTISTRSS-  689
             D+HIL +KT DAEA+ V+R HH+LGDG S+ SLL ACT +T++P      +P +  R   
Sbjct  114   DIHILKVKTTDAEAVGVIRSHHSLGDGMSLCSLLRACTHKTSDPSTSSTAVPPVKRRGEV  173

Query  690   --SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKR  863
               S  K            +   L+WNT+VD+F+  AT+ FLKD++TP+     + S PKR
Sbjct  174   LHSLRKKGWFLITIFTIGSTMTLIWNTIVDMFLLFATILFLKDTKTPLKGGENAMSNPKR  233

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQ-NNLP  1034
             F +RI+SL+D   IK A N TIND  LG+TQA+LS Y+N  Y K++   G++    NNLP
Sbjct  234   FYHRIISLDDIKLIKDAMNMTINDALLGITQASLSHYVNGHYVKKNTEDGALTSHTNNLP  293

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
               +R R     NLR   G + LADMM K+       SK  WGN F +  LP  I +  DP
Sbjct  294   DGMRFRVACTVNLRSDIGFKPLADMMVKD-------SKCKWGNYFSFIFLPFSISLQKDP  346

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             L Y+++++AT  RKK+SY     Y++   V+K FG K AA L ++   N +TC SNV+GP
Sbjct  347   LVYLKKSQATMARKKHSYHANLVYFIIKIVLKVFGAKVAAELFDRPVRNTTTCVSNVIGP  406

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F GHPIA+IAP+ YG   AL+VHF SY +KM + ++VD  VI DP+++ D+ EKS
Sbjct  407   MEEISFRGHPIAYIAPSSYGHSHALLVHFISYAEKMIISMAVDSTVIHDPHKICDEMEKS  466

Query  1575  LHLIK  1589
             +  +K
Sbjct  467   MKAMK  471



>ref|XP_002871716.1| hypothetical protein ARALYDRAFT_488487 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47975.1| hypothetical protein ARALYDRAFT_488487 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   382 bits (981),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 207/485 (43%), Positives = 292/485 (60%), Gaps = 34/485 (7%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  +L  L  +GF +KINP V    +   + KHP         + EN
Sbjct  6     EEPLSPMARVFQSPGIDLCALINIGFKTKINPDVVLDALKQNVYKHP---------QSEN  56

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G+ KW+ET+V++  H+ V   P ++ E  E     + FV+DY+  L+   +D SRPLWD+
Sbjct  57    GE-KWIETKVNVEDHVIV---PYIDPE--EICEIGQSFVDDYISRLTLIPLDRSRPLWDI  110

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------STRSS  689
             HILN+KT DAEA+ V+R +HAL DG S  SL+LACT +T+NP +L T        ST S 
Sbjct  111   HILNVKTSDAEAVGVIRFNHALADGMSFISLVLACTNKTSNPDMLSTAIPSVKRRSTVSH  170

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S  K            +  +L+WNTLVD+F+  AT+ FLKD++TP+       S PK+F 
Sbjct  171   SLEKNGWFLRAIFTIGSTVRLIWNTLVDMFLLFATVLFLKDTKTPLKGGANVRSNPKKFY  230

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ-----NNLP  1034
             +R +SL+D   IK   N TINDV LG+TQAALS YLNR+Y +      +G      NNLP
Sbjct  231   HRNISLDDIKLIKNVMNMTINDVLLGITQAALSSYLNRQYEQAKNSEEDGALTSYPNNLP  290

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
               +R R+    NLR   G + LA+MM K+       SK  WGN F + ILPL IG+  DP
Sbjct  291   VGIRFRAGCTVNLRSDIGFKPLAEMMVKD-------SKCRWGNYFSFIILPLSIGLETDP  343

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             + Y++++KA   RKK+SY+   TY+L    +K  G KA   L N+   N +TC SNV+GP
Sbjct  344   MVYLKKSKAMMARKKHSYQAALTYFLIKISLKVLGAKATTSLFNQHLMNITTCVSNVMGP  403

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F GHP+A+I P+ YG   AL++H+ SY +++ + I+VD  VIPDP+++ DD E+S
Sbjct  404   MEEISFHGHPVAYIYPSSYGHSHALLIHYTSYAEELTITITVDPTVIPDPHKIFDDMEES  463

Query  1575  LHLIK  1589
             L  +K
Sbjct  464   LKTMK  468



>ref|XP_006287603.1| hypothetical protein CARUB_v10000814mg [Capsella rubella]
 gb|EOA20501.1| hypothetical protein CARUB_v10000814mg [Capsella rubella]
Length=492

 Score =   382 bits (981),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 207/485 (43%), Positives = 300/485 (62%), Gaps = 25/485 (5%)
 Frame = +3

Query  159   MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD  338
             M+  EEPVSP +R+   P  +L  + I+GF +KINP V    +   + KHPRF+S++   
Sbjct  16    MNQEEEPVSPMARVFQSPRIDLCAVTIVGFKTKINPDVVLDALKQNVSKHPRFSSIL---  72

Query  339   KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
               ENG  KW++TEV++  H+ V   P ++ E  E     + FV+DY+  L+   +D+S+P
Sbjct  73    -SENGA-KWIDTEVNVEDHVIV---PYIDPE--EIGEDGQSFVDDYMSRLTMIPLDISKP  125

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL----PTISTR-  683
             LWD+HILN+KT DAEA++ +R HH+LGDG S+ SL+LACT +T++P +L    P +  R 
Sbjct  126   LWDIHILNVKTSDAEAVSFIRSHHSLGDGMSLVSLILACTHKTSDPDMLSNAIPPMKRRP  185

Query  684   SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKR  863
               +  K            +  + +WNT+VD+ + +AT+ FLKD++TP+     + S P+R
Sbjct  186   KHNLTKKGCLLRSIITIGSTMRQIWNTIVDMLLLLATVLFLKDTKTPLKAGVDTRSNPRR  245

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNLP  1034
             F +RI+SL+D   IK A + TINDV  G+TQA+ S YLNRRY KR   D      +NNLP
Sbjct  246   FYHRIISLDDIKHIKNAMDMTINDVLFGMTQASFSRYLNRRYDKRNEEDGALTSHRNNLP  305

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
             + +R R     NLR   G + LADMM K+       SK  WGN F +  LP  IG+  DP
Sbjct  306   EGMRFRVACTVNLRSDIGFKPLADMMVKD-------SKCRWGNYFSFIFLPFSIGLRKDP  358

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             L +++ +K+   RKK+SY     Y++   V+K FG K AA L ++   N +TC SNV+GP
Sbjct  359   LVHLKLSKSMMARKKHSYHAALVYFIIKIVLKVFGAKVAAELFDRPVRNTTTCVSNVIGP  418

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F GHPIA+IAP+ YG   AL+VH  SY DKM + ++ D  VIPDP+++ DD E+S
Sbjct  419   MEEISFRGHPIAYIAPSSYGHSHALLVHLMSYADKMVISLAFDPTVIPDPHKICDDMEES  478

Query  1575  LHLIK  1589
             L+ +K
Sbjct  479   LNEMK  483



>ref|NP_568275.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 emb|CAC42903.1| putative protein [Arabidopsis thaliana]
 gb|AAL87279.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45124.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42150.1| unknown protein [Arabidopsis thaliana]
 gb|AED91807.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=480

 Score =   381 bits (979),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 299/483 (62%), Gaps = 27/483 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEPVSP +R+   P  +L  + IMGF +KINP V    +   + KHPRF+S++     +N
Sbjct  6     EEPVSPMARVFQSPGIDLCAVTIMGFKTKINPDVVLDALKQNVSKHPRFSSIL----SDN  61

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V   P ++ E  E     + F++DY+  L+   +D SRPLWD+
Sbjct  62    GA-KWIETEVNVEDHVIV---PYIDAE--EIGEGGQSFIDDYMSRLTMIPLDRSRPLWDI  115

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKL----LPTI---STRSS  689
             HILN+KT +AEA+  +R HH+LGDG S+ SL+LACT +T++P +    +P++   +T S 
Sbjct  116   HILNVKTSEAEAVGFIRSHHSLGDGMSLISLMLACTHKTSDPDMFSNAIPSMKRRATMSH  175

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S               +  +L+WNT +D+ + +AT+ FLKD++TP+       S PKRF 
Sbjct  176   SLKTKGWFLRSIFTIGSTMRLLWNTTIDMLLLLATVLFLKDTKTPLKAGADVRSNPKRFY  235

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG--KRDIGSIEG-QNNLPKN  1040
             +RI+SL+D   IK A N TINDV  G+TQA+LS YLNR+YG  K + G++   +NNLP  
Sbjct  236   HRIISLDDIKLIKNAMNMTINDVLFGITQASLSHYLNRQYGTKKEEDGALTSYRNNLPDG  295

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +R R     NLR   G + LADMM K+       SK  WGN F +  LP  IG+  DPL 
Sbjct  296   IRFRVACTVNLRSDIGFKPLADMMVKD-------SKCRWGNYFSFIFLPFTIGLQTDPLV  348

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             Y++ +K+   RKK+SY     Y++   V+K FG KAAA L ++   N +TC SNV+GP E
Sbjct  349   YLKMSKSMMARKKHSYHAALVYFIIKIVLKVFGAKAAAELFDRPVRNTTTCVSNVIGPME  408

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F GHP+++IAP+ YG   AL++H  SY DKM + ++ D  VI DP+++ DD E+SL 
Sbjct  409   EISFRGHPVSYIAPSSYGHSHALLIHLMSYADKMIISLAYDPTVISDPHKICDDMEESLK  468

Query  1581  LIK  1589
              +K
Sbjct  469   AMK  471



>ref|XP_002873570.1| hypothetical protein ARALYDRAFT_488089 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49829.1| hypothetical protein ARALYDRAFT_488089 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   381 bits (978),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 298/483 (62%), Gaps = 27/483 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  +L  + IMGF +KINP V    +   + KHPRF+S++     +N
Sbjct  6     EEPLSPMARVFQSPGIDLCAVTIMGFKTKINPDVVLDALKQNVSKHPRFSSIL----SDN  61

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW+ETEV++  H+ V   P ++ E  E     + F++DY+  L+   +D SRPLWD+
Sbjct  62    GA-KWIETEVNVEDHVIV---PYIDPE--EIGEGGQSFIDDYMSRLTMIPLDRSRPLWDI  115

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKL----LPTI---STRSS  689
             HILN+KT DAEA++ +R HH+LGDG S+ SL+LACT +T++P +    +P +   +T S 
Sbjct  116   HILNVKTSDAEAVSFIRSHHSLGDGMSLISLMLACTHKTSDPDMFSNAIPPMKRRATMSH  175

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S               +  +L+WNT +D+ + +AT+ FLKD++TP+       + PKRF 
Sbjct  176   SLKTKGWFLRSIFTIGSTMRLLWNTTIDMLLLLATVLFLKDTETPLKGGADVRNNPKRFY  235

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNLPKN  1040
             +RI+SL+D   IK A N TINDV LG+TQA+LS YLNR+Y K+   D      QNNLP  
Sbjct  236   HRIISLDDIKLIKNAMNMTINDVLLGITQASLSHYLNRQYDKKKEEDGALTSYQNNLPDG  295

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +R R     NLR   G + LADMM K+       SK  WGN F +  LP  IG+  DPL 
Sbjct  296   IRFRVACTVNLRSDIGFKPLADMMVKD-------SKCRWGNYFSFIFLPFTIGLQTDPLV  348

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             Y++ +K+   RKK+SY     Y++   V+K FG KAAA L ++   N +TC SNV+GP E
Sbjct  349   YLKMSKSMMARKKHSYHAALVYFIIKIVLKVFGSKAAAELFDRPVRNTTTCVSNVIGPME  408

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F GHP+++IAP+ YG   A+++H  SY DKM + ++ D  VIPDP+++ DD E+SL 
Sbjct  409   EISFRGHPVSYIAPSSYGHSHAMLIHLMSYADKMIISLAYDPTVIPDPHKICDDMEESLK  468

Query  1581  LIK  1589
              +K
Sbjct  469   AMK  471



>dbj|BAK02325.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   383 bits (984),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 207/497 (42%), Positives = 294/497 (59%), Gaps = 23/497 (5%)
 Frame = +3

Query  126   RKQKSGMENNNMSI-AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             R+ K G       +   EPVSP+ RL  E  FN +I+A++G  + ++       +  TL+
Sbjct  82    RESKEGAGEGGREVEGAEPVSPAGRLFREAHFNCYIVALLGLAAPVDVAAARAGLQATLV  141

Query  303   KHPRFTSLMVVD-KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYV  479
             +HPRF S+ V D  ++N K +WV T V+L  H+ + +        D       + +EDYV
Sbjct  142   RHPRFCSVQVSDDAKKNAKPRWVRTTVNLDDHVIIPDLDPAATSADP-----DRALEDYV  196

Query  480   YELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPK  659
               LS   MD SRPLWDLH+++  T +A A   +RMHH+LGDG S+ SLL ACTR  A+P 
Sbjct  197   SSLSTRPMDHSRPLWDLHVIDFPTSEAAAAVAIRMHHSLGDGVSLISLLTACTRSAADPT  256

Query  660   LLPTIS-------TRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQ  818
              LP +        + +++PP +           +   L WNTLVDV +F+AT +FL+DS 
Sbjct  257   RLPALRPPPPPRRSGAAAPPLSAGTLALAAWAWSLVALAWNTLVDVALFVATSWFLRDSP  316

Query  819   TPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR  998
             TP   SP  E + KRF    L L+D   +K A   T+NDV +GVT AALS Y  R+ G+ 
Sbjct  317   TPFLGSPGVEFRRKRFLNCTLDLDDVKLVKNAMKCTVNDVLVGVTSAALSRYYFRKTGET  376

Query  999   DIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYA  1178
                  + Q    KN+R+RS L  N+R   G+  LA MM   K   N++    WGN+ GY 
Sbjct  377   SNDKSKPQ----KNIRMRSALLVNIRKTPGLHTLAQMMDPSK--DNTVK---WGNQIGYI  427

Query  1179  ILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFS  1358
             +LP +I M +DPL+Y+R+ K TADRKK S E +FTY+  N V+K  G KAAA L   +F+
Sbjct  428   VLPFRIAMHDDPLEYIRQGKKTADRKKRSLEAVFTYWSGNLVVKLLGIKAAAALCYGMFT  487

Query  1359  NASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIP  1538
             N +  FS++ GP E ++F+GHPI +IA + YG P AL VHFQSY++ M ++++VD+   P
Sbjct  488   NTTMSFSSLPGPTEKVQFYGHPIVYIATSVYGHPHALTVHFQSYMNIMKLVLAVDDEQFP  547

Query  1539  DPNQLLDDFEKSLHLIK  1589
             D +QLLDDF +SL L++
Sbjct  548   DSHQLLDDFAESLRLVR  564



>emb|CDY60222.1| BnaA06g39110D [Brassica napus]
Length=493

 Score =   380 bits (975),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 294/488 (60%), Gaps = 38/488 (8%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             +EP++P++RL   P FN +I A++G  SKIN  VF   +  TLLKHPRF+S++V D  + 
Sbjct  19    DEPLTPTARLFTAPEFNCYITAVIGLKSKINRDVFIEGLEQTLLKHPRFSSILVNDSSQ-  77

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              + KWV T+V    H+ +   P++E+E          F+E YV +L+   +D S+PLW++
Sbjct  78    -EQKWVRTKVVAEDHVII---PKIELENANA----DAFLESYVSDLTTIPLDTSKPLWEV  129

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppkt  704
             H+L+LKT DA+ + VL++HH++GDG S+ SL+ ACTR+T+N + LP++    R SS    
Sbjct  130   HLLDLKTSDAQNVVVLKIHHSVGDGMSLMSLVHACTRKTSNHEELPSLPNENRLSSKSMA  189

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITP--SPA------SESKPK  860
                             VWNTL D   FIAT  FLKD+ TP TP  +P       S+SK  
Sbjct  190   GYSRLIWMVML-----VWNTLCDALKFIATTMFLKDTDTPSTPLDTPIKGDFRLSKSKRM  244

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQN-----  1025
                +R + L D   IK A   T+NDV LGV QAALS YL RRYG+++  + E ++     
Sbjct  245   CLVHRTVDLEDIKFIKNAMKMTVNDVLLGVAQAALSEYLERRYGEKEKKAGEHESKRNSS  304

Query  1026  NLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGML  1205
             N+ K +RLR+CL  N+RP  G   LA+MM K        SK  WGN  GY + PL + + 
Sbjct  305   NVLKEIRLRACLLVNIRPTTG--DLANMMAKG-------SKCKWGNWIGYMLFPLSLALH  355

Query  1206  NDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNV  1385
             +DPL+++R  K+   RKK S E + T+     +IK  G   AA LT++  SN +  FSN+
Sbjct  356   DDPLEHLRRVKSIIHRKKNSLEALLTFTSTKILIKMLGVVRAASLTSRTISNTTMSFSNL  415

Query  1386  VGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDF  1565
             VGP E++  +GHPI +IAP+ YG P AL +HFQSY++KM + ++VD   I DP+QL DD 
Sbjct  416   VGPTEEVSLYGHPITYIAPSAYGHPHALTMHFQSYMNKMTISLTVDPTAICDPHQLCDDL  475

Query  1566  EKSLHLIK  1589
             E+SL  IK
Sbjct  476   EESLRSIK  483



>ref|XP_002440221.1| hypothetical protein SORBIDRAFT_09g027970 [Sorghum bicolor]
 gb|EES18651.1| hypothetical protein SORBIDRAFT_09g027970 [Sorghum bicolor]
Length=554

 Score =   381 bits (979),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 210/487 (43%), Positives = 292/487 (60%), Gaps = 33/487 (7%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE--E  347
             EP+SP+ RL  E  FN +I+A++G  + ++       M  TL++HPRF+S+ V D +  +
Sbjct  66    EPMSPAGRLFREKHFNCYIVAVIGLGTAVDVAAARAGMEATLVRHPRFSSIQVKDDDARK  125

Query  348   NGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
             N K +WV T V+L  H+ V   P ++     T  K  + VEDY+  LS   MD SRPLW+
Sbjct  126   NAKPRWVRTTVNLDDHVIV---PYLDPAATST--KPDQAVEDYLSWLSTAPMDHSRPLWE  180

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppk  701
              H+LN  T +A A   +RMHH+LGDG S+ SLL+ACTR  A+P  LP +  + R + P  
Sbjct  181   FHVLNFPTSEATATVAIRMHHSLGDGVSLLSLLIACTRSAADPARLPELPPAPRRAGPVY  240

Query  702   tlkpnnpkpkpkn-------ffklVWNTLVDVFIFIATLFFLKDSQTP-ITPSPASESKP  857
                                 +  L W+TLVDV  F+AT +FL D +TP +  S   E + 
Sbjct  241   ARPRPPLSAGFVAFALWLWSYVVLAWHTLVDVVCFVATAWFLSDPRTPFMAASEGVEFRR  300

Query  858   KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK  1037
             KRF +R LSL+D   +K A   T+NDV +GVT A LS Y  R+          G NN  K
Sbjct  301   KRFVHRTLSLDDVKFVKNAMKCTVNDVLIGVTNAGLSRYYFRK--------TSGSNNEGK  352

Query  1038  ---NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLN  1208
                N+R+RS L  N+R A G+ AL +MM   K   N+ +K  WGN  GY ILP  I M +
Sbjct  353   KSQNIRVRSALLVNIRRAPGLHALTEMMASSK---NNGAK--WGNLIGYMILPFHIAMHD  407

Query  1209  DPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVV  1388
             DPL+Y+R+ K TA+RKK S E +FTY+  N ++K FG KAAA L   +F+N +  FS++V
Sbjct  408   DPLEYIRQGKRTAERKKASLEAVFTYWSGNLIVKLFGMKAAAALCYGMFTNTTLSFSSMV  467

Query  1389  GPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFE  1568
             GP E +EF+GHPI +IAP+ YG P AL VH+QSY + + ++++VD+   PD +QLLDDF 
Sbjct  468   GPAEKVEFYGHPIVYIAPSVYGHPHALTVHYQSYTNSIKLVLAVDDAQFPDSHQLLDDFA  527

Query  1569  KSLHLIK  1589
             +SL LI+
Sbjct  528   ESLRLIR  534



>gb|KEH39731.1| O-acyltransferase (WSD1-like) family protein [Medicago truncatula]
Length=439

 Score =   377 bits (968),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 271/423 (64%), Gaps = 20/423 (5%)
 Frame = +3

Query  342   EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPL  521
             ++  K +W ET +DL  HI V   P+++ + D   R    FVEDY+   +K  +D+S+PL
Sbjct  19    KKGRKTRWTETTIDLDNHIIV---PQIDSKIDFPDR----FVEDYISNFTKTPLDISKPL  71

Query  522   WDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR----SS  689
             W+LH+LN+KT +AE++ + R+HH+LGDG S+ SLL+A TR+T++P  LPT+ T      S
Sbjct  72    WELHLLNIKTSNAESIGIFRIHHSLGDGTSLISLLIAATRKTSDPNALPTVPTTRKRDDS  131

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             +        +         +L+WNT+VDV + + T+ F KD+ TP+  +   E   KRF 
Sbjct  132   NVHNCSIIVSFWLSILWGLRLIWNTIVDVLLLVLTILFFKDTHTPLKGAHGVELNTKRFV  191

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI--GSIEGQNNLPKNL  1043
             Y ++S++D   +K    TTINDV LG+TQA L+ YLNR YG ++   G+   ++ +PKN+
Sbjct  192   YLMVSMDDIKLVKAEMKTTINDVLLGLTQAGLARYLNREYGVKNANDGAAMSKSGIPKNI  251

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLR+ +  N+R + GIQ LADMM  EKG++       WGN+ GY I P  I +  DPL+Y
Sbjct  252   RLRASILVNIRASPGIQDLADMMA-EKGKAR------WGNKMGYIIFPFNIALQEDPLEY  304

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             VR+AKAT DRKK S E I +Y  A  V+  FG K A ++T ++  + +  FSNV GP E+
Sbjct  305   VRQAKATIDRKKQSLEAICSYACAKLVLNLFGVKIAGVITRRVLFHTTMAFSNVAGPVEE  364

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + F+GHP+AFIAP+ YG P AL +HFQSY ++M + ++VD  +IPDP  L DDFE+SL L
Sbjct  365   ISFYGHPVAFIAPSVYGHPHALTIHFQSYANQMTISMAVDPTIIPDPYLLCDDFEESLKL  424

Query  1584  IKD  1592
             I D
Sbjct  425   ICD  427



>ref|XP_010520978.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Tarenaya hassleriana]
Length=495

 Score =   378 bits (971),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 198/473 (42%), Positives = 287/473 (61%), Gaps = 22/473 (5%)
 Frame = +3

Query  180   VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKM  359
             VSP SRL   P  +  I+  +G   ++N       +  +L+ HPRF+S+  + +   GK 
Sbjct  25    VSPFSRLFQSPEVDSFIIVTLGCGIRLNSTTIIDGLKLSLINHPRFSSIPEMGRGNGGKP  84

Query  360   KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHIL  539
              WV+T+V++  H+ V   P++    D       +F+EDY+  L+   MDMS+PLW+LH+L
Sbjct  85    VWVQTKVNVEDHVFV---PDI----DPDMESPDQFLEDYISNLTTIPMDMSKPLWELHLL  137

Query  540   NLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpnn  719
              +K+  AE++ V ++HH+LGDG S+ SLLLACTR+T++P+ LP +S + +    +     
Sbjct  138   QVKSSVAESVGVFKIHHSLGDGMSLMSLLLACTRKTSDPEALPAVSAKKNHVGPSSFLGK  197

Query  720   p---kpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                         +LV+NT VD+ + I T+ FL+D++TPI     +E K +RF +RI+SL+
Sbjct  198   IWWLVAGSWWITRLVFNTCVDLVMTILTICFLRDTKTPIVG--GAEHKSRRFIHRIISLD  255

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFN  1070
             D   +K A   TINDV +GVTQA LS YL+RR+   D  +       PK +RLR  +F N
Sbjct  256   DVKIVKTAMKMTINDVLVGVTQAGLSRYLSRRH---DQETTSKSQQFPKRIRLRGAVFMN  312

Query  1071  LRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATAD  1250
             LRP  GI+ LADMM K        SK  WGN  GY ++P  +G   DPL++VR AK T +
Sbjct  313   LRPTTGIKDLADMMAKG-------SKCRWGNWIGYVLIPFTVGSEADPLEHVRRAKYTME  365

Query  1251  RKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIA  1430
             RKK S E +F+Y + +  +  FG KA   LT +IF   +  FSN+VGP E++ F+GHPI 
Sbjct  366   RKKLSLEAVFSYAILSLTMTAFGLKALEDLTRRIFERTTLTFSNMVGPEEEVSFYGHPIT  425

Query  1431  FIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +IAP+ +G P  L +HFQSY  KM +I++VD  VIPDP+QL DD  +SL L K
Sbjct  426   YIAPSAFGLPHGLTLHFQSYAKKMIIIVAVDPTVIPDPHQLCDDLVESLSLFK  478



>ref|XP_006852653.1| hypothetical protein AMTR_s00021p00243800 [Amborella trichopoda]
 gb|ERN14120.1| hypothetical protein AMTR_s00021p00243800 [Amborella trichopoda]
Length=473

 Score =   377 bits (968),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 196/476 (41%), Positives = 281/476 (59%), Gaps = 20/476 (4%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKI-NPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             +P+SP++RL  +P FN  IL ++G   K+ +       +  T+ +HPRF+S  +V ++ +
Sbjct  7     QPLSPAARLFKQPLFNCSILCMLGLGKKVTDIEAVMAGLERTMARHPRFSS--IVKEDSS  64

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKN-KKFVEDYVYELSKERMDMSRPLWD  527
             GK +WV T V +  HI       +    DE    N    ++ Y+ +LS   +DMS+PLW+
Sbjct  65    GKQQWVRTNVVMEDHI-------ITQPFDEDQEANGADLIDQYITKLSTTPLDMSKPLWE  117

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LHILNLKT +AEA A+ R+HH+LGDG S+ SLL+ACTR+T++P  LP++  R   P +  
Sbjct  118   LHILNLKTDEAEATAIFRIHHSLGDGISLMSLLMACTRKTSDPDSLPSVPQRKEKPLENR  177

Query  708   kpnnpkpkpk-nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                          F  +W TL+D+ +FI    FLKD+ TPI   P  E  PK+  +  LS
Sbjct  178   SGLLSILSRIWVIFLTIWYTLMDLLLFIPNTLFLKDTDTPIKGLPGVEKSPKKVVHLTLS  237

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY--GKRDIGSIEGQNNLPKNLRLRSC  1058
             L+D   +K   N T+NDV LG+T A L  YL RRY   K +      + + P+N+ +RS 
Sbjct  238   LDDMKKMKYHVNGTLNDVMLGITSAGLVKYLARRYELSKENHNGKTEKPSFPQNIHIRSS  297

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
             L  NLR A G+  LA+MMK +  ++       WGNR GY +  + +    DPL+Y REAK
Sbjct  298   LLVNLRSAPGLHELAEMMKDKSKKAR------WGNRMGYLVFKMPMLRHTDPLEYFREAK  351

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
             A  DRKK S+EP  TY++   V++ FG K+AA + +   SN +  FSNV+GP E++EF G
Sbjct  352   AIIDRKKMSFEPFITYFIGKLVVRLFGIKSAARMMHTALSNTTFSFSNVMGPTEEVEFLG  411

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
              PI FIAPT YG P AL +H+QSY +K+ ++I V E  IPDP  L  D   +L L+
Sbjct  412   LPIVFIAPTVYGHPHALTIHYQSYTNKVKLVICVAEETIPDPFNLCQDIADALKLM  467



>emb|CDX91162.1| BnaC02g04350D [Brassica napus]
Length=485

 Score =   377 bits (967),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 209/485 (43%), Positives = 299/485 (62%), Gaps = 29/485 (6%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             + E+P+SP +R+   P  +   + IMGF +K    V    + H + KHPRF++ +     
Sbjct  11    VEEQPLSPMARVFQSPEVDYCAVTIMGFKTKFCLDVLLDALKHNVSKHPRFSTKL----S  66

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             E+G  KW+ET+V++  H+TV   P ++ E  E     + FV+DY+  L+   +D SRPLW
Sbjct  67    EDGA-KWIETQVNVEDHVTV---PNIDPE--EIGEDGQSFVDDYISRLTTIPLDRSRPLW  120

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPK--LLPTISTRSS---  689
             D+HILN+KT DAEA+ V+R HH+LGDG S+ SL+LACT +T++P    +P++  R +   
Sbjct  121   DMHILNVKTSDAEAVGVIRSHHSLGDGMSLISLMLACTHKTSDPDNTAIPSLKRRQTVPH  180

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
                K            +  +L+WNT+VD+ + +AT+ FL+D++TP+         P RF 
Sbjct  181   GLIKQSWFLRFIFNVGSTTRLIWNTVVDMLLLLATILFLEDTKTPLKGGADVRRNPTRFY  240

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG-----QNNLP  1034
              R +SL+D   IK + N TINDV LGVTQAALS YLNR YGK++    EG     QN+LP
Sbjct  241   RRTISLDDIKLIKNSMNMTINDVLLGVTQAALSRYLNRLYGKKN--EEEGVLTSNQNHLP  298

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
               LR R+    NLR   G + LADMM K+       SK  WGN F + ILP  IG+  DP
Sbjct  299   SKLRFRAGCTVNLRSDIGFKPLADMMTKD-------SKCRWGNYFSFIILPFSIGLQTDP  351

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             L Y++ +K+T  RKK+SY     Y++   ++K FG KAAA + N+   N +TC SNV+GP
Sbjct  352   LVYLKISKSTMARKKHSYLAALVYFIIKLILKVFGAKAAAAIFNRPVVNLTTCVSNVIGP  411

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F GHPIA+IAP+ YGQ  AL+VH+ SY  KM + ++VD  VIPDP+++ DD E+S
Sbjct  412   MEEISFRGHPIAYIAPSNYGQSQALLVHYMSYAGKMIISMAVDPTVIPDPHKICDDMEES  471

Query  1575  LHLIK  1589
             L  +K
Sbjct  472   LKDMK  476



>ref|XP_010492529.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=494

 Score =   377 bits (968),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 206/492 (42%), Positives = 295/492 (60%), Gaps = 40/492 (8%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  ++  +  +GF +KINP V    + H + K+PRF+S +     EN
Sbjct  15    EEPLSPMARVFQSPDIDICPIVNIGFKTKINPDVVLDALRHNVYKYPRFSSKL----SEN  70

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW++TEV++  H+ V   P +++E  E     + FV+DY   L+   +D SRPLWD+
Sbjct  71    GA-KWIKTEVNVEDHVIV---PYIDLE--EICESGQSFVDDYCSRLTMTPLDRSRPLWDI  124

