BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23382_g4_i1 len=847 path=[1537:0-58 1596:59-104 1642:105-151
1689:152-187 1725:188-200 1738:201-256 1793:257-617 1336:618-671
2206:672-846]

Length=847
                                                                      Score     E

gb|KDP45996.1|  hypothetical protein JCGZ_11899                         252   1e-78   
ref|XP_008230962.1|  PREDICTED: metalloendoproteinase 1-like            252   2e-78   
emb|CAN59960.1|  hypothetical protein VITISV_011608                     250   1e-77   Vitis vinifera
ref|XP_002517411.1|  Metalloendoproteinase 1 precursor, putative        249   2e-77   Ricinus communis
ref|XP_008230963.1|  PREDICTED: metalloendoproteinase 1-like            248   6e-77   
ref|XP_007216839.1|  hypothetical protein PRUPE_ppa022514mg             246   3e-76   
ref|XP_002275556.1|  PREDICTED: metalloendoproteinase 1-like            244   2e-75   Vitis vinifera
ref|XP_008230957.1|  PREDICTED: metalloendoproteinase 1-like            243   5e-75   
ref|XP_006482472.1|  PREDICTED: metalloendoproteinase 1-like            241   3e-74   
ref|XP_008230960.1|  PREDICTED: metalloendoproteinase 1-like            240   1e-73   
ref|XP_007216922.1|  hypothetical protein PRUPE_ppa018385mg             239   1e-73   
ref|XP_008230675.1|  PREDICTED: metalloendoproteinase 1-like            239   2e-73   
ref|XP_002280833.1|  PREDICTED: metalloendoproteinase 1                 239   3e-73   Vitis vinifera
ref|XP_007010413.1|  Matrixin family protein                            238   3e-73   
ref|XP_002517412.1|  Matrix metalloproteinase, putative                 239   3e-73   Ricinus communis
ref|XP_008230959.1|  PREDICTED: metalloendoproteinase 1-like            238   5e-73   
ref|XP_007010415.1|  Matrixin family protein                            238   7e-73   
ref|XP_003633209.1|  PREDICTED: metalloendoproteinase 1-like            237   1e-72   
emb|CBI34985.3|  unnamed protein product                                234   3e-72   
ref|XP_008458713.1|  PREDICTED: metalloendoproteinase 1-like            233   1e-71   
gb|KDO37621.1|  hypothetical protein CISIN_1g035681mg                   234   1e-71   
ref|XP_008352994.1|  PREDICTED: metalloendoproteinase 1-like            234   2e-71   
ref|XP_007014936.1|  Matrixin family protein, putative                  233   3e-71   
gb|EYU29748.1|  hypothetical protein MIMGU_mgv1a025409mg                231   5e-71   
ref|XP_004142462.1|  PREDICTED: metalloendoproteinase 1-like            233   6e-71   
ref|XP_004288499.1|  PREDICTED: metalloendoproteinase 1-like            232   8e-71   
ref|XP_008458714.1|  PREDICTED: metalloendoproteinase 1-like            232   1e-70   
emb|CAN73128.1|  hypothetical protein VITISV_030256                     231   2e-70   Vitis vinifera
ref|XP_002280805.2|  PREDICTED: metalloendoproteinase 1-like            232   2e-70   Vitis vinifera
ref|XP_004296560.1|  PREDICTED: metalloendoproteinase 1-like            231   3e-70   
ref|XP_008230676.1|  PREDICTED: metalloendoproteinase 1-like            230   3e-70   
ref|XP_008458907.1|  PREDICTED: metalloendoproteinase 1-like            231   4e-70   
ref|XP_008368314.1|  PREDICTED: LOW QUALITY PROTEIN: metalloendop...    230   4e-70   
ref|XP_009341183.1|  PREDICTED: metalloendoproteinase 1-like            231   6e-70   
ref|XP_008355534.1|  PREDICTED: metalloendoproteinase 1-like            230   6e-70   
gb|EYU18042.1|  hypothetical protein MIMGU_mgv1a018853mg                229   8e-70   
ref|XP_010039144.1|  PREDICTED: metalloendoproteinase 1-like            229   2e-69   
ref|XP_006363533.1|  PREDICTED: metalloendoproteinase 1-like            230   2e-69   
ref|XP_004296559.1|  PREDICTED: metalloendoproteinase 1-like            228   3e-69   
ref|XP_004142457.1|  PREDICTED: metalloendoproteinase 1-like            228   4e-69   
ref|XP_008365496.1|  PREDICTED: metalloendoproteinase 1-like            228   4e-69   
ref|NP_001266203.1|  matrix metalloproteinase precursor                 229   5e-69   
ref|XP_010037506.1|  PREDICTED: metalloendoproteinase 1-like            228   6e-69   
ref|XP_007217804.1|  hypothetical protein PRUPE_ppa024325mg             229   1e-68   
ref|XP_010037507.1|  PREDICTED: metalloendoproteinase 1-like            226   2e-68   
gb|EYU34696.1|  hypothetical protein MIMGU_mgv11b016964mg               226   2e-68   
ref|XP_008343421.1|  PREDICTED: metalloendoproteinase 1-like            226   3e-68   
ref|XP_007216020.1|  hypothetical protein PRUPE_ppa014830mg             225   3e-68   
ref|XP_007216923.1|  hypothetical protein PRUPE_ppa018181mg             223   5e-68   
ref|XP_008361888.1|  PREDICTED: metalloendoproteinase 1-like            225   6e-68   
ref|XP_007216949.1|  hypothetical protein PRUPE_ppa016355mg             223   7e-68   
gb|KCW49215.1|  hypothetical protein EUGRSUZ_K02795                     228   8e-68   
gb|EYU34694.1|  hypothetical protein MIMGU_mgv1a023515mg                222   2e-67   
emb|CAN73130.1|  hypothetical protein VITISV_030258                     227   3e-67   Vitis vinifera
emb|CCH68443.1|  matrix metalloproteinase precursor                     223   2e-66   
ref|XP_007010134.1|  Matrixin family protein, putative                  220   3e-66   
ref|XP_004237082.2|  PREDICTED: metalloendoproteinase 1                 223   4e-66   
ref|XP_006363534.1|  PREDICTED: metalloendoproteinase 1-like            221   6e-66   
ref|XP_008230961.1|  PREDICTED: metalloendoproteinase 1-like            219   8e-66   
ref|XP_004139164.1|  PREDICTED: metalloendoproteinase 1-like            219   1e-65   
ref|XP_009368959.1|  PREDICTED: metalloendoproteinase 1-like            219   1e-65   
ref|XP_009351242.1|  PREDICTED: metalloendoproteinase 1-like            219   2e-65   
ref|XP_011073059.1|  PREDICTED: metalloendoproteinase 1-like            218   2e-65   
ref|XP_009624303.1|  PREDICTED: metalloendoproteinase 1-like            220   3e-65   
ref|XP_004142461.1|  PREDICTED: metalloendoproteinase 1-like            218   5e-65   
ref|XP_010255256.1|  PREDICTED: metalloendoproteinase 1-like            217   9e-65   
ref|XP_008458911.1|  PREDICTED: metalloendoproteinase 1-like            216   9e-65   
ref|XP_006482471.1|  PREDICTED: metalloendoproteinase 1-like            214   1e-64   
gb|ADD21635.1|  matrix metalloprotease 1                                218   1e-64   Nicotiana benthamiana
gb|EPS59674.1|  hypothetical protein M569_15132                         214   2e-64   
ref|XP_006376166.1|  hypothetical protein POPTR_0013s10410g             215   2e-64   
gb|ABK95950.1|  unknown                                                 215   3e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010091950.1|  Metalloendoproteinase 1                            217   3e-64   
ref|XP_011085796.1|  PREDICTED: metalloendoproteinase 1-like            215   3e-64   
ref|XP_006856883.1|  hypothetical protein AMTR_s00055p00201730          216   5e-64   
ref|XP_006448956.1|  hypothetical protein CICLE_v10017926mg             215   6e-64   
ref|XP_006448955.1|  hypothetical protein CICLE_v10017519mg             212   6e-64   
ref|XP_010278837.1|  PREDICTED: metalloendoproteinase 1-like            214   9e-64   
ref|XP_010273763.1|  PREDICTED: metalloendoproteinase 1-like            215   9e-64   
gb|KDO75344.1|  hypothetical protein CISIN_1g037265mg                   214   1e-63   
ref|XP_011072962.1|  PREDICTED: metalloendoproteinase 1-like            214   1e-63   
ref|XP_004159087.1|  PREDICTED: metalloendoproteinase 1-like            218   2e-63   
ref|XP_006438497.1|  hypothetical protein CICLE_v10031870mg             215   2e-63   
ref|XP_004142466.1|  PREDICTED: metalloendoproteinase 1-like            213   3e-63   
ref|XP_008222422.1|  PREDICTED: metalloendoproteinase 1-like            213   3e-63   
ref|XP_004167464.1|  PREDICTED: metalloendoproteinase 1-like            213   3e-63   
ref|XP_007226174.1|  hypothetical protein PRUPE_ppa015434mg             213   4e-63   
ref|XP_002325947.1|  hypothetical protein POPTR_0019s10230g             212   7e-63   Populus trichocarpa [western balsam poplar]
gb|ABF58910.1|  matrix metalloprotease 1                                213   8e-63   Nicotiana tabacum [American tobacco]
ref|XP_009758591.1|  PREDICTED: metalloendoproteinase 1-like            213   1e-62   
ref|XP_010255281.1|  PREDICTED: metalloendoproteinase 1-like            213   2e-62   
ref|XP_006431003.1|  hypothetical protein CICLE_v10012543mg             209   2e-62   
gb|EYU29749.1|  hypothetical protein MIMGU_mgv1a023711mg                209   3e-62   
ref|XP_008376281.1|  PREDICTED: metalloendoproteinase 1-like            212   3e-62   
ref|XP_004297959.1|  PREDICTED: metalloendoproteinase 1-like            210   4e-62   
ref|XP_008458910.1|  PREDICTED: metalloendoproteinase 1-like            209   5e-62   
ref|XP_002311051.2|  hypothetical protein POPTR_0008s02790g             209   6e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006387200.1|  hypothetical protein POPTR_1544s00200g             209   6e-62   
ref|XP_008443669.1|  PREDICTED: metalloendoproteinase 1-like            209   7e-62   
ref|XP_007044491.1|  Matrixin family protein, putative                  211   9e-62   
ref|XP_006495379.1|  PREDICTED: metalloendoproteinase 1-like            206   1e-61   
ref|XP_006371427.1|  hypothetical protein POPTR_0019s10270g             209   1e-61   
gb|KDO82628.1|  hypothetical protein CISIN_1g021444mg                   208   2e-61   
ref|XP_010272073.1|  PREDICTED: metalloendoproteinase 1                 210   2e-61   
ref|XP_004139163.1|  PREDICTED: metalloendoproteinase 1-like            208   2e-61   
ref|XP_011071055.1|  PREDICTED: metalloendoproteinase 1-like            209   6e-61   
ref|XP_004297896.1|  PREDICTED: metalloendoproteinase 1-like            207   7e-61   
ref|XP_007153680.1|  hypothetical protein PHAVU_003G055800g             208   1e-60   
gb|KDP45419.1|  hypothetical protein JCGZ_09668                         204   2e-60   
ref|XP_008233236.1|  PREDICTED: metalloendoproteinase 1-like            207   2e-60   
gb|KCW49214.1|  hypothetical protein EUGRSUZ_K02794                     202   2e-60   
gb|KDP21290.1|  hypothetical protein JCGZ_21761                         207   3e-60   
ref|XP_011010763.1|  PREDICTED: metalloendoproteinase 1-like            204   4e-60   
emb|CAN76268.1|  hypothetical protein VITISV_004096                     206   5e-60   Vitis vinifera
ref|XP_002267298.2|  PREDICTED: metalloendoproteinase 1                 206   5e-60   Vitis vinifera
ref|XP_007220919.1|  hypothetical protein PRUPE_ppb025548mg             204   7e-60   
gb|KDP32993.1|  hypothetical protein JCGZ_13024                         204   7e-60   
ref|XP_007219827.1|  hypothetical protein PRUPE_ppa026649mg             205   8e-60   
ref|XP_008458715.1|  PREDICTED: metalloendoproteinase 1-like            204   1e-59   
ref|XP_002275671.1|  PREDICTED: metalloendoproteinase 1-like            203   1e-59   Vitis vinifera
emb|CBI34987.3|  unnamed protein product                                203   1e-59   
ref|XP_002520211.1|  Metalloendoproteinase 1 precursor, putative        205   1e-59   Ricinus communis
ref|XP_011003818.1|  PREDICTED: metalloendoproteinase 1-like            203   2e-59   
ref|XP_004142465.1|  PREDICTED: metalloendoproteinase 1-like            202   2e-59   
ref|XP_004509890.1|  PREDICTED: metalloendoproteinase 1-like            204   3e-59   
gb|EYU38312.1|  hypothetical protein MIMGU_mgv11b017434mg               200   3e-59   
gb|EYU46222.1|  hypothetical protein MIMGU_mgv1a027058mg                201   4e-59   
gb|EYU46221.1|  hypothetical protein MIMGU_mgv1a010535mg                202   4e-59   
ref|XP_006602365.1|  PREDICTED: metalloendoproteinase 1-like            203   6e-59   
ref|XP_011085865.1|  PREDICTED: metalloendoproteinase 1-like            201   7e-59   
ref|XP_003530663.1|  PREDICTED: metalloendoproteinase 1-like            203   8e-59   
ref|XP_008465718.1|  PREDICTED: metalloendoproteinase 1                 202   9e-59   
ref|XP_011003815.1|  PREDICTED: metalloendoproteinase 1-like            201   9e-59   
ref|XP_011086481.1|  PREDICTED: metalloendoproteinase 1-like            203   1e-58   
ref|XP_004143787.1|  PREDICTED: metalloendoproteinase 1-like            202   1e-58   
ref|XP_003517862.1|  PREDICTED: metalloendoproteinase 1-like            202   1e-58   
ref|XP_006838196.1|  hypothetical protein AMTR_s00106p00141160          202   2e-58   
gb|KGN52417.1|  hypothetical protein Csa_5G633150                       200   2e-58   
ref|XP_004159085.1|  PREDICTED: metalloendoproteinase 1-like            199   2e-58   
ref|XP_010255269.1|  PREDICTED: metalloendoproteinase 1-like            200   3e-58   
gb|KGN51345.1|  hypothetical protein Csa_5G522910                       199   3e-58   
ref|XP_004159086.1|  PREDICTED: matrix metalloproteinase-9-like         198   7e-58   
gb|EYU46220.1|  hypothetical protein MIMGU_mgv1a010241mg                199   7e-58   
ref|XP_004142459.1|  PREDICTED: matrix metalloproteinase-9-like         197   1e-57   
ref|XP_008353003.1|  PREDICTED: metalloendoproteinase 1-like            200   1e-57   
ref|XP_010110202.1|  Metalloendoproteinase 1                            199   2e-57   
ref|NP_001267680.1|  metalloendoproteinase 1-like precursor             198   2e-57   
ref|XP_008458915.1|  PREDICTED: metalloendoproteinase 1-like            197   2e-57   
gb|EYU34695.1|  hypothetical protein MIMGU_mgv1a024051mg                194   3e-57   
ref|XP_003519796.1|  PREDICTED: metalloendoproteinase 1-like            199   3e-57   
gb|AAC00572.1|  similar to zinc metalloproteinases                      199   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173824.2|  putative metalloproteinase                            199   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EYU35921.1|  hypothetical protein MIMGU_mgv1a019701mg                197   4e-57   
gb|EPS61169.1|  matrixin family protein                                 196   6e-57   
gb|KDO37628.1|  hypothetical protein CISIN_1g039411mg                   193   8e-57   
ref|XP_008244963.1|  PREDICTED: metalloendoproteinase 1                 199   1e-56   
ref|XP_003628627.1|  Matrix metalloproteinase-9                         197   1e-56   
ref|XP_008458913.1|  PREDICTED: metalloendoproteinase 1-like            195   1e-56   
ref|XP_004297678.1|  PREDICTED: metalloendoproteinase 1-like            197   1e-56   
gb|EYU31381.1|  hypothetical protein MIMGU_mgv1a023026mg                194   2e-56   
gb|ACJ24812.1|  matrix metalloproteinase                                197   2e-56   Pinus taeda
ref|XP_011080437.1|  PREDICTED: metalloendoproteinase 1-like            195   2e-56   
gb|KCW85819.1|  hypothetical protein EUGRSUZ_B02562                     197   2e-56   