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL----PTISTRSS---  689
             HILN+KT DAEA+ V+R +HAL DG S  SL+LACT +T+NP +L    P +  R++   
Sbjct  125   HILNVKTADAEAVGVIRFNHALADGMSFISLVLACTHKTSNPDMLSTATPLVKRRTTVPH  184

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S  KT           +  +L+WNT+VDVF+  AT+ FLKD+ TP+  +      P+RF 
Sbjct  185   SLEKTGWFVRVIFTIGSTMRLLWNTIVDVFLLAATVLFLKDTMTPLKGNANVRRNPRRFY  244

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNN-------  1028
             +R +SL+D   IK A N TINDV LG+TQAALS Y+NR+Y    + S E   N       
Sbjct  245   HRTISLDDIKLIKNAMNMTINDVLLGITQAALSSYMNRQY----LVSQEQDKNDELEDGS  300

Query  1029  -----LPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
                  LP  +R R+    NLR   G + LA+MM K+       SK  WGN F + ILPL 
Sbjct  301   LLTSYLPDGIRFRAGCTVNLRSDIGFKPLAEMMVKD-------SKCRWGNYFSFLILPLS  353

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTC  1373
             IG+  DPL Y+ ++KA   RKK+SY+    Y+    ++K  G KAA++  N+   N +TC
Sbjct  354   IGLETDPLVYLEKSKAIMARKKHSYQAALAYFFIKIILKVLGAKAASLAFNQHLKNITTC  413

Query  1374  FSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQL  1553
              SNV+GP E++ F GHPIA+I+P+ YG   A ++H+ SY  ++ + I VD  VIPDP+++
Sbjct  414   VSNVMGPMEEISFRGHPIAYISPSSYGHSQASLIHYTSYAGEVTITIGVDPTVIPDPHKI  473

Query  1554  LDDFEKSLHLIK  1589
              DD EKSL  +K
Sbjct  474   CDDMEKSLKTMK  485



>ref|XP_010555728.1| PREDICTED: O-acyltransferase WSD1-like [Tarenaya hassleriana]
Length=476

 Score =   376 bits (965),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 200/479 (42%), Positives = 293/479 (61%), Gaps = 25/479 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP SRL H   FN+ +L  +G  +K         + HTL+KHPRF+S M +D  + 
Sbjct  6     EQPLSPFSRLFHSSDFNVTLLITLGCRTKCVVPAIIEGLKHTLIKHPRFSSKMEMDGGKR  65

Query  351   GKMKWVETEVDLSQHITVVEAPEVE--VEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             G   W  T+V +  H+ V   P+++  +EG +      +F+EDY+  L+   MDMSRPLW
Sbjct  66    GNPIWARTKVRVEDHVFV---PDIDPDMEGPD------QFLEDYISNLTTLPMDMSRPLW  116

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRS---SSp  695
             +LH+L +KT DAE++ V ++HH+LGDG S+ SL LAC R+T+NP+ LPT+   +      
Sbjct  117   ELHLLQVKTSDAESVGVFKIHHSLGDGMSLMSLFLACCRKTSNPQALPTVPVTNKLVGPS  176

Query  696   pktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASES-KPKRFAY  872
                 K            +L+ NT VDVF+F+ T+FFLKD++T I   P+ +    K F  
Sbjct  177   GFLGKIWWTVVGFWLLIRLILNTCVDVFMFVVTIFFLKDTKTLIKGKPSVQRHAAKTFVR  236

Query  873   RILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLR  1052
             +I+SL+D  ++K A N T+NDV LG+TQA LS YLNRRY   D  ++ G   + +  R+R
Sbjct  237   KIISLDDIKTVKNAMNMTVNDVLLGMTQAGLSRYLNRRY---DEETVPGSKKVLEKARIR  293

Query  1053  SCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVRE  1232
             S ++ NLRP   I+ LADMM K        S   WGN  G+ +LP  +   +DPL++VR 
Sbjct  294   STVYMNLRPNTRIEDLADMMAKG-------SNCRWGNWIGFVLLPFSMKPESDPLEHVRR  346

Query  1233  AKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEF  1412
             AKAT DRKK S+E + ++   + V++ FG KA   +  +I  N +  FS+V+GP E++ F
Sbjct  347   AKATIDRKKLSFEAMLSFASVDIVMRVFGFKAVETVVRRINGNTTMTFSSVLGPTEEISF  406

Query  1413  FGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
              GHPI++IAP+ YG   A+ +H+QSYVDKM + + +D  V+PDP+ L DD  +SL  IK
Sbjct  407   CGHPISYIAPSGYGHSHAITLHYQSYVDKMIISMGIDPTVVPDPHNLADDLAESLKAIK  465



>ref|XP_010231047.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Brachypodium 
distachyon]
Length=537

 Score =   377 bits (968),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 207/494 (42%), Positives = 290/494 (59%), Gaps = 22/494 (4%)
 Frame = +3

Query  129   KQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKH  308
             K +   E  +M   E+PVSP+ RL  E  FN +I+A++G  + ++       +  TL++H
Sbjct  52    KARQETETADM---EQPVSPAGRLFREAHFNCYIVALLGLGAPLDVEAARAGLLDTLVRH  108

Query  309   PRFTSLMVVDK-EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYE  485
             PRF+S+ V+D+  +N K +WV T V+L  H+   +        D       K +EDYV  
Sbjct  109   PRFSSVQVLDEANKNAKPRWVRTTVNLDDHVIFPDLDPAATSADP-----DKAMEDYVSS  163

Query  486   LSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL  665
             LS   MD SRPLW+ H+L+  T +A A   +RMHH+LGDG S+ SLL+ACTR  A+P  L
Sbjct  164   LSTRPMDHSRPLWEFHVLDFPTSEARAAVAIRMHHSLGDGVSLISLLMACTRSAADPARL  223

Query  666   PTISTRSSSppktlkpnnpkpkpknffklVW-----NTLVDVFIFIATLFFLKDSQTPIT  830
             P +  + + PP   +           +         NTLVDV  F+AT +FL+D +TP  
Sbjct  224   PALPAQPTPPPGPGRGLAAMLAAWAAWAWALLVLAWNTLVDVARFVATSWFLRDERTPFM  283

Query  831   PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS  1010
               P  E + KRF    LSL+D   +K A   T+NDV +GVT AALS Y  R+    D  S
Sbjct  284   GVPGVEFRRKRFLNCTLSLDDVKFVKNALKCTVNDVLIGVTSAALSRYYFRKTASTDDTS  343

Query  1011  IEGQNNLP-KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILP  1187
               G    P K++RLR+ L  N+R   G+  LA+MM   K   N+  KWG  N+ GY +LP
Sbjct  344   --GDRTKPQKDIRLRAALLVNIRKTPGLHTLAEMMDNSK---NNTVKWG--NQIGYIVLP  396

Query  1188  LKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAS  1367
               I M +DPL+Y+R  K TADRKK S E +FTY+  N V+K FG KAAA L   +F+N +
Sbjct  397   FHIVMHDDPLEYIRRGKRTADRKKRSLEAVFTYWSGNLVVKLFGIKAAAALCYGMFTNTT  456

Query  1368  TCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPN  1547
               FS++ GP E +EF+GHPI +IA + YG P AL VHFQSY + + ++++VD+   PD +
Sbjct  457   MSFSSLAGPAEKVEFYGHPIVYIATSVYGHPHALTVHFQSYSNIVKLVLAVDDEQFPDSH  516

Query  1548  QLLDDFEKSLHLIK  1589
             QLLDDF +SL L++
Sbjct  517   QLLDDFAESLRLVR  530



>ref|XP_009125863.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=486

 Score =   375 bits (963),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 208/482 (43%), Positives = 296/482 (61%), Gaps = 29/482 (6%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             +P+SP +R+   P  +   + IMGF +K  P V    + H + KHPRF++ +     E+G
Sbjct  15    QPLSPMARVFQSPEVDYCAVTIMGFKTKFCPDVLLDALKHNVSKHPRFSTKL----SEDG  70

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               KW+ET+V++  H+ V   P ++ E  E     + FV+DY+  L+   +D SRPLWD+H
Sbjct  71    A-KWIETQVNVEDHVIV---PNIDPE--EIGEDGQSFVDDYISRLTTIPLDRSRPLWDMH  124

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPK--LLPTISTRSS---Spp  698
             ILN+KT DAEA+ V+R HH+LGDG S+ SL+LACT +T++P    +P++  R +      
Sbjct  125   ILNVKTSDAEAVGVIRSHHSLGDGMSLISLMLACTHKTSDPDNTAIPSLKRRQTVPHGLI  184

Query  699   ktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRI  878
             K            +  +L+WNT+VD+ + +AT+ FL D++TP+         P RF  R 
Sbjct  185   KQSWFLRFIFTVGSTTRLIWNTVVDMLLLLATILFLVDTKTPLKGGADVGRNPTRFYRRT  244

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG-----QNNLPKNL  1043
             +SL+D   IK + N TINDV LGVTQAALS YLNR YGK++    EG     QN+LP  L
Sbjct  245   ISLDDIKLIKNSMNMTINDVLLGVTQAALSRYLNRLYGKKN--EEEGVLTSNQNHLPSKL  302

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             R R+    NLR   G + LADMM K+       SK  WGN F + ILP  IG+  DPL Y
Sbjct  303   RFRAGCTVNLRSDIGFKPLADMMTKD-------SKCRWGNYFSFIILPFSIGLQTDPLVY  355

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             ++ +K+T  RKK+SY     Y++   ++K FG KAAA + N+   N +TC SNV+GP E+
Sbjct  356   LKISKSTMARKKHSYHAALVYFIIKIILKVFGAKAAAAIFNRPVVNLTTCVSNVIGPMEE  415

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + F GHPIA+IAP+ YGQ  AL+VH+ SY  KM + ++VD  VIPDP+++ DD E+SL  
Sbjct  416   ISFRGHPIAYIAPSNYGQSQALLVHYMSYAGKMIISMAVDPTVIPDPHKICDDMEESLKD  475

Query  1584  IK  1589
             +K
Sbjct  476   MK  477



>emb|CDX85687.1| BnaA02g01260D [Brassica napus]
Length=485

 Score =   374 bits (961),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 207/485 (43%), Positives = 298/485 (61%), Gaps = 29/485 (6%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             + E+P+SP +R+   P  +   + IMGF +K  P V    +   + KHPRF++ +     
Sbjct  11    VEEQPLSPMARVFQSPEVDYCAVTIMGFKTKFCPDVLLDALKQNVSKHPRFSTKL----S  66

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             E+G  KW++T+V++  H+ V   P ++ E  E     + FV+DY+  L+   +D SRPLW
Sbjct  67    EDGA-KWIKTQVNVEDHVIV---PNIDPE--EIGEDGQSFVDDYISRLTTIPLDRSRPLW  120

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPK--LLPTISTRSS---  689
             D+HILN+KT DAEA+ V+R HH+LGDG S+ SL+LACT +T++P    +P++  R +   
Sbjct  121   DMHILNVKTSDAEAVGVIRSHHSLGDGMSLISLMLACTHKTSDPDNTAIPSLKRRQTVPH  180

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
                K            +  +L+WNT+VD+ + +AT+ FL+D++TP+         P RF 
Sbjct  181   GLIKQSWFLRFIFTVGSTTRLIWNTVVDMLLLLATILFLEDTKTPLKGGADVGMNPTRFY  240

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG-----QNNLP  1034
              R +SL+D   IK + N TINDV LGVTQAALS YLNR YGK++    EG     QN+LP
Sbjct  241   RRTISLDDIKLIKNSMNMTINDVLLGVTQAALSRYLNRLYGKKN--EEEGVLTSNQNHLP  298

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
               LR R+    NLR   G + LADMM K+       SK  WGN F + ILP  IG+  DP
Sbjct  299   SKLRFRAGCTVNLRSDIGFKPLADMMTKD-------SKCRWGNYFSFIILPFSIGLQTDP  351

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             L Y++ +K+T  RKK+SY     Y++   ++K FG KAAA + N+   N +TC SNV+GP
Sbjct  352   LVYLKISKSTMARKKHSYHAALVYFIIKIILKVFGAKAAAAIFNRPVVNLTTCVSNVIGP  411

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F GHPIA+IAP+ YGQ  AL+VH+ SY  KM + ++VD  VIPDP+++ DD E+S
Sbjct  412   MEEISFRGHPIAYIAPSNYGQSQALLVHYMSYAGKMIISMAVDPTVIPDPHKICDDMEES  471

Query  1575  LHLIK  1589
             L  +K
Sbjct  472   LKDMK  476



>emb|CDX86991.1| BnaC03g52610D [Brassica napus]
Length=488

 Score =   374 bits (961),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/481 (42%), Positives = 289/481 (60%), Gaps = 29/481 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             ++P++P++RL   P FN +I A++G  SKI   VF   +  TLLKHPRF+S++V +    
Sbjct  19    DQPLTPTARLFTAPEFNCYITAVIGLKSKIKRDVFIEGLEQTLLKHPRFSSILVRNNMYI  78

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              + KWV T+V    H+ +   P++E+E          F+E YV +L+   +D S+PLW++
Sbjct  79    QEQKWVRTKVVAEDHVII---PKIELENANA----DAFLESYVSDLTTIPLDTSKPLWEV  131

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppkt  704
             H+++LKT DA+ + VL++HH++GDG S+ SL+ ACTR+T+N + LP++    R SS    
Sbjct  132   HLVDLKTSDAQNVVVLKIHHSVGDGMSLMSLVHACTRKTSNHEELPSLPNENRLSSKSMA  191

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKPKRFAYRIL  881
                             VWNTL D   FIAT  FLKD+ TPI      S+SK     +R +
Sbjct  192   GYSRLIWMVML-----VWNTLCDALKFIATTMFLKDTDTPIKGDFRLSKSKRMCLVHRTV  246

Query  882   SLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQN-----NLPKNLR  1046
              L D   IK A   T+NDV LGV QAALS YL RRYG+++  + E ++     N+ K +R
Sbjct  247   DLEDIKLIKNAMKMTVNDVLLGVAQAALSEYLERRYGEKEKKAGEHESKRNSSNMLKEIR  306

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             LR+CL  N+RP  G   LA+MM K        SK  WGN  GY + PL + + +DPL+++
Sbjct  307   LRACLLVNIRPTTG--DLANMMAKG-------SKCKWGNWIGYMLFPLSLALHDDPLEHL  357

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R  K+   RKK S E + T+     +IK  G   AA LT++  SN +  FSN+VGP E++
Sbjct  358   RRVKSIIHRKKNSLEALLTFTSTKILIKMLGVVWAASLTSRTISNTTMSFSNLVGPTEEV  417

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
               +GHPI +IAP+ YG P AL +HFQSY++KM + ++VD   I DP+QL DD E+SL  I
Sbjct  418   SLYGHPITYIAPSAYGHPHALTMHFQSYMNKMTISLTVDPTAICDPHQLCDDLEESLRSI  477

Query  1587  K  1589
             K
Sbjct  478   K  478



>ref|XP_010520977.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Tarenaya hassleriana]
Length=498

 Score =   374 bits (961),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 198/476 (42%), Positives = 288/476 (61%), Gaps = 25/476 (5%)
 Frame = +3

Query  180   VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKM  359
             VSP SRL   P  +  I+  +G   ++N       +  +L+ HPRF+S+  + +   GK 
Sbjct  25    VSPFSRLFQSPEVDSFIIVTLGCGIRLNSTTIIDGLKLSLINHPRFSSIPEMGRGNGGKP  84

Query  360   KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHIL  539
              WV+T+V++  H+ V   P++    D       +F+EDY+  L+   MDMS+PLW+LH+L
Sbjct  85    VWVQTKVNVEDHVFV---PDI----DPDMESPDQFLEDYISNLTTIPMDMSKPLWELHLL  137

Query  540   NLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpnn  719
              +K+  AE++ V ++HH+LGDG S+ SLLLACTR+T++P+ LP +S + +    +     
Sbjct  138   QVKSSVAESVGVFKIHHSLGDGMSLMSLLLACTRKTSDPEALPAVSAKKNHVGPSSFLGK  197

Query  720   p---kpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
                         +LV+NT VD+ + I T+ FL+D++TPI     +E K +RF +RI+SL+
Sbjct  198   IWWLVAGSWWITRLVFNTCVDLVMTILTICFLRDTKTPIVG--GAEHKSRRFIHRIISLD  255

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFN  1070
             D   +K A   TINDV +GVTQA LS YL+RR+   D  +       PK +RLR  +F N
Sbjct  256   DVKIVKTAMKMTINDVLVGVTQAGLSRYLSRRH---DQETTSKSQQFPKRIRLRGAVFMN  312

Query  1071  LRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATAD  1250
             LRP  GI+ LADMM K        SK  WGN  GY ++P  +G   DPL++VR AK T +
Sbjct  313   LRPTTGIKDLADMMAKG-------SKCRWGNWIGYVLIPFTVGSEADPLEHVRRAKYTME  365

Query  1251  RKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIA  1430
             RKK S E +F+Y + +  +  FG KA   LT +IF   +  FSN+VGP E++ F+GHPI 
Sbjct  366   RKKLSLEAVFSYAILSLTMTAFGLKALEDLTRRIFERTTLTFSNMVGPEEEVSFYGHPIT  425

Query  1431  FIAPTCYGQP---SALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +IAP+ +G P   + L +HFQSY  KM +I++VD  VIPDP+QL DD  +SL L K
Sbjct  426   YIAPSAFGLPHVRTGLTLHFQSYAKKMIIIVAVDPTVIPDPHQLCDDLVESLSLFK  481



>ref|XP_010315460.1| PREDICTED: LOW QUALITY PROTEIN: O-acyltransferase WSD1 [Solanum 
lycopersicum]
Length=527

 Score =   375 bits (963),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 217/521 (42%), Positives = 304/521 (58%), Gaps = 50/521 (10%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             LKPI T K+    +    ++    +SP SR+ HEP FN+HI+AIMG+   ++       +
Sbjct  10    LKPIRTSKKFDDDDEEEEAVL---LSPGSRMFHEPNFNIHIVAIMGWKIPLDIDSLKAQL  66

Query  288   PHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFV  467
                LLKHPRF+SL V+D  E+G+M+W+ T V++  H+ V   P+++V  +       K V
Sbjct  67    LSKLLKHPRFSSLQVMD--ESGEMRWIPTIVNVDDHVIV---PQLDVTNN---MDTDKLV  118

Query  468   EDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQT  647
             E Y+  LS   +D+S+PLWD HILN+KT  AEA +V R HH+LGDG ++ SLLL+C+R+ 
Sbjct  119   EQYISNLSTTNIDISKPLWDYHILNVKTSHAEATSVFRFHHSLGDGIALMSLLLSCSRKP  178

Query  648   ANPKLLPTI---------STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLF  800
             ++P  LPT+         S  S+             K   F +L++NT+VDV +F AT  
Sbjct  179   SDPTSLPTLPVSYSKEKKSNSSNRTNIRSLLWQYMVKLWLFIRLLFNTVVDVLLFGATAL  238

Query  801   FLKDSQTPITPSPA---SESKPKRFAYRILSLNDF-FSIKLATNTTINDVALGVTQAALS  968
             FLKDSQ+P T +       S  +RF YR LSL+D    IK ATN TINDV LG+TQAALS
Sbjct  239   FLKDSQSPFTVAKGFNNKHSTRQRFVYRTLSLDDIKLFIKNATNATINDVILGITQAALS  298

Query  969   MYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQ------ALADMMKKEKGE  1130
              Y++R+Y       +EG+  + + +R R+ +  NLRPA G+Q      + A +  +  G 
Sbjct  299   RYIHRKY------DVEGK--MKEQMRCRATVLVNLRPALGVQVSIISSSCAAICVRSNGA  350

Query  1131  SNSMSKWGW------------GNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEP  1274
              N     G             GN FG+ ++PL I  L +PLDYV +AK + DRKK S E 
Sbjct  351   INYDELAGLAEMIEKNAIVIQGNCFGFVLIPLDIAQLQNPLDYVHKAKISMDRKKRSLEA  410

Query  1275  IFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYG  1454
               T+Y+    +  FG + AA L  ++ S  +  FSNV GP E++ + GHP+AF+APTCYG
Sbjct  411   QCTFYILQLFLNLFGFRGAAKLAKRVPSQTTLSFSNVAGPIEEVSWSGHPLAFLAPTCYG  470

Query  1455  QPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             QP+ LMVH  SY  K+   I+VDE +I DPNQL DDF  S 
Sbjct  471   QPTGLMVHACSYAKKLTFAITVDEGMISDPNQLGDDFVDSF  511



>ref|XP_010420325.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=496

 Score =   374 bits (959),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 207/498 (42%), Positives = 300/498 (60%), Gaps = 34/498 (7%)
 Frame = +3

Query  144   MENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTS  323
             M+N      EEP+SP +R+   P  ++  +  +GF +KINP V    + H + KHPRF+S
Sbjct  8     MKNKEEEGEEEPLSPMARVFQSPDIDICAIINIGFKTKINPDVVLDALRHNVYKHPRFSS  67

Query  324   LMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERM  503
              +     ENG  KW+ETEV++  H+ V   P V++E  E     + FV+DY   L+   +
Sbjct  68    KL----SENGA-KWIETEVNVEDHVIV---PYVDLE--EICESGQSFVDDYCSRLTMTPL  117

Query  504   DMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL----PT  671
             D SRPLWD+HILN+KT DAEA+ V+R + AL DG S  SL+LACT +T+NP +L    P 
Sbjct  118   DRSRPLWDIHILNVKTSDAEAVGVIRFNQALADGMSFISLVLACTHKTSNPSMLSTATPL  177

Query  672   ISTRSS---SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPA  842
             +  R++   S  KT           +  +L+WNT+VDV +  AT+ FLKD++TP+  +  
Sbjct  178   VKRRTTAPHSLEKTGWFLRAIFTIGSTMRLIWNTIVDVLLLGATVLFLKDTKTPLKGNAN  237

Query  843   SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY---GKRDI---  1004
                 P+RF +R +SL+D   IK A N TINDV LG+TQAALS Y+NR+Y    K+D    
Sbjct  238   VRRNPRRFYHRTISLDDIKLIKNAMNMTINDVLLGITQAALSSYMNRQYLVSQKQDKNDE  297

Query  1005  ---GSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGY  1175
                GS+   + LP  +R R+    NLR   G ++LA+MM K+       SK  WGN F +
Sbjct  298   LEDGSLL-TSYLPDGIRFRAGCTVNLRSDIGFKSLAEMMVKD-------SKCRWGNYFSF  349

Query  1176  AILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIF  1355
              ILPL I +  DPL Y+ ++KA   RKK+SY+    Y+  N ++K  G KAA++  N+  
Sbjct  350   IILPLSIALETDPLVYLEKSKAIMARKKHSYQAALAYFFINIILKVLGAKAASLAFNQHL  409

Query  1356  SNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVI  1535
              N +TC SNV+GP E++ F GHPIA+I+P+ YG   A ++H+ SY  ++ + I VD  +I
Sbjct  410   KNITTCVSNVMGPTEEISFHGHPIAYISPSSYGHSQASLIHYTSYAGEVTITIGVDPTII  469

Query  1536  PDPNQLLDDFEKSLHLIK  1589
             PD +++ DD E+SL  +K
Sbjct  470   PDAHKICDDMEESLKTMK  487



>ref|XP_006371406.1| hypothetical protein POPTR_0019s09950g [Populus trichocarpa]
 gb|ERP49203.1| hypothetical protein POPTR_0019s09950g [Populus trichocarpa]
Length=422

 Score =   370 bits (949),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 269/423 (64%), Gaps = 23/423 (5%)
 Frame = +3

Query  336   DKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR  515
             D++  G++KWV T VDL  H+ V   P ++   D        FVEDYV  LSK  + MS 
Sbjct  6     DEKRGGELKWVRTVVDLDNHVKV---PTLDPNMDSPDM----FVEDYVSNLSKTGISMSI  58

Query  516   PLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSS  689
             P+WDLH+LN+KT DAE++ VLR+HH+LGDG S+ +L ++CTR+ ++P+ LP++  + +  
Sbjct  59    PMWDLHLLNIKTSDAESVGVLRVHHSLGDGTSLMTLFMSCTRKVSDPEALPSLPMNMKKK  118

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
                 +        K  +   L WNT VDV +F  T F+L D++TP+       S P+R  
Sbjct  119   HGSSSGGFLQYFIKLFSVLLLYWNTFVDVVMFFITTFYLDDTKTPLKGPLGVASTPRRIV  178

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK--RDIGSIEGQNNLPKNL  1043
             +R +SL D   +K A N T+NDV +GVT+AAL+  LNR+YGK   + G  EG NNLPKN+
Sbjct  179   HRTVSLEDVKLVKNAMNVTVNDVMVGVTEAALTRNLNRKYGKIKEEAGGAEGHNNLPKNI  238

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             RLR+  F NLRP    + +++M+K       S SK   GN  GY I P  IG+  D LD+
Sbjct  239   RLRATHFVNLRPYLVNEDVSEMIK-------SSSKVKLGNLIGYVIFPFTIGLREDVLDH  291

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             VR AKAT  RKK S E ++TY +A F IKFF  K A+  T       +  +SNV GP+E+
Sbjct  292   VRSAKATGKRKKASLEALYTYLMAKFFIKFFSAKWASFPTQ-----TTLWYSNVPGPQEE  346

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             +  FGH +A++APTCYGQP+ALM+H  SYV+KM +I+SVDE V+PDP+Q+ DD E+SL L
Sbjct  347   VTCFGHQVAYVAPTCYGQPNALMIHVVSYVNKMKIIVSVDEGVVPDPHQICDDIEESLKL  406

Query  1584  IKD  1592
             IK+
Sbjct  407   IKN  409



>ref|XP_004961273.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=558

 Score =   373 bits (958),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 206/486 (42%), Positives = 288/486 (59%), Gaps = 27/486 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD--K  341
             A EP+SP+ RL  E   N HI+A++G  + ++       +  TL++HPRF+S+ V D  K
Sbjct  82    AGEPMSPAGRLFRETHLNCHIVALIGLGAAVDVAAARAGLEATLVRHPRFSSVQVKDDVK  141

Query  342   EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPL  521
              +N K +WV T V+L  HI     P ++     T     + VEDY+  LS   MD SRPL
Sbjct  142   NKNAKPRWVRTTVNLDDHIIF---PHLDPAA--TSANPDQAVEDYLSSLSTAPMDHSRPL  196

Query  522   WDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSp  695
             W+LH+L+  T +A +   +RMHH+LGDG S+ SLL+ACTR  A+P  LP +  + R + P
Sbjct  197   WELHVLDFPTSEAASAVAVRMHHSLGDGISLLSLLIACTRSAADPARLPELPPAPRRAGP  256

Query  696   pktlkpnnpkpkpknffklVWN-------TLVDVFIFIATLFFLKDSQTPI-TPSPASES  851
                                VW+       TLVDV  F+AT +FL+D +TP    S   E 
Sbjct  257   VHARPRPPLSAGLAALALWVWSYAVLAWHTLVDVACFVATSWFLRDPRTPFAAASEGVEF  316

Query  852   KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNL  1031
             + KRF +R LSL+D   +K A   T+NDV +GVT A LS     RY  R       +   
Sbjct  317   RRKRFVHRTLSLDDVKFVKTAMKCTVNDVLIGVTSAGLS-----RYYFRKTSDTNERKKS  371

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
              KN+ +RS L  N+R   G+ ALA+MM   K   N+ +K  WGN  GY ILP  I M +D
Sbjct  372   QKNICVRSALLVNIRKTPGLHALAEMMDSSK---NNGAK--WGNLIGYVILPFHIAMHDD  426

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PL+Y+R+ K TA+RKK S E +FTY+  N ++K FG KAAA L   +F+N +  FS++VG
Sbjct  427   PLEYIRQGKRTAERKKTSLEAVFTYWSGNLIVKLFGMKAAAALCYGMFTNTTMSFSSMVG  486

Query  1392  PREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEK  1571
             P E +EF+GHPI +IAP+ YG P AL VH+QSY++ + ++++VD+   PD +QLLDDF +
Sbjct  487   PAEKVEFYGHPIQYIAPSVYGHPHALTVHYQSYMNSIKLVLAVDDAQFPDSHQLLDDFAE  546

Query  1572  SLHLIK  1589
             SL LI+
Sbjct  547   SLRLIR  552



>gb|AGT16887.1| hypothetical protein SHCRBa_165_I15_F_280 [Saccharum hybrid cultivar 
R570]
Length=552

 Score =   371 bits (952),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 201/493 (41%), Positives = 293/493 (59%), Gaps = 27/493 (5%)
 Frame = +3

Query  147   ENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSL  326
                ++  A EP+SP+ RL  E  FN +I+A++G  + ++       +  TL++HPRF+S+
Sbjct  69    REGDLEAAGEPMSPAGRLFREKHFNCYIVAVIGLGAAVDVAAARAGLEATLVRHPRFSSI  128

Query  327   MVVDKE--ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKER  500
              V D +  ++ K +WV T V+L  H+ V   P ++     T  K  + VEDY+  LS   
Sbjct  129   QVNDDDARKSAKPRWVRTTVNLDDHVIV---PYLDPSATST--KPDQAVEDYLSWLSTAP  183

Query  501   MDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--  674
             MD SRPLW+ H+L+  T +A A   +RMHH+LGDG S+ SLL+ACTR  A+P  LP +  
Sbjct  184   MDHSRPLWEFHVLDFPTSEATATVAIRMHHSLGDGVSLLSLLIACTRSAADPARLPELPP  243

Query  675   STRSSSppktlkpnnpkpkpkn-------ffklVWNTLVDVFIFIATLFFLKDSQTP-IT  830
             + R + P                      +  L W+TLVDV  F+AT +FL+D +TP + 
Sbjct  244   APRRAGPLFARPRPPLSAGLVAFVLWLWSYVVLAWHTLVDVVCFVATAWFLRDQRTPFMA  303

Query  831   PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS  1010
              S   E + KRF +R L+L+D   +K A   T+NDV +GVT A LS Y  R+        
Sbjct  304   ASEGVEFRRKRFVHRTLNLDDVKFVKNAMKCTVNDVLIGVTNAGLSQYYFRK-----TSD  358

Query  1011  IEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPL  1190
                +    +++R+RS L  N+R   G+ AL++MM   K   NS +K  WGN  GY ILP 
Sbjct  359   TNSERKKSQSIRVRSALLVNIRKTPGLHALSEMMDSGK---NSGAK--WGNLIGYMILPF  413

Query  1191  KIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAST  1370
              I M +DPL+Y+R+ K TA+RKK S E +FTY+  N ++K FG KAAA L   +F+N + 
Sbjct  414   HIAMHDDPLEYIRQGKRTAERKKASLEAVFTYWSGNLIVKLFGMKAAAALCYGMFTNTTM  473

Query  1371  CFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQ  1550
              FS++ GP E +EF+GHPI +IAP+ YG P AL VH+QSY + + ++++VD+   PD +Q
Sbjct  474   SFSSMGGPAEKVEFYGHPIVYIAPSVYGHPHALTVHYQSYTNSIKLVLAVDDAQFPDSHQ  533

Query  1551  LLDDFEKSLHLIK  1589
             LLDDF +SL LI+
Sbjct  534   LLDDFAESLRLIR  546



>emb|CDX68518.1| BnaC01g25960D [Brassica napus]
Length=500

 Score =   369 bits (947),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 203/488 (42%), Positives = 293/488 (60%), Gaps = 36/488 (7%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             E+P+SP++R+ H P FN ++++++G   KI P V    +  TL++HPRF+S MV  + +N
Sbjct  24    EQPLSPAARVFHAPEFNCYVISVIGVKKKIEPDVIMEGLKQTLIRHPRFSSKMVSRRNKN  83

Query  351   GKMK-WVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
              + + WV T V +S H+ V   P ++ +  E    +K F+E YV +L+   +D S+PLW+
Sbjct  84    SQTQIWVRTNVVVSDHVIV---PYIQTQNIENANADK-FLESYVSDLTLIPLDTSKPLWE  139

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LH+L+LKT DAE +AVL+ HH+LGDG S+ +L+LAC R+T+NP  LPT+  ++ S  ++ 
Sbjct  140   LHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPDELPTLPNQNRSSSRSS  199

Query  708   kpnnpk----------pkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESK  854
             +                   +   LV NT+ D   FIAT  FLKD++TPI      S+ K
Sbjct  200   RLKAGSRGDFRFLWLIMVLWSAIMLVLNTMCDALEFIATAMFLKDTETPIKGDFRLSKHK  259

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNN--  1028
                  +R +SL+D   IK   N T+NDV LGVTQA LS YL  RY ++     E Q N  
Sbjct  260   RMSLVHRTVSLDDIKLIKNTMNMTVNDVVLGVTQAGLSQYLETRYVEKKKKLGEDQRNSD  319

Query  1029  -LPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGML  1205
              +PK +RLRS +            L+DMM K        SK  WGN  GY + P  IG+ 
Sbjct  320   HMPKIIRLRSAIL----------DLSDMMAKG-------SKCRWGNWIGYIVFPFSIGLR  362

Query  1206  NDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNV  1385
              DPL+++R AK   DRKK S E   T+ +   +IK FG K  A + N+  SN +  FSN+
Sbjct  363   KDPLEHLRSAKRIIDRKKNSLEAALTFIVGKLMIKSFGVKITANIINRALSNTTMSFSNL  422

Query  1386  VGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDF  1565
             +GP E++ FFGHPIA++AP+ YG P AL +HFQSY++KM + ++VD  VI D ++LLDD+
Sbjct  423   IGPIEEISFFGHPIAYMAPSVYGHPHALTMHFQSYMNKMTISLTVDPTVISDTHRLLDDW  482

Query  1566  EKSLHLIK  1589
             E+SL  IK
Sbjct  483   EESLKNIK  490



>ref|XP_009415744.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   370 bits (950),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 205/491 (42%), Positives = 298/491 (61%), Gaps = 14/491 (3%)
 Frame = +3

Query  132   QKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHP  311
             Q    E       EEPVSP+  +  +   N +I+AI+GF   ++  +    +  TL +HP
Sbjct  69    QSGRAEEKEGDQVEEPVSPAGLVFRQEHTNCYIIAILGFGKPLDVAIIKAGLEATLARHP  128

Query  312   RFTSLMVVDKEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYEL  488
             RF+S+ V D +  G  ++W  T+VD+  H+ V +    E    +T   ++  VEDYV  L
Sbjct  129   RFSSVQVSDDDREGTTLRWKPTKVDVDDHVVVPDL-HPESSSSDTASPDQ-LVEDYVASL  186

Query  489   SKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLP  668
             +   M+ SRPLW+LH+LN+ T +A A+AV R+HH+LGDGAS+ SLLLACTR+TA+P  LP
Sbjct  187   TTVPMNFSRPLWELHLLNIPTSEAAAVAVFRIHHSLGDGASLISLLLACTRRTADPASLP  246

Query  669   TI-STRSSSppktlkpnnpkpkpknffklV--WNTLVDVFIFIATLFFLKDSQTPITPSP  839
             T+  +R   PP     +        +  LV  WNTLVD  + +AT  +LKD+ T +    
Sbjct  247   TLPESRPPPPPPPTSASPLALLLYIWTVLVVSWNTLVDFVVLVATSIWLKDTPTALKGGE  306

Query  840   ASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG  1019
               E + KR  +R +SL+D   IK + + T+NDV +GVT A +S YL+RR+G+ + G  + 
Sbjct  307   GVEFRSKRVVHRTVSLDDVKDIKNSMHCTVNDVLVGVTSAGISRYLHRRHGETNDG--KK  364

Query  1020  QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIG  1199
             Q  L  + RLRS +  N+RP   I  LA+MM    G++  +    WGN   Y ILP  I 
Sbjct  365   QQLLKASTRLRSAMIINMRPKLEIHDLAEMMA---GKNCGIK---WGNLISYVILPFPIA  418

Query  1200  MLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFS  1379
             M  DPLDYVR+ KA  DRKK S + +  Y  A F+IK FG K  A +T  + SN +  +S
Sbjct  419   MYEDPLDYVRKGKAAVDRKKNSLQAVLAYRCATFLIKMFGVKGGAAMTYGLISNTTFSYS  478

Query  1380  NVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLD  1559
             NVVGP +++ F+GHPI ++AP+ YG P AL +H+QSY++ M ++++VDE+ IP P+QLLD
Sbjct  479   NVVGPVDEISFYGHPILYLAPSVYGHPHALTLHYQSYMNTMKIVVAVDESTIPYPHQLLD  538

Query  1560  DFEKSLHLIKD  1592
             D  +SL +IK+
Sbjct  539   DLAESLKVIKE  549



>gb|EAY98969.1| hypothetical protein OsI_20927 [Oryza sativa Indica Group]
Length=565

 Score =   369 bits (946),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 289/482 (60%), Gaps = 25/482 (5%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-EENG  353
             P+SP+ RL  E  FN +I+A++G  ++++       +  TL++HPRF S+ V D+  +  
Sbjct  91    PMSPAGRLFRETNFNCYIVAVIGLGARVDVAAARAGLEATLVRHPRFCSVQVSDEASKRA  150

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             K +WV T V+L  H+   E     ++   T     + +EDY+  LS + MD SRPLW+LH
Sbjct  151   KPRWVRTTVNLDDHLIFPE-----LDPTATSASPDQVIEDYMSTLSTQPMDHSRPLWELH  205

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIS---TRSSSppkt  704
             +L+  T +A A   +RMHH+LGDG S+ SLL+ACTR  A+P  LP +     R   P   
Sbjct  206   VLDFPTSEAAATVAVRMHHSLGDGVSLLSLLIACTRSAADPARLPALPPAPARRDGPVYA  265

Query  705   lkpnnpkpkpknffklVWN-------TLVDVFIFIATLFFLKDSQTPITPSPASESKPKR  863
              +               W+       TLVDV  F+AT  FL+D++TP+  +   E + KR
Sbjct  266   RRRPPLSAGIVALAAWAWSYLVLALHTLVDVACFVATSLFLRDARTPLMGTEGVEFRRKR  325

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNL  1043
             F +  LSL+D   +K A   T+NDV +GVT AALS Y    Y +++  +   +    K++
Sbjct  326   FVHCTLSLDDVKLVKNAMKCTVNDVLVGVTSAALSRY----YFRKENDTNSEKRTRRKHI  381

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             R+RS L  N+R   G+  LA+MM   K   N++++WG  N  GY +LP +I M +DPL+Y
Sbjct  382   RVRSALLVNIRKTPGLHVLAEMMNSNK---NNVARWG--NLIGYIVLPFRIAMFHDPLEY  436

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             +R+ K T DRKK S E IFTY+  N ++K FG K AA L + + +N +  FS++VGP E 
Sbjct  437   IRQGKRTVDRKKSSLEAIFTYWSGNLIVKLFGIKTAAALCHGMLANTTLSFSSMVGPAEK  496

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             +EF+GHPI +IAP+ YG P AL VH+QSY++ + ++++VD+   PD +QLLDDF +SL L
Sbjct  497   VEFYGHPIEYIAPSVYGHPHALTVHYQSYMNIIKLVLAVDDAQFPDAHQLLDDFAESLRL  556

Query  1584  IK  1589
             I+
Sbjct  557   IR  558



>ref|XP_009627721.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=457

 Score =   365 bits (936),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 199/467 (43%), Positives = 286/467 (61%), Gaps = 35/467 (7%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             +KPI T K+   ++ N        +SP+SR+ HEP +NL+ILAIMG+   IN       +
Sbjct  11    MKPIRTTKK---LDENGGEEEALLMSPTSRMFHEPNYNLYILAIMGWKVPINVDAMKAEI  67

Query  288   PHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
                LLKHPRF+SL V+D+ ++  KMKWV T V++  H+TV   P++ ++ +  +    K 
Sbjct  68    QGKLLKHPRFSSLQVIDESDDSRKMKWVPTTVNIDDHVTV---PDL-IKSNPNNMDTDKL  123

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y+  LS   +DMS+PLWDLHILN KT  AEA  + R+HH+LGDG S+ SLLL+C R+
Sbjct  124   VEEYISNLSTANIDMSKPLWDLHILNAKTSHAEATCIFRLHHSLGDGVSLVSLLLSCFRK  183

Query  645   TANPK------------LLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFI  788
             +++P                  +  ++             K  +  +L++NT+VDV +F+
Sbjct  184   SSDPTSLPTLLVSSSSSSKGKSNLSNNRTSIRSLMWQYLVKLWSCIRLLFNTVVDVLLFV  243

Query  789   ATLFFLKDSQTPITPSPASESKP-KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAAL  965
             AT  FLKDSQ+P T +   +S   +RF YR +SLND   IK  TN+T+NDV +G+TQAAL
Sbjct  244   ATALFLKDSQSPFTVAQGFKSSTRRRFIYRTVSLNDIKFIKNLTNSTVNDVIMGITQAAL  303

Query  966   SMYLNRRYGKRDIGSIEGQNNL-PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
             S Y++RRY       IEG+    P+ +R R+ +  NLRPA G+QA+A+M++K        
Sbjct  304   SRYIHRRY------EIEGKRKFSPQKMRCRASVVVNLRPALGVQAIAEMIEKNAVVIQ--  355

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
                  GN FG+ I+PL I  L++PLDYVR+AK T DR K+S   + T+YL+  +IK FG 
Sbjct  356   -----GNCFGFYIIPLSISQLDNPLDYVRKAKTTMDRTKHSLGSLCTFYLSQLIIKLFGF  410

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPS  1463
             K A  L  ++ S+ +  FSNV GP E++   GHP+ FIAPTCYGQP+
Sbjct  411   KGATTLAARVLSHTTIFFSNVAGPLEEVSCSGHPLTFIAPTCYGQPT  457



>ref|XP_006401713.1| hypothetical protein EUTSA_v10015825mg [Eutrema salsugineum]
 gb|ESQ43166.1| hypothetical protein EUTSA_v10015825mg [Eutrema salsugineum]
Length=482

 Score =   365 bits (938),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/485 (42%), Positives = 293/485 (60%), Gaps = 28/485 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +++   P  +  ++ I+GF +KIN HV   ++ H + KHPRF+  +  D    
Sbjct  7     EEPLSPVAQVYQSPGIDYCVVTIIGFKTKINAHVIIDDLRHNVYKHPRFSCKLGSDGT--  64

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
                KW++T+V++  H+ +   P V++E  E       FV+DYV  L+   +D SRPLWD+
Sbjct  65    ---KWIKTKVNIEDHVVI---PTVDLE--EIGEDGDGFVDDYVSRLTMIPLDKSRPLWDI  116

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI------STRSSS  692
             HILN+KT DAEA++V+R HH+LGD  S+ SLL+ACTR+T++P+  PTI       TRS  
Sbjct  117   HILNVKTSDAEAVSVIRSHHSLGDATSLMSLLVACTRKTSDPETFPTIPALKRRETRSFG  176

Query  693   ppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKP--KRF  866
                            N  +L+WNT +D+ + +ATL FLKD++TP+     ++S+   KRF
Sbjct  177   LNDKDWFTKFIFAMCNALRLIWNTSIDLLLLLATLLFLKDTETPLRSHTGTDSRRSMKRF  236

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI---GSIEGQNNLPK  1037
              +R +SL+D   IK A N TINDV LG+ QAALS Y+N RY KR++    S    +NLP+
Sbjct  237   YHRAVSLDDIRHIKKAMNMTINDVLLGIIQAALSRYMNGRYDKRNVEGGTSKSDTSNLPQ  296

Query  1038  NLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPL  1217
              +R R+ L  NLR   G+Q LA M+ K        SK  WGN    A++P  IG+  DPL
Sbjct  297   RIRFRAVLAVNLRSEIGLQPLAGMIHKG-------SKCRWGNCISLAVVPFFIGLETDPL  349

Query  1218  DYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPR  1397
              Y+ + K+T DRKK S +    Y+     +   G K    L   +FSN + C SNVVGP 
Sbjct  350   VYLTKTKSTMDRKKNSLQATIMYWFLKLSLSMLGAKVGGFLLKLLFSNTTICVSNVVGPV  409

Query  1398  EDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSL  1577
             E++ + G PIA+I+ + YG   AL++HF SY +KM + I+VD +VIPDP++L D+ E+SL
Sbjct  410   EEVSYQGQPIAYISLSGYGHSQALLIHFLSYAEKMVISIAVDPSVIPDPHKLFDEMEESL  469

Query  1578  HLIKD  1592
               IK+
Sbjct  470   KAIKN  474



>ref|XP_009627720.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   365 bits (937),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 199/467 (43%), Positives = 286/467 (61%), Gaps = 35/467 (7%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             +KPI T K+   ++ N        +SP+SR+ HEP +NL+ILAIMG+   IN       +
Sbjct  11    MKPIRTTKK---LDENGGEEEALLMSPTSRMFHEPNYNLYILAIMGWKVPINVDAMKAEI  67

Query  288   PHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
                LLKHPRF+SL V+D+ ++  KMKWV T V++  H+TV   P++ ++ +  +    K 
Sbjct  68    QGKLLKHPRFSSLQVIDESDDSRKMKWVPTTVNIDDHVTV---PDL-IKSNPNNMDTDKL  123

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VE+Y+  LS   +DMS+PLWDLHILN KT  AEA  + R+HH+LGDG S+ SLLL+C R+
Sbjct  124   VEEYISNLSTANIDMSKPLWDLHILNAKTSHAEATCIFRLHHSLGDGVSLVSLLLSCFRK  183

Query  645   TANPK------------LLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFI  788
             +++P                  +  ++             K  +  +L++NT+VDV +F+
Sbjct  184   SSDPTSLPTLLVSSSSSSKGKSNLSNNRTSIRSLMWQYLVKLWSCIRLLFNTVVDVLLFV  243

Query  789   ATLFFLKDSQTPITPSPASESKP-KRFAYRILSLNDFFSIKLATNTTINDVALGVTQAAL  965
             AT  FLKDSQ+P T +   +S   +RF YR +SLND   IK  TN+T+NDV +G+TQAAL
Sbjct  244   ATALFLKDSQSPFTVAQGFKSSTRRRFIYRTVSLNDIKFIKNLTNSTVNDVIMGITQAAL  303

Query  966   SMYLNRRYGKRDIGSIEGQNNL-PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
             S Y++RRY       IEG+    P+ +R R+ +  NLRPA G+QA+A+M++K        
Sbjct  304   SRYIHRRY------EIEGKRKFSPQKMRCRASVVVNLRPALGVQAIAEMIEKNAVVIQ--  355

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
                  GN FG+ I+PL I  L++PLDYVR+AK T DR K+S   + T+YL+  +IK FG 
Sbjct  356   -----GNCFGFYIIPLSISQLDNPLDYVRKAKTTMDRTKHSLGSLCTFYLSQLIIKLFGF  410

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPS  1463
             K A  L  ++ S+ +  FSNV GP E++   GHP+ FIAPTCYGQP+
Sbjct  411   KGATTLAARVLSHTTIFFSNVAGPLEEVSCSGHPLTFIAPTCYGQPT  457



>gb|EYU33179.1| hypothetical protein MIMGU_mgv1a026751mg [Erythranthe guttata]
Length=497

 Score =   365 bits (937),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 194/489 (40%), Positives = 298/489 (61%), Gaps = 27/489 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP SP +RL+  P F + I AIMG+ + I+  +F + +  TL+KHPRF+SL++   +  
Sbjct  6     EEPASPGARLMQTPGFGICIYAIMGYMTIIDIDLFKNELVQTLVKHPRFSSLLIEKDKRL  65

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             GK  W  T+VD+ +H   V APE+    D       +FVE +V  LS++ +D ++PLW++
Sbjct  66    GKYSWKRTKVDIEKH---VFAPEL----DPDMESPDEFVEKFVSALSRQTLDPTKPLWEI  118

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACT---RQTANPKL--LPTISTRSSSp  695
             HILN+KT DA + AV ++ H++GDG S+ SL+LAC    R + NP +  LP + ++    
Sbjct  119   HILNVKTSDANSTAVFKIDHSIGDGVSLISLVLACAAMRRSSNNPGVEYLPVMPSKKQKT  178

Query  696   pktlkpnnpkpkpk--nffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
                +     +        F +++ TL+D+ + +AT+ FLKD++TPI      E+ PKRF 
Sbjct  179   NIGILVVMKRLFLSFWTGFLIIYYTLIDLIMVLATMLFLKDTKTPIKGERGVENSPKRFV  238

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK------RDIGSI--EGQN  1025
             +RI  L+D   +K A + ++NDV +GVT+A LS YLN RYG        + G I  +  N
Sbjct  239   HRIFDLDDVKLVKNAMHVSVNDVLMGVTEAGLSHYLNTRYGATTEKHTENGGEIIKKSNN  298

Query  1026  NLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGML  1205
              LPK+LR+R+ + FNLRP+  ++ L ++M  EK E   M    WGN  G  ++PL I + 
Sbjct  299   TLPKDLRIRAGISFNLRPSPSVKDLIEVMD-EKRELMGM----WGNLVGIVLVPLTIALE  353

Query  1206  NDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNV  1385
             ++PL Y+R AK+T DRKK S  P   Y L   +I FFG KAA +    +    +  FSNV
Sbjct  354   DEPLAYIRRAKSTMDRKKLSLAPHCIYVLLKLLINFFGTKAAVLAAKNVSYKTTVGFSNV  413

Query  1386  VGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDF  1565
             VGP+E+   FGHP+++I+PT  G P AL++++QSY +K+ + ++ DE +IP+P+Q+ DD 
Sbjct  414   VGPKEETNLFGHPLSYISPTASGFPLALVINYQSYGNKLVIAVAADEKLIPNPHQICDDL  473

Query  1566  EKSLHLIKD  1592
               SL + K+
Sbjct  474   HNSLQVFKE  482



>ref|XP_002516707.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45726.1| conserved hypothetical protein [Ricinus communis]
Length=436

 Score =   363 bits (931),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 191/476 (40%), Positives = 274/476 (58%), Gaps = 71/476 (15%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EE +SP++RL H P FN +I++I+G N                                 
Sbjct  20    EEVLSPAARLFHAPRFNCYIISIIGSN---------------------------------  46

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
                             T ++   V+V   +T  K+ +F  +              PLW+L
Sbjct  47    ----------------TAIDPGLVKVSLQQTLVKHPRFSSNL-------------PLWEL  77

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI--STRSSSppkt  704
             H+LNL+T +AEA+ V RMHH++GDGAS+ SLLLACTR+T++P  LPTI    R+ S    
Sbjct  78    HLLNLRTSNAEAIGVFRMHHSIGDGASLMSLLLACTRKTSDPDSLPTIPVQKRAGSGSSP  137

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                           +++WNT VD+ +F AT+ FLKD++T +  S   + KPKR  YR +S
Sbjct  138   GGFWWFFIAIWLVLRIIWNTFVDLILFSATILFLKDTKTALKGSSGVDLKPKRLVYRTIS  197

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             ++D   +K   N TINDV LG+TQA LS YL   YG+      + + +L K +RLR+ + 
Sbjct  198   MDDIKLVKNKMNITINDVILGITQAGLSRYLYAEYGE---AKQQKKISLLKRIRLRATVL  254

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
              NLRP  GIQ LA++M KE  ++    KWGWGNR GY +LP +I + +DPL+Y+R+AKA 
Sbjct  255   INLRPTPGIQTLAELMSKESNQA----KWGWGNRIGYIVLPFRIALQDDPLEYIRQAKAA  310

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S E I TY +A  V+  FG K A+ + ++   N +  FSNVVGP E++ F GHP
Sbjct  311   IDRKKLSLEAICTYRIAKLVLAIFGVKVASAIAHRFLLNTTMAFSNVVGPLEEISFCGHP  370

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             I+F+AP+ YG P AL +H+QSY +KM ++++VD +VIP P+ L    E+SL++IKD
Sbjct  371   ISFLAPSVYGHPHALTIHYQSYFNKMTIVLAVDPDVIPHPHNLCHHLEESLNIIKD  426



>gb|KDO46855.1| hypothetical protein CISIN_1g043866mg, partial [Citrus sinensis]
Length=449

 Score =   363 bits (931),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 203/442 (46%), Positives = 281/442 (64%), Gaps = 32/442 (7%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             ++P+SP SRL HEP  NL+I+ ++GF SKINP     N+ H+LLKH RF+SL V D++  
Sbjct  25    DQPLSPMSRLFHEPESNLYIVVMIGFKSKINPDFVKANLGHSLLKHHRFSSLQVEDEKIK  84

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR-PLWD  527
             G +KWV T+V+L  H+ V   P +E +  ++     KFVEDYV  LSK  + MS+ P+WD
Sbjct  85    GGLKWVPTKVNLDNHVIV---PNLEPKSIDSA---DKFVEDYVSNLSKTGIKMSKQPMWD  138

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             LH+LN+KT DAE++AVLR+HH+LGDG S+ SL L+CTR+ +NP+ LP+ S   +S     
Sbjct  139   LHLLNIKTSDAESVAVLRVHHSLGDGTSLVSLFLSCTRKVSNPEELPSNSIPPTSKEGDS  198

Query  708   kpnnpkpkpknff--------klVWNTLVDVFIFIAT-LFFLKDSQTPITPSPASESKPK  860
             +    K                L +NTLVD  + IAT L F+KDS+TP+       S P+
Sbjct  199   RSYGIKGFWPYLSFKYFWFVFSLFYNTLVDAVMVIATILMFVKDSETPLKGIMGKASGPR  258

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNL  1031
             R  +R LSL+DF ++K A NTTIND  + VTQA LS  LNR+YG+    + G+ E  NNL
Sbjct  259   RTVHRSLSLDDFKNVKNAMNTTINDAVVAVTQAGLSRNLNRKYGELLLVNKGASERNNNL  318

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
             PKN+RLR+ +  +LR +  +Q LAD++K       +  K   GN+ G+ I P  I + +D
Sbjct  319   PKNIRLRAAIMKDLRSSGEVQELADIVK-------NGYKTKSGNKIGFVIFPFSIALRDD  371

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PLDY+REAKA  DRKK S E  F+Y L+ + +K FG K A        S  +  FSNV G
Sbjct  372   PLDYLREAKARMDRKKASLEAEFSYLLSQYTVK-FGIKGA-----NCPSKTTLLFSNVNG  425

Query  1392  PREDLEFFGHPIAFIAPTCYGQ  1457
             P+E++ F+GHPIA++AP+CYGQ
Sbjct  426   PQEEISFYGHPIAYVAPSCYGQ  447



>gb|EYU25223.1| hypothetical protein MIMGU_mgv1a005236mg [Erythranthe guttata]
Length=492

 Score =   363 bits (933),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 296/475 (62%), Gaps = 23/475 (5%)
 Frame = +3

Query  195   RLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVET  374
             RL+  P F++ + A++G+ + I+  +F + +  TL+KHPRF+SL++   ++ G   W  T
Sbjct  19    RLMQTPGFDICVYAVLGYMTVIDVDLFKNELELTLVKHPRFSSLLIEKDKKRGNYSWKRT  78

Query  375   EVDLSQHITVVEA-PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKT  551
              VD+ +H+ V +  P++E   DE       FVE++   LS++ +D ++PLW++HILN+KT
Sbjct  79    VVDIDKHVFVPDLDPDME-NPDE-------FVENFTSGLSRKTLDPTKPLWEIHILNVKT  130

Query  552   RDAEALAVLRMHHALGDGASINSLLLACT-RQTANPKLLPTI-STRSSSppktlkpnnpk  725
              DA +  + ++ H++GDG S+ SL+LAC    ++   LLP + S +  +     + +N  
Sbjct  131   SDANSTVIFKIDHSIGDGVSLISLVLACAAMHSSGGDLLPVLPSKKRKTNSIGDRNSNIG  190

Query  726   pkpknffklVWN-------TLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
              K K  F   W        TL+D+ + +AT+ FLKDS+TPI      E+ PKRF +RIL+
Sbjct  191   SKMKRLFLSAWTILLVVFYTLIDLIMLLATMLFLKDSKTPIKGERGVENTPKRFVHRILN  250

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A + +INDV +GVT+A LS YLN RY   +       N LP+NLRLR+ + 
Sbjct  251   LDDVKLVKTAMHVSINDVLMGVTEAGLSRYLNTRYATTEKHEKSNNNTLPRNLRLRAGIA  310

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP+  I+ L ++M  EK E   M    WGN  G  ++PL I + +DPL Y+R AK+ 
Sbjct  311   FNLRPSPSIKDLIEVMD-EKKELKGM----WGNLVGLVLIPLTIALQDDPLAYIRRAKSI  365

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S  P F + L   +I  FG KAA ++T  +F+  +  FSNVVGP+E+++ FGHP
Sbjct  366   MDRKKLSLGPNFIFMLLKLLINLFGTKAALLVTRAVFTKTTVGFSNVVGPQEEIKLFGHP  425

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +++I+PT  G P AL++H+QSY +K+ + ++ DE +IP+P+QL DD + SL  IK
Sbjct  426   LSYISPTVSGFPLALVIHYQSYGNKLIIALAADEKLIPNPHQLCDDLQNSLQDIK  480



>ref|XP_009119883.1| PREDICTED: O-acyltransferase WSD1 [Brassica rapa]
Length=493

 Score =   363 bits (933),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 202/482 (42%), Positives = 293/482 (61%), Gaps = 26/482 (5%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+      +   + I+GF +KINP V   ++   + KHPR +S +     E+
Sbjct  6     EEPLSPMARIFQSSGADYCTVIIVGFKTKINPDVILDDLKQNVSKHPRISSKLA----ED  61

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  +W++T+V++  H+ V +     ++ DE   +  KFVEDY+  L+   +D SRPLWD+
Sbjct  62    GA-RWIKTQVNVKDHVFVPD-----IDPDEIGDQGDKFVEDYISRLTMLPLDRSRPLWDI  115

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI------STRSSS  692
             HILN+KT DAEA+ V+R HH+LGDG S  SL+LACT ++++P+ LPTI         S  
Sbjct  116   HILNVKTSDAEAIGVIRSHHSLGDGMSRMSLILACTHKSSDPEALPTIPILKRRENVSHG  175

Query  693   ppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAY  872
                T    +         +L+WNT+VD+ + +AT+ FLKD++T +     +ES  KRF++
Sbjct  176   LRNTGWFLSSMFAIYATVRLIWNTIVDLLLLLATVLFLKDTETSLKGGAEAESNAKRFSH  235

Query  873   RILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ---NNLPKNL  1043
             RI+SLND   IK   + TINDV LGVTQAALS YLN  + K +      +   NN+P N+
Sbjct  236   RIVSLNDVRLIKDIMDMTINDVLLGVTQAALSRYLNGAHDKTNENGGTSRPLLNNIPCNI  295

Query  1044  RLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDY  1223
             R+R+ +  NLR   G+Q LADMM K+       SK  WGN     +LPL IG   DPL Y
Sbjct  296   RVRAGVLVNLRSEIGVQPLADMMAKD-------SKCRWGNLINIVVLPLSIGPETDPLVY  348

Query  1224  VREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRED  1403
             + +AK+T D+KK S      Y + +F++  FG K  A L N++  + +   SNV GP E+
Sbjct  349   LSKAKSTMDQKKNSLHAPILYLIMSFIVSVFGAKIGAALFNRLLLSTTAFISNVNGPTEE  408

Query  1404  LEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHL  1583
             + F GHPIA+IAP+ YG   +L++HFQSY DKM + I+VD  +IPD ++L D  E+SL  
Sbjct  409   ISFHGHPIAYIAPSVYGHAQSLLIHFQSYADKMVISIAVDPTIIPDSHKLCDAMEESLKS  468

Query  1584  IK  1589
             +K
Sbjct  469   MK  470



>ref|XP_010492524.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=486

 Score =   363 bits (931),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 209/489 (43%), Positives = 298/489 (61%), Gaps = 34/489 (7%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  ++  +  +GF +KINP V    + H + KHPRF+S +     EN
Sbjct  7     EEPLSPMARVFQSPDIDICPIINIGFKTKINPDVVLDALRHNVYKHPRFSSKL----SEN  62

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
             G  KW++TEV++  H+ V   P +++E  E     + FV+DY   L+   +D SRPLWD+
Sbjct  63    GA-KWIKTEVNVEDHVIV---PYIDLE--EICESGQSFVDDYCSRLTMTPLDRSRPLWDI  116

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL----PTISTRSS---  689
             HILN+KT DAEA+ V+R +HAL DG S  SL+LACT +T+NP +L    P++  R++   
Sbjct  117   HILNVKTADAEAVGVIRFNHALADGMSFISLVLACTHKTSNPNMLSTAIPSVKRRTTVPH  176

Query  690   SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFA  869
             S  KT   +       +  +L+WNT+VDVF+  ATL FLKD+ TP+  +      P+RF 
Sbjct  177   SLEKTGWFSRVIFTIGSTMRLLWNTIVDVFLLAATLLFLKDTMTPLKGNANVRRNPRRFY  236

Query  870   YRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY------GKRD---IGSIEGQ  1022
             +R +SL+D   IK A N TINDV LG+TQAALS Y+NR+Y       K+D    GS+   
Sbjct  237   HRTISLDDIKLIKNAMNMTINDVLLGITQAALSSYMNRQYLVSQEQDKKDELEDGSLL-T  295