gb|EYU46223.1|  hypothetical protein MIMGU_mgv1a025538mg                194   2e-56   
ref|XP_007157519.1|  hypothetical protein PHAVU_002G076600g             197   2e-56   
gb|KHN28682.1|  Metalloendoproteinase 1                                 197   3e-56   
ref|XP_009626465.1|  PREDICTED: metalloendoproteinase 1-like            196   3e-56   
ref|XP_010100525.1|  Metalloendoproteinase 1                            196   3e-56   
ref|XP_002319607.2|  hypothetical protein POPTR_0013s03350g             194   4e-56   Populus trichocarpa [western balsam poplar]
ref|XP_008458917.1|  PREDICTED: metalloendoproteinase 1-like            194   4e-56   
ref|XP_004142460.1|  PREDICTED: metalloendoproteinase 1-like            194   4e-56   
emb|CDP00221.1|  unnamed protein product                                196   4e-56   
ref|XP_002893327.1|  hypothetical protein ARALYDRAFT_889959             196   5e-56   
ref|XP_010414620.1|  PREDICTED: metalloendoproteinase 1-like            195   7e-56   
ref|XP_007033356.1|  Matrixin family protein, putative                  196   7e-56   
ref|XP_006416025.1|  hypothetical protein EUTSA_v10007920mg             196   8e-56   
gb|EYU28648.1|  hypothetical protein MIMGU_mgv1a008442mg                195   1e-55   
gb|KHN16358.1|  Metalloendoproteinase 1                                 192   1e-55   
ref|XP_009360449.1|  PREDICTED: metalloendoproteinase 1                 194   2e-55   
ref|XP_004504503.1|  PREDICTED: metalloendoproteinase 1-like            194   2e-55   
ref|XP_004965108.1|  PREDICTED: metalloendoproteinase 1-like            194   2e-55   
ref|XP_004142843.1|  PREDICTED: metalloendoproteinase 1-like            192   2e-55   
ref|XP_010264870.1|  PREDICTED: metalloendoproteinase 1-like            192   3e-55   
ref|NP_176205.1|  Matrixin family protein                               193   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004965107.1|  PREDICTED: metalloendoproteinase 1-like            192   3e-55   
gb|KCW49213.1|  hypothetical protein EUGRSUZ_K02793                     189   3e-55   
ref|XP_010552627.1|  PREDICTED: metalloendoproteinase 1                 194   4e-55   
emb|CBI34986.3|  unnamed protein product                                191   4e-55   
ref|XP_002533939.1|  Metalloendoproteinase 1 precursor, putative        189   6e-55   Ricinus communis
ref|XP_007223246.1|  hypothetical protein PRUPE_ppa007227mg             193   6e-55   
emb|CDY11609.1|  BnaC06g31300D                                          193   6e-55   
ref|XP_004142468.1|  PREDICTED: metalloendoproteinase 1-like            191   8e-55   
ref|XP_008458912.1|  PREDICTED: metalloendoproteinase 1-like            191   9e-55   
ref|XP_010043822.1|  PREDICTED: metalloendoproteinase 1-like            196   1e-54   
ref|XP_008458914.1|  PREDICTED: metalloendoproteinase 1-like            190   1e-54   
emb|CDY38799.1|  BnaA07g28710D                                          192   1e-54   
gb|KFK41437.1|  hypothetical protein AALP_AA2G130300                    192   2e-54   
gb|AES96374.2|  matrix metalloproteinase                                191   3e-54   
emb|CDY23516.1|  BnaC06g24850D                                          191   3e-54   
ref|XP_006357274.1|  PREDICTED: metalloendoproteinase 1-like            190   3e-54   
ref|XP_010913461.1|  PREDICTED: metalloendoproteinase 1-like            191   3e-54   
ref|XP_010553642.1|  PREDICTED: metalloendoproteinase 1                 191   4e-54   
ref|XP_003613416.1|  Matrix metalloproteinase-9                         191   5e-54   
ref|XP_002318762.2|  MATRIX METALLOproteinASE                           191   5e-54   Populus trichocarpa [western balsam poplar]
gb|KCW56124.1|  hypothetical protein EUGRSUZ_I01878                     188   7e-54   
dbj|BAE98757.1|  predicted GPI-anchored protein                         190   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105693.1|  PREDICTED: metalloendoproteinase 1-like            190   9e-54   
ref|XP_008389591.1|  PREDICTED: metalloendoproteinase 1-like            190   9e-54   
ref|XP_010030761.1|  PREDICTED: metalloendoproteinase 1-like            188   9e-54   
ref|XP_006304956.1|  hypothetical protein CARUB_v10011449mg             190   9e-54   
ref|XP_006603838.1|  PREDICTED: metalloendoproteinase 1-like            189   1e-53   
ref|NP_177174.1|  matrix metalloproteinase                              190   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113266.1|  PREDICTED: metalloendoproteinase 1                 190   1e-53   
gb|EYU42526.1|  hypothetical protein MIMGU_mgv1a011887mg                186   1e-53   
gb|KDO75343.1|  hypothetical protein CISIN_1g043086mg                   186   1e-53   
ref|XP_006647869.1|  PREDICTED: metalloendoproteinase 1-like            189   1e-53   
ref|XP_011002109.1|  PREDICTED: metalloendoproteinase 1-like            189   1e-53   
ref|XP_010320628.1|  PREDICTED: metalloendoproteinase 1                 189   1e-53   
ref|XP_002888162.1|  predicted protein                                  189   2e-53   
emb|CDY45157.1|  BnaA09g14350D                                          189   2e-53   
emb|CDX68356.1|  BnaA07g23960D                                          189   2e-53   
ref|XP_009418044.1|  PREDICTED: metalloendoproteinase 1-like            189   2e-53   
dbj|BAJ94792.1|  predicted protein                                      189   2e-53   
ref|XP_006390919.1|  hypothetical protein EUTSA_v10018701mg             189   3e-53   
ref|XP_002322292.2|  hypothetical protein POPTR_0015s11510g             189   3e-53   Populus trichocarpa [western balsam poplar]
ref|XP_002452573.1|  hypothetical protein SORBIDRAFT_04g028370          188   4e-53   Sorghum bicolor [broomcorn]
ref|XP_002887284.1|  hypothetical protein ARALYDRAFT_476141             188   4e-53   
gb|EYU22461.1|  hypothetical protein MIMGU_mgv1a008611mg                188   5e-53   
ref|XP_009104967.1|  PREDICTED: metalloendoproteinase 1-like            188   6e-53   
ref|XP_011080438.1|  PREDICTED: metalloendoproteinase 1-like            186   6e-53   
ref|XP_010470167.1|  PREDICTED: metalloendoproteinase 1-like            187   7e-53   
ref|XP_008798076.1|  PREDICTED: metalloendoproteinase 1-like            189   7e-53   
ref|XP_006367952.1|  PREDICTED: metalloendoproteinase 1-like            187   8e-53   
ref|XP_006300514.1|  hypothetical protein CARUB_v10020497mg             187   8e-53   
gb|EAY87473.1|  hypothetical protein OsI_08881                          187   9e-53   Oryza sativa Indica Group [Indian rice]
gb|KFK44477.1|  hypothetical protein AALP_AA1G261400                    187   9e-53   
gb|KFK40830.1|  hypothetical protein AALP_AA2G047000                    187   1e-52   
emb|CDY30915.1|  BnaC09g14910D                                          186   1e-52   
gb|EAZ24565.1|  hypothetical protein OsJ_08327                          187   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048075.1|  Os02g0740700                                       187   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011042944.1|  PREDICTED: metalloendoproteinase 1-like            187   2e-52   
ref|XP_010415694.1|  PREDICTED: metalloendoproteinase 1-like            187   2e-52   
ref|XP_004953898.1|  PREDICTED: metalloendoproteinase 1-like            186   2e-52   
ref|NP_001235535.1|  metalloendoproteinase 1 precursor                  184   2e-52   
ref|XP_010512095.1|  PREDICTED: metalloendoproteinase 1                 186   3e-52   
ref|XP_007033352.1|  Matrixin family protein                            183   4e-52   
ref|XP_006300509.1|  hypothetical protein CARUB_v10020468mg             186   5e-52   
emb|CBI34984.3|  unnamed protein product                                191   6e-52   
ref|XP_010510985.1|  PREDICTED: metalloendoproteinase 1-like            184   8e-52   
ref|XP_004142467.1|  PREDICTED: matrix metalloproteinase-9-like         183   9e-52   
ref|NP_001151749.1|  metalloendoproteinase 1 precursor                  184   1e-51   Zea mays [maize]
dbj|BAJ93963.1|  predicted protein                                      184   1e-51   
ref|XP_003554856.1|  PREDICTED: metalloendoproteinase 1-like            182   2e-51   
ref|XP_010460187.1|  PREDICTED: metalloendoproteinase 1-like            183   3e-51   
ref|XP_010471013.1|  PREDICTED: metalloendoproteinase 1-like            183   3e-51   
gb|ACU20327.1|  unknown                                                 181   4e-51   Glycine max [soybeans]
ref|XP_004983677.1|  PREDICTED: metalloendoproteinase 1-like            183   4e-51   
gb|EYU29520.1|  hypothetical protein MIMGU_mgv1a018504mg                180   4e-51   
gb|EAY79487.1|  hypothetical protein OsI_34615                          181   9e-51   Oryza sativa Indica Group [Indian rice]
gb|KHN16355.1|  Metalloendoproteinase 1                                 179   9e-51   
ref|XP_010498935.1|  PREDICTED: metalloendoproteinase 1-like            183   1e-50   
dbj|BAJ98922.1|  predicted protein                                      181   1e-50   
emb|CDY16241.1|  BnaA09g29750D                                          182   2e-50   
ref|NP_001065361.2|  Os10g0557900                                       181   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658321.1|  PREDICTED: metalloendoproteinase 1-like            180   4e-50   
gb|KHN16360.1|  Metalloendoproteinase 1                                 178   4e-50   
ref|XP_010477738.1|  PREDICTED: metalloendoproteinase 1                 181   4e-50   
emb|CDY66521.1|  BnaCnng51190D                                          180   5e-50   
ref|XP_008379873.1|  PREDICTED: metalloendoproteinase 1-like            178   5e-50   
ref|XP_002436777.1|  hypothetical protein SORBIDRAFT_10g008650          180   5e-50   Sorghum bicolor [broomcorn]
ref|XP_009115471.1|  PREDICTED: metalloendoproteinase 1                 180   6e-50   
ref|XP_009136800.1|  PREDICTED: metalloendoproteinase 1-like            179   7e-50   
ref|XP_009410261.1|  PREDICTED: metalloendoproteinase 1                 179   9e-50   
ref|XP_010647716.1|  PREDICTED: metalloendoproteinase 1-like            177   1e-49   
emb|CAN65266.1|  hypothetical protein VITISV_040133                     176   3e-49   Vitis vinifera
gb|ACB59207.1|  matrixin family protein                                 178   3e-49   Brassica oleracea
ref|XP_002274477.1|  PREDICTED: metalloendoproteinase 1                 177   3e-49   Vitis vinifera
dbj|BAJ94176.1|  predicted protein                                      177   6e-49   
ref|XP_003560867.1|  PREDICTED: metalloendoproteinase 1-like            177   7e-49   
ref|XP_011019812.1|  PREDICTED: metalloendoproteinase 1-like            175   7e-49   
ref|NP_001142095.1|  hypothetical protein precursor                     177   8e-49   
ref|XP_003574325.2|  PREDICTED: metalloendoproteinase 1-like            178   1e-48   
ref|XP_010264331.1|  PREDICTED: metalloendoproteinase 1-like            176   1e-48   
ref|NP_001057259.1|  Os06g0239100                                       176   1e-48   
emb|CAN66084.1|  hypothetical protein VITISV_024635                     176   1e-48   
gb|EAZ00310.1|  hypothetical protein OsI_22327                          176   1e-48   
emb|CDX90504.1|  BnaA03g42770D                                          176   2e-48   
ref|XP_002464938.1|  hypothetical protein SORBIDRAFT_01g029150          176   2e-48   
ref|XP_007215990.1|  hypothetical protein PRUPE_ppa011783mg             170   3e-48   
ref|XP_007052204.1|  Matrixin family protein                            174   9e-48   
ref|XP_008802827.1|  PREDICTED: metalloendoproteinase 1-like            174   9e-48   
ref|XP_004169198.1|  PREDICTED: metalloendoproteinase 1-like            172   1e-47   
ref|XP_004152428.1|  PREDICTED: metalloendoproteinase 1-like            172   1e-47   
gb|AGT16050.1|  metalloendoproteinase                                   172   7e-47   
gb|KDP28814.1|  hypothetical protein JCGZ_14585                         171   1e-46   
ref|XP_010434790.1|  PREDICTED: metalloendoproteinase 1-like            171   1e-46   
ref|XP_009780227.1|  PREDICTED: metalloendoproteinase 1-like            171   1e-46   
ref|XP_002511639.1|  Metalloendoproteinase 1 precursor, putative        171   1e-46   
ref|XP_006355432.1|  PREDICTED: metalloendoproteinase 1-like            171   1e-46   
gb|KGN50256.1|  hypothetical protein Csa_5G162050                       171   2e-46   
ref|XP_004963649.1|  PREDICTED: metalloendoproteinase 1-like            171   2e-46   
ref|XP_007151139.1|  hypothetical protein PHAVU_004G021000g             168   2e-46   
ref|XP_010440122.1|  PREDICTED: metalloendoproteinase 1-like            170   2e-46   
ref|XP_007010972.1|  Matrixin family protein                            169   2e-46   
ref|XP_006283956.1|  hypothetical protein CARUB_v10005079mg             170   2e-46   
ref|XP_010910625.1|  PREDICTED: metalloendoproteinase 1-like            170   2e-46   
ref|XP_002969781.1|  hypothetical protein SELMODRAFT_13930              168   3e-46   
ref|XP_002870142.1|  hypothetical protein ARALYDRAFT_493212             169   4e-46   
gb|KDP39879.1|  hypothetical protein JCGZ_03410                         170   4e-46   
ref|XP_010451026.1|  PREDICTED: metalloendoproteinase 1-like            169   4e-46   
ref|XP_008437072.1|  PREDICTED: metalloendoproteinase 1                 169   5e-46   
ref|XP_007039816.1|  Matrixin family protein                            169   6e-46   
ref|XP_003618349.1|  Interstitial collagenase                           168   6e-46   
ref|XP_011020982.1|  PREDICTED: metalloendoproteinase 1-like            166   6e-46   
ref|XP_006477577.1|  PREDICTED: metalloendoproteinase 1-like            169   7e-46   
ref|XP_010089255.1|  Metalloendoproteinase 1                            168   8e-46   
ref|XP_010444942.1|  PREDICTED: metalloendoproteinase 1-like            169   8e-46   
ref|XP_010325488.1|  PREDICTED: metalloendoproteinase 1                 168   1e-45   
ref|XP_008369492.1|  PREDICTED: metalloendoproteinase 1                 168   1e-45   
ref|XP_010449738.1|  PREDICTED: metalloendoproteinase 1-like            168   2e-45   
ref|XP_006440301.1|  hypothetical protein CICLE_v10024210mg             167   2e-45   
ref|XP_010053954.1|  PREDICTED: metalloendoproteinase 1                 168   2e-45   
ref|XP_004301194.1|  PREDICTED: metalloendoproteinase 1-like            167   2e-45   
ref|XP_002534615.1|  Metalloendoproteinase 1 precursor, putative        166   3e-45   
ref|XP_008373793.1|  PREDICTED: metalloendoproteinase 1-like            167   3e-45   
ref|XP_004511690.1|  PREDICTED: metalloendoproteinase 1-like            167   3e-45   
ref|XP_009334548.1|  PREDICTED: metalloendoproteinase 1                 167   4e-45   
emb|CDP09976.1|  unnamed protein product                                165   5e-45   