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
             + LP  +R R+    NLR   G + LA+MM+K+       SK  WGN F + ILPL IG+
Sbjct  296   SYLPDGIRFRAGCTVNLRSDIGFKPLAEMMEKD-------SKCRWGNYFSFIILPLSIGL  348

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
               DPL Y+ ++KA  DRKK+SY     Y +    +K  G KAA  + N+   N +TC SN
Sbjct  349   ETDPLVYLEKSKAIMDRKKHSYHAALAYLIIKIALKVLGAKAAVSVFNQHLLNITTCVSN  408

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             V+GP E++ F GHPIA+I+P+ YG   A ++H+ SY  K+ + I VD  VIPD +++ DD
Sbjct  409   VMGPMEEISFHGHPIAYISPSSYGHSQASLIHYTSYAGKVTITIGVDPTVIPDAHKICDD  468

Query  1563  FEKSLHLIK  1589
              E+SL  +K
Sbjct  469   MEESLKTMK  477



>emb|CDX87730.1| BnaC02g32190D [Brassica napus]
Length=633

 Score =   367 bits (942),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 203/489 (42%), Positives = 296/489 (61%), Gaps = 32/489 (7%)
 Frame = +3

Query  159   MSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD  338
             M+  EEP+SP +R+      +   + I+GF +KINP V   ++   + KHPR +S +   
Sbjct  1     MAKEEEPLSPMARMFQSSGTDYCTVIIVGFKTKINPDVILDDLKQNVSKHPRISSKLA--  58

Query  339   KEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRP  518
               E+G  +W++T+V++  H+ V +     ++ DE   +  KFV+DY+  L+   +D SRP
Sbjct  59    --EDGT-RWIKTQVNVEDHVFVPD-----IDPDEIGDQGDKFVDDYISRLTMLPLDRSRP  110

Query  519   LWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI------ST  680
             LWD+HILN+KT DAEA+ V+R HH+LGDG S  SL++ACT ++++P+ LPTI        
Sbjct  111   LWDIHILNVKTSDAEAIGVIRSHHSLGDGMSRMSLIMACTHKSSDPEALPTIPILKRREN  170

Query  681   RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPK  860
              S     T    +         +L+WNT+VD  + ++T+ FLKD++T +     +ES  K
Sbjct  171   VSHGLRNTGWFLSSMFAIYATVRLIWNTIVDFLLLLSTVLFLKDTETSLKGGAEAESNAK  230

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ------  1022
             RF++RI+SL+D   IK   + TINDV LGVTQAALS YLN   G  D  +  G       
Sbjct  231   RFSHRIVSLDDVRLIKDIMDVTINDVLLGVTQAALSRYLN---GAHDETNENGGTSRPVL  287

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
             NN+P N+R+R+ +  NLR   G+Q LADMM K+       SK  WGN     +LPL IG+
Sbjct  288   NNIPCNIRVRAGVLVNLRSEIGVQPLADMMAKD-------SKCRWGNLINIVVLPLSIGL  340

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
               DPL Y+ +AK+T D+KK S      Y + +F++  FG K  A L N++  + +   SN
Sbjct  341   ETDPLVYLSKAKSTMDQKKNSLHAPILYLIMSFIVSVFGAKIGAALFNRLLLSTTAFISN  400

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             V GP E++ F GHPIA+IAP+ YG   AL++HFQSY DKM + I+VD  +IPDP++L D 
Sbjct  401   VNGPTEEISFHGHPIAYIAPSVYGHAQALLIHFQSYADKMVISIAVDPTIIPDPHKLCDA  460

Query  1563  FEKSLHLIK  1589
              E+SL  +K
Sbjct  461   MEESLKSMK  469



>ref|NP_200150.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 dbj|BAB09800.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96346.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=483

 Score =   359 bits (922),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 197/487 (40%), Positives = 287/487 (59%), Gaps = 27/487 (6%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             + EEP+SP +RL   P     I+ ++GF +KINP +   ++ H + KHPRF S +V+   
Sbjct  6     VEEEPLSPMARLFQSPGIENCIITMIGFKAKINPDIILDDLKHNVSKHPRFCSKLVIATH  65

Query  345   EN-GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPL  521
              N    +W++T+V++  H+ V   P+++++  E ++    FV+DYV  L+   +D S+PL
Sbjct  66    TNYDGERWMKTKVNVEDHVFV---PDIDLQ--EINKDGDGFVDDYVSRLTLSPLDKSKPL  120

Query  522   WDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------ST  680
             WD+HILN+KT DAEA+ V+R HH+L DG S+ SLL+ACTR+T+N +  PTI         
Sbjct  121   WDIHILNVKTSDAEAVGVMRCHHSLADGMSLMSLLVACTRKTSNLESFPTIPAIKRREQM  180

Query  681   RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPK  860
              S         +          +L+WNT+VD+ +  AT  F KD++TPI+    S +  +
Sbjct  181   MSHRFGNKGWYSRSINAVYYAVRLIWNTIVDLLLLWATSLFFKDTETPISEGIGSGNNAR  240

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRD---IGSIEGQNNL  1031
             RF +R +SL+D   IK A   TINDV LGVTQ ALS YLN+RYG ++   + +    NNL
Sbjct  241   RFYHRTVSLDDIKLIKNAMKMTINDVLLGVTQDALSRYLNQRYGDKNGEGVTTTSNLNNL  300

Query  1032  PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLND  1211
             P  +R+R+ +  NLR   GIQ L DM+ K+       SK  WGN      +P  I +  D
Sbjct  301   PGKIRIRAGVAVNLRQDIGIQPLEDMLAKD-------SKCRWGNYDSLVFVPFSISLETD  353

Query  1212  PLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVG  1391
             PL  + +AK+  DRKK+S      Y +  F+I  FG K    + N+  SN +T  SN+VG
Sbjct  354   PLVPLLKAKSIMDRKKHSLVAPMHYSIIEFIINTFGTK----VFNRTCSNTTTILSNIVG  409

Query  1392  PREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEK  1571
             P E++   G+ I +IA T YG   ALM+HF SY +KM + I+VD  VIPDP+ + D+ EK
Sbjct  410   PVEEVSLHGNCITYIALTGYGHSQALMIHFISYANKMIITIAVDPAVIPDPHNICDEMEK  469

Query  1572  SLHLIKD  1592
             SL  +KD
Sbjct  470   SLKAMKD  476



>ref|XP_006478071.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=393

 Score =   355 bits (912),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 253/404 (63%), Gaps = 25/404 (6%)
 Frame = +3

Query  138   SGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRF  317
             +G + ++  I EEP+SP++ L   P FN HI+AIMG  + INP V    + HTL+KHPRF
Sbjct  4     NGGKASSGDIYEEPLSPAALLFQAPNFNCHIIAIMGCKTSINPSVIKEGLQHTLIKHPRF  63

Query  318   TSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKE  497
             +S +VV   +  K KW  T V++  H+ V   PE+    D       +F+EDY+  ++  
Sbjct  64    SSKLVV---QGRKKKWTRTTVNVENHVIV---PEL----DPKMENPDQFIEDYISYITTN  113

Query  498   RMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIS  677
              MD S+PLW++H+LN+KT DAEA+ V R+HH++GDGAS+ SLLLACTR+T++ + LPTI 
Sbjct  114   PMDYSKPLWEVHLLNVKTSDAEAVGVFRIHHSIGDGASLISLLLACTRKTSDTEALPTIP  173

Query  678   TR----SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPAS  845
              +    SS+               +  +L+WNT+ D+  F+AT+ FLKD++ P+   P  
Sbjct  174   VQKRGGSSTATAGWFCWWLLLAIWSAIRLIWNTIADLVTFLATVLFLKDTENPLKGGPGV  233

Query  846   ESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDI----GSI  1013
             E  PKRF +R + L+D   +K A N TINDV LG+TQAALS YL+RRYG + +       
Sbjct  234   ELVPKRFVHRTIGLDDIKLVKNAMNMTINDVILGLTQAALSRYLHRRYGDKSMQNGGAKH  293

Query  1014  EGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLK  1193
             E  N LPK LRLR+ +  NLRP  GIQALADMM KE       SK GWGN  GY +LP  
Sbjct  294   ESNNTLPKKLRLRAAILVNLRPTTGIQALADMMAKE-------SKGGWGNWIGYILLPFT  346

Query  1194  IGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
             I + NDPLDY+R AKAT DR+K+S E   T+  A FV+  FG K
Sbjct  347   IALQNDPLDYIRVAKATIDRRKHSLEAFCTFSTAKFVLYTFGAK  390



>ref|XP_011024822.1| PREDICTED: O-acyltransferase WSD1-like isoform X4 [Populus euphratica]
Length=436

 Score =   355 bits (911),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 187/419 (45%), Positives = 267/419 (64%), Gaps = 19/419 (5%)
 Frame = +3

Query  90    MEMERNLKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPH  269
             ++ E   K  ET ++K   ++   + ++EP+SP++RL H P FN  IL  +G  + INP 
Sbjct  21    VKTETATKKWETNEEKGMADSKESTSSQEPLSPAARLFHAPQFNCTILTAIGCKTSINPG  80

Query  270   VFTHNMPHTLLKHPRFTSLMVVDKEENG-KMKWVETEVDLSQHITVVEAPEVEVEGDETH  446
             V    +  TL+KHPRF+  +V+D  + G K KW  T V++  H+TV   P ++   D   
Sbjct  81    VIKMGLEQTLMKHPRFSKKLVIDDNKCGSKSKWESTIVNVENHVTV---PNLDPNMDSP-  136

Query  447   RKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLL  626
                 +FVEDY+  LS   +D+S+PLW++HILN+KT DAEA+AV R+HH+LGDGAS+ SLL
Sbjct  137   ---DQFVEDYISSLSTIPLDLSKPLWEMHILNVKTSDAEAIAVFRIHHSLGDGASLISLL  193

Query  627   LACTRQTANPKLLPTI-STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFF  803
             LACTR+T++P  LP+I + + +    +              +++WNT VD+ +F AT+ F
Sbjct  194   LACTRKTSDPDALPSIPAQQRAGSHFSGGFWGLFFAMWTVLRVIWNTSVDLVLFAATMLF  253

Query  804   LKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNR  983
             L+D++TP+  +   E KPKRF +R +SL+D   +K A N TIND  +GVTQA LS YLNR
Sbjct  254   LEDTKTPLKGASGVELKPKRFVHRTVSLDDIKLVKNAMNMTINDAIMGVTQAGLSRYLNR  313

Query  984   RYGKRDIGSIEG-----QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSK  1148
             +Y   D   IE      +NN+PK++RLR+ +  N+RP  GIQ LAD+M     ESN+  K
Sbjct  314   KYAG-DQSEIEDGENGKKNNIPKSIRLRASVLVNVRPTPGIQTLADLMAD---ESNN-PK  368

Query  1149  WGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
             WGWGNR GY ILP  +G+ +DPL+++R AKA  DRKK S E  F+++ A  VIK FG K
Sbjct  369   WGWGNRIGYIILPFTVGLQDDPLEHLRRAKAMIDRKKLSLEATFSFHSAILVIKLFGAK  427



>emb|CBH32551.1| conserved hypothetical protein, expressed [Triticum aestivum]
 emb|CDM83948.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   357 bits (917),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 200/489 (41%), Positives = 280/489 (57%), Gaps = 38/489 (8%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-EENG  353
             PVSP+ RL  EP F+ +I+++ G  ++++       +  TL +HPRF S+ VVD+ EE+ 
Sbjct  38    PVSPTGRLFREPHFSCYIVSVFGLGARVDLAGVRAGLEATLARHPRFCSVQVVDELEEDA  97

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             + KWV T V+L  H+ V +        D       + +E YV  LS   MD SRPLW+LH
Sbjct  98    RPKWVRTTVNLDDHVIVPDLDPTATSADP-----DRALEHYVSSLSTLPMDHSRPLWELH  152

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSS--------  689
             + +  T DA A  VLR+HH++GDG S+ SL +ACTR+ A+P  LP + T  +        
Sbjct  153   VFDFPTSDAAAAVVLRVHHSVGDGVSLLSLFIACTRRAADPDALPELPTTGAPRRAGPAY  212

Query  690   ------SppktlkpnnpkpkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSPASE  848
                   SP              +   L W+T+VDV  F AT  + L+D  T    +   E
Sbjct  213   ALRSRHSPSSWGALAVLAAWVVSLLVLAWHTVVDVLCFSATATWMLRDPPTLFKGAEGVE  272

Query  849   SKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNN  1028
              +PKRF  R LSL+D   +K   N T+NDV LGVT AALS +  R+ G+       G+  
Sbjct  273   FRPKRFVNRTLSLDDVKYVKNTMNCTVNDVLLGVTSAALSRFYFRKTGE------SGR--  324

Query  1029  LPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWG-WGNRFGYAILPLKIGML  1205
               K++++RS L  NLR   G+ ALA MMK  K        W  WGNR GY ILP  I   
Sbjct  325   --KSIKVRSTLLVNLRKTPGLHALATMMKSGK------DNWAEWGNRLGYMILPFHIVHG  376

Query  1206  NDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNV  1385
             +DPL+YVR+A   A RKK S E IFTY+ A+ ++KFFG KAAA L   +  N +  FSN+
Sbjct  377   DDPLEYVRKATKVARRKKSSMESIFTYWSASMIMKFFGIKAAASLCYGMMRNTTLSFSNM  436

Query  1386  VGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDF  1565
              GP E + F+GHPI +IAP+ YG P AL +H+QSY++ + ++++ +E   PD ++LLDDF
Sbjct  437   AGPTEQVVFYGHPIVYIAPSVYGHPHALTMHYQSYMNIIKLVLATEEEQFPDAHELLDDF  496

Query  1566  EKSLHLIKD  1592
               SL LI++
Sbjct  497   AVSLKLIRE  505



>ref|XP_010445765.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=421

 Score =   354 bits (909),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/421 (42%), Positives = 269/421 (64%), Gaps = 23/421 (5%)
 Frame = +3

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             + GK  WV T+V +  H+ V   P++    D       +++EDY+ +L+   MD+S+PLW
Sbjct  5     KKGKPCWVRTKVKVEDHVIV---PDI----DPKIENPDQYLEDYISKLTTIPMDLSKPLW  57

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTR------S  686
             ++H+++LKT +AE++A+L++HH+LGDG S+ SL LACTR+T+N + LPT++ +      S
Sbjct  58    EIHLIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNLEALPTVAVQKKRFGPS  117

Query  687   SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
              +     K            +L++NT VD+ +F  T+F ++D++TP+   P SE  PKRF
Sbjct  118   CNSGFFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPLLAKPGSELNPKRF  177

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +RI+S +D   +K A   T+NDV LGVT+A LS YL+RRY +     ++      + +R
Sbjct  178   VHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKLKESM---RRIR  234

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             LRS +  NLRP  GI+ALADMM K+       SK  WGN FGY +LP  +G+  DPL+YV
Sbjct  235   LRSAIMINLRPNAGIEALADMMAKK-------SKCRWGNLFGYILLPFSVGLETDPLEYV  287

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R AKAT DRKK+S E +F+      ++K  G KA+ +L  K+  + +  FSNVVGP+E++
Sbjct  288   RRAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTFSNVVGPKEEI  347

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
              F GHP+++IAP  +G P AL +HFQSY +K+ + ++ D  VIPDP+++ DD  +SL +I
Sbjct  348   TFHGHPLSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVIPDPHKMCDDLVESLKII  407

Query  1587  K  1589
             K
Sbjct  408   K  408



>ref|XP_009140411.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=460

 Score =   355 bits (912),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 195/483 (40%), Positives = 273/483 (57%), Gaps = 38/483 (8%)
 Frame = +3

Query  159   MSIAEE---PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLM  329
             MS  EE   P+SP +R+   P  +  I+ ++G  +KIN  V    +   + KHPRF+   
Sbjct  1     MSTGEEDGEPLSPMARVFQLPGNDCCIITVIGCKTKINADVIRSGLNQNVFKHPRFSR--  58

Query  330   VVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDM  509
                K     + W++T+V++  HI V +  + E+  D      + FVEDYV  L+   +D 
Sbjct  59    ---KLSRDGLSWIKTQVNIEDHIFVADKDQNEIAED-----GELFVEDYVSRLTMIPLDK  110

Query  510   SRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTA--NPKLLPTISTR  683
             +RPLWD+HILN+KT DA+A+ V+R HH+LGDG S+ SLL ACT+ T+  +   +P +  R
Sbjct  111   ARPLWDIHILNVKTSDADAVCVIRSHHSLGDGTSLMSLLAACTQTTSHRDKATIPALKRR  170

Query  684   SSSppktlk-pnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPK  860
                    +           +  +L+WNT VD+ + +A   FLKD++TP+      ES PK
Sbjct  171   KRVYKDKISWFVRLIQAIFSSVRLIWNTFVDLVLLLAIAVFLKDTKTPLKGDVGVESSPK  230

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKN  1040
             +F +R +SL+DF  IK A + TINDV LGVTQAALS YLN               N P  
Sbjct  231   KFCHRTVSLDDFRVIKEAMSMTINDVLLGVTQAALSRYLN---------------NFPGK  275

Query  1041  LRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLD  1220
             +RL + +F NLRP  G Q LADMM K        SK  WGN F     P+ I +  DPL 
Sbjct  276   IRLTAGVFVNLRPDNGFQPLADMMAKN-------SKCRWGNYFSSISFPISICLEADPLV  328

Query  1221  YVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPRE  1400
             Y+ +AK+  DRKK+S  P   +    F+   FG K    L  ++ SN +T  SN++GP +
Sbjct  329   YLSKAKSAMDRKKHSLLPALAFSSTEFIFNTFGAKLGGTLLKRLVSNTTTFISNMIGPTD  388

Query  1401  DLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLH  1580
             ++ F GHPI +IAP+ YG   AL +HF SY +KM + I+VD NVIP P+QL D+ E SL 
Sbjct  389   EISFHGHPIVYIAPSVYGHAHALTIHFLSYAEKMVISIAVDPNVIPSPHQLCDEIEDSLK  448

Query  1581  LIK  1589
              IK
Sbjct  449   AIK  451



>ref|NP_001043877.1| Os01g0681000 [Oryza sativa Japonica Group]
 dbj|BAD73756.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05791.1| Os01g0681000 [Oryza sativa Japonica Group]
 dbj|BAG94326.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   356 bits (914),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 201/509 (39%), Positives = 296/509 (58%), Gaps = 37/509 (7%)
 Frame = +3

Query  120   ETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTL  299
             ET+K+ + +      + EEPVSP+ RL  EP F+ +I+  +G    ++       +  TL
Sbjct  29    ETKKKAAAVAEEEEELLEEPVSPAGRLFREPHFSCYIVCTLGVAEPVDLPAVRAGIEATL  88

Query  300   LKHPRFTSLMVVDK-EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDY  476
              +HPRF S+ V+D+ +++ K  WV T+V+L  HI V +    +   D      +K VEDY
Sbjct  89    ARHPRFCSIQVLDELDKSAKPMWVRTKVNLDDHIIVPDLGPTDTSADP-----EKAVEDY  143

Query  477   VYELSKERM--DMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTA  650
             V  LS   M  D SRPLW+LH+L   T +A A   LRMHH+LGDG S+ SLL+ACTR+  
Sbjct  144   VSSLSTPSMPMDRSRPLWELHVLGFPTAEAAATVALRMHHSLGDGVSLLSLLIACTRRAD  203

Query  651   NPKLLPTISTRSSSppktl--------------kpnnpkpkpknffklVWNTLVDVFIFI  788
             +P  +P + + ++   +                          ++  L W+T+VDV  F 
Sbjct  204   DPDAIPALPSSAAGRRRREGPLHALPPRPPLAAGALALAAWALSYLVLAWHTVVDVVCFT  263

Query  789   ATLF-FLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAAL  965
              T    + D++T +     +E +P+RF  R +SL+D  +IK A   T+NDV +G++ AAL
Sbjct  264   LTAASLMGDARTVLKGDEGAEFRPRRFVNRTISLDDVKNIKNAVGCTVNDVLVGLSSAAL  323

Query  966   SMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMS  1145
             S Y  RR G+      EG+    KN+++R+ L  NLRP  G+  LA MM  E G++N + 
Sbjct  324   SRYYFRRTGES-----EGK----KNIKVRTALMVNLRPTPGLHELAKMM--ESGKNNGVK  372

Query  1146  KWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
                WGNRFGY ILP  +   +DPL+YVR+A     RKK S E IFTY+ A+ V+K FG K
Sbjct  373   ---WGNRFGYMILPFHLAKHDDPLEYVRKATKVTRRKKSSMEAIFTYWSADMVVKLFGIK  429

Query  1326  AAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMG  1505
             AAA L   +FSN +  FSN+ GP E + F G+PI +I+PT YG P AL +H+QSY++ + 
Sbjct  430   AAASLCYGMFSNTTLSFSNLAGPSEQILFCGNPIVYISPTSYGHPHALTMHWQSYMNTIK  489

Query  1506  VIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             + ++VDE   PD ++LLDDF +S+ LI++
Sbjct  490   LALAVDETQFPDAHELLDDFTESMRLIRE  518



>emb|CAN79451.1| hypothetical protein VITISV_001677 [Vitis vinifera]
Length=805

 Score =   363 bits (932),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 195/422 (46%), Positives = 267/422 (63%), Gaps = 30/422 (7%)
 Frame = +3

Query  99    ERNLKPIETRKQKSGMENNNMSIAEE--------PVSPSSRLLHEPAFNLHILAIMGFNS  254
             ++ LKPI+T++  +     +    E+         +SP  R+ HE  FN++++AI GF  
Sbjct  402   QQALKPIQTKRXAAREVEGDGKKPEDIKEEEEGEALSPVGRIFHETCFNVYVIAIAGFKI  461

Query  255   KINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEG  434
             +IN  V   N+ HTLLKHPRF+SL V D +++G MKWV T+VDL +HI +   P +    
Sbjct  462   RINVDVVKANLEHTLLKHPRFSSLQVKDVKKDGGMKWVPTKVDLDKHIII---PSLH---  515

Query  435   DETHRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASI  614
               T     K VEDY+  LSK  +D S+PLW+LHILN+KT DAE++AV R+HH+LGDG S+
Sbjct  516   -HTISSPDKMVEDYISNLSKTYIDYSKPLWELHILNIKTSDAESVAVFRIHHSLGDGMSL  574

Query  615   NSLLLACTRQTANPKLLPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT  794
              SL+L C+RQ +NPK LPT+  + +S            +     +LVWNT++DV +F+AT
Sbjct  575   MSLVLXCSRQISNPKALPTLPXKKTS----NPDPVXSGRIWWTIRLVWNTIIDVLMFLAT  630

Query  795   LFFLKDSQTPITPS--PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALS  968
               FLKD+ TP++          P+RF YR +SL+D   IK    TTINDV +GV+ A LS
Sbjct  631   TLFLKDTMTPLSNGWKKGGGHVPRRFVYRTVSLDDIKLIKNGMKTTINDVVMGVSLAGLS  690

Query  969   MYLNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
              YLNRRYG  K D G+ + +NNLPKN+RLR+ L  N+RP+ G+ ALA+MM  EKG     
Sbjct  691   RYLNRRYGETKEDKGATQKKNNLPKNIRLRATLMMNIRPSPGLHALAEMM--EKG-----  743

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
             SK  WGN  G  +LP  I + +DPLDYVR+ KAT DRKK+S+E IFT ++   V+K FG 
Sbjct  744   SKAKWGNWIGSMLLPFVIALYDDPLDYVRQTKATIDRKKHSHEAIFTCFIIKTVLKLFGA  803

Query  1323  KA  1328
             K 
Sbjct  804   KV  805



>dbj|BAJ97841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   353 bits (905),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 200/498 (40%), Positives = 279/498 (56%), Gaps = 39/498 (8%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-EENG  353
             PVSP+ RL  EP F+ +I+++ G  ++++       +  TL +HPRF S+ V+D+ EE+ 
Sbjct  37    PVSPTGRLFREPHFSCYIVSVFGLGARVDLAAVRAGLEATLARHPRFCSVQVIDELEEDA  96

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             + KWV T V+L  H+ V          D       + +E YV  LS   MD SRPLW+LH
Sbjct  97    RPKWVRTTVNLDDHVIVPHLDPTATSADP-----DRALEKYVSSLSTLPMDHSRPLWELH  151

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIST-----------  680
             +L+  T DA A  VLR+HH++GDG S+ SL +ACTR+ A+   LP +             
Sbjct  152   VLDFPTSDAAAAVVLRVHHSVGDGVSLLSLFIACTRRAADQGALPELPATGAPRRAGPVH  211

Query  681   ------RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSP  839
                   R                  +   L W+TLVDV  F AT    L D  T    + 
Sbjct  212   ALPSRPRHRPRSSWGALAFLAAWVASLLVLAWHTLVDVACFAATATAMLGDPPTLFKGAE  271

Query  840   ASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG  1019
               E +PKRF  R LSL+D   +K   + T+NDV LGVT AALS +  R+ G+        
Sbjct  272   GVEFRPKRFVNRTLSLDDVKYVKNTMSCTVNDVLLGVTSAALSRFYFRKTGESS------  325

Query  1020  QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIG  1199
                  K++++RS L  NLR   G+ ALA MM  E G+ N      WGNR GY ILP  I 
Sbjct  326   ----RKSIKVRSTLLVNLRKTPGLHALATMM--ESGKDNGAE---WGNRLGYMILPFHIA  376

Query  1200  MLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFS  1379
             M +DPL+YVR+A   A RKK S E +FTY+ A+ ++K FG KAAA L   +  N +  FS
Sbjct  377   MHDDPLEYVRKATKVARRKKSSMESVFTYWSASVIMKIFGIKAAASLCYGMMRNTTLSFS  436

Query  1380  NVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLD  1559
             NV GP E + F+GHPI +IAP+ YG P AL +H+QSY++ + ++++ +E   PD ++LLD
Sbjct  437   NVAGPSEQVVFYGHPIVYIAPSVYGHPHALTMHYQSYMNIIKLVLATEEEQFPDAHELLD  496

Query  1560  DFEKSLHLIKDaaaaaaT  1613
             DF +SL LI++AA+A  T
Sbjct  497   DFAESLKLIREAASAKNT  514



>ref|XP_010445752.1| PREDICTED: O-acyltransferase WSD1 [Camelina sativa]
Length=475

 Score =   350 bits (899),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 196/486 (40%), Positives = 287/486 (59%), Gaps = 30/486 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             EEP+SP +R+   P  +  I+ ++GF +KINPH+   ++ H + KHPRF S     K  +
Sbjct  6     EEPLSPMARVFLSPGIDNCIITMIGFKAKINPHIILDDLKHNVSKHPRFCS-----KLSD  60

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
                +W++T V++  H   V +P+++++  E       FV+DYV  L+   +D SRPLWD+
Sbjct  61    DGARWMKTRVNVEDH---VFSPDIDLQ--EIKDDGDGFVDDYVSRLTLSPLDKSRPLWDI  115

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIST--RSSSppkt  704
             HILN+KT DAEA+ V+R HH+L DG S+ SLL+ACTR+T++P+  PTI    R       
Sbjct  116   HILNVKTSDAEAVGVMRCHHSLADGMSLMSLLVACTRKTSDPEAFPTIPAIKRREKIGNK  175

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                        +  +L+WNT+VD+ + +AT  FLKD++TP+    A     +RF +R +S
Sbjct  176   GWFIRSIIAIYSAVRLIWNTIVDLLLLLATTLFLKDTETPLNEG-AGVGNTRRFYHRTVS  234

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNLPKNLRLRS  1055
             L+D   IK   N T+NDV LGVTQAALS YLN+RYG +   D  +   QNNLP  +R+R+
Sbjct  235   LDDIKLIKKTMNMTVNDVLLGVTQAALSRYLNQRYGNKDGEDGTTTSDQNNLPDGMRIRA  294

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              +  NLR   GIQ +ADM+ K        SK  WGN    A +P  I +  DPL  + +A
Sbjct  295   GVAVNLRQDIGIQPVADMLAKG-------SKCRWGNYVTLAFVPFSISLETDPLVPLLKA  347

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILT-------NKIFSNASTCFSNVVGP  1394
             K+  DR K+S+  +  Y + N ++  FGP A   +         + FSN +T  SN+VGP
Sbjct  348   KSIMDRMKHSFCAVVHYSIINVILNIFGPDAKVYIVINNSKVFKRTFSNTTTILSNIVGP  407

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++   G+ I +IA + YG   AL +HF SY +KM + I+VD +VIPDP+ + D  E+S
Sbjct  408   VEEVSLHGNHITYIALSSYGHSQALGIHFISYAEKMVISIAVDPSVIPDPHNICDKMEES  467

Query  1575  LHLIKD  1592
             L  +KD
Sbjct  468   LKAMKD  473



>dbj|BAJ93204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   351 bits (900),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 199/498 (40%), Positives = 279/498 (56%), Gaps = 39/498 (8%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-EENG  353
             PVSP+ RL  EP F+ +I+++ G  ++++       +  TL +HPRF S+ V+D+ EE+ 
Sbjct  37    PVSPTGRLFREPHFSCYIVSVFGLGARVDLAAVRAGLEATLARHPRFCSVQVIDELEEDA  96

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             + KWV T V+L  H+ V          D       + +E YV  LS   MD SRPLW+LH
Sbjct  97    RPKWVRTTVNLDDHVIVPHLDPTATSADP-----DRALEKYVSSLSTLPMDHSRPLWELH  151

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIST-----------  680
             +L+  T DA A  VLR+HH++GDG S+ SL +ACTR+ A+   LP +             
Sbjct  152   VLDFPTSDAAAAVVLRVHHSVGDGVSLLSLFIACTRRAADQGALPELPATGAPRRAGPVH  211

Query  681   ------RSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIAT-LFFLKDSQTPITPSP  839
                   R                  +   L W+TLVDV  F AT    L D  T    + 
Sbjct  212   ALPSRPRHRPRSSWGALAFLAAWVASLLVLAWHTLVDVACFAATATAMLGDPPTLFKGAE  271

Query  840   ASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEG  1019
               E +PKRF  R LSL+D   +K   + T+NDV LGVT AALS +  R+ G+        
Sbjct  272   GVEFRPKRFVNRTLSLDDVKYVKNTMSCTVNDVLLGVTSAALSRFYFRKTGESS------  325

Query  1020  QNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIG  1199
                  K++++RS L  NLR   G+ ALA MM  E G+ N      WGNR GY ILP  I 
Sbjct  326   ----RKSIKVRSTLLVNLRKTPGLHALATMM--ESGKDNGAE---WGNRLGYMILPFHIA  376