ref|XP_006375259.1|  hypothetical protein POPTR_0014s05720g             166   6e-45   
ref|XP_007157295.1|  hypothetical protein PHAVU_002G058000g             166   7e-45   
ref|XP_003573113.1|  PREDICTED: metalloendoproteinase 1-like            167   8e-45   
ref|XP_011033214.1|  PREDICTED: metalloendoproteinase 1                 166   8e-45   
ref|XP_006414320.1|  hypothetical protein EUTSA_v10025551mg             166   1e-44   
gb|AET01165.2|  matrix metalloproteinase                                166   1e-44   
ref|XP_009397655.1|  PREDICTED: metalloendoproteinase 1-like            166   1e-44   
ref|XP_007219228.1|  hypothetical protein PRUPE_ppa017777mg             166   2e-44   
ref|XP_009610496.1|  PREDICTED: metalloendoproteinase 1-like            165   2e-44   
emb|CDY40518.1|  BnaC01g19940D                                          165   2e-44   
ref|XP_009629020.1|  PREDICTED: metalloendoproteinase 1-like            165   2e-44   
ref|XP_006387815.1|  hypothetical protein POPTR_0547s00200g             164   3e-44   
ref|XP_003626689.1|  Matrix metalloproteinase-27                        164   5e-44   
gb|AAO42162.1|  putative proteinase                                     164   5e-44   
ref|NP_193397.1|  Matrixin family protein                               164   5e-44   
ref|XP_010055492.1|  PREDICTED: metalloendoproteinase 1                 164   7e-44   
gb|KCW77797.1|  hypothetical protein EUGRSUZ_D02088                     163   8e-44   
ref|XP_006369019.1|  senescence-specific family protein                 163   9e-44   
ref|XP_009145660.1|  PREDICTED: metalloendoproteinase 1-like            163   9e-44   
ref|XP_011001486.1|  PREDICTED: metalloendoproteinase 1-like            163   1e-43   
ref|XP_011010768.1|  PREDICTED: metalloendoproteinase 1-like            158   1e-43   
ref|XP_010053486.1|  PREDICTED: metalloendoproteinase 1-like            163   2e-43   
gb|KGN52411.1|  hypothetical protein Csa_5G632100                       161   2e-43   
gb|EYU34693.1|  hypothetical protein MIMGU_mgv1a025583mg                156   3e-43   
ref|XP_006361512.1|  PREDICTED: metalloendoproteinase 1-like            162   3e-43   
ref|XP_007216495.1|  hypothetical protein PRUPE_ppa023859mg             156   4e-43   
ref|XP_010538414.1|  PREDICTED: metalloendoproteinase 1                 162   4e-43   
ref|XP_009398117.1|  PREDICTED: metalloendoproteinase 1                 161   5e-43   
ref|XP_003538740.1|  PREDICTED: metalloendoproteinase 1-like            161   6e-43   
gb|EYU19330.1|  hypothetical protein MIMGU_mgv1a010192mg                160   6e-43   
ref|XP_007157294.1|  hypothetical protein PHAVU_002G058000g             159   6e-43   
gb|AAM62476.1|  proteinase like protein                                 161   7e-43   
gb|KHN34932.1|  Metalloendoproteinase 1                                 160   1e-42   
gb|EYU29746.1|  hypothetical protein MIMGU_mgv1a022148mg                155   2e-42   
ref|XP_011094514.1|  PREDICTED: metalloendoproteinase 1                 159   2e-42   
ref|XP_003516663.2|  PREDICTED: metalloendoproteinase 1-like            159   2e-42   
ref|XP_003562240.2|  PREDICTED: metalloendoproteinase 1                 159   3e-42   
gb|EYU20655.1|  hypothetical protein MIMGU_mgv1a025968mg                153   4e-42   
ref|XP_006371425.1|  hypothetical protein POPTR_0019s10250g             154   4e-42   
gb|EPS70970.1|  hypothetical protein M569_03790                         158   5e-42   
ref|XP_007210794.1|  hypothetical protein PRUPE_ppa018176mg             158   6e-42   
emb|CDP09487.1|  unnamed protein product                                158   6e-42   
ref|WP_001265815.1|  hypothetical protein                               155   7e-42   
gb|EYU29747.1|  hypothetical protein MIMGU_mgv1a025729mg                152   8e-42   
ref|XP_008238512.1|  PREDICTED: metalloendoproteinase 1                 158   1e-41   
ref|XP_007099566.1|  Matrix metalloproteinase, putative                 154   3e-41   
ref|XP_008458908.1|  PREDICTED: metalloendoproteinase 1-like            156   3e-41   
ref|XP_001774956.1|  predicted protein                                  154   5e-41   
gb|EYU34692.1|  hypothetical protein MIMGU_mgv1a022100mg                150   9e-41   
ref|XP_004248606.1|  PREDICTED: metalloendoproteinase 1-like            155   9e-41   
gb|EYU31934.1|  hypothetical protein MIMGU_mgv1a021000mg                154   2e-40   
ref|XP_006431002.1|  hypothetical protein CICLE_v10013597mg             150   2e-40   
ref|XP_003611315.1|  Matrix metalloproteinase-28                        154   2e-40   
ref|XP_002309553.2|  hypothetical protein POPTR_0006s25750g             152   3e-40   
gb|KHN25070.1|  Metalloendoproteinase 1                                 154   3e-40   
ref|XP_006583548.1|  PREDICTED: metalloendoproteinase 1-like            154   3e-40   
emb|CAN66781.1|  hypothetical protein VITISV_013507                     154   4e-40   
ref|XP_010692448.1|  PREDICTED: metalloendoproteinase 1                 154   4e-40   
ref|XP_011081262.1|  PREDICTED: metalloendoproteinase 1-like            154   4e-40   
ref|XP_006577655.1|  PREDICTED: metalloendoproteinase 1-like            154   5e-40   
ref|XP_002979138.1|  hypothetical protein SELMODRAFT_110370             153   5e-40   
ref|XP_003635123.1|  PREDICTED: metalloendoproteinase 1                 151   7e-40   
ref|XP_010524412.1|  PREDICTED: metalloendoproteinase 1                 152   8e-40   
ref|XP_011032037.1|  PREDICTED: metalloendoproteinase 1                 154   1e-39   
ref|XP_007041108.1|  Matrix metalloproteinase, putative                 150   1e-39   
ref|XP_010676950.1|  PREDICTED: metalloendoproteinase 1-like            152   3e-39   
ref|XP_007134548.1|  hypothetical protein PHAVU_010G056300g             151   4e-39   
ref|XP_010647721.1|  PREDICTED: metalloendoproteinase 1-like            149   6e-39   
ref|XP_002988587.1|  hypothetical protein SELMODRAFT_128150             150   7e-39   
ref|XP_002440092.1|  hypothetical protein SORBIDRAFT_09g025870          150   1e-38   
ref|XP_010647717.1|  PREDICTED: metalloendoproteinase 1-like            147   2e-38   
ref|XP_007217818.1|  hypothetical protein PRUPE_ppb019632mg             146   3e-38   
gb|EYF01915.1|  Interstitial collagenase precursor                      150   3e-38   
ref|XP_004167465.1|  PREDICTED: metalloendoproteinase 1-like            144   5e-38   
ref|XP_004510108.1|  PREDICTED: metalloendoproteinase 1-like            148   5e-38   
ref|XP_002304280.1|  hypothetical protein POPTR_0003s07510g             146   6e-38   
ref|WP_035319307.1|  hypothetical protein                               145   6e-38   
gb|KGL80216.1|  Matrilysin                                              145   6e-38   
ref|XP_006397684.1|  hypothetical protein EUTSA_v10001525mg             147   8e-38   
gb|AAC31167.1|  metalloproteinase                                       147   1e-37   
ref|XP_010217214.1|  PREDICTED: matrilysin                              145   1e-37   
ref|NP_182030.1|  matrixin family protein                               146   2e-37   
ref|XP_004142464.1|  PREDICTED: metalloendoproteinase 1-like            145   2e-37   
ref|XP_005149869.1|  PREDICTED: matrilysin                              144   2e-37   
ref|XP_002880153.1|  matrix metalloproteinase                           145   3e-37   
ref|XP_009554452.1|  PREDICTED: matrilysin                              143   5e-37   
gb|KFO69571.1|  Stromelysin-1                                           142   6e-37   
ref|XP_010156415.1|  PREDICTED: matrilysin                              142   1e-36   
gb|KFW11249.1|  Matrilysin                                              142   1e-36   
ref|XP_010508218.1|  PREDICTED: metalloendoproteinase 1-like            143   2e-36   
gb|EYU29523.1|  hypothetical protein MIMGU_mgv1a020428mg                139   3e-36   
gb|KHN01125.1|  Metalloendoproteinase 1                                 140   5e-36   
ref|XP_005808976.1|  PREDICTED: matrix metalloproteinase-20-like        143   1e-35   
ref|XP_010129608.1|  PREDICTED: matrilysin                              139   1e-35   
gb|KFO84409.1|  Matrix metalloproteinase-18                             139   1e-35   
ref|XP_009143096.1|  PREDICTED: metalloendoproteinase 1                 141   2e-35   
gb|KDO61427.1|  hypothetical protein CISIN_1g037540mg                   140   2e-35   
ref|XP_008424216.1|  PREDICTED: matrilysin-like                         142   2e-35   
ref|XP_007562840.1|  PREDICTED: matrix metalloproteinase-20-like        142   2e-35   
emb|CDX74706.1|  BnaA05g04520D                                          140   2e-35   
emb|CDY18956.1|  BnaC04g03940D                                          140   2e-35   
ref|XP_004661959.1|  PREDICTED: stromelysin-1                           142   4e-35   
dbj|BAA83518.1|  matrilysin                                             138   5e-35   
ref|XP_004385917.1|  PREDICTED: matrix metalloproteinase-20             141   5e-35   
ref|WP_037696766.1|  hypothetical protein                               137   5e-35   
gb|KFF99256.1|  hypothetical protein IQ62_20055                         140   6e-35   
ref|XP_009685061.1|  PREDICTED: matrilysin                              137   6e-35   
ref|XP_004447335.1|  PREDICTED: matrix metalloproteinase-26             137   6e-35   
gb|KFV87419.1|  Matrilysin                                              137   6e-35   
ref|XP_005010554.1|  PREDICTED: matrilysin isoform X2                   137   7e-35   
gb|EOB07965.1|  Matrilysin                                              137   8e-35   
ref|XP_010518113.1|  PREDICTED: metalloendoproteinase 1-like            139   1e-34   
ref|XP_002198049.2|  PREDICTED: 72 kDa type IV collagenase-like         137   1e-34   
ref|XP_001924042.4|  PREDICTED: matrix metalloproteinase-15             142   1e-34   
ref|XP_004052079.1|  PREDICTED: matrix metalloproteinase-20             140   1e-34   
gb|KFP18449.1|  Stromelysin-1                                           136   1e-34   
ref|XP_003496183.1|  PREDICTED: matrix metalloproteinase-20             140   1e-34   
ref|XP_006983827.1|  PREDICTED: stromelysin-1                           140   1e-34   
ref|XP_005010553.1|  PREDICTED: matrilysin isoform X1                   137   1e-34   
ref|XP_009640064.1|  PREDICTED: matrilysin                              136   1e-34   
gb|KFK37298.1|  hypothetical protein AALP_AA4G239100                    138   2e-34   
ref|XP_006293383.1|  hypothetical protein CARUB_v10023542mg             138   2e-34   
ref|XP_007637744.1|  PREDICTED: matrix metalloproteinase-20             140   2e-34   
ref|XP_008577849.1|  PREDICTED: matrilysin                              135   3e-34   
gb|KFP36635.1|  Stromelysin-1                                           135   3e-34   
gb|ERE75957.1|  matrix metalloproteinase-20                             140   3e-34   
gb|KFQ57727.1|  Stromelysin-1                                           135   3e-34   
gb|KDO37620.1|  hypothetical protein CISIN_1g039712mg                   134   3e-34   
pdb|1SLM|A  Chain A, Crystal Structure Of Fibroblast Stromelysin-...    135   4e-34   
ref|XP_009490287.1|  PREDICTED: matrilysin                              135   4e-34   
ref|XP_005077401.1|  PREDICTED: matrix metalloproteinase-20             138   5e-34   
gb|KFW77959.1|  Stromelysin-1                                           135   6e-34   
ref|XP_008828119.1|  PREDICTED: matrix metalloproteinase-20             139   6e-34   
ref|XP_009509073.1|  PREDICTED: matrilysin                              134   6e-34   
ref|XP_003780845.1|  PREDICTED: matrix metalloproteinase-20             138   7e-34   
ref|XP_003472824.1|  PREDICTED: matrix metalloproteinase-20             138   7e-34   
ref|XP_006242549.1|  PREDICTED: matrix metalloproteinase-20 isofo...    138   7e-34   
ref|NP_001100270.1|  matrix metalloproteinase-20 precursor              138   8e-34   
ref|XP_005230633.1|  PREDICTED: stromelysin-2                           136   8e-34   
ref|XP_010891574.1|  PREDICTED: matrix metalloproteinase-20-like ...    138   8e-34   
ref|XP_005432126.1|  PREDICTED: 72 kDa type IV collagenase-like         135   8e-34   
ref|XP_005329176.1|  PREDICTED: stromelysin-2                           138   9e-34   
ref|XP_006627924.1|  PREDICTED: matrix metalloproteinase-20-like        135   9e-34   
gb|AEA40854.1|  matrix metalloproteinase-7                              133   9e-34   
gb|KFP62029.1|  Stromelysin-1                                           134   1e-33   
ref|XP_006983832.1|  PREDICTED: matrix metalloproteinase-20             138   1e-33   
ref|XP_004604868.1|  PREDICTED: matrix metalloproteinase-20             138   1e-33   
ref|XP_005346838.1|  PREDICTED: matrix metalloproteinase-20             138   1e-33   
ref|XP_009708511.1|  PREDICTED: matrilysin                              134   1e-33   
ref|XP_005378039.1|  PREDICTED: matrilysin                              134   1e-33   
ref|XP_006983829.1|  PREDICTED: stromelysin-2                           137   1e-33   
gb|KFR13852.1|  Matrilysin                                              134   1e-33   
gb|AAT70722.1|  matrix metalloproteinase 20 (enamelysin)                137   1e-33   
ref|NP_004762.2|  matrix metalloproteinase-20 preproprotein             137   1e-33   
ref|XP_010121667.1|  PREDICTED: matrilysin                              135   1e-33   
emb|CAA73317.1|  enamelysin                                             137   2e-33   
ref|XP_009936824.1|  PREDICTED: matrilysin                              134   2e-33   
ref|XP_004688814.1|  PREDICTED: matrilysin                              135   2e-33   
ref|XP_007944196.1|  PREDICTED: macrophage metalloelastase              137   2e-33   
ref|XP_001153208.1|  PREDICTED: matrix metalloproteinase-20             137   2e-33   
ref|XP_006032993.1|  PREDICTED: macrophage metalloelastase-like         133   2e-33   
gb|EFB17312.1|  hypothetical protein PANDA_010999                       132   2e-33   
ref|XP_007939268.1|  PREDICTED: matrix metalloproteinase-26             135   2e-33   
ref|XP_003828430.1|  PREDICTED: matrix metalloproteinase-20             137   2e-33   
ref|NP_001229655.1|  matrilysin precursor                               133   2e-33   
ref|XP_005998661.1|  PREDICTED: matrix metalloproteinase-20-like        137   2e-33   
ref|XP_003253094.1|  PREDICTED: matrix metalloproteinase-20             137   2e-33   
ref|XP_004324174.1|  PREDICTED: matrix metalloproteinase-20-like        134   2e-33   
gb|KFQ46681.1|  Matrilysin                                              133   2e-33   
ref|XP_008348251.1|  PREDICTED: metalloendoproteinase 1-like            130   2e-33   
ref|XP_004661963.1|  PREDICTED: matrix metalloproteinase-20             137   2e-33   
ref|XP_009973912.1|  PREDICTED: matrilysin                              133   2e-33   



>gb|KDP45996.1| hypothetical protein JCGZ_11899 [Jatropha curcas]
 gb|KDP45997.1| hypothetical protein JCGZ_11900 [Jatropha curcas]
Length=309

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 165/271 (61%), Gaps = 18/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQGSKKGD++KG++ LKKYLK FGY++    N S  D D F D LESA++ YQ  +HLN+
Sbjct  43   LQGSKKGDKIKGIHELKKYLKHFGYLS--CENQSFADDDEFDDVLESALKVYQLNYHLNT  100

Query  181  TGILDAETARQMMKPRCGVADIINGT-------------SGGAGVVPHYRFLPGEPKWPA  321
            TG LD ET   MM PRCG+ DIING+             S    +V HY F  G+PKWP 
Sbjct  101  TGFLDYETMSIMMMPRCGIPDIINGSTRMLSGKNNHRHSSSSFHMVSHYTFFRGKPKWPV  160

Query  322  DKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGK  498
             K  LT+GF P TP +    V  A   W +V  F F   + Y  AD+K   +RG+HGDG 
Sbjct  161  SKYNLTYGFEPSTPTEARGAVANAFETWATVTKFKFTSVQDYKTADLKIGFYRGEHGDGL  220

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG  AHAF P +G  H+DADE +A  G      D+++VALHEIGHLLGL HS   
Sbjct  221  PFDGPGGITAHAFAPQDGRFHYDADEKYA-VGAVQGAFDLKTVALHEIGHLLGLQHSSLQ  279

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
             AVMY     G  +  LT DD  G++ALYNF
Sbjct  280  AAVMYAYTSRGVTKD-LTADDVQGIRALYNF  309



>ref|XP_008230962.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=314

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 166/270 (61%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+   + D F DQLESAI+TYQ  +HL +
Sbjct  47   LKGCHKGDKVQGIKDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQINYHLKA  104

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-------------GAGVVPHYRFLPGEPKWPA  321
            TG LDA+T   MM PRCGVADIINGTS              G   V HY F  G PKWPA
Sbjct  105  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGKKRHPHHHHGGHTVAHYSFFQGNPKWPA  164

Query  322  DKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGK  498
             K  LT+ F  GTP +   PV++A + W +   F F + +   N D+  +  RG+HGDG 
Sbjct  165  SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEVQSNQNPDLTVSFHRGNHGDGA  224

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG+ AHAF PTNG  H+DA E WA  G      D+QSVALHEIGHLLGL HS   
Sbjct  225  PFDGPGGTIAHAFAPTNGRFHYDAAEAWA-VGAVSGAFDLQSVALHEIGHLLGLGHSSVQ  283

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
             A+M+     G   + L  DD  G+KALYN
Sbjct  284  GAIMFPSIGTGVTEQSLHGDDIQGIKALYN  313



>emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera]
Length=319

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/285 (47%), Positives = 173/285 (61%), Gaps = 18/285 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G +KG +VK ++ LKKYL+ FGY++   S + +  D D F D LE AI+TYQT ++L 
Sbjct  38   LEGCQKGHKVKDIHKLKKYLQQFGYLSYSHSEHQTHADNDDFDDLLEFAIKTYQTNYYLK  97

Query  178  STGILDAETARQMMKPRCGVADIINGTS-------------GGAGVVPHYRFLPGEPKWP  318
            ++G LD+ET   M+KPRCGVADIINGTS             G    V HY FL G P+WP
Sbjct  98   ASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSFHTVAHYSFLAGSPRWP  157

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
              K  LT+ F  GTP      VT A   W S   F F + + Y NAD+K    RGDHGDG
Sbjct  158  PSKTHLTYAFLSGTPSTTMSAVTRAFGQWASATNFSFAETQDYTNADMKIGFQRGDHGDG  217

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
             PFDGPGG+ AH+FPPT+G  HFD DE+W   G      D+++VALHEIGHLLGL HS  
Sbjct  218  HPFDGPGGTIAHSFPPTDGRLHFDGDESWV-VGAVAGAFDVETVALHEIGHLLGLGHSSV  276

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF*QNRGQQCM*QLL  810
              A+M+    YG  +  L  DD  G++ALYNF + R   C  +++
Sbjct  277  EGAIMFPTIAYGVTKG-LNEDDIQGIQALYNF-RTRTGSCSYEIM  319



>ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=311

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 168/272 (62%), Gaps = 21/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSPDADYFSDQLESAIRTYQTRHHLN  177
            LQG  KGD +KG+++LKKYL+ FGY   LSY N S  + D F D LE A++TYQ  +HLN
Sbjct  44   LQGCHKGDNLKGIHDLKKYLENFGY---LSYKNQSHSNDDDFDDLLEYALKTYQFNYHLN  100

Query  178  STGILDAETARQMMKPRCGVADIINGT--------------SGGAGVVPHYRFLPGEPKW  315
             TG LD+ET  +MM PRCGVADIINGT              S     V HY F PG P+W
Sbjct  101  VTGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSSTSFHTVSHYEFFPGNPRW  160

Query  316  PADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGD  492
            PA K  LT+GF PGTP++   PV  A + W +   F F + + Y  ADI     RGDHGD
Sbjct  161  PASKYHLTYGFLPGTPNQAMEPVAKAFQTWAANTHFRFTRVQDYRAADITIGFHRGDHGD  220

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G PFDG GG+ AHAF P +G  H+D DE+WA  G      D+++VALHEIGHLLGL HS 
Sbjct  221  GSPFDGRGGTLAHAFAPQDGRFHYDGDEHWA-VGATQGAFDVETVALHEIGHLLGLGHSS  279

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
               A+M+   + G  +  L +DD  G++ALYN
Sbjct  280  VEGAIMHPSIQSGATKG-LHSDDIQGIRALYN  310



>ref|XP_008230963.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 166/270 (61%), Gaps = 18/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY   LS N+   + D F DQLESAI+TYQ  +HL +
Sbjct  47   LKGCHKGDKVQGIQDLKKYLGKFGY---LSSNNGHLNDDDFDDQLESAIKTYQINYHLKA  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-------------GAGVVPHYRFLPGEPKWPA  321
            TG LDA+T   MM PRCGVADIINGTS                  V +Y F  G P WPA
Sbjct  104  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGQKRHPHHHHRGHTVANYSFFQGNPTWPA  163

Query  322  DKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGK  498
             K  LT+ F  GTP +   PV++A + W +   F F + +   N D+  +  RGDHGDG 
Sbjct  164  SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGT  223

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG+ AHAF PTNG  H+DADE ++  G      D +++ALHEIGHLLGL HS   
Sbjct  224  PFDGPGGTIAHAFAPTNGRLHYDADERFS-VGAVSGAYDFETIALHEIGHLLGLGHSSVQ  282

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            +A+M+     GE ++ L  DD  G+KALYN
Sbjct  283  EAIMFPSVRSGETQQSLHGDDIQGIKALYN  312



>ref|XP_007216839.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
 gb|EMJ18038.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
Length=296

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 162/257 (63%), Gaps = 12/257 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++    N+   + D F DQLESAI+TYQ  +HL +
Sbjct  50   LKGCHKGDKVQGIKDLKKYLGKFGYLS--RNNNGHFNDDDFDDQLESAIKTYQINYHLKA  107

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LDA+T   MM PRCGVADIIN        V HY F  G PKWPA K  LT+ F  GT
Sbjct  108  TGTLDAKTVSNMMMPRCGVADIIN--------VAHYSFFQGNPKWPASKYHLTYAFLQGT  159

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P +   PV++A + W +   F F + +   N D+  +  RG+HGDG PFDGPGG+ AHAF
Sbjct  160  PAEAMGPVSSAFQTWAANKHFTFSEVQSNQNPDLTVSFHRGNHGDGAPFDGPGGTIAHAF  219

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DA E WA  G      D+QSVALHEIGHLLGL HS    A+M+     G  
Sbjct  220  APTNGRFHYDAAEAWA-VGAVTGAFDLQSVALHEIGHLLGLGHSSVQGAIMFPSIGTGVT  278

Query  718  RRVLTTDDKNGLKALYN  768
            ++ L  DD  G+KALYN
Sbjct  279  QQSLHGDDIQGIKALYN  295



>ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=315

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 169/272 (62%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSPDADYFSDQLESAIRTYQTRHHL  174
            LQG  KGD+V+G++ LKKYL  FGY++     Y++ + D D F D +ESAI+TYQT +HL
Sbjct  46   LQGCHKGDKVEGIHKLKKYLGQFGYLSYSHSKYHTHANDDD-FDDLVESAIKTYQTNYHL  104

Query  175  NSTGILDAETARQMMKPRCGVADIINGTS-------------GGAGVVPHYRFLPGEPKW  315
            N+TG LD+ET  QM+KPRCG ADIINGT+             G    V HY F  G P+W
Sbjct  105  NATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRTVAHYSFFSGSPRW  164

Query  316  PADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGD  492
            P  K  LT+ F PGTP     PV+ A   W+S   F F   + + +AD+  +  R DHGD
Sbjct  165  PPSKTYLTYAFLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGD  224

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G PFDGPGG+ AHAF PTNG  H+D DE W+  G   N +D+++VALHEIGHLLGL HS 
Sbjct  225  GYPFDGPGGTIAHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVALHEIGHLLGLGHSS  283

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
              +A+M+     G  +  L  DD  G+ ALYN
Sbjct  284  VQNAIMFPSISSGVTKG-LHEDDIQGISALYN  314



>ref|XP_008230957.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=310

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 164/269 (61%), Gaps = 21/269 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N    N      D F DQLE+AI+TYQ  +HL +
Sbjct  49   LKGCHKGDKVQGIQDLKKYLERFGYLNGDINN------DDFDDQLEAAIKTYQINYHLKA  102

Query  181  TGILDAETARQMMKPRCGVADIINGTSG------------GAGVVPHYRFLPGEPKWPAD  324
            TG LD +T  +MM PRCGV DIINGT+             G   V HY F  G PKWPA+
Sbjct  103  TGTLDTKTISKMMMPRCGVPDIINGTTAMRSGKKRHPHHHGGHTVAHYAFFQGSPKWPAN  162

Query  325  KRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDGKP  501
            K  LT+GFA GTP      VT A   W     F F + +  + AD+K +   G+HGDG+P
Sbjct  163  KYHLTYGFARGTPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGRP  222

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPD  681
            FDGPGG  AHA+ PTNG  H+DADE W     P  G+D+++VALHEIGHLLGL+HS    
Sbjct  223  FDGPGGVLAHAYAPTNGRFHYDADETWVVGAVP-GGMDLETVALHEIGHLLGLEHSSVEG  281

Query  682  AVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            AVM      G  +  L  DD  G+KALYN
Sbjct  282  AVMLPGIRAGFTQS-LHADDIQGIKALYN  309



>ref|XP_006482472.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=320

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 164/274 (60%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA--DYFSDQLESAIRTYQTRHHL  174
            L+G  KGD++KG++ LKKY++ FGY+N  +Y + S  A  D F + LESAI+TYQ  +HL
Sbjct  48   LKGCHKGDKIKGIHELKKYMEKFGYLNYDNYKNQSTHANDDDFDELLESAIKTYQLNYHL  107

Query  175  NSTGILDAETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWP  318
             STGILDA T  +M  PRCGVADI+NGT+                 V HY F  G P+WP
Sbjct  108  KSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWP  167

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            A K  LT+ F PGT      PV  A + W +   F F K   +ANADIK +   GDHGDG
Sbjct  168  ASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDG  227

Query  496  KPFD---GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
             PFD   GP G  AHAF PTNG  H+DADE WA  G      D+++VALHEIGHLLGL H
Sbjct  228  NPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLHH  286

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S    A+MY     G K+  L  DD  G++ LYN
Sbjct  287  SSVEGAIMYPSIAAGVKKG-LHGDDIQGIRDLYN  319



>ref|XP_008230960.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 164/270 (61%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+   + D F DQLESAI+TYQ  +HL +
Sbjct  48   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQLNYHLKA  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSG--------------GAGVVPHYRFLPGEPKWP  318
            TG LDAET   MM PRCGVADIINGTS               G   V HY F  G PKWP
Sbjct  106  TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGK  498
            A K  LT+ F  GTP +   PV  A + W +   F F +    N D+  +  RG+HGDG 
Sbjct  166  ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN-QNPDLTVSFHRGNHGDGS  224