Query  1200  MLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFS  1379
             M +DPL+YVR+A   A RKK S E +FTY+ A+ ++K FG KAAA L   +  N +  FS
Sbjct  377   MHDDPLEYVRKATKVARRKKSSMESVFTYWSASVIMKIFGIKAAASLCYGMMRNTTLSFS  436

Query  1380  NVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLD  1559
             N+ GP E + F+GHPI +IAP+ YG P AL +H+QSY++ + ++++ +E   PD ++LLD
Sbjct  437   NMAGPSEQVVFYGHPIVYIAPSVYGHPHALTMHYQSYMNIIKLVLATEEEQFPDAHELLD  496

Query  1560  DFEKSLHLIKDaaaaaaT  1613
             DF +SL LI++AA+A  T
Sbjct  497   DFAESLKLIREAASAKNT  514



>emb|CDX70475.1| BnaC03g05590D [Brassica napus]
Length=481

 Score =   349 bits (896),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 197/477 (41%), Positives = 275/477 (58%), Gaps = 23/477 (5%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP +R+      +   + ++GF +KI   V    + H + KHPRF+S +  D      
Sbjct  13    PLSPMARVFQSRGIDYCAVTMIGFKTKIKLGVVLDALNHNVYKHPRFSSKLSSDGA----  68

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              KW+ETEV++  H+ V   P ++ E  E     + F++DY   L+   +D SRPLWD+HI
Sbjct  69    -KWIETEVNVKDHVVV---PYIDPE--EIGEDGEGFIDDYTSRLTMNPLDRSRPLWDIHI  122

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTIS---TRSSSppktl  707
             LN+KT D EA+ V+R HH LGDG S+ SLLLACT +T NP  + T      R        
Sbjct  123   LNVKTSDGEAVGVVRTHHTLGDGTSMVSLLLACTHKTPNPNRVSTTIPSLKRRERHKNKG  182

Query  708   kpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSL  887
                       +   L+WNT+VD+ +  ATL FLKD++T +       S PKRF +R +SL
Sbjct  183   WLLRSMFTIGSTMTLIWNTIVDMLLLFATLLFLKDTKTHLKGGADVGSNPKRFYHRTVSL  242

Query  888   NDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNLPKNLRLRSC  1058
             +D   IK   N TINDV +G+TQA+LS YLNRRY  +   D   I   NNLP  +R R+ 
Sbjct  243   DDIKLIKNTMNMTINDVLVGITQASLSSYLNRRYDNKNEEDGVLIAYPNNLPDGIRFRAG  302

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
                NLR   G + LADMM K+       SK  WGN F Y +LP  IG+ +DPL Y++ +K
Sbjct  303   CTVNLRSEIGFKPLADMMVKD-------SKCRWGNYFSYIVLPFSIGLQSDPLVYLKLSK  355

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
             +  DRKK+SY     Y +     K FG K AA L N+   N +T  SNV+GP+E++ F G
Sbjct  356   SMMDRKKHSYHAHLAYMMIKICQKSFGAKVAAKLFNRTVINTTTSLSNVIGPKEEISFDG  415

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +PI +IA + YG   AL++HF SY  KM + ++VD  +IPDP+++ DD E+SL  +K
Sbjct  416   NPITYIATSGYGHSQALLMHFMSYAGKMTISLAVDPTIIPDPHKICDDMEQSLKEMK  472



>emb|CDX68517.1| BnaC01g25950D [Brassica napus]
Length=586

 Score =   353 bits (905),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 194/486 (40%), Positives = 291/486 (60%), Gaps = 41/486 (8%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMV-VDKEE  347
             E+P+SP++RL H P FN +I++++G  SKI P V    +  TL++HPRF+  +V     +
Sbjct  25    EQPLSPAARLFHAPEFNCNIISVVGLKSKIKPAVIIEGIKQTLIRHPRFSCKLVESGNNK  84

Query  348   NGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
               + KWV+T+V    H+ +   P++++        +  F++ YV  L+   +D S+PLW+
Sbjct  85    RREQKWVQTKVVAEDHVVI---PKIDMHNIGNANADA-FLDSYVSNLTTIPLDTSKPLWE  140

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
             +H+L+L+T DAE +A+L++HH++GDG S+ SL+LACTR+T+NP  LP++  + SS   + 
Sbjct  141   VHLLDLRTSDAENVAILKIHHSVGDGMSLMSLVLACTRKTSNPDELPSLPNQKSSLSGSR  200

Query  708   kpnnp---kpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKPKRFAYR  875
               +          +   LV NT+ D   FIAT  FLKD++TPI  +   S SK     +R
Sbjct  201   SYSRLLWLVMALWSVVMLVLNTVCDALEFIATAMFLKDTETPIKGNFRLSTSKRMCCVHR  260

Query  876   ILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRS  1055
              +S +D   IK A   T+NDV LGV+QA LS YL RRYG       E +  +PK +RLR+
Sbjct  261   TVSFDDLKLIKNAMQMTVNDVILGVSQAGLSQYLKRRYG-------EQEEPMPKGIRLRA  313

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              L            LAD+M K        SK  WGN  GY I P  I + +DPL+++R A
Sbjct  314   ALL----------DLADIMAKG-------SKCTWGNWIGYIIFPFSISLCDDPLEHLRRA  356

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFF  1415
             K   DRKK S+E + T+ + NF++K FG + AA +  +  SN +  FSN+VGP E++ F+
Sbjct  357   KFIIDRKKNSFEALLTFIVGNFILKSFGVQRAANILKRALSNTTMSFSNMVGPIEEISFY  416

Query  1416  GHPIAFIAPTCYGQPSALMVHFQSYVDK--------MGVIISVDENVIPDPNQLLDDFEK  1571
             GHP+ ++AP+ YG P AL +HFQSY++K        M V ++VD   I DP++L DD+E+
Sbjct  417   GHPVTYMAPSVYGHPHALTMHFQSYMNKMKPGHLILMTVSLTVDPTAISDPHRLCDDWEE  476

Query  1572  SLHLIK  1589
             SL  IK
Sbjct  477   SLRSIK  482



>ref|XP_011008181.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=439

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 186/413 (45%), Positives = 266/413 (64%), Gaps = 19/413 (5%)
 Frame = +3

Query  102   RNLKPIETRKQ-KSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             R +KPI+T K  ++ + +++    ++P+SP +R+ HEP  N++I+ I+GF +KINP V  
Sbjct  4     RAIKPIQTAKNVENVLSSSSADEEQQPLSPMARMFHEPDSNVYIIIIIGFQTKINPEVMR  63

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNK  458
              N+ +TLLKHPRF+SL V D++  G++KWV TEVDL  H+ +   P ++   D       
Sbjct  64    ANLGNTLLKHPRFSSLQVPDEKHGGQLKWVRTEVDLDNHVKI---PTIDPNMDFP----D  116

Query  459   KFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACT  638
              +VEDYV  LSK ++ MS P+WDLH+LN+KT +AE++ +LR+HH++GDG S+ SL ++ T
Sbjct  117   MYVEDYVSNLSKTKISMSIPMWDLHLLNIKTSNAESVGILRVHHSIGDGTSLMSLFMSFT  176

Query  639   RQTANPKLLPT--ISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKD  812
             R+ ++P+ LPT  IS +      +        K  +   + WNTLVDV +F+ T+FFL D
Sbjct  177   RKASDPEALPTLPISKKQKPCSSSGGLLQHFIKLFSVLLIYWNTLVDVVMFLITIFFLDD  236

Query  813   SQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYG  992
             ++TP+       S P+R  +R +SL D   +K A N TINDV +GVTQAALS YLNR+YG
Sbjct  237   TKTPLKGPLGVGSTPRRIVHRTVSLEDVKLVKNAMNATINDVMVGVTQAALSRYLNRKYG  296

Query  993   --KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNR  1166
               K+D G  EG +NLPKN+RLR+  F NLRP  G +++A     EK ES+S  +   GN 
Sbjct  297   ENKKDGGGAEGNSNLPKNIRLRATSFVNLRPYLGNESVA-----EKTESSSNVR--LGNL  349

Query  1167  FGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
              GY +LP  I +  D LDYVR AKAT  RKK S E I+TY++A   +K F  K
Sbjct  350   IGYVLLPFTIALREDALDYVRSAKATGKRKKASLEAIYTYFMAKTFLKLFAGK  402



>gb|EAY75973.1| hypothetical protein OsI_03895 [Oryza sativa Indica Group]
Length=518

 Score =   349 bits (895),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 201/482 (42%), Positives = 278/482 (58%), Gaps = 33/482 (7%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EPVSPS+RL+ +      I+ ++G  + +N  V    +   L ++PRF S+ V D E+ G
Sbjct  49    EPVSPSARLVED----FFIVVVIGIATPVNDPVARAGIAAQLARYPRFRSIQVTD-EDGG  103

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               +WV T V+L  HI     PE+++  D       K VEDYV  LS + MD SRPLW+ H
Sbjct  104   NPRWVRTTVNLDDHIIY---PELDM--DAVAADPDKAVEDYVASLSTKPMDESRPLWEFH  158

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT---ISTRSSSppkt  704
             +L+  T +A A   +R+HH+LGDG S+ +LL+ACTR  A+P  LP    + TR+ +    
Sbjct  159   VLDFPTSEAAATTAIRVHHSLGDGMSLLTLLMACTRSAADPARLPAMPPLPTRAGAIYAR  218

Query  705   lkpnnpkpkpknf------fklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
              +P                  L W+T+VDV  F AT  FLKD  T        E + KR 
Sbjct  219   PRPPASAGALAFAAWLWSFVALAWHTVVDVASFFATTMFLKDPHTLFKRVKHGEFQRKRI  278

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +R LSL+D   +K A N T+NDV +G+T +ALS Y  R+ G +D           +++R
Sbjct  279   VHRGLSLDDVKLVKNAMNCTVNDVLVGITYSALSRYYYRKSGDKDTD---------EDIR  329

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             LRS L  NLRP   + A  DM+      S    +  WGN  G+ ILP  IG+  DPLDYV
Sbjct  330   LRSILLVNLRPTTSLHAYVDMIN-----SGREDEVKWGNALGFIILPFFIGVHKDPLDYV  384

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R+AK   DRKK S E +FT+  A  ++K FG KAAA + +++ S+ +  FSN++GP E +
Sbjct  385   RKAKKVVDRKKSSLEVVFTHLAAEVILKLFGLKAAAAIFHRMISHTTISFSNMIGPVEQV  444

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             EF GHP+ FIAP+ YG P AL V+FQSYV+ M V ++VDE   PD ++LLDDF +SL  I
Sbjct  445   EFCGHPVVFIAPSGYGPPEALTVNFQSYVNTMMVNLAVDEAQFPDCHELLDDFSESLRQI  504

Query  1587  KD  1592
             KD
Sbjct  505   KD  506



>ref|XP_004969548.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=538

 Score =   349 bits (895),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 287/512 (56%), Gaps = 44/512 (9%)
 Frame = +3

Query  129   KQKSGMENNNM----SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHT  296
             +  SG E +      ++ EEPVSP+ RL  EP F  HI+++ G  + ++       +  T
Sbjct  32    RAASGREEDKGGAVGAVEEEPVSPTGRLFREPNFRCHIVSVFGLAAPVDLPALRDGVAAT  91

Query  297   LLKHPRFTSLMVVDK-EENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVED  473
             L +HPRF S+  +++ E++ + KWV T V+L  HI V +        D       K +ED
Sbjct  92    LARHPRFCSVQALNEFEKDARPKWVRTAVNLDNHIIVPDLDPAATSADP-----DKALED  146

Query  474   YVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTAN  653
             YV  LS   MD S PLW++H+L+  T +A A   LR+HH++GDG S+ SL +ACTR  A+
Sbjct  147   YVSSLSTRPMDHSVPLWEVHVLDFPTAEAAAAVALRVHHSVGDGVSMLSLFMACTRSAAD  206

Query  654   PKLLPTI--STRSSSppktlkpnnpkpkpknffkl----------------VWNTLVDVF  779
             P  LP++  + R+       +   P         L                 W+T+VDV 
Sbjct  207   PGALPSLLPARRAGPVYAVRRRQRPPSSSAAAGALDALAALAAWVVAFLVLAWHTVVDVV  266

Query  780   IFIATLF-FLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQ  956
              F AT    L D+ T +     +E +PKRF  R LSL+D   +K A + T+NDV LG+T 
Sbjct  267   CFFATATSLLGDAPTVLKGQEGTEFRPKRFVNRTLSLDDVKFVKNAMSCTVNDVLLGITS  326

Query  957   AALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESN  1136
             AALS Y  R+ G+ D  SI           +RS +  NLRP  GIQ LA MM  E G+ N
Sbjct  327   AALSRYYFRKTGESDSNSIT----------VRSAVLVNLRPTPGIQTLASMM--ESGKDN  374

Query  1137  SMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFF  1316
                   WGN+ GY ++P  +   +DP++YVR A   A RKK S E +FT++  + V+K F
Sbjct  375   GAR---WGNKIGYMLIPFHLATHDDPIEYVRRATKVARRKKSSMESVFTFWSGDMVLKLF  431

Query  1317  GPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVD  1496
             G KAAA L   +F++ +  FSN+VGP E + F G+PI +IAP  YG P AL VH+QSY++
Sbjct  432   GIKAAAALCYGMFTHTTLSFSNMVGPPEQVLFCGNPIVYIAPGTYGHPHALTVHYQSYMN  491

Query  1497  KMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              + +++SVDE+  PD +QLLDDF +SL LI++
Sbjct  492   TVKLVLSVDESQFPDCHQLLDDFAESLRLIRE  523



>ref|NP_001044374.1| Os01g0770000 [Oryza sativa Japonica Group]
 dbj|BAB56064.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06288.1| Os01g0770000 [Oryza sativa Japonica Group]
 dbj|BAH00065.1| unnamed protein product [Oryza sativa Japonica Group]
Length=518

 Score =   348 bits (892),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 201/482 (42%), Positives = 277/482 (57%), Gaps = 33/482 (7%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EPVSPS+RL+ +      I+ ++G  + +N  V    +   L ++PRF S+ V D E+ G
Sbjct  49    EPVSPSARLVED----FFIVVVIGIATPVNDPVARAGIAAQLARYPRFRSIQVTD-EDGG  103

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               +WV T V+L  HI     PE+++  D       K VEDYV  LS + MD SRPLW+ H
Sbjct  104   NPRWVRTTVNLDDHIIY---PELDM--DAVAADPDKAVEDYVASLSTKPMDESRPLWEFH  158

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT---ISTRSSSppkt  704
             +L+  T +A A   +R+HH+LGDG S+ +LL+ACTR  A+P  LP    + TR+ +    
Sbjct  159   VLDFPTSEAAATTAIRVHHSLGDGMSLLTLLMACTRSAADPARLPAMPPLPTRAGAIYAR  218

Query  705   lkpnnpkpkpknf------fklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
              +P                  L W+T+VDV  F AT  FLKD  T        E + KR 
Sbjct  219   PRPPASAGALAFAAWLWSFVALAWHTVVDVASFFATTMFLKDPHTLFKRVKHGEFQRKRI  278

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +R LSL+D   +K A N T+NDV +G+T +ALS Y  R+ G  D           +++R
Sbjct  279   VHRGLSLDDVKLVKNAMNCTVNDVLVGITYSALSRYYYRKSGDMDTD---------EDIR  329

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             LRS L  NLRP   + A  DM+      S    +  WGN  G+ ILP  IG+  DPLDYV
Sbjct  330   LRSILLVNLRPTTSLHAYVDMIN-----SGREDEVKWGNALGFIILPFFIGVHKDPLDYV  384

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R+AK   DRKK S E +FT+  A  ++K FG KAAA + +++ S+ +  FSN++GP E +
Sbjct  385   RKAKKVVDRKKSSLEVVFTHLAAEVILKLFGLKAAAAIFHRMISHTTISFSNMIGPVEQV  444

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             EF GHP+ FIAP+ YG P AL V+FQSYV+ M V ++VDE   PD ++LLDDF +SL  I
Sbjct  445   EFCGHPVVFIAPSGYGPPEALTVNFQSYVNTMMVNLAVDEAQFPDCHELLDDFSESLRQI  504

Query  1587  KD  1592
             KD
Sbjct  505   KD  506



>emb|CDY15943.1| BnaA04g11680D [Brassica napus]
Length=480

 Score =   345 bits (886),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 196/503 (39%), Positives = 274/503 (54%), Gaps = 58/503 (12%)
 Frame = +3

Query  159   MSIAEE---PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLM  329
             MS  EE   P+SP +R+   P  +  I+ ++G  +KIN  V    +   + KHPRF+S  
Sbjct  1     MSTGEEDGEPLSPMARVFQLPGNDCCIITVIGCKTKINADVIRSGLNQNVFKHPRFSS--  58

Query  330   VVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDM  509
                K     + W++T+V++  HI V +  + E+  D      + FVEDYV  L+   +D 
Sbjct  59    ---KLSRDGLSWIKTQVNIEDHIFVADKDQNEIAED-----GELFVEDYVSRLTMIPLDK  110

Query  510   SRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTA--NPKLLPTISTR  683
             SRPLWD+HILN+KT DA+A+ V+R HH+LGDG S+ SLL ACT+ T+  +   +P +  R
Sbjct  111   SRPLWDIHILNVKTSDADAVCVIRSHHSLGDGTSLMSLLAACTQTTSHRDKATIPALKRR  170

Query  684   SSSppktlk-pnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPK  860
                    +           +  +L+WNT VD+ + +A   FLKD++TP+      ES PK
Sbjct  171   KRVYKDKVSWFVRLILAIFSSVRLIWNTFVDLVLLLAIAVFLKDTKTPLKGDVGVESSPK  230

Query  861   RFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKN  1040
             +  +R +SL+D   IK A + TINDV LGVTQAALS YLN               N P  
Sbjct  231   KLCHRTVSLDDLRVIKEAMSMTINDVLLGVTQAALSRYLN---------------NFPGK  275

Query  1041  LRLRSCLFFNLRPAKGIQA--------------------LADMMKKEKGESNSMSKWGWG  1160
             +RL + +F NLRP KGIQ                     LADMM K        SK  WG
Sbjct  276   IRLTAGVFVNLRPDKGIQVRNVHTSSLKYSKNTEIFSLPLADMMAKN-------SKCRWG  328

Query  1161  NRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAIL  1340
             N F     P+ I +  DPL Y+ +AK+  DR+K+S  P   +    F+   FG K    L
Sbjct  329   NYFSSISFPISICLEADPLVYLSKAKSAMDRRKHSLLPALAFSSTEFIFNTFGAKLGGTL  388

Query  1341  TNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISV  1520
               ++ SN +T  SN++GP +++ F GHPI +IAP+ YG   AL +HF SY +KM + I+V
Sbjct  389   LKRLVSNTTTFISNMIGPTDEISFHGHPIVYIAPSVYGHAHALTIHFLSYAEKMVISIAV  448

Query  1521  DENVIPDPNQLLDDFEKSLHLIK  1589
             D NVIP P+QL D+ E SL  IK
Sbjct  449   DPNVIPSPHQLCDEIEDSLKAIK  471



>gb|EAY75974.1| hypothetical protein OsI_03896 [Oryza sativa Indica Group]
Length=507

 Score =   346 bits (887),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 276/482 (57%), Gaps = 33/482 (7%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EPVSPS+RLL +      I+ ++G  + +N  V    +     ++PRF S+ V D E+ G
Sbjct  45    EPVSPSARLLED----FFIVVVIGIATPVNDPVARAGIAAQFARYPRFRSIQVTD-EDGG  99

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
               +WV T ++L  HI     PE+++  D       K VEDYV  LS + MD SRPLW+ H
Sbjct  100   NPRWVRTTLNLDDHIIY---PELDM--DAVAADPDKAVEDYVASLSTKPMDESRPLWEFH  154

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT---ISTRSSSppkt  704
             +L+  T +A A   +R+HH+LGDG S+ +LL+ACTR  A+P  LP    + TR+ +    
Sbjct  155   VLDFPTSEAAATTAIRVHHSLGDGMSLLTLLMACTRSAADPARLPAMPPLPTRAGAIYAR  214

Query  705   lkpnnpkpkpknf------fklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
              +P                  L W+T+VDV  F AT  FLKD  T        E + KR 
Sbjct  215   PRPPASAGALAFAAWLWSFVALAWHTVVDVASFFATTMFLKDPHTLFKRVKHGEFQRKRI  274

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +R LSL+D   +K A N T+NDV +G+T +ALS Y  R+ G  D           +++R
Sbjct  275   VHRGLSLDDVKLVKNAMNCTVNDVLVGITYSALSRYYYRKSGDTDTD---------EDIR  325

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             LR+ L  NLRP   + A  DM+      S    +  WGN  G+ ILP  IGM  DPLDYV
Sbjct  326   LRTILLVNLRPTTSLHAYVDMIN-----SGREDEVKWGNALGFIILPFFIGMHKDPLDYV  380

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R+AK   DRKK S E +FT+  A  ++K FG KAAA + +++ S+ +  FSN++GP E +
Sbjct  381   RKAKKVVDRKKSSLEVVFTHLAAEVILKLFGLKAAAAIFHRMISHTTISFSNMIGPVEQV  440

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             EF GHP+ FIAP+ YG P AL V+FQSY++ M V ++VDE   PD ++LLDDF +SL  I
Sbjct  441   EFCGHPVVFIAPSGYGPPEALTVNFQSYINTMMVNLAVDEAQFPDCHELLDDFSESLRQI  500

Query  1587  KD  1592
             KD
Sbjct  501   KD  502



>ref|XP_003569566.1| PREDICTED: O-acyltransferase WSD1-like [Brachypodium distachyon]
Length=519

 Score =   346 bits (888),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 199/492 (40%), Positives = 273/492 (55%), Gaps = 41/492 (8%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EPVSP+ RL  EP FN +I+++ G  + ++       +  TL +HPRF S+ V+D E   
Sbjct  41    EPVSPTGRLFREPHFNCYIVSVFGLGAPVDLPAVRAGLEATLARHPRFHSVQVLDAE-GA  99

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             + KWV T V+L  H+ V +   +     +  R     +EDYV  LS   MD SRPLW+LH
Sbjct  100   RPKWVRTTVNLDDHVVVPDLDAITATPADPDRA----LEDYVSSLSTLPMDHSRPLWELH  155

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------------  674
             +L+  T +A A    R+HH++GDG S+ SL LACTR+TA+P  LP I             
Sbjct  156   VLDFPTSEAAAALAFRVHHSVGDGVSLLSLFLACTRRTADPSALPAIIPAARRAGPAVYA  215

Query  675   --STRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPIT----PS  836
                 R                  +F  LVW+T VDV  F+AT      ++ P T      
Sbjct  216   LPPQRPRLQSLGALLVFLVAWVGSFLVLVWHTAVDVACFVATA--ASAARDPPTLFRGAE  273

Query  837   PASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIE  1016
                E +PKRF  R LSL+D   IK A N T+NDV LGV  AALS Y  R+ G+       
Sbjct  274   EGVEFRPKRFVNRTLSLDDVKHIKNAMNCTVNDVLLGVASAALSRYYFRKTGE-------  326

Query  1017  GQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKI  1196
                N+ K++++RS L  NLR   G+  LA MM     ES   S   WGNR GY ILP  +
Sbjct  327   ---NVRKSIKVRSTLLVNLRKTPGLHTLASMM-----ESGKDSGAKWGNRLGYMILPFHL  378

Query  1197  GMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCF  1376
                +D L+YVREA   A RKK S E + TY+ A+ ++K FG KAAA L   +  N +  F
Sbjct  379   AKHDDHLEYVREATKVARRKKSSMESVLTYWSASIIMKIFGIKAAASLCYSMMRNTTLSF  438

Query  1377  SNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLL  1556
             S++ GP E + F GHPI +IAP+ YG P AL +H+QSY+  + ++++VDE  +PD ++LL
Sbjct  439   SSLAGPSEQVVFCGHPIVYIAPSVYGHPHALTMHYQSYMRIIKLVLAVDETQVPDAHELL  498

Query  1557  DDFEKSLHLIKD  1592
             DDF +SL LI++
Sbjct  499   DDFTESLKLIRE  510



>ref|XP_009760121.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nicotiana 
sylvestris]
Length=456

 Score =   343 bits (881),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 196/467 (42%), Positives = 281/467 (60%), Gaps = 36/467 (8%)
 Frame = +3

Query  108   LKPIETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNM  287
             +KPI T K+   ++ N        +SP+SR  HEP +NL++LAI+G+   IN       +
Sbjct  11    IKPIRTTKK---LDANGGEEEALLMSPTSRTFHEPNYNLYVLAILGWKVPINVDAMKAEI  67

Query  288   PHTLLKHPRFTSLMVVDKEENGK-MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
                LLKHPRF+SL V+D+ ++ + MKW+ T V+L  H+ V +     ++ +  +    K 
Sbjct  68    QSKLLKHPRFSSLQVIDESDDSRNMKWIPTTVNLDDHVIVPD-----LKPNPNNMDTDKL  122

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             VEDY+  LS   +DMS+PLWDLHILN+KT  AEA  + R+HH++GDG S+ SLLL+C R+
Sbjct  123   VEDYISNLSAVSIDMSKPLWDLHILNVKTSHAEATCIFRLHHSIGDGVSLVSLLLSCFRK  182

Query  645   TANPKLLPTISTR------------SSSppktlkpnnpkpkpknffklVWNTLVDVFIFI  788
             +++P  LPT+               ++             K  +   L++NT+VDV +F+
Sbjct  183   SSDPTSLPTLLVSSSSSSKGKSNLSNNRGSIWSLMWQYLVKLWSCISLLFNTVVDVPMFV  242

Query  789   ATLFFLKDSQTPIT-PSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAAL  965
             AT  FLKDSQ+P T P     S   RF YR +SL+D   IK  TN+T+NDV LG+TQAAL
Sbjct  243   ATALFLKDSQSPFTVPQGFKSSTRLRFVYRTVSLDDIKFIKNLTNSTVNDVILGITQAAL  302

Query  966   SMYLNRRYGKRDIGSIEGQNNL-PKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
             S Y++R+Y       IEG+    P+ +R R+ +  NLRP  G+QA+A+M++K        
Sbjct  303   SRYVHRKY------EIEGKRKFSPQKMRCRASVVMNLRPLLGVQAVAEMIEKNTVVIQ--  354

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
                  GN FG  I+PL I   ++PLDYVR+AK T DRKK+S E   T+YL+  + K FG 
Sbjct  355   -----GNCFGIVIIPLSISQFDNPLDYVRKAKTTMDRKKHSLESRCTFYLSQLLTKLFGF  409

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPS  1463
             K AA L  +  S+ +  FSNV+GP E++ +  HP+AFIAPTCYGQ +
Sbjct  410   KGAAALAPRALSHTTLFFSNVLGPLEEVSWSRHPLAFIAPTCYGQST  456



>emb|CDY14417.1| BnaC03g21780D [Brassica napus]
Length=480

 Score =   343 bits (880),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 178/472 (38%), Positives = 277/472 (59%), Gaps = 17/472 (4%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP SRL   P F   I+  +GF ++ N       + +T +K PRF+S +V+D ++NG
Sbjct  13    EPLSPVSRLFVSPGFYGVIVFTLGFKTRCNSSAIVEGIKNTWIKLPRFSSKVVMDDKKNG  72

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             +  WV   V +  H+ V +    ++   +      +F+EDY   ++   MDMSRPLW+ H
Sbjct  73    EAVWVPVNVRVEDHVFVPDIDHFDITNPD------QFIEDYTSNIANTTMDMSRPLWEFH  126

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT +AE+L + + HH+LGDG S+ SLL A +R+ ++P  LPT +T +     +   
Sbjct  127   VLNIKTSNAESLGIGKFHHSLGDGMSLMSLLYASSRKISDPNALPTTAT-TRKQVGSNDN  185

Query  714   nnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLND  893
                  +     ++++ T +++F  + TL F++D++TP+   P   + P++  +RI+S +D
Sbjct  186   WWLVARFLLMIRVIFTTFIELFKSLLTLCFMRDTKTPLMGKPGDRNGPRKIIHRIVSFDD  245

Query  894   FFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNL  1073
                +K      +NDV LG+TQA LS YL ++YG+  +   E + +L +  RLR  +  NL
Sbjct  246   VKFVKNTMKMKVNDVLLGITQAGLSRYLRKKYGEDPV--TEKKKSLEET-RLRGTIAVNL  302

Query  1074  RPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADR  1253
             RP   I+ LADMM K        SK  WGN  G  I PL I   +DPL+YVR AKAT D+
Sbjct  303   RPETKIKDLADMMTKG-------SKCRWGNFIGVVIFPLWIRSEDDPLEYVRRAKATMDK  355

Query  1254  KKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAF  1433
             KK S E +  Y    F +K FG KA   +T ++FS+ +  FSNV+GP ED+ FF HP+ +
Sbjct  356   KKISMEALVLYGFIKFTMKIFGEKAVEAITKRVFSHTTLTFSNVLGPNEDISFFEHPMCY  415

Query  1434  IAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +  +    P AL++H+ SY DK+ + ++VD  VIPDP+ L D+  +SL +IK
Sbjct  416   VGASALIGPQALIIHYVSYADKIIINLAVDTTVIPDPHVLCDNLVESLEIIK  467



>emb|CDX83070.1| BnaA01g20700D [Brassica napus]
Length=468

 Score =   342 bits (878),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 188/477 (39%), Positives = 282/477 (59%), Gaps = 49/477 (10%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMV-VDKEEN  350
             +P+SP++RL H P FN +I++++G  SKI P V    +  TL++HPRF+  +V     + 
Sbjct  26    QPLSPAARLFHAPEFNCNIISVVGLKSKIKPAVIIDGIKQTLIRHPRFSCKLVESGNNQR  85

Query  351   GKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDL  530
              + KWV+T+V    H+ +   P++++   E    +  F++ YV +L+   +D S+PLW++
Sbjct  86    REQKWVQTKVVAEDHVVI---PKIDMHNIENANADA-FLDSYVSDLTTIPLDTSKPLWEV  141

Query  531   HILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlk  710
             H+L+L+T DAE +A+L++HH++GDG S+ SL+LACTR+T+NP  LP++  + SS   +  
Sbjct  142   HLLDLRTSDAENVAILKIHHSVGDGMSLMSLVLACTRKTSNPDELPSLPNQKSSLSGSRS  201

Query  711   pnn---pkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPS-PASESKPKRFAYRI  878
              +          +   LV NT+ D   FIAT  FLKD++TPI  +   S SK     +R 
Sbjct  202   YSRLFWLVMALWSVAMLVLNTVCDALEFIATTMFLKDTETPIKGNFRLSTSKRMCCVHRT  261

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSC  1058
             +S +D   IK A   T+NDV LGV+QA LS YL RRY                       
Sbjct  262   VSFDDLKLIKNAMQMTVNDVILGVSQAGLSQYLKRRYE----------------------  299