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG+ AHAF PTNG  H+DADE ++  G      D+++VALHEIGHLLGL HS   
Sbjct  225  PFDGPGGTIAHAFAPTNGRFHYDADERFS-VGAVSGAYDLETVALHEIGHLLGLGHSSVL  283

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
             A+MY     G  +  L  DD  G+KALYN
Sbjct  284  GAIMYPTISPGATKG-LHGDDIQGIKALYN  312



>ref|XP_007216922.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
 gb|EMJ18121.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
Length=297

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 160/257 (62%), Gaps = 13/257 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY   LS N+   + D F DQLESAI+TYQ  +HL +
Sbjct  52   LKGCHKGDKVQGIQDLKKYLGKFGY---LSSNNGHLNDDDFDDQLESAIKTYQINYHLKA  108

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LDA+T   MM PRCGVADIIN        V +Y F    P WPA K  LT+ F  GT
Sbjct  109  TGTLDAKTVSNMMMPRCGVADIIN--------VANYSFFEENPTWPASKYHLTYAFLQGT  160

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P +   PV++A + W +   F F + +   N D+  +  RGDHGDG PFDGPGG+ AHAF
Sbjct  161  PAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGTPFDGPGGTIAHAF  220

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DADE ++  G      D ++VALHEIGHLLGL HS    A+M+     G  
Sbjct  221  APTNGRLHYDADERFS-VGAVSGAYDFETVALHEIGHLLGLRHSSVQGAIMFPSVRAGVT  279

Query  718  RRVLTTDDKNGLKALYN  768
            ++ L  DD  G+KALYN
Sbjct  280  QQSLHGDDIQGIKALYN  296



>ref|XP_008230675.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=305

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 164/270 (61%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+   + D F DQLESAI+TYQ  +HL +
Sbjct  40   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQLNYHLKA  97

Query  181  TGILDAETARQMMKPRCGVADIINGTSG--------------GAGVVPHYRFLPGEPKWP  318
            TG LDAET   MM PRCGVADIINGTS               G   V HY F  G PKWP
Sbjct  98   TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  157

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGK  498
            A K  LT+ F  GTP +   PV  A + W +   F F +    N D+  +  RG+HGDG 
Sbjct  158  ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN-QNPDLTVSFHRGNHGDGS  216

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG+ AHAF PTNG  H+DADE ++  G      D+++VALHEIGHLLGL HS   
Sbjct  217  PFDGPGGTIAHAFAPTNGRFHYDADERFS-VGAVSGAYDLETVALHEIGHLLGLGHSSVL  275

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
             A+MY     G  +  L  DD  G+KALYN
Sbjct  276  GAIMYPTISPGATKG-LHGDDIQGIKALYN  304



>ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
 emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera]
Length=319

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 168/275 (61%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            LQG  KGD V G+  LKKYL+ FGY++   S N +  D D F D LESAI+TYQ  +HL 
Sbjct  46   LQGCHKGDEVNGIQKLKKYLEQFGYLSYSRSKNQTHADDDDFDDLLESAIKTYQANYHLE  105

Query  178  STGILDAETARQMMKPRCGVADIINGTS-----------------GGAGVVPHYRFLPGE  306
            +TG LD+ET  +M+KPRCGVADIINGT+                 G    V HY F PG 
Sbjct  106  ATGDLDSETVSEMVKPRCGVADIINGTNWMLSGKKRQYHGHGHGHGSLRTVAHYSFFPGS  165

Query  307  PKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGD  483
            P+WP  K  LT+ F PGTP+    PV+ A   W+S   F F   + Y +AD+  +  R D
Sbjct  166  PRWPPSKTYLTYAFLPGTPNWAMSPVSRAYGRWDSATHFTFGWIQDYTSADMTISFHRLD  225

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLD  663
            HGDG PFDGPGG+ AHAF PTNG  H+D DE W+  G   N +D+++VALHEIGHLLGL 
Sbjct  226  HGDGSPFDGPGGTIAHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVALHEIGHLLGLG  284

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            HS   +A+M+     G  +  L  DD  G++ALYN
Sbjct  285  HSSVQNAIMFPSISTGVTKG-LHEDDIQGIRALYN  318



>ref|XP_007010413.1| Matrixin family protein [Theobroma cacao]
 ref|XP_007099564.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19223.1| Matrixin family protein [Theobroma cacao]
 gb|EOY20464.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 161/272 (59%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQG  KGD+VK +  LKKYL+ FGY++  S N +  + D F D LESAI+TYQ   HLNS
Sbjct  42   LQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDDDFDDLLESAIKTYQLNFHLNS  100

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------GAGV-----VPHYRFLPGEPKW  315
             G LD ET  +MM PRCGVADIINGTSG           AG      V HY F P  P+W
Sbjct  101  NGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRW  160

Query  316  PADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGD  492
            P  K  LT+ F PGT      PV  A + W +   F F +   Y +ADI     R DHGD
Sbjct  161  PPSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDHGD  220

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G PFDGPGG+ AHAF PT G  H+DADE W+    P   + +++VALHEIGHLLGL HS 
Sbjct  221  GNPFDGPGGTLAHAFAPTLGRFHYDADETWSVSARP-GTMHLETVALHEIGHLLGLGHSS  279

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
              +A+MY     G  +  L  DD  G+KALYN
Sbjct  280  IENAIMYPSITAGTSKG-LARDDIEGIKALYN  310



>ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis]
 gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis]
Length=321

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 164/285 (58%), Gaps = 33/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQ-----LESAIRTYQTR  165
            LQG  KGD++KG+  LKKYLK FGY   LSYN +   A+   D      LESAIRTYQ  
Sbjct  41   LQGCHKGDKLKGVGELKKYLKHFGY---LSYNKNQSHANEDDDDDFDDPLESAIRTYQLN  97

Query  166  HHLNSTGILDAETARQMMKPRCGVADIINGTSGGAGV----------------------V  279
            +HLN +G+LD+ETA +MM PRCGVADIINGT+                           V
Sbjct  98   YHLNVSGLLDSETASKMMMPRCGVADIINGTTWMESGRKHHRHPHRHHHRRHGPKSLHKV  157

Query  280  PHYRFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANAD  456
             HY F  G PKWP  K  LT+ F PG P     PV  A   W +   F F   R Y N+D
Sbjct  158  SHYSFFSGNPKWPPSKYHLTYSFLPGFPTAAVNPVANAFETWAANTHFSFSWTRDYINSD  217

Query  457  IKFTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALH  636
            I  + +RGDHGDG PFDGPGG+ AHAF P NG  H+DADE W+  G      D+++ ALH
Sbjct  218  ILISFYRGDHGDGHPFDGPGGTLAHAFAPQNGLFHYDADERWS-IGAVLGAYDLETTALH  276

Query  637  EIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            EIGHLLGL HS    A+MY +   GE R  L +DD  G++ LYN 
Sbjct  277  EIGHLLGLGHSSVEGAIMYPQIFAGETRG-LHSDDLEGIRTLYNI  320



>ref|XP_008230959.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 166/270 (61%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ NLK YL+ FGY+N  + N      DYF D+LE AI+TYQ  +HL  
Sbjct  50   LKGCHKGDKVQGIQNLKIYLEKFGYLNGNTNND-----DYFDDELELAIKTYQINYHLKV  104

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------GGAG---VVPHYRFLPGEPKWPADK  327
            TG LDA+T ++M  PRCGV DIINGT+        GG G    V HY F  G PKWPA+K
Sbjct  105  TGTLDAKTVKKMEIPRCGVPDIINGTTSMRSGNKRGGHGSTHTVGHYAFFQGNPKWPANK  164

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG--K  498
              LT+GF  GTP +    V  A   W+    F F + + + +AD+K    RGDHGDG   
Sbjct  165  YHLTYGFLQGTPSEAVGAVARAFATWQGNTHFTFSQAQSFESADLKIGFGRGDHGDGANN  224

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
             FDGPG + AHAFPP++G  H+DADE W     P  G D+++VALHEIGHLLGLDHS   
Sbjct  225  AFDGPGKTIAHAFPPSDGRFHYDADETWVVGAVP-GGFDLETVALHEIGHLLGLDHSSVS  283

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
             AVM  +   G  +  L  DD  G++ALYN
Sbjct  284  GAVMQSQIPSGYTQS-LHADDVQGIRALYN  312



>ref|XP_007010415.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19225.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 161/272 (59%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQG  KGD+VK +  LKKYL+ FGY++  S N +  + + F D LESAI+TYQ   HLNS
Sbjct  42   LQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDNDFDDLLESAIKTYQLNFHLNS  100

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------GAGV-----VPHYRFLPGEPKW  315
             G LD ET  +MM PRCGVADIINGTSG           AG      V HY F P  P+W
Sbjct  101  NGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRW  160

Query  316  PADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGD  492
            P  K  LT+ F PGT      PV  A + W +   F F +   Y +ADI     R DHGD
Sbjct  161  PPSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDHGD  220

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G PFDGPGG+ AHAF PT G  H+DADE W+    P   + +++VALHEIGHLLGL HS 
Sbjct  221  GNPFDGPGGTLAHAFAPTIGRFHYDADETWSVSARP-GTMHLETVALHEIGHLLGLSHSS  279

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
              +A+MY     G  +  L  DD  G+KALYN
Sbjct  280  IENAIMYPSITAGTSKG-LARDDIEGIKALYN  310



>ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=319

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 169/288 (59%), Gaps = 24/288 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----PDADYFSDQLESAIRTYQTRH  168
            L+G +KG +VK ++ LKKYL+ FGY   LSY+ S      D D F D LE AI+TYQT +
Sbjct  38   LEGCQKGHKVKDIHKLKKYLQQFGY---LSYSHSEYQTHADNDDFDDLLEFAIKTYQTNY  94

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTS-------------GGAGVVPHYRFLPGEP  309
            +L ++G LD+ET   M+KPRCGVADIINGTS             G    V HY F  G P
Sbjct  95   YLKASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSLHTVAHYSFFAGSP  154

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDH  486
            +WP     LT+ F  GT       VT A   W S   F F + + Y NAD+K    RGDH
Sbjct  155  RWPPSNTHLTYAFLSGTSSTTMSAVTRAFGQWASATDFTFAETQDYTNADMKIGFQRGDH  214

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG PFDGPGG+ AH+F PT+G  HFD DE+W   G      D+++VALHEIGHLLGL H
Sbjct  215  GDGFPFDGPGGTIAHSFSPTDGRLHFDGDESWV-VGAVAGAFDVETVALHEIGHLLGLGH  273

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF*QNRGQQCM*QLL  810
            S    A+++    +G  +  L  DD  G++ALYNF + R   C  +++
Sbjct  274  SSVEGAIIFPTIAFGVTKG-LNEDDIQGIQALYNF-RTRTGSCSYEIM  319



>emb|CBI34985.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 162/261 (62%), Gaps = 21/261 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----PDADYFSDQLESAIRTYQTRH  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S      + D F D +ESAI+TYQT +
Sbjct  17   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  73

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGF  348
            HLN+TG LD+ET  QM+KPRCG ADIINGT+               P+WP  K  LT+ F
Sbjct  74   HLNATGSLDSETVSQMVKPRCGAADIINGTN-----------WMRSPRWPPSKTYLTYAF  122

Query  349  APGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPGGSY  525
             PGTP     PV+ A   W+S   F F   + + +AD+  +  R DHGDG PFDGPGG+ 
Sbjct  123  LPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGDGYPFDGPGGTI  182

Query  526  AHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFE  705
            AHAF PTNG  H+D DE W+  G   N +D+++VALHEIGHLLGL HS   +A+M+    
Sbjct  183  AHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVALHEIGHLLGLGHSSVQNAIMFPSIS  241

Query  706  YGEKRRVLTTDDKNGLKALYN  768
             G  +  L  DD  G+ ALYN
Sbjct  242  SGVTKG-LHEDDIQGISALYN  261



>ref|XP_008458713.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=282

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 159/272 (58%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G KKGD+V+G++ +KKYL+ FGY+N+  +  S    D F + LE A++TYQ  ++L +
Sbjct  10   LNGCKKGDKVEGIHQMKKYLQHFGYMNNDVHIHSKSSDDEFDEILEFAVKTYQINYNLKA  69

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG----------------VVPHYRFLPGEPK  312
            TG LD  T  QM KPRCGVADIING +G                    V H+ F  G  K
Sbjct  70   TGTLDNSTISQMSKPRCGVADIINGRTGMKSGKRLVNRHRKIIGHFHEVSHFAFFEGNLK  129

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHG  489
            WP  K  LT+GF PGTP +   PV  A   W +   F F +   Y NADIK T  RGDHG
Sbjct  130  WPNSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESNYENADIKVTFERGDHG  189

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFD  GG  AHAF PT+G  HFDA E+WA+   P N  D+++VALHEIGHLLGL HS
Sbjct  190  DGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWADGAVP-NSYDMETVALHEIGHLLGLHHS  248

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
                A+M+     G   + L  DD  G+K LY
Sbjct  249  SVEGAIMWPSI-MGGTTKGLHADDIEGIKVLY  279



>gb|KDO37621.1| hypothetical protein CISIN_1g035681mg [Citrus sinensis]
Length=320

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 162/274 (59%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFS--DQLESAIRTYQTRHHL  174
            L+G  KGD++KG++ LK+Y++ FGY+N  +Y + S  AD     + LESAI+TYQ  +HL
Sbjct  48   LKGCHKGDKIKGIHELKEYMEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHL  107

Query  175  NSTGILDAETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWP  318
             STG+LDA T  +M  PRCGVADI+NGT+                 V HY F P  PKWP
Sbjct  108  KSTGVLDANTVAKMTIPRCGVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWP  167

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            A K  LT+ F PGT      PV  A + W +   F F K   +ANADIK +   GDHGDG
Sbjct  168  ASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDG  227

Query  496  KPFD---GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
             PFD   GP G  AHAF PTNG  H+DADE WA  G      D+++VALHEIGHLLGL H
Sbjct  228  NPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLHH  286

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S    A+MY     G  +  L  DD  G++ LYN
Sbjct  287  SSVEGAIMYPSISAGVTKG-LHGDDIQGIRDLYN  319



>ref|XP_008352994.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/273 (48%), Positives = 158/273 (58%), Gaps = 25/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D D F D LESAI+TYQ  +HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DNDDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------------GAGVVPHYRFLPGEPK  312
            TG LDA+T  +MM PRCGV DIINGT+                     V HY F PG PK
Sbjct  98   TGTLDAKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP+ K  LT+ F   TP +    V  A   W     F F + + Y NAD+  +   GDHG
Sbjct  158  WPSSKYHLTYAFDQTTPTEARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDG GG+ AHAF PTNG  H+DADE WA  G      D+++VALHEIGHLLGL HS
Sbjct  218  DGNPFDGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGAYDLETVALHEIGHLLGLRHS  276

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                AVM      G  +  L  DD  G+KALYN
Sbjct  277  SVEGAVMSSTVRTGFAQS-LHADDIQGIKALYN  308



>ref|XP_007014936.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY32555.1| Matrixin family protein, putative [Theobroma cacao]
Length=310

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 163/271 (60%), Gaps = 18/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQG  KG++VK ++ LKKYL++FGY++  S N +  + D F D LESAIRTYQ  ++L +
Sbjct  42   LQGCHKGEKVKDIHKLKKYLESFGYLS-YSKNETHANDDDFDDFLESAIRTYQLNYNLKT  100

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG---------AG-----VVPHYRFLPGEPKWP  318
            TG LD++T  +MM  RC VADI NGT+G          AG      V HY F PG PKWP
Sbjct  101  TGTLDSKTVSKMMTSRCAVADITNGTTGMRSGKKRQHPAGSKSFHTVAHYAFFPGNPKWP  160

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
              K  LT+ F PGT      PV  A + W +   F F + + Y NADI  +    DH DG
Sbjct  161  DSKSHLTYAFLPGTRADAINPVVRAFQTWAANTHFSFSRTQDYTNADITISFESRDHADG  220

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
             PFDGP G+ AHAF PTNG  H+DADE W+    P     ++++ALHEIGHLLGL HS  
Sbjct  221  NPFDGPDGTLAHAFAPTNGRFHYDADEQWSVSVTP-GAYHLETIALHEIGHLLGLHHSSV  279

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
              A+MY  F  GE +  L  DD  G++ALYN
Sbjct  280  EGAIMYPTFMAGESKG-LHGDDIQGIRALYN  309



>gb|EYU29748.1| hypothetical protein MIMGU_mgv1a025409mg, partial [Erythranthe 
guttata]
Length=262

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 152/258 (59%), Gaps = 13/258 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQGS KG+R  G+  +K YL+ FGY+++L+    +   + F D LESAI+TYQ   ++N 
Sbjct  17   LQGSVKGNRALGISGIKNYLQKFGYLDNLNNTQVN---NLFDDALESAIKTYQQNFNINP  73

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TGILDA T   M+ PRCGV DIIN        V HY F  G PKWP  K  LT+GF    
Sbjct  74   TGILDASTVSTMIIPRCGVPDIIN--------VSHYTFFSGNPKWPPSKYNLTYGFLSNV  125

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFRYANA-DIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P     P   A +NW++   F F +       D+     RG+HGDG  FDGPGG+ AHAF
Sbjct  126  PANAVAPAERAFQNWDNATHFTFKRASSGQTPDLTIGFLRGNHGDGASFDGPGGTLAHAF  185

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DADE W+   P  N   +++VALHEIGHLLGL HS    A+MY     G+ 
Sbjct  186  APTNGRLHYDADERWS-VDPVANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGQA  244

Query  718  RRVLTTDDKNGLKALYNF  771
            +  L +DD  G+KALYN 
Sbjct  245  KIKLNSDDIQGIKALYNM  262



>ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52413.1| hypothetical protein Csa_5G632120 [Cucumis sativus]
Length=319

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 161/273 (59%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L GS+KGD+V+G++ LKKYL  FGY+N+ +   S  + D F + LE+AI+TYQ  ++L  
Sbjct  46   LYGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENNDDEFDELLETAIKTYQKNYNLKV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEPK  312
            TG LDA T  QM KPRCGVADII+G +                G    V H+ F  G PK
Sbjct  106  TGTLDAMTIAQMSKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHSVSHFAFFDGNPK  165

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHG  489
            WPA K  LT+GF PGTP +   PV  A   W +   F F +      +DI      GDHG
Sbjct  166  WPATKSHLTYGFLPGTPSETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFETGDHG  225

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDG GG  AHAF P++G  H DADE+WA  G   +  D+++VALHEIGHLLGL HS
Sbjct  226  DGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN-GVVSDSFDLETVALHEIGHLLGLQHS  284

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                A+M+ +   G  +  L  DD  G+KALYN
Sbjct  285  STEGAIMWPQVPVGASKG-LHVDDIAGIKALYN  316



>ref|XP_004288499.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 158/269 (59%), Gaps = 16/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G +KGD+ KGL +LK YL+ FGY+N   Y + S   D F D LE AI+TYQ  + L  
Sbjct  46   LKGRQKGDKFKGLNDLKNYLEKFGYLN---YKNRSLFNDDFDDLLEEAIKTYQINYRLEV  102

Query  181  TGILDAETARQMMKPRCGVADIINGTS-----------GGAGVVPHYRFLPGEPKWPADK  327
            TG LD +T  +MM PRCGV DIINGTS           G       Y F PG PKWP+ K
Sbjct  103  TGKLDNKTVSKMMMPRCGVPDIINGTSFMRSANKGHHHGSIHTTALYSFFPGSPKWPSSK  162

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPF  504
              LT+GF PGT  +    V  A   W     F F   + Y NAD+K +  RGDHGDG PF
Sbjct  163  YHLTYGFLPGTRSEATAAVARAFATWAKSSRFTFSPAQSYYNADLKISFQRGDHGDGVPF  222

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG  AH+F P++G  H+DAD+ W     P    D++SVALHEIGHLLGL HS  P A
Sbjct  223  DGPGGILAHSFCPSDGRFHYDADDTWTVGAKP-GAFDLESVALHEIGHLLGLQHSSLPGA  281

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            VM      G  +  LT DD  G+KALYNF
Sbjct  282  VMAPGIPPGVTKTSLTEDDVQGIKALYNF  310



>ref|XP_008458714.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=319

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 160/273 (59%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L GS+KGD+V+G++ LKKYL  FGY+N+ +   S    D F + LESAI+TYQ  ++L  
Sbjct  46   LHGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENKDDEFDELLESAIKTYQKNYNLKV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEPK  312
            TG LDA T  QM+KPRCGVADII+G +                G    V H+ F  G PK
Sbjct  106  TGTLDAMTIAQMLKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHRVSHFAFFDGNPK  165

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHG  489
            WPA K  LT+GF PGTP +   PV  A   W +   F F +      +DI      GDHG
Sbjct  166  WPATKSHLTYGFLPGTPPETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFESGDHG  225

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDG GG  AHAF P++G  H DADE+WA  G      D+++VALHEIGHLLGL HS
Sbjct  226  DGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN-GVVSGSFDLETVALHEIGHLLGLQHS  284

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                A+M+ +   G  +  L  DD  G+KALYN
Sbjct  285  SIEGAIMWPQVPEGASKG-LHADDIAGIKALYN  316



>emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera]
Length=305

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 164/264 (62%), Gaps = 13/264 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----PDADYFSDQLESAIRTYQTRH  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S      + D F D +ESAI+TYQT +
Sbjct  46   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  102

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPG---EPKWPADKRRLT  339
            HLN+TG LD+ET  QM+KPRCG ADIINGT+        +    G    P+WP  K  LT
Sbjct  103  HLNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRSPRWPPSKTYLT  162

Query  340  FGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            + F PGTP     PV+ A   W+S   F F   + + +AD+  +  R DHGDG PFDGPG
Sbjct  163  YAFLPGTPSWAMSPVSRAXXQWDSATHFTFGXIQDHTSADMTISFHRLDHGDGXPFDGPG  222

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
            G+ AHAF PTNG  H+D DE W+  G   N +D+++VA+HEIGHLLGL HS   +A+M+ 
Sbjct  223  GTIAHAFAPTNGRFHYDGDETWS-IGAVPNAMDLETVAVHEIGHLLGLGHSSVQNAIMFP  281

Query  697  RFEYGEKRRVLTTDDKNGLKALYN  768
                G  +  L  DD  G+ ALYN
Sbjct  282  SISSGVTKG-LHEDDIQGIXALYN  304



>ref|XP_002280805.2| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=335

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/277 (48%), Positives = 171/277 (62%), Gaps = 26/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD------ADYFSDQLESAIRTYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S +       DYF D LESAI++YQT
Sbjct  63   LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  119

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTS-------------GGAGVVPHYRFLPG  303
             +HL +TG LD+ET  +MM+ RCGVADI+NGTS             G    V HY+F PG
Sbjct  120  NYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPG  179

Query  304  EPKWP-ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFR  477
             P+WP ++   LT+ F PGTPD+   PV+ A   W S   F F +   + NA++  +   
Sbjct  180  SPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHS  239

Query  478  GDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLG  657
              HGD  PFDGPGG+ AHA+ PT+G  H+DADE W+    P   LD+++VALHEIGHLLG
Sbjct  240  LLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEWSVGAVP-GALDVETVALHEIGHLLG  298

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            L HS   +A+M+     G  +  L  DD  G++ALYN
Sbjct  299  LGHSSVREAIMFPSISTGVTKG-LHRDDIEGIRALYN  334



>ref|XP_004296560.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 162/269 (60%), Gaps = 16/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+VKG+ +LKKYL+ +GY+N    N S  D D F D LE A++TYQ  +HL S
Sbjct  44   LKGCHKGDKVKGINDLKKYLEKYGYLN--YKNHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  181  TGILDAETARQMMKPRCGVADIINGTS-----------GGAGVVPHYRFLPGEPKWPADK  327
            TG LD++T  +M  PRCGVADIINGTS           G      HY F  G PKWP+ K
Sbjct  102  TGTLDSKTVSKMTTPRCGVADIINGTSSMRSAKKRHHHGSLHTTAHYSFFQGNPKWPSSK  161

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPF  504
              LT+GF P TP +    V  A   WE    F F + + Y NAD+K    RG+HGDG  F
Sbjct  162  YHLTYGFLPNTPSEATGAVARAFATWEGNTHFTFSQAQSYENADLKIGFQRGNHGDGAAF  221

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG+ AHAF PT+G  H+DADE W+    P    D+++VALHEIGHLLGL HS    A
Sbjct  222  DGPGGTLAHAFSPTHGIFHYDADETWSVGAVP-GATDLETVALHEIGHLLGLGHSSVKGA  280

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            +M      GE R  L  DD  G+KALYN 
Sbjct  281  IMEPTLPTGETRG-LHGDDVQGIKALYNV  308



>ref|XP_008230676.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=299

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 161/267 (60%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            ++G +KGD V+G+ ++KK+L+ FGY++  S N      D F DQLE AI+TYQ  ++L +
Sbjct  39   VKGCRKGDNVQGILDVKKHLEKFGYLSGHSQN------DDFDDQLELAIKTYQLNYNLEA  92

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG---------VVPHYRFLPGEPKWPADKRR  333
            TG LD +T   MM PRCGV DIINGT+              V  Y F  G PKWP+ K R
Sbjct  93   TGRLDVKTVSNMMIPRCGVPDIINGTTSMISRKIQHHEGLTVSKYSFFSGNPKWPSAKYR  152

Query  334  LTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDG  510
            LT+ F  GTP++   PV  A ++W +   F F +   Y   D+  +  R DHGDG PFDG
Sbjct  153  LTYAFLQGTPNQAKDPVKRAFQSWANNTQFTFSQVEAYETPDLTISFQRLDHGDGYPFDG  212

Query  511  PGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVM  690
             GG  AHAF PT+G  H+DADE W   G  + G+D+QS+A+HEIGHLLGL+HS   +A+M
Sbjct  213  RGGVTAHAFSPTDGRFHYDADEMWV-VGSVNGGMDLQSIAVHEIGHLLGLNHSSVEEAIM  271

Query  691  YYRFEYGEKRRVLTTDDKNGLKALYNF  771
            Y        +R L  DD  G+K LYN 
Sbjct  272  YPFLNTATVKRNLKPDDIQGIKNLYNI  298



>ref|XP_008458907.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=316

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 162/274 (59%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSPDADYFSDQLESAIRTYQTRHHLN  177
            L G +KGD+V G++ +K+YL+ FGY+N+   N S S D D F   LESAI+TYQ  ++L 
Sbjct  43   LNGCRKGDKVAGIHQIKEYLQHFGYLNNYLQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  102

Query  178  STGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEP  309
            +TG LDA+T   M KPRCGVADII+G +                G    V HY F  G P
Sbjct  103  ATGTLDAKTLDLMSKPRCGVADIIDGKTRMKSGKKMVNQHRKINGHFHTVSHYAFFDGNP  162

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
            KWPA K  LT+GF PGTP K   PV  A + W +   F F +  +Y  ADIK +   GDH
Sbjct  163  KWPASKFHLTYGFLPGTPSKAVAPVGRAFKTWGAHTHFNFSRASKYKKADIKISFRSGDH  222

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG  FDG GG  AH F PT+G  HFDA E+WA  G   +  D+++VALHEIGHLLGL H
Sbjct  223  GDGHSFDGVGGVIAHGFAPTDGRLHFDAIESWA-VGAVADSFDLETVALHEIGHLLGLHH  281

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S    A+M+     G  +  L  DD  G+ ALYN
Sbjct  282  SSVEGAIMWPSIMEGTTKG-LDADDIAGINALYN  314



>ref|XP_008368314.1| PREDICTED: LOW QUALITY PROTEIN: metalloendoproteinase 1-like 
[Malus domestica]
Length=309

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 159/273 (58%), Gaps = 25/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D+D F D LESAI+TYQ  +H  +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DSDDFDDILESAIKTYQVNYHXKA  97

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------------GAGVVPHYRFLPGEPK  312
            TG LDA+T  +M+ PRCGVADIINGT+                     V HY F  G PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFXTGNPK  157

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP+ K  LT+ F   TP +    V  A   W     F F + + Y NAD+  +  +GDHG
Sbjct  158  WPSSKYHLTYAFDQSTPTEARDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDG GG  AHAFPPTN   H+DADE WA  G   +  D+++VALHEIGHLLGL HS
Sbjct  218  DGNPFDGRGGILAHAFPPTNXRFHYDADEXWA-VGAVADAYDLETVALHEIGHLLGLQHS  276

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                AVM      G  +  L  DD  G+KALYN
Sbjct  277  SVEGAVMSPGVRSGFTQS-LHADDIQGIKALYN  308



>ref|XP_009341183.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=340

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 164/280 (59%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA--DYFSDQLESAIRTYQTRHHL  174
            L+G  KGD ++G+++LK YL+ FGY++  ++  ++P A  D F + LE A++TYQ  +HL
Sbjct  61   LKGGHKGDHIEGIHDLKLYLEKFGYLS-YAHAKNNPHANDDDFDNLLELAVKTYQLNYHL  119

Query  175  NSTGILDAETARQMMKPRCGVADIINGTSG--------------------GAGV--VPHY  288
            N+TG LD ET  +MM PRCGVAD+INGTS                     G+ V  V HY
Sbjct  120  NTTGTLDGETVSKMMMPRCGVADVINGTSSMRSGKKKHHQHDPDHDHHNHGSSVHAVSHY  179

Query  289  RFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKF  465
             F  G  +WP  K  LT+GF P TP +   PV+ A R W S   F F + R Y  ADIK 
Sbjct  180  SFFKGRLRWPTSKHHLTYGFLPSTPTEAMGPVSHAFRTWASNTHFRFSRSRNYKRADIKI  239

Query  466  TLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIG  645
            +    DHGDG PFDG GG  AHA+ PTNG  H+DADE W+  G      D+++VALHEIG
Sbjct  240  SFEYSDHGDGSPFDGKGGVLAHAYAPTNGRFHYDADEPWS-VGALEGYYDLETVALHEIG  298

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS    A+MY     G  +  L  DD  G+K LY
Sbjct  299  HLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  338