Query  1059  LFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAK  1238
                        Q LAD+M  E G     S   WGN  GY I P  I + +DPL+++R AK
Sbjct  300   -----------QDLADIM--ENG-----SNCTWGNWIGYIIFPFSISLCDDPLEHLRRAK  341

Query  1239  ATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFG  1418
                DRKK S+E + T+ + NF++K FG + AA +  +  SN +  FSN+VGP E++ F+G
Sbjct  342   FIIDRKKNSFEALLTFIVGNFILKSFGVQRAANILKRALSNTTMSFSNMVGPIEEISFYG  401

Query  1419  HPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             HP+ ++AP+ YG P AL +HFQSY++KM V ++VD  VI DP++L DD+E+SL  IK
Sbjct  402   HPVTYMAPSVYGHPHALTMHFQSYMNKMTVSLTVDPTVISDPHRLCDDWEESLRSIK  458



>emb|CDY03658.1| BnaA02g15790D [Brassica napus]
Length=478

 Score =   342 bits (876),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/478 (39%), Positives = 280/478 (59%), Gaps = 24/478 (5%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             + E PVSP SRL   P  +   +  +GF ++ +P  F   + +TLL HPRF+ ++     
Sbjct  9     VGEIPVSPFSRLFSMPGLDCFNIVTIGFKNEASPSAFIEGLKNTLLNHPRFSCILETGSG  68

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             E+ K +W+ T V++  H+ V   P +    D T     +F+EDY   +    +D+ +PLW
Sbjct  69    EH-KPRWIPTNVNVKDHVVV---PNI----DPTIENPDQFLEDYTSNMVFSPIDVCKPLW  120

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             ++HILN+KT DAE+L V R HH+LGDG S+ SLLLAC+R+T++P  LPT+  +  S    
Sbjct  121   EIHILNIKTSDAESLLVARFHHSLGDGMSLMSLLLACSRKTSDPGALPTLVAQKKSKVTN  180

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +   +   +     KL++NT+V+VF F+  L  ++D+ TP+   P +   P +F +R++S
Sbjct  181   VVWWSLVSRLWLIIKLMFNTVVEVFKFLLILCSVRDNATPLMEKPRATLTPNKFIHRVIS  240

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK---NLRLRS  1055
             L+D   +K A N T+NDV LG+ QA LS YL+++Y        E    L K   N+ LR 
Sbjct  241   LDDVKVVKNAMNMTVNDVILGMVQAGLSRYLSQKYDS------ETNPKLKKSLENICLRG  294

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              +FFNLR  K I+ LA MM  EKG ++      WGN  GY ++PL I   ND  +Y+R +
Sbjct  295   VVFFNLRSNKKIEDLAKMM--EKGSTSR-----WGNSIGYVMIPLWIKSENDIFEYIRRS  347

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFF  1415
             K   DRKK S EP+F+Y L    ++ FG KA   L  +IF  ++   SNV GP E++  F
Sbjct  348   KTIMDRKKLSLEPLFSYTLFKLTVEVFGYKALRTLAMRIFGRSTVVLSNVAGPTEEISLF  407

Query  1416  GHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
              H I+++A +  G P AL+VH  SYV+K  + + VD +VIPDP+ L D   ++L ++K
Sbjct  408   DHQISYVAASISGFPQALIVHITSYVNKAIINLGVDLDVIPDPHHLCDHIVEALQIMK  465



>ref|XP_008675193.1| PREDICTED: O-acyltransferase WSD1-like [Zea mays]
 tpg|DAA58114.1| TPA: hypothetical protein ZEAMMB73_078342 [Zea mays]
Length=525

 Score =   343 bits (879),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 194/495 (39%), Positives = 280/495 (57%), Gaps = 27/495 (5%)
 Frame = +3

Query  129   KQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKH  308
             KQ +G+     +I EEPVSP+ RL  EP F  HI+++ G  + ++       +  TL +H
Sbjct  36    KQAAGVV---AAIEEEPVSPTGRLFREPNFRCHIVSVFGLGAPVDLPALRAGVAATLARH  92

Query  309   PRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYEL  488
             PRF S+ VV+ E++ + KW+ T V++  HI V E        D       K +EDYV  L
Sbjct  93    PRFCSVQVVN-EKDARPKWIRTAVNVDDHIIVPELNPATTSADP-----DKALEDYVSSL  146

Query  489   SKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLP  668
             S   M  SRPLW++H+L+  T DA A   LR HH++GDG S+ SL +ACTR  A+P  LP
Sbjct  147   STRPMAHSRPLWEVHVLDFPTADAAAALALRAHHSVGDGVSMLSLFMACTRSAADPGALP  206

Query  669   TI--STRSSSppktlk----pnnpkpkpknffklVWNTLVDVFIFIATLF-FLKDSQTPI  827
             ++  + R+       +             +   L W T VDV  F+AT    L D+ T +
Sbjct  207   SLPPARRAGPVHAVRRPAGALAALAAWLLSLLVLAWRTAVDVACFVATAASLLGDAPTVL  266

Query  828   TPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIG  1007
                  +E +P+RF  R LSL+D   +K A   T+NDV LG+T +ALS Y  RR G+ D  
Sbjct  267   KGKEGTEFQPRRFVNRTLSLDDIKLVKNAVGCTVNDVLLGITSSALSRYYYRRTGESDS-  325

Query  1008  SIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILP  1187
                      +++ +RS +  NLR   GI ALA MM  E G  N+     WGN+ GY ++P
Sbjct  326   --------KRSITVRSAVLVNLRATPGIHALASMM--ESGNDNNNGAARWGNKLGYMLIP  375

Query  1188  LKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNAS  1367
               +   +DP +YVR A     RKK S E  FT++  + V++ FG KAAA L   +F++ +
Sbjct  376   FHLAKHDDPTEYVRTAAKVTRRKKSSMESAFTFWSGDMVLRLFGIKAAAALCYGMFTHTT  435

Query  1368  TCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPN  1547
               FS++VGP E + F G+PI +IAP+ YG P AL VH+QSY++ + +++SVDE   PD  
Sbjct  436   LSFSSMVGPTEQVLFCGNPIVYIAPSTYGHPHALTVHYQSYINSVKLVLSVDEAQFPDGR  495

Query  1548  QLLDDFEKSLHLIKD  1592
             QLLDDF +SL +I++
Sbjct  496   QLLDDFAESLRIIRE  510



>ref|XP_010428065.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=470

 Score =   341 bits (874),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 183/475 (39%), Positives = 273/475 (57%), Gaps = 28/475 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              E PVSP +RL   P  ++  +  +G  ++ NP      + +TL+ HPRF S++V    E
Sbjct  10    GEAPVSPFARLFSLPGLDVFNIVTIGCKTEGNPSTIVEGLKNTLINHPRFFSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               GK KW+ T+V + +H+ V   P++    D       +F+EDY   ++   MDMS+PLW
Sbjct  70    HKGKAKWIPTKVKVEEHVIV---PDI----DSNIENPDEFLEDYTSRMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE++AV R HH+LGDG S+ SLLLACTR+T +P+ LPT      S  K 
Sbjct  123   EFHLLKLKTSHAESVAVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVAPKKSKDKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +               +++T V+V   +  +   +D+   I   P +  +  +F ++I+S
Sbjct  183   VCFVVVAWLWFIVRV-MFHTCVEVIKSVVFICCARDTSAHIMGKPGATLRNNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A N T+NDV  G+ QA LS YLN+RY            +L   LRL   +F
Sbjct  242   LDDVKMVKNAMNMTVNDVLFGMVQAGLSRYLNKRY------------DLEDKLRLHGVVF  289

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP + I+ LA+MM K        SK  WGN  GY ++PL++   +D  +YVR++K  
Sbjct  290   FNLRPNRNIEDLANMMAKG-------SKCRWGNSIGYVLIPLEMKSYDDVFEYVRQSKTM  342

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              +RKKYS EP+F++ L    +  FG KA   L  KIF + +  FSNVVGP E++ FFGH 
Sbjct  343   MNRKKYSLEPLFSHVLLKLTLDVFGFKALKTLVTKIFGSTTMIFSNVVGPAEEISFFGHV  402

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA + +G P  L++  QSYVDK+ + + VD +VIPDP+ L D   ++L ++K
Sbjct  403   ISYIAASTFGVPQGLIIGVQSYVDKLIINVGVDVDVIPDPHHLCDLIIEALSMMK  457



>emb|CDX78486.1| BnaA03g03980D [Brassica napus]
Length=479

 Score =   341 bits (875),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 277/476 (58%), Gaps = 23/476 (5%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP +R+      +   + ++GF +KI P V    + H + KHPRF+S +  D      
Sbjct  13    PLSPMARVFQSRGIDYCAVTMIGFKTKIKPAVVLDALKHNVYKHPRFSSKLSSDGA----  68

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              KW+ETEV++  H+ V   P ++ E  E     + F+++Y   L+   MD SRPLWD+HI
Sbjct  69    -KWIETEVNVKDHVVV---PYIDPE--EIGEDGEGFIDNYTSRLTMNPMDRSRPLWDIHI  122

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTAN----PKLLPTISTRSSSppkt  704
             LN+KT DAEA+ V+R HH LGDG S+ SLLL+CT +T++       +P++  R       
Sbjct  123   LNVKTSDAEAVGVVRTHHTLGDGTSMVSLLLSCTHKTSDHNRVSTTIPSLK-RRGRYKNK  181

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                        +   L+WNT+VD+ +  ATL FLKD++T I       S PKRF +R +S
Sbjct  182   GWFLRSMFTIGSTMTLIWNTIVDMLLLFATLLFLKDTKTHIKGGADVGSNPKRFYHRTIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS-IEGQNNLPKNLRLRSCL  1061
             L+D   IK A N TINDV +G+TQ +LS YL++     + G+ I   NNLP  ++ R+  
Sbjct  242   LDDIKLIKNAMNMTINDVLVGITQVSLSSYLSQHTKNEEDGALIPYPNNLPGGIQFRAGC  301

Query  1062  FFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKA  1241
               NLR  KG++ LADMM K+       SK  WGN F Y +LP  IG+ +DPL Y++ +K+
Sbjct  302   TVNLRSEKGLKPLADMMVKD-------SKCRWGNYFSYIVLPFSIGLQSDPLVYLKLSKS  354

Query  1242  TADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGH  1421
               DRKK+SY     Y +        G K AA L N+   N +T  SNV+GP E++ F G+
Sbjct  355   MMDRKKHSYHAHLAYMMIKICQNLLGAKVAAKLFNRTVINTTTSLSNVIGPMEEISFDGN  414

Query  1422  PIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             PI +IA + YG   AL++HF SY  +M + ++VD  +IPDP+++ DD E+SL  +K
Sbjct  415   PITYIATSGYGHSQALLMHFMSYAGRMTITLAVDPTIIPDPHKICDDMEQSLKEMK  470



>ref|XP_009133325.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Brassica rapa]
Length=480

 Score =   341 bits (875),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 178/472 (38%), Positives = 277/472 (59%), Gaps = 17/472 (4%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP SRL   P F   I+  +GF ++ N       + +T +K PRF+S +V+D ++NG
Sbjct  13    EPLSPVSRLFVSPGFYGVIVFTLGFKTRCNSSAIVEGIKNTWIKLPRFSSKVVMDDKKNG  72

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             +  WV   V +  H+ V +    ++   +      +F+EDY   ++   MDMSRPLW+ H
Sbjct  73    EAVWVPVNVRVEDHVFVPDIDHSDITNPD------QFIEDYTSNIANTLMDMSRPLWEFH  126

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT +AE+L + + HH+LGDG S+ SLL A +R+ ++P  LPT +T +     +   
Sbjct  127   VLNIKTSNAESLGIGKFHHSLGDGMSLMSLLYASSRKISDPNALPTTAT-TRKQVGSDDN  185

Query  714   nnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLND  893
                  +     ++++ T +++F  + TL F++D++TP+   P   + P++  +RI+S +D
Sbjct  186   WWLVARFWLMIRVIFTTFIELFKSLLTLCFMRDTKTPLMGKPGDRNGPRKIIHRIVSFDD  245

Query  894   FFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNL  1073
                +K      +NDV LG+TQA LS YL ++YG+  +   E + +L +  RLR  +  NL
Sbjct  246   VKFVKNTMKMKVNDVLLGITQAGLSRYLRKKYGEDPV--TEKKKSLEET-RLRGTIAVNL  302

Query  1074  RPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADR  1253
             RP   I+ LADMM K        SK  WGN  G  I PL I   +DPL+YVR AKAT D+
Sbjct  303   RPETKIKDLADMMTKG-------SKCRWGNFIGVVIFPLWIRSEDDPLEYVRRAKATMDK  355

Query  1254  KKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAF  1433
             KK S E +  Y    F +K FG KA   +T ++FS+ +  FSNV+GP ED+ FF HP+ +
Sbjct  356   KKISMEALVLYGFIKFTMKIFGVKAVEAITKRVFSHTTLTFSNVLGPNEDISFFEHPMCY  415

Query  1434  IAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +  +    P AL++H+ SY DK+ + ++VD  VIPDP+ L D+  +SL +IK
Sbjct  416   VGASALIGPQALIIHYVSYADKIIINLAVDTTVIPDPHVLCDNLVESLEIIK  467



>ref|XP_009131282.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=479

 Score =   341 bits (874),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 189/476 (40%), Positives = 277/476 (58%), Gaps = 23/476 (5%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             P+SP +R+      +   + ++GF +KI P V    + H + KHPRF+S +  D      
Sbjct  13    PLSPMARVFQSRGIDYCAVTMIGFKTKIKPAVVLDALKHNVYKHPRFSSKLSSDGA----  68

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              KW+ETEV++  H+ V   P ++ E  E     + F+++Y   ++   MD SRPLWD+HI
Sbjct  69    -KWIETEVNVKDHVVV---PYIDPE--EIGEDGEGFIDNYTSRITMNPMDRSRPLWDIHI  122

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTAN----PKLLPTISTRSSSppkt  704
             LN+KT DAEA+ V+R HH LGDG S+ SLLL+CT +T++       +P++  R       
Sbjct  123   LNVKTSDAEAVGVVRTHHTLGDGTSMVSLLLSCTHKTSDHNRVSTTIPSLK-RRGRYKNK  181

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                        +   L+WNT+VD+ +  ATL FLKD++T I       S PKRF +R +S
Sbjct  182   GWFLRSMFTIGSTMTLIWNTIVDMLLLFATLLFLKDTKTHIKGGADVGSNPKRFYHRTIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGS-IEGQNNLPKNLRLRSCL  1061
             L+D   IK A N TINDV +G+TQ +LS YL++     + G+ I   NNLP  ++ R+  
Sbjct  242   LDDIKLIKNAMNMTINDVLVGITQVSLSSYLSQHTKNEEDGALIPYPNNLPGGIQFRAGC  301

Query  1062  FFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKA  1241
               NLR  KG++ LADMM K+       SK  WGN F Y +LP  IG+ +DPL Y++ +K+
Sbjct  302   TVNLRSEKGLKPLADMMVKD-------SKCRWGNYFSYIVLPFSIGLQSDPLVYLKLSKS  354

Query  1242  TADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGH  1421
               DRKK+SY     Y +        G K AA L N+   N +T  SNV+GP E++ F G+
Sbjct  355   MMDRKKHSYHAHLAYMMIKICQNLLGAKVAAKLFNRTVINTTTSLSNVIGPMEEISFDGN  414

Query  1422  PIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             PI +IA + YG   AL++HF SY  +M + ++VD  +IPDP+++ DD E+SL  +K
Sbjct  415   PITYIATSGYGHSQALLMHFMSYAGRMTITLAVDPTIIPDPHKICDDMEQSLKEMK  470



>emb|CDY07682.1| BnaA03g18290D [Brassica napus]
Length=480

 Score =   341 bits (874),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 179/472 (38%), Positives = 276/472 (58%), Gaps = 17/472 (4%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP SRL   P F   I+  +GF ++ N       + +T +K PRF+S +V+D ++NG
Sbjct  13    EPLSPVSRLFVSPGFYGVIVFTLGFKTRCNSSAIVEGIKNTWIKLPRFSSKVVMDDKKNG  72

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             +  WV   V +  H+ V +    ++   +      +F+EDY   ++   MDMSRPLW+ H
Sbjct  73    EAVWVPVNVRVEDHVFVPDIDHSDITNPD------QFIEDYTSNIANTLMDMSRPLWEFH  126

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT +AE+L + + HH+LGDG S+ SLL A +R+ ++P  LPT +T +     +   
Sbjct  127   VLNIKTSNAESLGIGKFHHSLGDGMSLMSLLYASSRKISDPNALPTTAT-TRKQVGSNDN  185

Query  714   nnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLND  893
                  +     ++++ T +++F  + TL F++D++TP+   P   + P++  +RI+S +D
Sbjct  186   WWLVARFWLMIRVIFTTFIELFKSLLTLCFMRDTKTPLMGKPGDRNGPRKIIHRIVSFDD  245

Query  894   FFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNL  1073
                +K      +NDV LG+TQA LS YL ++YG  D    E + +L +  RLR  +  NL
Sbjct  246   VKFVKNTMKMKVNDVLLGITQAGLSRYLRKKYG--DDPVTEKKKSLEET-RLRGTIAVNL  302

Query  1074  RPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADR  1253
             RP   I+ LADMM K        SK  WGN  G  I PL I   +DPL+YVR AKAT D+
Sbjct  303   RPETKIKDLADMMTKG-------SKCRWGNFIGVVIFPLWIRSEDDPLEYVRRAKATMDK  355

Query  1254  KKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAF  1433
             KK S E +  Y    F +K FG KA   +T ++FS+ +  FSNV+GP ED+ FF HP+ +
Sbjct  356   KKISMEALVLYGFIKFTMKIFGVKAVEAITKRVFSHTTLTFSNVLGPNEDISFFEHPMCY  415

Query  1434  IAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +  +    P AL++H+ SY DK+ + ++VD  VIPDP+ L D+  +SL +IK
Sbjct  416   VGASALIGPQALIIHYVSYADKIIINLAVDTTVIPDPHVLCDNLVESLEIIK  467



>ref|XP_009127901.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=478

 Score =   340 bits (873),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 185/478 (39%), Positives = 280/478 (59%), Gaps = 24/478 (5%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             + E PVSP SRL   P  +   +  +GF ++ +P  F   + +TLL HPRF+ ++     
Sbjct  9     VGEIPVSPFSRLFSMPGLDCFNIVTIGFKNEASPSAFIEGLKNTLLNHPRFSCILETGSG  68

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             E+ K +W+ T V++  H+ V   P +    D T     +F+EDY   +    +D+ +PLW
Sbjct  69    EH-KPRWIPTNVNVKDHVVV---PNI----DPTIENPDQFLEDYTSNMVFSPIDVCKPLW  120

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             ++HILN+KT DAE+L V R HH+LGDG S+ SLLLAC+R+T++P  LPT+  +  S    
Sbjct  121   EIHILNIKTSDAESLLVARFHHSLGDGMSLMSLLLACSRKTSDPGALPTLVAQKKSKVTN  180

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +   +   +     KL++NT+V+VF F+  L  ++D+ TP+   P +   P +F +R++S
Sbjct  181   VVWWSLVSRLWLIIKLMFNTVVEVFKFLLILCSVRDNATPLMEKPRATLTPNKFIHRVIS  240

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPK---NLRLRS  1055
             L+D   +K A N T+NDV LG+ QA LS YL+++Y        E    L K   N+ LR 
Sbjct  241   LDDVKVVKNAMNMTVNDVILGMVQAGLSRYLSQKYDS------ETNPKLKKSLENICLRG  294

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              +FFNLR  K I+ LA MM  EKG ++      WGN  GY ++PL +   ND  +Y+R +
Sbjct  295   VVFFNLRSNKKIEDLAKMM--EKGSTSR-----WGNSIGYVMIPLWMKSENDIFEYIRRS  347

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFF  1415
             K   DRKK S EP+F+Y L    ++ FG KA   L  +IF  ++   SNV GP E++  F
Sbjct  348   KTIMDRKKLSLEPLFSYTLFKLTVEVFGYKALRTLAMRIFGRSTVVLSNVAGPTEEISLF  407

Query  1416  GHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
              H I+++A +  G P AL+VH  SYV+K  + + VD +VIPDP+ L D   ++L ++K
Sbjct  408   DHQISYVAASISGFPQALIVHITSYVNKAIINLGVDLDVIPDPHHLCDHIVEALQIMK  465



>ref|XP_010415938.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=471

 Score =   340 bits (872),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 275/475 (58%), Gaps = 28/475 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              EEPVSP +RL   P  ++  +  +GF +K NP +    + +TL+ HPRF+S++V    E
Sbjct  10    GEEPVSPFARLFSLPGLDVFNILTIGFKTKTNPSILVEGLKNTLINHPRFSSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
                K KW+ T+V + +H+ V   P++    D       +F+EDY  +++   MDMS+PLW
Sbjct  70    HKEKAKWIPTKVIVEEHVIV---PDI----DPNIENPNEFLEDYTSKMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE++ V R HH+LGDG S+ SLLLACTR+T +P+ LPT      +  K 
Sbjct  123   EFHLLKLKTSHAESVVVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVAPKKNKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +               +++T V+V   I  +   +D+   I   P +     +F ++I+S
Sbjct  183   ICFALVAWLWFIVRF-MFHTCVEVIKSIVFISCARDTSAHIMGKPGATLNNNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A N TINDV  G+ QA LS YLN+RY            +L   L L   +F
Sbjct  242   LDDIKMVKNAMNMTINDVLFGMVQAGLSRYLNQRY------------DLEDKLHLHGVVF  289

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP + I+ LA+MM K        SK  WGN  GY ++PL +   +D  +YVR++K  
Sbjct  290   FNLRPNRNIEELANMMAKG-------SKCRWGNSIGYVLIPLDMKSNDDVFEYVRQSKIV  342

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK+S EP+F++ L    ++ FG KA   L  +IF + +  FSNVVGP E++ FFGH 
Sbjct  343   MDRKKHSLEPLFSHVLLKLTLEVFGFKALKTLVKRIFGSTTMIFSNVVGPAEEISFFGHK  402

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I+++A + +G P  L++  QSYVDK+ + I VD +VIPDP+ L D   ++LH++K
Sbjct  403   ISYVASSTFGFPQGLIIGTQSYVDKLIINIGVDVDVIPDPHHLRDLIIEALHMMK  457



>ref|XP_010428063.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=470

 Score =   340 bits (871),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/475 (39%), Positives = 276/475 (58%), Gaps = 28/475 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              EEPVSP +RL   P  ++  +  +G  ++ NP      + +TL+ HPRF S++V    E
Sbjct  10    GEEPVSPFARLFSLPGLDVFNVVTIGSKTEGNPSTIIEGLKNTLINHPRFFSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               GK KW+ T+V + +H+ V   P++    D       +F+EDY   ++   MDMS+PLW
Sbjct  70    HKGKAKWIPTKVKVEEHVIV---PDI----DSNIENPDEFLEDYTSRMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE++AV R HH+LGDG S+ SLLLACTR+T +P+ LPT      S  K 
Sbjct  123   EFHLLKLKTSHAESVAVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVAPKKSKDKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +               +++T V+V   +  +   +D+   I   P +  +  +F ++I+S
Sbjct  183   VCFVVVAWLWFIVRV-MFHTCVEVIKSVVFICCARDTSAHIMGKPGATLRNNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A N T+NDV  G+ QA LS YLN+RY            +L   LRL   +F
Sbjct  242   LDDVKMVKNAMNMTVNDVLFGMVQAGLSRYLNKRY------------DLEDKLRLHGVVF  289

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP + I+ LA+MM K        SK  WGN  GY ++PL++   +D  +YVR++K  
Sbjct  290   FNLRPNRNIEDLANMMAKG-------SKCRWGNSIGYVLIPLEMKSYDDVFEYVRQSKTM  342

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              +RKK+S EP+F++ L    ++ FG KA   L  KIF + +  FSNVVGP E++ FFGH 
Sbjct  343   MNRKKHSLEPLFSHGLLKLTMEVFGFKALKTLVTKIFGSTTMIFSNVVGPTEEISFFGHQ  402

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA + +G P  L++  QSYV+K+ + I+VD +VIPDP+ L D   ++L ++K
Sbjct  403   ISYIAASTFGIPQGLVISIQSYVEKLIINIAVDVDVIPDPHHLCDLIIEALSMMK  457



>gb|KFK41644.1| hypothetical protein AALP_AA2G154500 [Arabis alpina]
Length=448

 Score =   339 bits (869),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 192/477 (40%), Positives = 272/477 (57%), Gaps = 58/477 (12%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-EE  347
             EEPVSP +RLL  P  ++  +  +G  ++ +P      + +TL+ HPRF+S+++    E 
Sbjct  11    EEPVSPFARLLSLPGLDVFNVITIGCKTECDPSTIVEGLKNTLINHPRFSSILLTGHGEH  70

Query  348   NGKMKWVETEVDLSQHITVVEA-PEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             NGK KW+ TEV +  H+TV +  P++E   DE       F+E+Y  +++   MDMS+PLW
Sbjct  71    NGKAKWIPTEVKVEDHVTVPDIDPDIE-NPDE-------FLENYTSDMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + HILN+KT  AE +AV R HH+LGDG S+ SLLLACTR+T +P+ LPT      +  K 
Sbjct  123   EFHILNIKTSYAEVVAVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVVPKQTKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                              W+T + +                    P +     +F ++I+S
Sbjct  183   A---------------CWDTAIHLM-----------------GKPGATLSCNKFIHKIIS  210

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR---LRS  1055
             L+D   +K   N TINDV  G+ QA LS Y N+RYG      +E   N  K+L    L  
Sbjct  211   LDDVKRVKNVMNMTINDVLFGMVQAGLSRYFNQRYG------LETTTNPRKSLDKICLHG  264

Query  1056  CLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREA  1235
              +FFNLRP + I+ LA+MM K        SK  WGN  GY +LPL I   ND L+YVR+A
Sbjct  265   VVFFNLRPNRDIEDLANMMAKG-------SKCRWGNSVGYVLLPLWIKSENDILEYVRQA  317

Query  1236  KATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFF  1415
             K T DRKK S EP+F+Y L    ++ FG KA   L  +IF + +  FSNVVGP E++ FF
Sbjct  318   KTTMDRKKLSLEPLFSYGLLKLTMELFGLKALKNLVKRIFGSTTIIFSNVVGPAEEISFF  377

Query  1416  GHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             GH I++IA   +G P A+++  QSYVDK+ + +SVD +VIPDP+ L D   +SL ++
Sbjct  378   GHQISYIAACTFGFPQAMVISIQSYVDKLIINLSVDLDVIPDPHHLCDLIIESLGMM  434



>ref|XP_006302205.1| hypothetical protein CARUB_v10020217mg [Capsella rubella]
 gb|EOA35103.1| hypothetical protein CARUB_v10020217mg [Capsella rubella]
Length=479

 Score =   340 bits (871),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 277/475 (58%), Gaps = 19/475 (4%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVD-KE  344
              EEPVSP +RL   P  ++  +  +G  ++ NP      + +TL+ HPRF+S++V    E
Sbjct  10    GEEPVSPFARLFSLPGLDVFNIVTIGCKTEGNPSTIIEGLKNTLINHPRFSSILVTGYGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             + GK KW+ T+V +  H+ V   P++    D       +F+EDY   ++   MDM++PLW
Sbjct  70    QKGKAKWIPTKVKVEDHVIV---PDI----DPNIENPDEFLEDYTSNMALSPMDMTKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE++AV R HH+LGDG S+ SLLLACTR+T +P+ LPT      S  K 
Sbjct  123   EFHLLKLKTSHAESVAVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVVPKKSKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +               +++T V+V   I  +   KD+   I   P +  +  +F +RI+S
Sbjct  183   VCSALVGWLWFIVRV-MFHTCVEVIKSIIFICCAKDTSAHIMGKPGATLRNNKFLHRIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A + T+NDV  G+ QA LS YL++RY   D+ +      +    RL   +F
Sbjct  242   LDDVKMVKNAMSMTVNDVLFGMVQAGLSRYLHQRY---DLETSPKSRKIIDKKRLHGVVF  298

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP + I+ LA+MM K        SK  WGN  GY ++PL++   +D  +YVR++K  
Sbjct  299   FNLRPNRDIEDLANMMAKG-------SKCRWGNSIGYVLIPLEMKSNDDVFEYVRQSKTM  351

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK+S EP+F++ L    ++ FG KA   L  +IF + +  FSNVVGP E++ FFGH 
Sbjct  352   MDRKKHSLEPLFSHGLLKCTLEVFGFKALKTLITRIFGSTTMIFSNVVGPAEEISFFGHR  411

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA + +G P  L++  QSYVDK+ + I VD +VIPDP+ L D   ++LH +K
Sbjct  412   ISYIAASTFGIPQGLIIGIQSYVDKLIINIGVDVDVIPDPHHLCDLIVEALHTMK  466



>ref|XP_010520975.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Tarenaya hassleriana]
Length=489

 Score =   340 bits (872),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 264/425 (62%), Gaps = 30/425 (7%)
 Frame = +3

Query  336   DKEENGKM-KWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMS  512
             D E+ GK  +WV T V++  H+ V   PE+++EG +     ++F + YV  L+   ++ S
Sbjct  75    DGEKRGKKPRWVRTNVNVQDHVIV---PEIDLEGIQ---DTEQFTDHYVTNLTTVPLNTS  128

Query  513   RPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSS  692
             +PLW++HILN+KT DAE++AV+R HH+LGDG S+ SL+LACTR+T++P+ LPT+      
Sbjct  129   KPLWEIHILNVKTSDAESIAVIRSHHSLGDGLSLMSLVLACTRKTSDPEALPTVPVMKRH  188

Query  693   ppktlkpnnpkpkpknf---fklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKR  863
                    N             +L+ NT+VDV +F+AT  FLKD++TP+         PKR
Sbjct  189   QLFRSDRNLFIRSVLAVWLVMRLILNTVVDVLLFLATTLFLKDTETPLKGGADVGLNPKR  248

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY---GKRDIGSIEGQNNLP  1034
             FA+RI+ L+D   IK A   TINDV LGVTQAALS YLNRRY    K D  +   +NNLP
Sbjct  249   FAHRIVPLDDIKLIKNAMKMTINDVLLGVTQAALSRYLNRRYDNNNKEDEITRGNRNNLP  308

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
             + +RLR+ +           +LADMM K        SK+ WGNR GY ILP  I +  +P
Sbjct  309   RRIRLRATVL----------SLADMMGKG-------SKFRWGNRIGYVILPFSITLRTNP  351