>ref|XP_008355534.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 164/280 (59%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA--DYFSDQLESAIRTYQTRHHL  174
            L+G  KGD ++G+++LK YL+ FGY++  ++  ++P A  D F +  E A++TYQ  +HL
Sbjct  30   LRGGHKGDHIEGIHDLKLYLEKFGYLS-YAHAKNNPHANDDDFDNLXELAVKTYQLNYHL  88

Query  175  NSTGILDAETARQMMKPRCGVADIINGTSG--------------------GAGV--VPHY  288
            N+TG LD ET  +MM PRCGVADIINGTS                     G+ V  V HY
Sbjct  89   NTTGTLDGETVSKMMMPRCGVADIINGTSSMRSGKKKHHHHDPDHDHHNHGSSVHAVSHY  148

Query  289  RFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKF  465
             F  G  +WP  K  LT+GF P TP +   PV+ A R W S   F F + R Y  ADIK 
Sbjct  149  SFFKGRLRWPTSKHHLTYGFLPNTPTEAMGPVSYAFRTWASNTHFRFSRSRNYRRADIKI  208

Query  466  TLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIG  645
            +   GDHGDG PFDG GG  AHA+ PTNG  H+DADE W+  G      D+++VALHEIG
Sbjct  209  SFEYGDHGDGSPFDGEGGVLAHAYAPTNGRFHYDADEPWS-VGALEGYYDLETVALHEIG  267

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS    A+MY     G  +  L  DD  G+K LY
Sbjct  268  HLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  307



>gb|EYU18042.1| hypothetical protein MIMGU_mgv1a018853mg [Erythranthe guttata]
Length=287

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 150/258 (58%), Gaps = 13/258 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQGS KGDR  G+  LK YL+ FGY+ +L+    +   + F D LESAI+TYQ   ++N 
Sbjct  42   LQGSVKGDRTLGISGLKSYLQKFGYLENLNNTQVN---NVFDDALESAIKTYQQNFNINP  98

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TGILDA T   M+ PRCGV DIIN        V HY F  G PKWPA K  LT+ F    
Sbjct  99   TGILDAATVSTMIIPRCGVPDIIN--------VSHYTFFLGNPKWPASKYNLTYEFLSNV  150

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P     PV  A +NW++   F F +      AD+     RG HGDG  FDGPGG+ AHAF
Sbjct  151  PSNAVAPVERAFQNWDNATHFTFRRSSSDQTADLIIEFQRGYHGDGASFDGPGGTLAHAF  210

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DADE W+   P  N   +++VALHEIGHLLGL HS    A+MY     G  
Sbjct  211  APTNGRFHYDADERWS-VDPVANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGTA  269

Query  718  RRVLTTDDKNGLKALYNF  771
            +  L TDD  G+KALY  
Sbjct  270  KIKLNTDDIQGIKALYTM  287



>ref|XP_010039144.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=315

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 165/281 (59%), Gaps = 29/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-----PDADYFSDQLESAIRTYQTR  165
            LQG  KG+   G+  LK+YL+ FGY+N   YN S       D D F D LE A++TYQ  
Sbjct  40   LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  96

Query  166  HHLNSTGILDAETARQMMKPRCGVADIINGTS--------------GGAGVVPHYRFLPG  303
            +HLN TG LD +T  +MM+PRCGVADIINGT+              G    V HY FL G
Sbjct  97   YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  156

Query  304  EPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRG  480
             P+WPA    LT+GF PGTP+    PV  A   W SV  F F Y   +  A+I+    RG
Sbjct  157  SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARG  216

Query  481  DHGDG--KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN--GLDIQSVALHEIGH  648
            DHGDG    FDGPGG+ AHAFPPT G  H+DADE WA   PP      ++++VALHEIGH
Sbjct  217  DHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWA-VDPPSGSAAFNVETVALHEIGH  275

Query  649  LLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            LLGL HS+   A+MY     G  +  L  DD  G+KALYNF
Sbjct  276  LLGLGHSDVEGAIMYSSIAPGTTKG-LHADDIQGIKALYNF  315



>ref|XP_006363533.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=370

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 160/278 (58%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G  V GL  +KKY   FGYIN    NSSS   D F D LESA++TYQ   +LN+
Sbjct  48   LLGCHSGQTVDGLAKIKKYFHYFGYIN----NSSSNFTDDFDDTLESALKTYQLNFNLNT  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG------AG-----VVPHYRFLPGEPKWPADK  327
            TG+LDA T + ++KPRCG AD++NGTS        AG      V HY F PG P+WPA+K
Sbjct  104  TGVLDASTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGRPRWPANK  163

Query  328  RRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
            R LT+ FAP  G  D      T A   W  V P  F +   Y +ADIK   F GDH DG+
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTHAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPP---------HNGLDIQSVALHEIGHL  651
            PFDGP G+ AHAF P  G+ H D +ENW   G P          + +D++SVA+HEIGHL
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGHL  283

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   DA+MY     G +R  L  DD  G++ LY
Sbjct  284  LGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_004296559.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 161/268 (60%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+VKG+ +LKKYL+ FGY+N    N S  D D F D LE A++TYQ  +HL S
Sbjct  44   LKGCHKGDKVKGINDLKKYLEKFGYLN--YKNHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  181  TGILDAETARQMMKPRCGVADIINGTS-----------GGAGVVPHYRFLPGEPKWPADK  327
            TG LD +T  +MM PRCG+ DIINGTS           G      HY F  G PKWP+ K
Sbjct  102  TGTLDGKTVAKMMMPRCGLPDIINGTSSMRSAKKRHHHGSIHTTAHYAFPAGNPKWPSSK  161

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPF  504
              LT+GF PGTP +    V  A   W     F F + + Y NAD+K    +GDHGDG  F
Sbjct  162  YHLTYGFLPGTPSEATGAVARAFATWAGNTHFTFSQAQNYENADLKIGFEKGDHGDGSAF  221

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG  AHAF PT+G  H+DADENW+    P    D++++ALHEIGHLLGLDHS    A
Sbjct  222  DGPGGVLAHAFYPTDGRFHYDADENWSVGAKP-GAFDLETLALHEIGHLLGLDHSSVEGA  280

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            +M      G  R  L  DD  G+KALYN
Sbjct  281  IMSSGIPAGVTRG-LHGDDVQGIKALYN  307



>ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52418.1| hypothetical protein Csa_5G633160 [Cucumis sativus]
Length=313

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 159/273 (58%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G KKGD+V+G++ +KKYL+ FGY+N+  +  S    D F + LE A++TYQ  ++L  
Sbjct  41   LKGCKKGDKVEGIHQMKKYLQHFGYLNNDVHIRSESSDDEFDEILEFAVKTYQINYNLKV  100

Query  181  TGILDAETARQMMKPRCGVADIING----------------TSGGAGVVPHYRFLPGEPK  312
            TG LD  T  QM KPRCGVADIING                 SG    V H+ F  G  +
Sbjct  101  TGTLDNSTLMQMSKPRCGVADIINGKTSMKSGKRFVNQHRKISGHFHEVSHFAFFEGNLR  160

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHG  489
            WP  K  LT+GF PGTP +   PV  A   W +   F F +  +Y NADIK +  +GDHG
Sbjct  161  WPDSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESKYENADIKISFEKGDHG  220

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFD  GG  AHAF PT+G  HFDA E+WA+   P    D+++VALHEIGHLLGL HS
Sbjct  221  DGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWADGAVP-KSYDMETVALHEIGHLLGLHHS  279

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                A+M+     G   + L  DD  G+K LY 
Sbjct  280  SVEGAIMWPSI-MGGATKGLHADDIEGIKVLYT  311



>ref|XP_008365496.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=319

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 158/273 (58%), Gaps = 25/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D+D F D LESAI+TYQ  +H  +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DSDDFDDILESAIKTYQVNYHXKA  97

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------------GAGVVPHYRFLPGEPK  312
            TG LDA+T  +M+ PRCGVADIINGT+                     V HY F  G PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFFTGNPK  157

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP+ K  LT+ F   TP +    V  A   W     F F + + Y NAD+  +  +GDHG
Sbjct  158  WPSSKYHLTYAFDQSTPTEAXDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDG GG  AHAFPPTN   H+DADE WA  G   +  D+++VALHEI HLLGL HS
Sbjct  218  DGNPFDGRGGILAHAFPPTNXRFHYDADEAWA-VGAVADAYDLETVALHEIXHLLGLQHS  276

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                AVM      G  +  L  DD  G+KALYN
Sbjct  277  SVEGAVMSPGXRSGFTQS-LHADDIQGIKALYN  308



>ref|NP_001266203.1| matrix metalloproteinase precursor [Solanum lycopersicum]
 emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=367

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 160/278 (58%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G  V GL  +KKY   FGYIN    NSS+   D F D LESA++TYQ   +LN+
Sbjct  48   LLGCHSGQTVDGLAKIKKYFHYFGYIN----NSSTNFTDDFDDTLESALKTYQLNFNLNT  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG------AG-----VVPHYRFLPGEPKWPADK  327
            TG+LDA T + ++KPRCG AD++NGTS        AG      V HY F PG P+WPA+K
Sbjct  104  TGVLDANTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGSPRWPANK  163

Query  328  RRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
            R LT+ FAP  G  D      T A   W  V P  F +   Y +ADIK   F GDH DG+
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTRAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPP---------HNGLDIQSVALHEIGHL  651
            PFDGP G+ AHAF P  G+ H D +ENW   G P          + +D++SVA+HEIGHL
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGHL  283

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   DA+MY     G +R  L  DD  G++ LY
Sbjct  284  LGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_010037506.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49212.1| hypothetical protein EUGRSUZ_K02792 [Eucalyptus grandis]
Length=311

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 158/273 (58%), Gaps = 23/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----PDADYFSDQLESAIRTYQTRH  168
            LQG  KGD+VKGL  LK+YL+ FGY+N   YN S+     + + F + LESA++TYQ  +
Sbjct  42   LQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQGHANDEDFDELLESAVKTYQLNY  98

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSGGAG-------------VVPHYRFLPGEP  309
            H+  TG LD++T   M  PRCGVADI+NGTS                  V H+ F  G P
Sbjct  99   HMKVTGNLDSQTVAMMTTPRCGVADIVNGTSRMRSGKRTTHHGSNKFHTVGHFTFFDGSP  158

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDH  486
            KWP+ K  LT+   PGT D    PV+ A + W S   F F + + Y +ADIK    R DH
Sbjct  159  KWPSSKYHLTYALDPGTQDDVLGPVSRAFKTWASATHFTFSQSQNYESADIKIAFARRDH  218

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG PFDGP G  AHAF PT G  H+D DE W+  GP     D+++VALHEIGHLLGL H
Sbjct  219  GDGAPFDGPSGVIAHAFQPTIGVFHYDGDEPWS-VGPVRGSYDLETVALHEIGHLLGLGH  277

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            S    A+MY     G  +  L  DD  G+K LY
Sbjct  278  SSVAGAIMYPTISPGVSKG-LHGDDVQGIKTLY  309



>ref|XP_007217804.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
 gb|EMJ19003.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
Length=406

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 159/259 (61%), Gaps = 13/259 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  + N      D+F D+LESAI+TYQ  +HL  
Sbjct  157  LKGCHKGDKVQGIQDLKKYLEKFGYLNGNTNND-----DHFDDELESAIKTYQINYHLKV  211

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LDA+T ++M  PRCG      G  G    V HY F  G PKWPA+K  LT+GF  GT
Sbjct  212  TGTLDAKTVKKMEMPRCGKK---RGGHGSTHTVGHYAFFQGNPKWPANKYHLTYGFLQGT  268

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG--KPFDGPGGSYAH  531
              +    V  A   W+S   F F + + + +AD+K    RGDHGDG    FDGPG + AH
Sbjct  269  QSEAVGAVARAFATWQSNTHFTFSQAQSFESADLKIGFGRGDHGDGANNAFDGPGKTIAH  328

Query  532  AFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYG  711
            AF PTNG  H+DADE W     P  G D+++VALHEIGHLLGLDHS  P AVM  +   G
Sbjct  329  AFRPTNGRFHYDADETWVVGAVP-GGFDLETVALHEIGHLLGLDHSSVPGAVMQSQIPPG  387

Query  712  EKRRVLTTDDKNGLKALYN  768
              +  L  DD  G++ALYN
Sbjct  388  YTQS-LHADDVQGIRALYN  405



>ref|XP_010037507.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49217.1| hypothetical protein EUGRSUZ_K02797 [Eucalyptus grandis]
Length=311

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 159/270 (59%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            LQG  KGD+VKGL  LK+YL+ FGY+N + S   ++ + D F + LESAI+ YQ  +HL 
Sbjct  42   LQGCHKGDKVKGLQELKQYLEKFGYLNYNQSNLQTNANDDDFDELLESAIKLYQLNYHLK  101

Query  178  STGILDAETARQMMKPRCGVADIINGTS----GGAGV---------VPHYRFLPGEPKWP  318
             TG LD++T   M  PRCG ADI+NGTS    G  G          V H+ F  G PKWP
Sbjct  102  VTGNLDSQTVAMMTMPRCGAADIVNGTSRMRSGKRGTRHGSSNFHTVGHFTFFDGNPKWP  161

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            + K  LT+ F P T D    PV+ A   W S   F F + + Y +ADIK    R DHGDG
Sbjct  162  SSKYHLTYAFYPETRDDVVGPVSRAFNTWASATQFTFSQSQNYESADIKIAFARRDHGDG  221

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
             PFDGP G  AHAF PT G  H+DADE W+  GP     ++++VALHEIGHLLGL HS  
Sbjct  222  APFDGPNGVIAHAFQPTVGMFHYDADEPWSA-GPVSGSYNMETVALHEIGHLLGLGHSSV  280

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              A+MY     G  +  L  DD  G+KALY
Sbjct  281  AGAIMYPTISPGVSKG-LHGDDVQGIKALY  309



>gb|EYU34696.1| hypothetical protein MIMGU_mgv11b016964mg [Erythranthe guttata]
Length=312

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 159/273 (58%), Gaps = 23/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSPDADYFSDQLESAIRTYQTRHHLN  177
            +QG  KG++ K ++NLKKYL  FGY   L Y N +  + D F + LESA++TYQ  +++N
Sbjct  45   VQGCHKGNKTKEIHNLKKYLHKFGY---LQYPNQTHANNDDFDEALESAVKTYQRNYNIN  101

Query  178  STGILDAETARQMMKPRCGVADIING----------------TSGGAGVVPHYRFLPGEP  309
             TG LDA T  +M  PRCGV DIING                +S     V HY FLPG P
Sbjct  102  PTGTLDATTVSKMTTPRCGVPDIINGKNTMQKHGTKEHESNSSSKHIHTVSHYSFLPGNP  161

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHG  489
            +WP  K  LT+ F+  TP     PV+ A + W S   F F     ++AD+      GDHG
Sbjct  162  RWPRSKTHLTYMFSANTPAAAVGPVSRAFQKWASSTHFTF-SLAQSSADLVIGFHSGDHG  220

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDG GG+ AHAF PTNG  H+DADE W+  GP  +  D+++VALHEIGHLLGL HS
Sbjct  221  DGNPFDGRGGTLAHAFAPTNGRFHYDADELWS-VGPVQDAFDLETVALHEIGHLLGLGHS  279