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             LD++ +AKAT DRKK S E   TY+ A  V+   G K AA + ++  SN +  FSN+VGP
Sbjct  352   LDHLSKAKATIDRKKLSLEAALTYFSAKLVLNTLGVKVAAKIVHRALSNTTMSFSNIVGP  411

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++ F+GHPI++ AP+ YG P AL VHFQSY +KM +  +VD   I DP +L DDFE+S
Sbjct  412   VEEISFYGHPISYFAPSVYGHPQALTVHFQSYANKMTISTAVDPKAISDPRKLCDDFEES  471

Query  1575  LHLIK  1589
             L  IK
Sbjct  472   LKAIK  476



>ref|XP_010427904.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Camelina sativa]
Length=473

 Score =   339 bits (870),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 270/475 (57%), Gaps = 25/475 (5%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              EE VSP ++L   P  ++  +   GF ++ NP      + +TL+ HPRF+S++V    E
Sbjct  10    GEEAVSPFAQLFSLPGLDVFNIVTFGFKTEGNPSTIVEGLKNTLINHPRFSSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               GK KW  T+V + +H+ V   P++    D  ++   +F+EDY+  ++   MDMSRPLW
Sbjct  70    HKGKAKWTPTKVKVEEHVIV---PDI----DLINKNPDEFLEDYISRVAFSPMDMSRPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE + V R HH+LGDG S+ SLLLACTR+T +P+ LPT           
Sbjct  123   EFHLLKLKTSHAEYVIVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTF-VAPKKRKAK  181

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                 +          ++++T V+V   +  +F ++D    I   P +     +F ++I+S
Sbjct  182   NVCFSLFAWLWFIVIIMFHTCVEVIKSMVFIFGVRDISAHIIAMPGATLSTNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             LND  ++K A N T+NDV LG+ QA LS YLN+R+    I          K+ ++R  +F
Sbjct  242   LNDVKTVKNAMNMTVNDVLLGMVQAGLSQYLNQRFDHETIS---------KSRKIRGVVF  292

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP K I+ LA+MM K        SK  WGN  GY + PL+    +D  +YVR++K  
Sbjct  293   FNLRPNKNIEDLANMMAKG-------SKCRWGNSIGYVLFPLETKSYDDVFEYVRQSKTI  345

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK+S EP+F+  L    +K FG K    L  K+F +    FSNVVGP E++ FFGH 
Sbjct  346   MDRKKHSLEPLFSNGLLKLTLKVFGFKGLRTLVRKLFGSTKMTFSNVVGPAEEISFFGHQ  405

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA    G P  L++  QSYVDK+ + I VD +VIPDP+ L D   ++LH +K
Sbjct  406   ISYIAANTIGIPQGLVICIQSYVDKLIINIGVDVDVIPDPHHLCDLIIEALHKMK  460



>ref|XP_007019907.1| O-acyltransferase family protein [Theobroma cacao]
 gb|EOY17132.1| O-acyltransferase family protein [Theobroma cacao]
Length=597

 Score =   343 bits (880),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 203/509 (40%), Positives = 293/509 (58%), Gaps = 44/509 (9%)
 Frame = +3

Query  105   NLKPIE-TRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTH  281
              LK I+ TR  K G   +     EEP+SP +R+ HEP  N+          +IN  +  H
Sbjct  13    GLKQIKVTRDMKEGQSVSGEE--EEPLSPMARMFHEPDSNVK---------EINDAL--H  59

Query  282   NMPHTL-------LKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDE  440
              +P  L       +         V D+   G++KWV+TEV+L +H+ +   P V+ E   
Sbjct  60    AIPMILQTLTCSNMNSAYRQGRRVADENNGGELKWVKTEVELEKHVII---PRVD-EEMA  115

Query  441   THRKNKKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINS  620
             +     KFVEDY+  +SK ++ +S P+WD HILN+KT DAE++ VL +HH+LGDG S+ S
Sbjct  116   SQGAADKFVEDYIANISKTKISLSIPMWDCHILNIKTSDAESVLVLLVHHSLGDGTSLMS  175

Query  621   LLLACTRQTANPKLL---PTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIA  791
             LL++C+R+ ++   L   P +  +      T        +  +FF L+WNT VD+ + +A
Sbjct  176   LLISCSRKLSDLLALLTFPAMKKKQMPTTTTTTWLCFWIRLWSFFLLIWNTSVDLLVCVA  235

Query  792   TLFFLKDSQTPITPSPAS-ESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALS  968
             TLFF KD+ TP+ PS       P R   R  +L+D   +K ATN T+NDV L +TQA LS
Sbjct  236   TLFFYKDTPTPLKPSSRRVACTPGRIMRRTFTLDDIKLVKNATNMTVNDVVLAITQAGLS  295

Query  969   MYLNRRYG--KRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSM  1142
              YLNR+YG  KR+    + ++NLP N+RLR+ LF NLR + GI AL +M+KK        
Sbjct  296   RYLNRKYGKTKRNEAGRKWEDNLPNNIRLRATLFINLRSSPGIYALGEMLKKN-------  348

Query  1143  SKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGP  1322
             SK  WGN+ GY + P  I + ++ LDY+R+ KA  DRKK   E  F   +A   ++F+  
Sbjct  349   SKAEWGNKIGYVLFPFTISLKDNLLDYIRDVKAATDRKKAYLEAKFRLLMAMVFVRFYRT  408

Query  1323  KAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKM  1502
             K A       F + +  FSNV  P++D+  FG+ +A+IAP+ YGQ  AL VH  SY   +
Sbjct  409   KFAK------FPSTTMWFSNVARPQDDITIFGNQVAYIAPSLYGQLVALTVHVVSYAKMI  462

Query  1503  GVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
              +++SVD+N+I DP QL DD E+SL LIK
Sbjct  463   SMVLSVDDNIISDPYQLCDDLEESLKLIK  491



>ref|XP_009127897.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Brassica rapa]
Length=477

 Score =   339 bits (869),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/485 (38%), Positives = 275/485 (57%), Gaps = 41/485 (8%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEE  347
              E PVSP SRL   P  +   +  +GF  + NP  F   + +TLL HPRF+S++     E
Sbjct  10    GEVPVSPFSRLFSMPGLDCFNIVTIGFKHEANPSAFVEGLKNTLLNHPRFSSIL-----E  64

Query  348   NG----KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR  515
              G    K KW+ T+V    H+ V   P++    D T +   +F+EDY   +    +DMS+
Sbjct  65    TGVGGKKAKWIPTKVKAEDHVVV---PDI----DPTIQNPDQFLEDYTSNMVFSPIDMSK  117

Query  516   PLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSp  695
             PLW++HILN+KT DAE+  V R HH+LGDG S+ SLLLAC+R+ ++P+ LPT+     S 
Sbjct  118   PLWEMHILNMKTSDAESFLVARFHHSLGDGMSLMSLLLACSRKASDPESLPTLVAPKKSK  177

Query  696   pktlkpnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPSPASESK  854
                +  +            VW       NT V+VF F+  L  ++D+ TP+   P +   
Sbjct  178   VTNVLWSLVAR--------VWFIIRLMCNTFVEVFNFLLILCSVRDAATPLMEKPIATLS  229

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLP  1034
             P +F +R++SL+D   +K A N T+NDV LG+ QA LS YL+++Y       ++      
Sbjct  230   PNKFIHRVISLDDVKIVKNAMNMTVNDVILGMVQAGLSRYLSQKYDSETNSKLKRS---L  286

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
             +N+ LR+ +FFNLR  K I+ LA MM K       +S   WGN  GY ++PL +   ND 
Sbjct  287   ENVSLRAAVFFNLRSNKKIEDLAKMMAK-------LSTSRWGNSIGYVMIPLWMRSENDI  339

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
              +Y+R AK   DRKK S EP+F+Y L    ++ FG KA   L  +IF  ++   SNV GP
Sbjct  340   FEYIRRAKTIMDRKKLSLEPLFSYVLLKLTVEIFGSKALRNLAMRIFGRSTIILSNVAGP  399

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++  F H I+++A +  G P AL+VH  SYV+K+ + + VD +VIPDP+ L D   ++
Sbjct  400   SEEISLFDHQISYVAASVSGFPQALIVHITSYVNKVIINLGVDLDVIPDPHHLCDHMVEA  459

Query  1575  LHLIK  1589
             L ++K
Sbjct  460   LQMMK  464



>ref|XP_010474267.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=473

 Score =   339 bits (869),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 274/475 (58%), Gaps = 25/475 (5%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              EE VSP ++L   P  ++  +   GF ++ NP      +  TL+ HPRF+S++V    E
Sbjct  10    GEEAVSPFAQLFSLPGLDVFNIVTFGFKTEGNPSTIVEGLKKTLINHPRFSSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             +  K KW  T+V + +H+ V   P++    D  ++   +F+EDY   ++   MDMSRPLW
Sbjct  70    QKRKAKWTPTKVKVEEHVIV---PDI----DLINKNPDEFLEDYTSRMAFSPMDMSRPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  A+ + V R HH+LGDG S+ SLLLACTR+T +P+ LPT           
Sbjct  123   EFHLLKLKTSHAKYVIVGRFHHSLGDGMSLMSLLLACTRKTCDPEALPTF-VAPKKRKVK  181

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                 +         +++++T V+V   +  +F ++D+   I  +P +     +F ++I+S
Sbjct  182   NVCFSLFAWLWFIVRVMFHTCVEVIKSMVFIFGVRDTSAHIIATPGATLSTNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D  ++K A N T+NDV LG+ QA LS YLN+R+G              K+ ++R  +F
Sbjct  242   LDDVKTVKNAMNMTVNDVVLGMVQAGLSQYLNQRFG---------HETSSKSRKIRGVVF  292

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP K I+ LA+MM K        SK  WGN  GY ++PL+    +D  +YVR++K  
Sbjct  293   FNLRPNKNIEDLANMMAKG-------SKCRWGNSIGYVLIPLETKSYDDVFEYVRQSKTI  345

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK+S EP+F+  L    +K FG K    L  K+F   +  FSNVVGP E++ FFGH 
Sbjct  346   MDRKKHSLEPLFSNGLLKLTLKLFGFKGLRTLVRKLFGTTTMTFSNVVGPSEEISFFGHH  405

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA    G P  L++  QSYVDK+ + I+VD +VIPDP+ L D   ++LH++K
Sbjct  406   ISYIAANTIGIPQGLVICIQSYVDKLIINIAVDVDVIPDPHHLCDLIIEALHMMK  460



>ref|XP_002864239.1| hypothetical protein ARALYDRAFT_495410 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40498.1| hypothetical protein ARALYDRAFT_495410 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   338 bits (866),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 190/481 (40%), Positives = 278/481 (58%), Gaps = 31/481 (6%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             + EEP+SP +RL   P  +  I+ ++GF +KIN  +    +   + KHPRF S     K 
Sbjct  6     VEEEPLSPMARLFQSPGIDNCIVTMIGFKAKINRDIILDELKQNVSKHPRFCS-----KL  60

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
              +   +W++ +V++  H   V AP+++ +  E ++    FV+DYV  L+   +D S+PLW
Sbjct  61    SDDGARWMKIKVNVEDH---VFAPDIDPQ--EINKDGDSFVDDYVSRLTLIPLDKSKPLW  115

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------STR  683
             D+HILN+KT DAEA+ V+R HH+L DG S+ SL +A TR+T++ +  PTI          
Sbjct  116   DIHILNVKTSDAEAVGVMRCHHSLADGMSLMSLSVAFTRKTSDLEAFPTIPAIKRREQIM  175

Query  684   SSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKR  863
             S                    +L+WNT+VD+ + +AT+ FLKD++TP+    +  +  +R
Sbjct  176   SQRLGNKGWLLRWIFAIYFAVRLIWNTIVDLLLLLATIMFLKDTETPLNEGASVGNNARR  235

Query  864   FAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKR---DIGSIEGQNNLP  1034
             F +R +SL+D   IK A N TINDV LGVTQAALS YLN+RYG +   D  +    NNLP
Sbjct  236   FYHRTISLDDIKLIKNAMNMTINDVLLGVTQAALSRYLNQRYGDKDGEDGTTTSDLNNLP  295

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
               +R+R+ +  NLR   GIQ + DM+ K        SK  WGN      +PL I +  DP
Sbjct  296   GEIRIRAGVAVNLRQDIGIQPVEDMLAKG-------SKCRWGNYDSLVFVPLSISLEIDP  348

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGP  1394
             L  + +AK+  DRKK+S+     Y +  F+I  FGPK    +  +  SN +T  SN+VGP
Sbjct  349   LVPLLKAKSIMDRKKHSHCAAMHYSVLEFIINTFGPK----VFKRTCSNTTTILSNIVGP  404

Query  1395  REDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKS  1574
              E++   G+ I +IA + YG   ALM+HF SY  KM + I+VD  VIPDP+ + D+ EKS
Sbjct  405   VEEVSLHGNCITYIALSGYGHSQALMIHFISYAKKMVITIAVDPAVIPDPHNICDEMEKS  464

Query  1575  L  1577
             L
Sbjct  465   L  465



>ref|XP_010924518.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Elaeis guineensis]
Length=473

 Score =   337 bits (864),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 269/474 (57%), Gaps = 62/474 (13%)
 Frame = +3

Query  177   PVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENGK  356
             PVSP+ RL  +P FN HI+++MG   +++       +  TL++HPRF+S+ V D++    
Sbjct  55    PVSPAGRLFLQPRFNCHIVSVMGCGKRLDVDAVKAGLEVTLVRHPRFSSIQVSDEK---P  111

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
             ++WV T+V++  H+ + +     ++ + T     K VEDYV  LS   MD SRPLWDLHI
Sbjct  112   LRWVRTKVNVEDHVIIPD-----LDPNATSANPDKVVEDYVASLSSTTMDHSRPLWDLHI  166

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkpn  716
             LN  T +A A+A+LR+HH+LGDG S+ SL LACTRQ ++P  LP++    SS     +  
Sbjct  167   LNFVTSEAAAVAILRIHHSLGDGISLMSLFLACTRQCSDPDRLPSLPDARSSTAANSRSG  226

Query  717   npkpkpknffklV--WNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLN  890
               +     +  LV  W+TLVDV +F ATL F+KD++TP+      E  PKRF +R +SL+
Sbjct  227   ILELLLWVWAGLVLAWHTLVDVVLFTATLAFVKDTRTPLVGMEGVEFHPKRFLHRTVSLD  286

Query  891   DFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFN  1070
             D   IK A N T+NDV +G+T A LS YL+RRYG+ D    E +  LP N+RLR+ L  N
Sbjct  287   DIKDIKKAMNCTVNDVLVGITSAGLSRYLDRRYGEGDDVKKE-KKRLPANIRLRTALLVN  345

Query  1071  LRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATAD  1250
             +R   GI ALA+MM+K KG            + GY +L   I +  DPL+Y+R  KA A+
Sbjct  346   IRRTPGIHALAEMMEKGKGGGAKWGN-----KLGYMVLQFPIAIFEDPLEYIRRGKAIAE  400

Query  1251  RKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIA  1430
             RKK S E +FTY+ A  ++K FG +                                   
Sbjct  401   RKKNSLEAVFTYWSAWVIVKIFGIE-----------------------------------  425

Query  1431  FIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
                        AL +HFQSY + M ++++VDE  IP+PNQLLDD  +SL LIKD
Sbjct  426   -----------ALTLHFQSYTNTMKIVVAVDELTIPNPNQLLDDLTESLRLIKD  468



>gb|EMS49019.1| O-acyltransferase WSD1 [Triticum urartu]
Length=498

 Score =   338 bits (867),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/499 (39%), Positives = 282/499 (57%), Gaps = 37/499 (7%)
 Frame = +3

Query  129   KQKSGMENNNMSIAE--EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLL  302
             K  +G E    + AE  EPVSPS+RL+     + +I+ +MG ++ +N       +   L 
Sbjct  14    KTAAGREGRTAAEAELGEPVSPSARLVE----DFYIIVLMGASTPLNLPALRAGIEAQLA  69

Query  303   KHPRFTSLMVVDKEENGKMKWVETEVDLSQHIT--VVEAPEVEVEGDETHRKNKKFVEDY  476
             ++P F S+ V DK  +G+++W  T V++  H+    ++   V    D       K VEDY
Sbjct  70    RYPHFRSIQVTDK--DGELRWAPTTVNVENHLIRPTLDPAAVAANPD-------KAVEDY  120

Query  477   VYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANP  656
             V  LS   MD S+PLW+ H+ +  T +A + A +R+HH+LGDG S+ +LL+ACTR  A+P
Sbjct  121   VASLSTLPMDRSQPLWEFHLFDFPTSEATSTAAIRVHHSLGDGMSLLTLLMACTRSAADP  180

Query  657   KLLPTISTRSSSppktlkpnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDS  815
               LP I    S      +   P      +   VW       +T+VDV  F AT+ FLKD 
Sbjct  181   TRLPAIPPLPSRTGAIYQRPRPSAGVLAYLLWVWSFVVLAWHTVVDVAGFFATILFLKDP  240

Query  816   QTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK  995
              T       +E++ KR  +R LSL+D   +K A   T+NDV +GVT AALS Y  R+ G 
Sbjct  241   HTLFKRVNHAETQRKRIVHRRLSLDDVKFVKNAMKCTVNDVLIGVTYAALSRYHFRKSG-  299

Query  996   RDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGY  1175
                    G+ +  K +R+RS L  NLRP   + A  DM+K     S   S   WGN  G+
Sbjct  300   -------GETDTRKEIRVRSMLLVNLRPTTSLHACVDMIK-----SGKESHVKWGNELGF  347

Query  1176  AILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIF  1355
              ILP  IGM +DPLDYVR+ K   DRKK S E +FT+  A  + K FG KAA+ + +++ 
Sbjct  348   IILPFFIGMHSDPLDYVRKGKKVVDRKKSSLEVVFTHVAAEVIFKVFGLKAASAIFHRMI  407

Query  1356  SNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVI  1535
             S+ +  F+N+ GP E +EF GHPI FIAP+ YG P AL V++QSYV+ + + +++DE   
Sbjct  408   SHTTISFANMTGPVEQVEFCGHPIVFIAPSGYGPPEALTVNYQSYVNTIMINLALDEGHF  467

Query  1536  PDPNQLLDDFEKSLHLIKD  1592
             PD ++LLDDF +SL  IKD
Sbjct  468   PDYDELLDDFVESLEDIKD  486



>ref|XP_006411123.1| hypothetical protein EUTSA_v10016602mg [Eutrema salsugineum]
 gb|ESQ52576.1| hypothetical protein EUTSA_v10016602mg [Eutrema salsugineum]
Length=474

 Score =   337 bits (864),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/475 (36%), Positives = 280/475 (59%), Gaps = 17/475 (4%)
 Frame = +3

Query  165   IAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKE  344
             IA +P+SP S+L   P F   I+  +GF ++ +P      + +T +K PRF+S +  D +
Sbjct  4     IAMKPLSPVSQLFLSPGFYGVIVFTLGFKTRCDPSAIVEGITNTWIKLPRFSSKVETDDK  63

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             +NG+  WV   V +  H+ V +     ++  +      +F+EDY   L+   MDM+RPLW
Sbjct  64    KNGEAVWVPVSVRVEDHVIVPDLDHSNIDNPD------QFIEDYTSNLANTPMDMTRPLW  117

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+LN+KT +AE+L + + HH+LGDG S+ SLL A +R+ ++P+ LPT +  +    ++
Sbjct  118   EFHVLNIKTSNAESLGIGKFHHSLGDGMSLMSLLYASSRKISDPEALPTTAA-TRKHVES  176

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                     +     ++++ T++D+F    TL F++D++ P+   P    +P++   RI+S
Sbjct  177   NSNWWLVGRLWLMIRIIFTTIIDLFKMSLTLCFMRDTKNPLMGKPGDRIRPRKVIQRIIS  236

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
              +D   +K      +NDV LG+TQA LS YL++ YG+     + G+  + + +RLR  + 
Sbjct  237   FDDVKFVKKTLKMKVNDVLLGMTQAGLSRYLSKTYGEE---PVVGKKTILEKIRLRGTVA  293

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
              NLRP   I+ LADMM K        SK  WGN  G  + PL I   +DPLDYVR AKAT
Sbjct  294   VNLRPHTKIEDLADMMTKG-------SKCRWGNFIGVVMFPLWIRSEDDPLDYVRRAKAT  346

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              D+KK S E + +Y    F++K FG K    ++ ++F + +  FSNV+GP E++ FF HP
Sbjct  347   MDKKKISMEALVSYGFIKFLMKVFGQKVVDTVSTRMFGHTTLTFSNVLGPCEEISFFKHP  406

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             ++++  +    P AL++HF SYVDK+ + ++VD  VIP+P+ L DD  +SL++IK
Sbjct  407   MSYVGASALIGPQALIIHFVSYVDKIIINLAVDTTVIPNPHLLCDDLVESLNIIK  461



>ref|XP_010100760.1| O-acyltransferase WSD1 [Morus notabilis]
 gb|EXB84227.1| O-acyltransferase WSD1 [Morus notabilis]
Length=617

 Score =   340 bits (873),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 182/389 (47%), Positives = 244/389 (63%), Gaps = 23/389 (6%)
 Frame = +3

Query  180   VSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEE-NGK  356
             +SP++RL   P FN +I++I+G NS I+P V    +  TL KHPRF+S +VVD  +   +
Sbjct  15    LSPAARLFQSPRFNCYIVSIIGCNSTIDPEVIKDGLTRTLFKHPRFSSKLVVDDGKFCRR  74

Query  357   MKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLHI  536
              +WV T V+L  H+ +       + G +    ++ FVEDY+  L+   +D+S+PLW+LH+
Sbjct  75    RRWVRTPVNLDDHVFI------RILGSKIENPDQ-FVEDYISHLTTTPLDLSKPLWELHL  127

Query  537   LNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI------STRSSSpp  698
             LNLKT D+E+L + R+HH++GDGAS+ SLLLACTR+T++P  LPT+           S  
Sbjct  128   LNLKTSDSESLGIFRIHHSVGDGASLMSLLLACTRRTSDPDALPTLPAPSKRPPPPDSGD  187

Query  699   ktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRI  878
              +++         +   L+WNT VDV +F AT+ FL DS+TPI   P  E   KRF +R 
Sbjct  188   FSVRFLRFLMAIWSVITLIWNTFVDVTVFAATILFLSDSKTPIKGPPGVELSTKRFVHRS  247

Query  879   LSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGK--RDIGSIEGQNNLPKNLRLR  1052
             +SL D   +K A NTTINDV LGVTQA LS YLNRRY +  +D G+ +  N LPK +RL 
Sbjct  248   ISLGDIKFVKNAMNTTINDVLLGVTQAGLSRYLNRRYAQIEKDEGTNKKTNFLPKKIRLS  307

Query  1053  SCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVRE  1232
             S +  NLRP  GIQAL DMM K        SK  WGN  GY +LP  I + +DPLDYVR+
Sbjct  308   STVLVNLRPTVGIQALTDMMAKN-------SKAKWGNLLGYLLLPFNIALQDDPLDYVRQ  360

Query  1233  AKATADRKKYSYEPIFTYYLANFVIKFFG  1319
             AKAT DRKK+S E I TY  A F+ K FG
Sbjct  361   AKATIDRKKHSLEAICTYLCARFLQKIFG  389


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +3

Query  1284  YYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPS  1463
             ++    +++    K  A    +  SN +  FSN++GP E++ F+GH I+++AP+ YG P 
Sbjct  503   WWYVRILVESHIAKITAATARRAISNTTVAFSNMMGPLEEVSFYGHQISYLAPSVYGHPH  562

Query  1464  ALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             AL +HFQSYVDKM +I++VD NVIPDP QL DDFE SL LI
Sbjct  563   ALTIHFQSYVDKMTIILAVDPNVIPDPQQLFDDFEDSLKLI  603



>ref|XP_010428073.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=471

 Score =   335 bits (859),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 182/475 (38%), Positives = 275/475 (58%), Gaps = 28/475 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEE  347
              EEPVSP +RL   P  ++  +  +GF ++ NP +    + +TL+ HPRF+S++V    E
Sbjct  10    GEEPVSPFARLFSLPGLDVFNIVTIGFKTETNPPIVVEGLKNTLINHPRFSSILVTGHGE  69

Query  348   NG-KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
             +  K KW+ T+V + +HI V   P++    D       +F+EDY  +++   MDMS+PLW
Sbjct  70    HKRKAKWIPTKVIVEEHIIV---PDI----DPNIENPDEFLEDYTSKMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE++ V R HH+LGDG S+ SLLLACTR+T +P+ LPT      +  K 
Sbjct  123   EFHLLKLKTSHAESVVVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVAPKKNKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +               +++T V+V   +  +   +D+   I   P +     +F ++I+S
Sbjct  183   VCFALVAWLWFIVRF-MFHTCVEVIKSMVFICCARDTSAHIMGKPGATLGNNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A N TINDV +G+ QA LS YLN RY            +L   L     +F
Sbjct  242   LDDVKMVKNAMNMTINDVLVGMVQAGLSRYLNERY------------DLEDKLHFHGVVF  289

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP + I+ LA+MM K        SK  WGN  GY ++PL +   +D  +YVR++K  
Sbjct  290   FNLRPNRNIEELANMMAKG-------SKCRWGNSIGYVLIPLDMKSNDDVFEYVRQSKTI  342

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK+S EP+F++ L    ++ FG KA   L  +IF + +  F+NVVGP E++ FFGH 
Sbjct  343   MDRKKHSLEPLFSHVLLKLTLEVFGFKALETLIKRIFGSTTMIFTNVVGPAEEISFFGHV  402

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA + +G P  L++  QSYVDK+ + I VD +VIPDP+ L D   ++LH++K
Sbjct  403   ISYIAASTFGVPQGLIIGTQSYVDKLIINIGVDVDVIPDPHHLRDLIIEALHMMK  457



>ref|XP_002879777.1| hypothetical protein ARALYDRAFT_321593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56036.1| hypothetical protein ARALYDRAFT_321593 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   334 bits (856),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 176/474 (37%), Positives = 276/474 (58%), Gaps = 22/474 (5%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEE  347
             A EP+SP S+L   P     I+  +GF ++ NP      + +T +K PRF+  +  + ++
Sbjct  10    AVEPLSPISQLFLSPTLYCVIIFTLGFKTRCNPSSIVEGIKNTWIKFPRFSCKL--EMKK  67

Query  348   NGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
             NGK  WV T  ++  H+ V   P+++    E      +F+EDY   ++   MDMS+PLW+
Sbjct  68    NGKAVWVPTTYEVEDHVIV---PDIDYSNIENP---DQFIEDYTSNIANTPMDMSKPLWE  121

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktl  707
              H+LN+KT +AE+L + ++HH+LGDG S+ SLLLA +R+T++P+ LPT +          
Sbjct  122   FHVLNIKTSNAESLCIGKLHHSLGDGMSLMSLLLAISRKTSDPEALPTTAATRKHVDSND  181

Query  708   kpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSL  887
             K      +     ++++ T++++F +  TL F++D++TP+   P    + ++  +RI+SL
Sbjct  182   KDWWLVGRFWFMIRIIFTTVIELFKYCLTLCFMRDTKTPLKGKPGDRVQSRKVIHRIISL  241

Query  888   NDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFF  1067
             +D   +K      +NDV LG+TQA LS YL+R+Y +  +          K +RLR  +  
Sbjct  242   DDVKLVKNTMEMKVNDVLLGMTQAGLSRYLSRKYDEDTVAE-------KKKIRLRGTVIV  294

Query  1068  NLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATA  1247
             NLR    I+ LA+MM K        SK  WGN  G  I PL I   +DPL+YV+ AK+T 
Sbjct  295   NLRETTKIEDLANMMAKG-------SKSRWGNFVGIVIFPLWIRSEDDPLEYVQRAKSTM  347

Query  1248  DRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPI  1427
             D KK S E +  Y +  F +K FG K    L  +IF + +  FSNV+GP E+  FFGHP+
Sbjct  348   DIKKLSMESLICYGVIKFAMKMFGEKVVETLVKRIFDHTTLAFSNVMGPDEETSFFGHPM  407

Query  1428  AFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             +++A +  G   AL++HF SYV+K+ + ++VD  VIPDP  L DD  +SL++IK
Sbjct  408   SYVAASALGGSQALIIHFVSYVNKIVINLAVDTTVIPDPYLLCDDLVESLNIIK  461



>emb|CDX78487.1| BnaA03g03990D [Brassica napus]
Length=468

 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 193/448 (43%), Positives = 275/448 (61%), Gaps = 30/448 (7%)
 Frame = +3

Query  285   MPHTLLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKF  464
             + H + K PRF++ +     ENG  KW+E ++++  H+ V   P ++ E  E     + F
Sbjct  29    LKHNVSKLPRFSTKLT----ENGA-KWIEAKINVQDHVAV---PYIDPE--EIGEDGQGF  78

Query  465   VEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQ  644
             V+DY+  L+   +D SRPLWD+HILN+KT DAEA+ V+R HH+LGDG S+ SL+LACT +
Sbjct  79    VDDYISRLTMIPLDRSRPLWDIHILNVKTSDAEAVGVIRSHHSLGDGMSLISLMLACTHK  138

Query  645   TANPK--LLPTISTRSS---SppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLK  809
             T +P+   +P++  R +      K       +    +   L+WNTLVD+ + +AT+ FLK
Sbjct  139   TLDPQNTAIPSLKRRETVLHGLRKQGWFLRLRCTVCSIATLLWNTLVDMLLLLATILFLK  198

Query  810   DSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRY  989
             D++TP+T    +    KRF +R++SL+D   IK A N +INDV +GVTQAALS YL+R Y
Sbjct  199   DTKTPLTGGEDTGRNRKRFYHRVISLDDIKLIKNAMNMSINDVLVGVTQAALSRYLSRLY  258

Query  990   ----GK---RDIGSIEGQ-NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMS  1145
                 GK    D G++    N LP  LR R+    NLR   G + LADMM K+       S
Sbjct  259   VNEQGKNNEEDDGALTSYPNRLPDRLRFRAACAVNLRSDIGFKPLADMMAKD-------S  311

Query  1146  KWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK  1325
             K  WGN F + ILPL IG+  DPL Y++ +KAT  RKK+SY     Y++   V+  FG K
Sbjct  312   KGRWGNYFSFIILPLSIGLQTDPLVYLKLSKATLARKKHSYHAALVYFIIKMVLMVFGTK  371

Query  1326  AAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMG  1505
             AAA L N+   N + C SNVVGP E++ F GHPIA+IA + YG   AL+VH+ SY  KM 
Sbjct  372   AAATLFNQPVKNLTACVSNVVGPMEEISFRGHPIAYIAFSSYGHSQALLVHYISYAGKMM  431

Query  1506  VIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             + ++VD  +IP+P+++ DD E+SL  +K
Sbjct  432   ISLAVDPTIIPNPHKICDDMEQSLKAMK  459



>emb|CDY27000.1| BnaC06g12160D [Brassica napus]
Length=485

 Score =   334 bits (856),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 185/489 (38%), Positives = 288/489 (59%), Gaps = 20/489 (4%)
 Frame = +3

Query  129   KQKSGMENNNM-SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLK  305
             ++K+ +E +++ +++ EP+SP S++L  P  NL I+   GF +K NP  F      TL+ 
Sbjct  2     EKKNFLERDDLETMSMEPLSPMSQMLSSP--NLFIVITFGFKTKCNPSTFVEGFKTTLIN  59

Query  306   HPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYE  485
              PRF+S MV++ ++NG+  W+   + +  H+TV +     +E  +      +F+EDY   
Sbjct  60    APRFSSKMVINYKKNGEPVWIPVSIRVEDHVTVPDLDYPNIENPD------QFLEDYTSR  113

Query  486   LSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLL  665
             ++   MDMS+PLW+LH+LN+KT +AE++ + ++HH++GDG S+ SLLLAC+R+T++P  L
Sbjct  114   IANIPMDMSKPLWELHLLNIKTSNAESVLLAKIHHSVGDGMSLMSLLLACSRKTSDPSAL  173

Query  666   PTISTRSSSppktlkpnnpkpkpknffklV-WNTLVDVFIFIATLFFLKDSQTPITPSPA  842
              + S  +  P K++           F   V + TLV+ F  + T  FL+D++ P+  +P 
Sbjct  174   ISNSPATKKPVKSMISAWWLIAGLWFMIRVTFTTLVEFFKLMLTTCFLRDTENPLMGNPE  233

Query  843   SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ  1022
               ++  +  +RI+S +D   +K   N  +NDV LG+TQA LS YL  +Y   D  ++  +
Sbjct  234   DGTQSWKVIHRIISFDDVKLVKNTMNMKVNDVLLGMTQAGLSRYLTTKY---DGYTMAQK  290

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
               + + +R R  +  NLRPA  I+ LA+MM K        SK  WGN  G  I PL I  
Sbjct  291   KKILEKIRFRGAVAINLRPATNIEDLANMMTKG-------SKCRWGNFIGTIIFPLWIKS  343

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
              NDPL+YVR AKAT DRKK S E    Y +  F + F G K+      +IF N S  FSN
Sbjct  344   ENDPLEYVRRAKATMDRKKISLEAFLFYGIIKFTLNFLGGKSVEAFGKRIFGNTSLAFSN  403

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             V GP E++  FGHPI+++A +      AL +HF SYV+K+ + ++VD   IPDP+QL D+
Sbjct  404   VKGPDEEISLFGHPISYVAGSALVGSQALNIHFISYVNKIIINLAVDTTTIPDPHQLCDE  463

Query  1563  FEKSLHLIK  1589
               ++L +IK
Sbjct  464   IVEALKIIK  472



>ref|XP_006390701.1| hypothetical protein EUTSA_v10018486mg [Eutrema salsugineum]
 gb|ESQ27987.1| hypothetical protein EUTSA_v10018486mg [Eutrema salsugineum]
Length=474

 Score =   333 bits (855),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/474 (38%), Positives = 276/474 (58%), Gaps = 24/474 (5%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              EEPVSP ++L   P  ++  +  +G  ++ +P      + +TL+ HPRF+S++V    E
Sbjct  10    GEEPVSPFAQLFSLPGLDVFNIVTIGCKTEGDPSTVVEGLKNTLINHPRFSSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               GK +W+ T+V++ +H+ V   PE+    D       +F+EDY   ++   MDMS+PLW
Sbjct  70    RKGKARWIPTKVNVEEHVIV---PEI----DPNIENPDEFLEDYTSNMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT +AE++A+ R HH+LGDG S+ SLLLACTR+T +P+ LPT      S  K 
Sbjct  123   EFHLLKLKTSNAESIAIARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVAPKKSKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                +            +++T ++V   +  + F  D+   +   P       +F +RI+S
Sbjct  183   ACWSLVAWLWFILRL-MFHTCIEVIKAMVIICFAGDTTAYLMGKPGVTLSTNKFIHRIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L++  ++K A N T+NDV  G+ QA LS YLN+RY        + +  L     +   +F
Sbjct  242   LDEVKNVKNALNMTVNDVLFGMVQAGLSRYLNQRY--------DLETTLKTRKTIYGVVF  293

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP K I+ LA+MM K        SK  WGN  GY ++PL +   +D L+YVR+AK T
Sbjct  294   FNLRPNKDIEDLANMMAKG-------SKCRWGNSIGYVLIPLWMKSEDDILEYVRQAKTT  346

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S EP+F++ L    ++ FG  A   L  +IF + +  FSNVVGP E++ FFGH 
Sbjct  347   MDRKKLSLEPLFSFGLLKLTMEVFGLTALKNLVKRIFGSTTVVFSNVVGPVEEISFFGHQ  406

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             I++IA + +G P AL++  QSYVDK+ + I+VD +VIPDP+ L D   ++L ++
Sbjct  407   ISYIAASTFGIPQALVISIQSYVDKLIININVDLDVIPDPHHLCDLIIEALGMM  460



>ref|XP_009144401.1| PREDICTED: O-acyltransferase WSD1 [Brassica rapa]
 emb|CDY38569.1| BnaA05g12980D [Brassica napus]
Length=485

 Score =   334 bits (856),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/489 (37%), Positives = 281/489 (57%), Gaps = 20/489 (4%)
 Frame = +3

Query  129   KQKSGMENNNM-SIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLK  305
             ++K  +E +++ + + EP+SP S++L  P  NL I+   GF +K NP  F      TL+ 
Sbjct  2     EKKKFLERDDLETTSMEPLSPMSQMLSSP--NLFIVITFGFKTKCNPSAFVEGFKTTLIN  59

Query  306   HPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYE  485
              PRF+S MV++ ++NG+  W+   + +  H+TV +     +E  +      +F+EDY   
Sbjct  60    APRFSSKMVINYKKNGEPVWIPVSIRIEDHVTVPDLDYPNIENPD------QFLEDYTSR  113

Query  486   LSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPK-L  662
             ++   MDMS+PLW+LH+LN+KT +AE++ + ++HH++GDG S+ SLLLAC+R+T++P  L
Sbjct  114   IANIPMDMSKPLWELHLLNIKTSNAESVLLAKIHHSVGDGMSLMSLLLACSRKTSDPSAL  173

Query  663   LPTISTRSSSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPA  842
             +   S         +             ++ + TLV+ F  + T  FL+D++ P+  +P 
Sbjct  174   ISNTSATKKPVKSMISAWWLIAGLWFMIRVTFTTLVEFFKLMLTTCFLRDTKNPLMGNPD  233

Query  843   SESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQ  1022
                +  +  +RI+S +D   +K   N  +NDV LG+TQA LS YL  +Y   D  ++  +
Sbjct  234   DGIQSWKVIHRIISFDDVKLVKNTMNMKVNDVLLGMTQAGLSRYLTTKY---DGYTMSQK  290

Query  1023  NNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGM  1202
               + + +R R  +  NLRPA  I+ LA+MM K        SK  WGN  G  I PL I  
Sbjct  291   KKILEKIRFRGAVAINLRPATNIEDLANMMTKG-------SKCRWGNFIGTIIFPLWIKS  343

Query  1203  LNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSN  1382
               DPL+YVR AKAT DRKK S E    Y +  F + FFG KA      +IF N S  FSN
Sbjct  344   EKDPLEYVRRAKATMDRKKISLEAFLFYGIIKFTLNFFGGKAVEAFGKRIFGNTSLAFSN  403

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             V GP E++  FGHPI+++A +      AL +HF SYV+K+ + ++VD   IPDP+QL D+
Sbjct  404   VKGPDEEISLFGHPISYVAGSALVGSQALNIHFISYVNKIIINLAVDTTTIPDPHQLCDE  463

Query  1563  FEKSLHLIK  1589
               ++L +IK
Sbjct  464   IVEALKIIK  472



>ref|XP_010492521.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
 ref|XP_010492522.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=416

 Score =   332 bits (850),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 256/428 (60%), Gaps = 26/428 (6%)
 Frame = +3

Query  171   EEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEEN  350
             +EP+SP +R+   PA +L  + ++G  +KINP V    + H + KHPRF+S +     EN
Sbjct  7     DEPLSPLARVFQSPAIDLCNIVVVGLKTKINPDVVLDALKHNVYKHPRFSSKL----SEN  62

Query  351   GKMKWVETEVDLSQHITVVEAPEVEV-EGDETHRKNKKFVEDYVYELSKERMDMSRPLWD  527
             G  KW++TEV++  H+ V      E+ EG ++      FV+DY+  L+   +D SRPLWD
Sbjct  63    GA-KWIKTEVNVEDHVIVPYVDPAEICEGGQS------FVDDYISRLTMIPLDRSRPLWD  115

Query  528   LHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTI-------STRS  686
             +HILN+KT DAEA+ V+R HH+LGDG SI SL+LACT +T+NP +L T        ST S
Sbjct  116   IHILNVKTSDAEAVGVIRSHHSLGDGMSIISLMLACTHKTSNPDMLSTAIPPMKRRSTVS  175

Query  687   SSppktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
              S  +            +  +L+WNT+VD+ +  AT+ FLKD++TP+  +      P+RF
Sbjct  176   HSLERNGWFLRVIFTIGSTMRLIWNTIVDMLLLAATVLFLKDTKTPMKGNANVRRNPRRF  235

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +R +SL+D   IK A N TINDV LG+TQAALS Y+ R+Y K +       NNLP  +R
Sbjct  236   YHRTISLDDIKLIKNAMNMTINDVLLGITQAALSSYMKRQYDKNNEEDGAHPNNLPDGIR  295

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
              R+    NLR   G + LA+MM K+       +K  WGN     ILPL IG+  DPL Y+
Sbjct  296   FRAGCSVNLRSDIGFKPLAEMMVKD-------TKCRWGNYVSSIILPLSIGLETDPLVYL  348

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             +++KA   RKK+SY    TY     ++K  G KAAA + N+   N +T  SN++GP E++
Sbjct  349   KKSKAMMARKKHSYHAALTYLFTKIILKVLGAKAAASVYNQNLKNITTFVSNIMGPIEEI  408

Query  1407  EFFGHPIA  1430
              F GHPIA
Sbjct  409   SFQGHPIA  416



>ref|XP_010440837.1| PREDICTED: O-acyltransferase WSD1-like isoform X3 [Camelina sativa]
Length=477

 Score =   333 bits (854),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 182/472 (39%), Positives = 274/472 (58%), Gaps = 20/472 (4%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             EP+SP S +L  P  N  I+   GF  + NP  F   +  +L+  PRF+S M +D +  G
Sbjct  12    EPLSPMSHMLSSP--NFVIVITFGFKIRCNPSKFVEGINKSLINAPRFSSKMEIDYKRKG  69

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             +  W+  +V +  HI V +     +E  +      +FVEDY+  ++   MDMS+PLW+ H
Sbjct  70    EPVWIPVKVRVEDHIIVPDLDYPNIENPD------QFVEDYISTIANIPMDMSKPLWEFH  123

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppktlkp  713
             +LN+KT  AE+LA++++HH++GDG S+ SLLLAC+R+T++P  L + ST ++        
Sbjct  124   LLNVKTSKAESLAIVKIHHSVGDGMSLMSLLLACSRKTSDPDALIS-STVATKKLVNSLA  182

Query  714   nnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILSLND  893
                        ++ + T+V+ F  I T+ F++D++ P+  +P+   +  +  +RI+SL+D
Sbjct  183   WWLVVGFLFLIRVTFTTIVEFFKLILTVCFMQDTKNPVMGNPSDGFQSWKLIHRIISLDD  242

Query  894   FFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNL  1073
                +K   N  +NDV LG+TQA LS YL+ +Y     GS   +  + + LR+R  +  NL
Sbjct  243   VKFVKDTMNMKVNDVLLGMTQAGLSRYLSSKYD----GSKAEKKEILEKLRVRGAVAINL  298

Query  1074  RPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADR  1253
             RPA  I+ LADMM K        SK  WGN  G  I PL +   NDPL+Y+R AKAT DR
Sbjct  299   RPATRIEDLADMMAKG-------SKCRWGNFIGTIIFPLWVKFENDPLEYIRRAKATMDR  351

Query  1254  KKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAF  1433
             KK S E    Y +  F +K FG KA      +IF + S  FSNV GP E++ FF HPI++
Sbjct  352   KKISLEAFIFYGIIKFTLKLFGGKAVEDFGKRIFGHTSLAFSNVKGPDEEISFFHHPISY  411

Query  1434  IAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             IA +      AL +HF SYV+K+ + ++VD   IPDP++L DD  ++L +IK
Sbjct  412   IAGSALVGSQALSIHFISYVNKIVINLAVDTTTIPDPHRLCDDMVEALKIIK  463



>ref|XP_006390705.1| hypothetical protein EUTSA_v10018487mg [Eutrema salsugineum]
 gb|ESQ27991.1| hypothetical protein EUTSA_v10018487mg [Eutrema salsugineum]
Length=474

 Score =   333 bits (854),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/474 (39%), Positives = 274/474 (58%), Gaps = 24/474 (5%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              EEPVSP ++L   P  ++  +  +G  ++ +P      + +TL+ HPRF+S++V    E
Sbjct  10    GEEPVSPIAQLFSLPGLDVFNIVTIGCKTEGDPSTVVEGLKNTLINHPRFSSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               GK KW+ T+V++ +H+ V   PE+    D       +F+EDY   ++   MDMS+PLW
Sbjct  70    RKGKPKWIPTKVNVEEHVVV---PEI----DPNIENPDEFLEDYTSNMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  A+++AV R HH+LGDG S+ SLLLACTR+T +P+ LPT  + + S  K 
Sbjct  123   EFHLLKLKTSHAKSIAVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVSPTKSKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
                             +++T V+V   +  + F  D+   +   P       +F +RI+S
Sbjct  183   ACWLLVAWLWFILRL-MFHTCVEVIKALVHICFAGDTAAYLMGKPGVTLSTNKFIHRIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A N T+NDV  G+ QA LS YLN+RY        + +  L     L   +F
Sbjct  242   LDDVKKVKNALNMTVNDVLFGMVQAGLSRYLNQRY--------DLETTLKTRKTLHGVVF  293

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP K I+ LA+MM K        SK  WGN  GY ++PL +   +D L+YVR+AK T
Sbjct  294   FNLRPNKDIEDLANMMAKG-------SKCRWGNSIGYVLIPLWLKSEDDILEYVRQAKTT  346

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK S EP+F+  L    +K FG  A   L  +IF + +  FSN+VGP +++ FFGH 
Sbjct  347   MDRKKLSLEPLFSSGLLKLTMKVFGLTALKNLVKRIFGSTTMIFSNLVGPADEISFFGHQ  406

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             I++IA + +G P AL++  QSYVDK+ + I+VD +VIPDP+ L D   ++L ++
Sbjct  407   ISYIAASTFGIPQALIIGIQSYVDKLIININVDLDVIPDPHHLCDLIIEALGMM  460



>ref|XP_009127896.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Brassica rapa]
 emb|CDY03660.1| BnaA02g15770D [Brassica napus]
Length=481

 Score =   333 bits (854),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 186/489 (38%), Positives = 274/489 (56%), Gaps = 45/489 (9%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEE  347
              E PVSP SRL   P  +   +  +GF  + NP  F   + +TLL HPRF+S++     E
Sbjct  10    GEVPVSPFSRLFSMPGLDCFNIVTIGFKHEANPSAFVEGLKNTLLNHPRFSSIL-----E  64

Query  348   NG----KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSR  515
              G    K KW+ T+V    H+ V   P++    D T +   +F+EDY   +    +DMS+
Sbjct  65    TGVGGKKAKWIPTKVKAEDHVVV---PDI----DPTIQNPDQFLEDYTSNMVFSPIDMSK  117

Query  516   PLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSp  695
             PLW++HILN+KT DAE+  V R HH+LGDG S+ SLLLAC+R+ ++P+ LPT+     S 
Sbjct  118   PLWEMHILNMKTSDAESFLVARFHHSLGDGMSLMSLLLACSRKASDPESLPTLVAPKKS-  176

Query  696   pktlkpnnpkpkpknffklVW-------NTLVDVFIFIATLFFLKDSQTPITPSPASESK  854
                           +    VW       NT V+VF F+  L  ++D+ TP+   P +   
Sbjct  177   -------KVTNVLWSLVARVWFIIRLMCNTFVEVFNFLLILCSVRDAATPLMEKPIATLS  229

Query  855   PKRFAYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLP  1034
             P +F +R++SL+D   +K A N T+NDV LG+ QA LS YL+++Y       ++      
Sbjct  230   PNKFIHRVISLDDVKIVKNAMNMTVNDVILGMVQAGLSRYLSQKYDSETNSKLKRS---L  286

Query  1035  KNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDP  1214
             +N+ LR+ +FFNLR  K I+ LA MM K       +S   WGN  GY ++PL +   ND 
Sbjct  287   ENVSLRAAVFFNLRSNKKIEDLAKMMAK-------LSTSRWGNSIGYVMIPLWMRSENDI  339

Query  1215  LDYVREAKATADRKKYSYEPIFTYYLANFVIKFFGPK----AAAILTNKIFSNASTCFSN  1382
              +Y+R AK   DRKK S EP+F+Y L    ++ FG K    A   L  +IF  ++   SN
Sbjct  340   FEYIRRAKTIMDRKKLSLEPLFSYVLLKLTVEIFGSKGGKQALRNLAMRIFGRSTIILSN  399

Query  1383  VVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDD  1562
             V GP E++  F H I+++A +  G P AL+VH  SYV+K+ + + VD +VIPDP+ L D 
Sbjct  400   VAGPSEEISLFDHQISYVAASVSGFPQALIVHITSYVNKVIINLGVDLDVIPDPHHLCDH  459

Query  1563  FEKSLHLIK  1589
               ++L ++K
Sbjct  460   MVEALQMMK  468



>ref|XP_010415939.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Camelina sativa]
Length=470

 Score =   333 bits (853),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/475 (39%), Positives = 273/475 (57%), Gaps = 28/475 (6%)
 Frame = +3

Query  168   AEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDK-E  344
              E PVSP +RL   P  ++  +  +G  ++ NP      + +TL+ HPRF+S++V    E
Sbjct  10    GEAPVSPFARLFSLPGLDVFNVVTIGCKTEGNPSTIVEGLKNTLINHPRFSSILVTGHGE  69

Query  345   ENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLW  524
               GK KW+ T+    +    V  P++    D       +F+EDY   ++   MDMS+PLW
Sbjct  70    HKGKAKWIPTK---VKVEEHVVVPDI----DPNIENPDEFLEDYTSRMALSPMDMSKPLW  122

Query  525   DLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPTISTRSSSppkt  704
             + H+L LKT  AE++AV R HH+LGDG S+ SLLLACTR+T +P+ LPT  T   S  K 
Sbjct  123   EFHLLKLKTLHAESVAVARFHHSLGDGMSLMSLLLACTRKTCDPEALPTFVTPKKSKAKN  182

Query  705   lkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRFAYRILS  884
             +               +++T V+V   +  +   +D+   I   P +  +  +F ++I+S
Sbjct  183   VCFAVVAWLWFIVRI-MFHTCVEVIKSMVFICCARDTSAHIMGKPGATLRNNKFIHQIIS  241

Query  885   LNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLF  1064
             L+D   +K A N T+NDV  G+ QA LS YLN+RY            +L   LRL   +F
Sbjct  242   LDDVKMVKNAMNMTVNDVLFGMVQAGLSRYLNQRY------------DLEDKLRLHGVVF  289

Query  1065  FNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKAT  1244
             FNLRP + I+ LA+MM K        SK  WGN  GY ++PL++   +D  +YVR++K+ 
Sbjct  290   FNLRPNRNIEDLANMMAKG-------SKCRWGNSIGYVLIPLEMKSYDDVFEYVRQSKSM  342

Query  1245  ADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHP  1424
              DRKK+S EP+F+Y L    ++ FG KA   L  KIF + +  FSNVVGP E++ FFGH 
Sbjct  343   MDRKKHSLEPLFSYGLLKLTLEVFGFKALKTLVTKIFGSTTMIFSNVVGPAEEISFFGHQ  402

Query  1425  IAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLIK  1589
             I++IA + +G P  L++  QSYVDK+ + I VD +VIPDP+ L D   ++L ++K
Sbjct  403   ISYIAASTFGIPQGLIIGTQSYVDKLIINIGVDVDVIPDPHHLCDLIIEALSMMK  457



>ref|XP_004984321.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=515

 Score =   334 bits (856),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 203/511 (40%), Positives = 290/511 (57%), Gaps = 44/511 (9%)
 Frame = +3

Query  117   IETRKQKSGMENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHT  296
             I+TR  ++G   +      EP+SP++R+ H+     +I+A++G  + I+       +  T
Sbjct  17    IDTR-HRAGAFGDADDDGGEPLSPTARMFHD----FYIVAVVGLGAPIDFEPARAGLEVT  71

Query  297   LLKHPRFTSLMVVDKEENGKMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDY  476
             L++HPRF+S+ V+D  E    +WV T V+L  HI V +     +          + +EDY
Sbjct  72    LVRHPRFSSIRVMDGPEP---RWVPTTVNLDDHIIVPDLDRAAIA-----ADADRALEDY  123

Query  477   VYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANP  656
             V  LS   MD SRPLW+LH+L+  T +A +    R+HHALGDGAS+ SLLLACTR  A+P
Sbjct  124   VASLSTLPMDQSRPLWELHVLDFPTSEAASAVAFRIHHALGDGASLVSLLLACTRSAADP  183

Query  657   KLLPTISTRSSSppk------------------tlkpnnpkpkpknffklVWNTLVDVFI  782
             K LP + + + +P                    +           +   L W+TLVDV  
Sbjct  184   KALPAMPSPAPAPGPGARRRARPVYGAPPRPAWSAGALALAAWVLSCALLAWHTLVDVAR  243

Query  783   FIA-TLFFLKDSQTPITPSPASESKPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQA  959
             F+A  L  ++D  T        ES+ KRF  R  SL+D   IK A   T+NDV +GVT A
Sbjct  244   FVAMALQLVRDPPTLFKGVKGVESRRKRFVMRTFSLDDVKLIKHALGCTVNDVLVGVTSA  303

Query  960   ALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESNS  1139
             ALS     RY  R +G  +  NN  ++   RS LF NLRP  GIQ LA MM  E G+ N 
Sbjct  304   ALS-----RYYFRKLGDDQDTNN--RSTCFRSVLFVNLRPTPGIQQLAKMM--ESGKHND  354

Query  1140  MSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFFG  1319
             +    WGNR GY +LP +I   +DPLDYVR  K T DRKK+S+E I T+ +A  V K FG
Sbjct  355   LK---WGNRLGYIVLPFEIVKHDDPLDYVRNGKKTVDRKKHSFEAIATHLIAETVTKLFG  411

Query  1320  PKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVDK  1499
              + A  L +++ S  +  FSN++GP E +EF+GHP+ +IAP+ +G PSAL +H+QSY+D 
Sbjct  412   IEVATGLFHRMISGTTVLFSNMIGPAEPIEFYGHPVVYIAPSNFGHPSALTIHWQSYLDT  471

Query  1500  MGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
             + +I++VD+    D + LLDDF +SL  I++
Sbjct  472   IRIILAVDDAQFLDSHDLLDDFAESLESIRN  502



>ref|XP_004970103.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=511

 Score =   333 bits (855),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 193/481 (40%), Positives = 277/481 (58%), Gaps = 34/481 (7%)
 Frame = +3

Query  174   EPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFTHNMPHTLLKHPRFTSLMVVDKEENG  353
             E VSPS+RL+ +     +I+ ++G  + +N  V    +   L ++PRF S+ V DK  +G
Sbjct  43    ELVSPSARLVED----FYIVVVIGIATPVNLPVARAGIEAQLARYPRFRSIQVKDK--SG  96

Query  354   KMKWVETEVDLSQHITVVEAPEVEVEGDETHRKNKKFVEDYVYELSKERMDMSRPLWDLH  533
             + +W  T VD++ HI     P+++       R   + VEDYV  LS   MD +RPLW+ H
Sbjct  97    QPRWEPTTVDVNDHIIY---PKLDAAA--VARDPDRAVEDYVATLSTLPMDETRPLWEFH  151

Query  534   ILNLKTRDAEALAVLRMHHALGDGASINSLLLACTRQTANPKLLPT---ISTRSSSp---  695
             +L+  T +A A   +R+HH+LGDG S+ +LL+ACTR   +P  LP    + TR+ +    
Sbjct  152   VLDFPTSEAAATTAIRVHHSLGDGMSLLTLLMACTRSATDPSRLPAMPPLPTRTGAIWER  211

Query  696   ---pktlkpnnpkpkpknffklVWNTLVDVFIFIATLFFLKDSQTPITPSPASESKPKRF  866
                P +           +F  L W+T+VDV  F AT+ F +D  T       +  + KR 
Sbjct  212   PRPPASAGALALAAWAWSFVALAWHTVVDVASFFATILFFRDPHTLFKRVNHAPHQRKRL  271

Query  867   AYRILSLNDFFSIKLATNTTINDVALGVTQAALSMYLNRRYGKRDIGSIEGQNNLPKNLR  1046
              +R LSL+D   +K A + T+NDV +GVT AALS Y  R+ G  D           K +R
Sbjct  272   VHRALSLDDVKFVKNAMSCTVNDVLVGVTYAALSRYYFRKTGDADTS---------KEIR  322

Query  1047  LRSCLFFNLRPAKGIQALADMMKKEKGESNSMSKWGWGNRFGYAILPLKIGMLNDPLDYV  1226
             +RS L  NLRP   +QA  +M+     ES   S   WGN  G+ ILP  IG+ +DPL YV
Sbjct  323   VRSILLVNLRPTTSLQACVNMI-----ESGKESDVKWGNELGFIILPFHIGLHDDPLQYV  377

Query  1227  REAKATADRKKYSYEPIFTYYLANFVIKFFGPKAAAILTNKIFSNASTCFSNVVGPREDL  1406
             R+AK   DRKK S E +FT+  A  ++K FG KAA  + +++ S+ +  FSN++GP E +
Sbjct  378   RKAKKIVDRKKSSLEVVFTHLAAEVILKIFGLKAAGAIFHRMISHTTISFSNMIGPVEQV  437

Query  1407  EFFGHPIAFIAPTCYGQPSALMVHFQSYVDKMGVIISVDENVIPDPNQLLDDFEKSLHLI  1586
             EF GHP+ FIAP+ YG P AL V+FQSYV+ M V ++VDE   PD ++LLDDF +SL LI
Sbjct  438   EFCGHPVVFIAPSGYGPPEALTVNFQSYVNTMMVNLAVDEAQFPDSHELLDDFVESLRLI  497

Query  1587  K  1589
             +
Sbjct  498   R  498



>gb|EMT14089.1| hypothetical protein F775_13804 [Aegilops tauschii]
Length=508

 Score =   333 bits (855),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 195/512 (38%), Positives = 276/512 (54%), Gaps = 41/512 (8%)
 Frame = +3

Query  108   LKPIETRKQKSG---MENNNMSIAEEPVSPSSRLLHEPAFNLHILAIMGFNSKINPHVFT  278
             L PI T +         +++ +  EEPV+P++RL+      ++I+  +G  S +N  VF+
Sbjct  9     LLPIRTPRSAPAEWTTTDDSSAATEEPVTPTARLMEA----IYIVVTIGLGSPVNLPVFS  64

Query  279   HNMPHTLLKHPRFTSLMVVDKEENGKM-KWVETEVDLSQHITVVEAPEVEVEGDETHRKN  455
               +   L ++ RF S+ V D  ++G   +W  T V++  H+ V       VE D      
Sbjct  65    AGVAAELARYARFRSIQVTDGSKDGNNPRWARTAVNVEDHMIVPTLDPAAVEADP-----  119

Query  456   KKFVEDYVYELSKERMDMSRPLWDLHILNLKTRDAEALAVLRMHHALGDGASINSLLLAC  635
              + VEDYV  +    MD SRPLW+ H L+  T +A +  V R+HH+L DG S+ ++LLA 
Sbjct  120   DRAVEDYVASVYTLPMDRSRPLWEFHFLDYPTSEAASTVVFRVHHSLSDGMSLITMLLAS  179

Query  636   TRQTANPKLLPTI-----------STRSSSppktlkpnnpkpkpknffklVWNTLVDVFI  782
              R  A+P  LP +           + R                   +  L WNT+VDV  
Sbjct  180   ARSAADPTRLPAMPDQPARTGAIYAPRHRESASAGALAAFIAWIWPYLVLAWNTMVDVSF  239

Query  783   FIATLFFLKDSQTPITPSPASES--KPKRFAYRILSLNDFFSIKLATNTTINDVALGVTQ  956
             F AT  FL+D  TP   +    +    +RF +R LSL+D   +K A + T+NDV +G T 
Sbjct  240   FAATTVFLRDPCTPFRRAEGDVTFNPRRRFVHRSLSLDDVKFVKNAMSCTVNDVLVGATS  299

Query  957   AALSMYLNRRYGKRDIGSIEGQNNLPKNLRLRSCLFFNLRPAKGIQALADMMKKEKGESN  1136
             AALS Y  R+ G        G N       LRS L  N RP   +Q  A+M+  E G SN
Sbjct  300   AALSRYYFRKSG--------GSNTY--RTWLRSVLLVNTRPTASLQTYANMI--ESGRSN  347

Query  1137  SMSKWGWGNRFGYAILPLKIGMLNDPLDYVREAKATADRKKYSYEPIFTYYLANFVIKFF  1316
              ++   WGN+ GY +LP  + M +DPL YVR+AK   DRKK S E IFT   +  V+K F
Sbjct  348   DVA---WGNQLGYILLPFHLAMHDDPLAYVRKAKMIVDRKKSSLEAIFTCKTSEVVVKMF  404

Query  1317  GPKAAAILTNKIFSNASTCFSNVVGPREDLEFFGHPIAFIAPTCYGQPSALMVHFQSYVD  1496
             G KA A +  ++FSN +  FSN+VGP E +E  GHP+ FIAP+ YG P AL+VH+QSY +
Sbjct  405   GLKAGAFIFRRMFSNTTISFSNLVGPTEKIELCGHPVVFIAPSVYGVPQALIVHYQSYNN  464

Query  1497  KMGVIISVDENVIPDPNQLLDDFEKSLHLIKD  1592
              + +++SVDE + PD +QLLDDF  S  LIKD
Sbjct  465   TIKIVLSVDEEIFPDYSQLLDDFVVSFGLIKD  496



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6680906542800