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                A+MY     G  +  L  DD  G+K+LYN
Sbjct  280  AVEAAIMYSGIGAGVTKN-LHPDDIQGIKSLYN  311



>ref|XP_008343421.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 154/272 (57%), Gaps = 25/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D D F D LESAI+TYQ  +HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DNDDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------------GAGVVPHYRFLPGEPK  312
            TG LD +T  +MM PRCGV DIINGT+                     V HY F PG PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP+ K  LT+ F   TP      V  A   W     F F + + Y NAD+  +   GDHG
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PF G GG+ AHAF PTNG  H+DADE WA  G      D+++VALHEIGHLLGL HS
Sbjct  218  DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGAYDLETVALHEIGHLLGLRHS  276

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
                AVM      G  +  L  DD  G+KALY
Sbjct  277  SVEGAVMSSTVRTGFAQS-LHADDIQGIKALY  307



>ref|XP_007216020.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
 gb|EMJ17219.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
Length=296

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/270 (48%), Positives = 158/270 (59%), Gaps = 36/270 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+   + D F DQLESAI+TYQ  +HL +
Sbjct  48   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQINYHLKA  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSG--------------GAGVVPHYRFLPGEPKWP  318
            TG LDA+T   MM PRCGVADIINGTS               G   V HY F  G PKWP
Sbjct  106  TGALDAKTVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGK  498
            A K  LT+ F   TP              E+ GP         N D+  +  RG+HGDG 
Sbjct  166  ASKYHLTYAFLQDTP-------------AEATGP------SNQNPDLTVSFHRGNHGDGA  206

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG+ AHAF PTNG  H+DADE ++  G      D+++VALHEIGHLLGL HS   
Sbjct  207  PFDGPGGTIAHAFAPTNGRFHYDADERFS-VGAVSGAYDLETVALHEIGHLLGLGHSSVQ  265

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
             A+MY     G  ++ L  DD  G+KALYN
Sbjct  266  GAIMYPTISPGVTQQSLHGDDIQGIKALYN  295



>ref|XP_007216923.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
 gb|EMJ18122.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
Length=264

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 155/257 (60%), Gaps = 11/257 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N    N      D F DQLE+AI+TYQ  +HL +
Sbjct  17   LKGCHKGDKVQGIQDLKKYLERFGYLNGDINN------DDFDDQLEAAIKTYQINYHLKA  70

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LD +T  +MM PRCG     +    G   V HY F  G  KWPA+K  LT+GFA GT
Sbjct  71   TGTLDTKTVSKMMMPRCGKKR--HPHHHGGHTVAHYAFFQGSAKWPANKYHLTYGFAQGT  128

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P      VT A   W     F F + +  + AD+K +   G+HGDG+PFDGPGG  AHA+
Sbjct  129  PANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGQPFDGPGGVLAHAY  188

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DADE W     P  G+D+++VALHEIGHLLGL HS    AVM      G  
Sbjct  189  APTNGRFHYDADETWVVGAVP-GGMDLETVALHEIGHLLGLAHSSVEGAVMLPGIRAGFT  247

Query  718  RRVLTTDDKNGLKALYN  768
            +  L  DD  G+KALYN
Sbjct  248  QS-LHADDIQGIKALYN  263



>ref|XP_008361888.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 154/272 (57%), Gaps = 25/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D D F D LESAI+TYQ  +HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DNDDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------------GAGVVPHYRFLPGEPK  312
            TG LD +T  +MM PRCGV DIINGT+                     V HY F PG PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP+ K  LT+ F   TP      V  A   W     F F + + Y NAD+  +   GDHG
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PF G GG+ AHAF PTNG  H+DADE WA  G      D+++VALHEIGHLLGL HS
Sbjct  218  DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGXYDLETVALHEIGHLLGLRHS  276

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
                AVM      G  +  L  DD  G+KALY
Sbjct  277  SVEGAVMSSTVRTGFAQS-LHADDIQGIKALY  307



>ref|XP_007216949.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
 gb|EMJ18148.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
Length=252

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 155/257 (60%), Gaps = 9/257 (4%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G + GD+V G+ +LKKYL  FGY++    ++++   D F DQL SAI+TYQ  ++L +TG
Sbjct  1    GFQNGDKVPGIQDLKKYLGRFGYLS----SNNNQTTDDFDDQLASAIKTYQLNYNLKTTG  56

Query  187  ILDAETARQMMKPRCGVADIINGTSG--GAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            ILDA+T   MM PRCGV DIINGTS       + HY F PG+PKWPA K  LT+ F  GT
Sbjct  57   ILDAQTVSNMMMPRCGVPDIINGTSSMRSGKQIAHYTFFPGKPKWPASKYHLTYAFLRGT  116

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P     PV  A   W +   F F + R     D+  +  R  HGDG PFDGPGG  AH+F
Sbjct  117  PTAAKGPVARAFNTWAAHTQFKFSQARRNQKPDLTVSFHRRSHGDGHPFDGPGGILAHSF  176

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             P +G  H+DADE W+  G       +++VALHEIGHLLGL HS    A+MY     GE 
Sbjct  177  APKDGRFHYDADEKWS-VGVVRGAFHLETVALHEIGHLLGLGHSSVRRAIMYPTISSGET  235

Query  718  RRVLTTDDKNGLKALYN  768
            +  L  DD  G+KALY+
Sbjct  236  KG-LNRDDIQGIKALYH  251



>gb|KCW49215.1| hypothetical protein EUGRSUZ_K02795 [Eucalyptus grandis]
Length=405

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 137/281 (49%), Positives = 165/281 (59%), Gaps = 29/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-----PDADYFSDQLESAIRTYQTR  165
            LQG  KG+   G+  LK+YL+ FGY+N   YN S       D D F D LE A++TYQ  
Sbjct  130  LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  186

Query  166  HHLNSTGILDAETARQMMKPRCGVADIINGTS--------------GGAGVVPHYRFLPG  303
            +HLN TG LD +T  +MM+PRCGVADIINGT+              G    V HY FL G
Sbjct  187  YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  246

Query  304  EPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRG  480
             P+WPA    LT+GF PGTP+    PV  A   W SV  F F Y   +  A+I+    RG
Sbjct  247  SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARG  306

Query  481  DHGDG--KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN--GLDIQSVALHEIGH  648
            DHGDG    FDGPGG+ AHAFPPT G  H+DADE WA   PP      ++++VALHEIGH
Sbjct  307  DHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWA-VDPPSGSAAFNVETVALHEIGH  365

Query  649  LLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            LLGL HS+   A+MY     G  +  L  DD  G+KALYNF
Sbjct  366  LLGLGHSDVEGAIMYSSIAPGTTKG-LHADDIQGIKALYNF  405



>gb|EYU34694.1| hypothetical protein MIMGU_mgv1a023515mg, partial [Erythranthe 
guttata]
Length=261

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 155/257 (60%), Gaps = 15/257 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSPDADYFSDQLESAIRTYQTRHHLN  177
            LQG  KG++ K +++LK YL  FGY   L Y N +  + D F + LESA++TYQ  +H+N
Sbjct  18   LQGCHKGNKSKDIHHLKNYLHQFGY---LQYPNETHANNDDFDETLESAVKTYQRNYHIN  74

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPG  357
             TG LDA T  +M  PRCGV DII+        V HY F  G P+WP  K  LT+ F P 
Sbjct  75   PTGTLDATTVSKMTTPRCGVPDIID--------VSHYSFFQGNPRWPPSKTHLTYRFLPN  126

Query  358  TPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            TP     PV+ A + W S   F F + + + AD+     RGDHGDG PFDG GG+ AHAF
Sbjct  127  TPAPAVGPVSRAFQKWASSTHFTFSRAQNS-ADLVIGFHRGDHGDGFPFDGRGGTLAHAF  185

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DADE W+  GP  +  D+++VALHEIGHLLGL HS    A+MY     G  
Sbjct  186  APTNGRFHYDADERWS-VGPVQDAFDLETVALHEIGHLLGLGHSSVEAAIMYSGIGAGVT  244

Query  718  RRVLTTDDKNGLKALYN  768
            +  L  DD  G++ALYN
Sbjct  245  KN-LHADDIQGIRALYN  260



>emb|CAN73130.1| hypothetical protein VITISV_030258 [Vitis vinifera]
Length=437

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 171/278 (62%), Gaps = 26/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA------DYFSDQLESAIRTYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S +       DYF D LESAI++YQT
Sbjct  49   LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  105

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTS-------------GGAGVVPHYRFLPG  303
             +HL +TG LD+ET  +MM+ RCGVADI+NGTS             G    V HY+F PG
Sbjct  106  NYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPG  165

Query  304  EPKWP-ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFR  477
             P+WP ++   LT+ F PGTPD+   PV+ A   W S   F F +   + NA++  +   
Sbjct  166  SPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHS  225

Query  478  GDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLG  657
              HGD  PFDGPGG+ AHA+ PT+G  H+DADE W+    P   LD+++VALHEIGHLLG
Sbjct  226  LLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEWSVGAVP-GXLDVETVALHEIGHLLG  284

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            L HS   +A+M+     G  +  L  DD  G++A+Y+ 
Sbjct  285  LGHSSVREAIMFPSISTGVTKG-LHRDDIEGIRAVYSM  321



>emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=363

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 158/272 (58%), Gaps = 21/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L G + G +V G+  +KKY + FGYIN+L S+N +    D F D LESA++TYQ   +L 
Sbjct  49   LLGCQPGQKVDGIAKIKKYFQHFGYINNLTSFNFT----DEFDDTLESALKTYQRNFNLK  104

Query  178  STGILDAETARQMMKPRCGVADIINGTS----GGAGVVPHYRFLPGEPKWPADKRRLTFG  345
            +TG+LDA T + ++KPRCG AD++NGTS    G    V HY F PG PKWP  K  LT+ 
Sbjct  105  ATGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYA  164

Query  346  FAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGPG  516
            F P     D      + A   W  V P  F +   + +ADIK     GDH DG+PFDGP 
Sbjct  165  FLPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPM  224

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHN---------GLDIQSVALHEIGHLLGLDHS  669
            G+ AHAF P  G+ H D +ENW   G P N          +D++SVA+HEIGHLLGL HS
Sbjct  225  GTLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHS  284

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               D++MY   E G +R  L  DD  G++ LY
Sbjct  285  SVEDSIMYPSLESGIRRVELVEDDIKGVQELY  316



>ref|XP_007010134.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY18944.1| Matrixin family protein, putative [Theobroma cacao]
Length=288

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 158/267 (59%), Gaps = 14/267 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSPDAD-YFSDQLESAIRTYQTRHH  171
            LQG  KG  V+GL  LK+Y K  GY+N    SYN+     D  F D LESAI+ YQ  + 
Sbjct  21   LQGCHKGHTVEGLCELKQYFKKLGYLNYDHASYNAYKHGNDNEFDDHLESAIKAYQVNYK  80

Query  172  LNSTGILDAETARQMMKPRCGVADIINGTSG----GAGVVPHYRFLPGEPKWPADKRRLT  339
            LN+TG LDA+T +QMMK RCG+AD++N  +     G G    Y F  G PKWP  K  LT
Sbjct  81   LNATGNLDADTVKQMMKSRCGIADVMNSNNSRSIYGIGA-SRYEFFLGNPKWPLSKTHLT  139

Query  340  FGFAPGT----PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPF  504
            + F         +        A + W +V  F F +   Y  ADI+     G+HGDG PF
Sbjct  140  YNFHSSVEVPLAENVRSVCVRAFQRWANVSRFTFEEVAEYYVADIEIGFHSGEHGDGNPF  199

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGP G+ AHA PPT+G  H+DADE+W+   P  + +D++SV +HEIGHLLGL HS  P+A
Sbjct  200  DGPQGTLAHASPPTDGKLHYDADEDWST-NPGPDEVDLESVTVHEIGHLLGLQHSLVPEA  258

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VMY  F+ G  +R L  DD +G++ALY
Sbjct  259  VMYAYFDSGMIKRKLHMDDVHGIRALY  285



>ref|XP_004237082.2| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=387

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 158/272 (58%), Gaps = 21/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L G + G +V G+  +KKY + FGYIN+L S+N +    D F D LESA++TYQ   +L 
Sbjct  73   LLGCQPGQKVDGIAKIKKYFQHFGYINNLTSFNFT----DEFDDTLESALKTYQRNFNLK  128

Query  178  STGILDAETARQMMKPRCGVADIINGTS----GGAGVVPHYRFLPGEPKWPADKRRLTFG  345
            +TG+LDA T + ++KPRCG AD++NGTS    G    V HY F PG PKWP  K  LT+ 
Sbjct  129  ATGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYA  188

Query  346  FAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGPG  516
            F P     D      + A   W  V P  F +   + +ADIK     GDH DG+PFDGP 
Sbjct  189  FLPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPM  248

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHN---------GLDIQSVALHEIGHLLGLDHS  669
            G+ AHAF P  G+ H D +ENW   G P N          +D++SVA+HEIGHLLGL HS
Sbjct  249  GTLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHS  308

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               D++MY   E G +R  L  DD  G++ LY
Sbjct  309  SVEDSIMYPSLESGIRRVELVEDDIKGVQELY  340



>ref|XP_006363534.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=363

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 158/273 (58%), Gaps = 23/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G + G +V G+  +KKY + FGYIN  +   +S   D F D LESA++TYQ   +LN+
Sbjct  48   LLGCQPGQKVDGIAKIKKYFQHFGYINTFT---TSNFTDEFDDTLESALKTYQRNFNLNA  104

Query  181  TGILDAETARQMMKPRCGVADIINGTS----GGAGVVPHYRFLPGEPKWPADKRRLTFGF  348
            TG+ D  T + ++KPRCG AD++NGTS    G    V HY F PG PKWP  K  LT+ F
Sbjct  105  TGLFDEPTIQNLIKPRCGNADVVNGTSTMNAGKPHTVAHYSFFPGRPKWPESKTDLTYSF  164

Query  349  APG---TPD-KFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGP  513
             P    T D K  F  + A   W  V P  F +   + +ADIK   F GDH DG+PFDGP
Sbjct  165  LPANNLTEDIKSVF--SRAFDRWSEVTPLSFTEIASFQSADIKIGFFTGDHNDGEPFDGP  222

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHN---------GLDIQSVALHEIGHLLGLDH  666
             G+ AHAF P  G+ H D +ENW   G P N          +D++SVA+HEIGHLLGL H
Sbjct  223  MGTLAHAFSPPAGHFHLDGEENWVVDGVPVNDGNFFSILSAVDLESVAVHEIGHLLGLGH  282

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            S   D++MY   E G +R  L  DD  G++ LY
Sbjct  283  SSVEDSIMYPSLEAGIRRVELVDDDVKGVQELY  315



>ref|XP_008230961.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=311

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 156/272 (57%), Gaps = 22/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G + GD+V G+ +LKKYL  FGY++    ++++   D F DQL SAI+TYQ  ++L +
Sbjct  45   LKGFQNGDKVPGIQDLKKYLGRFGYLS----SNNNQTTDEFDDQLASAIKTYQLNYNLKT  100

Query  181  TGILDAETARQMMKPRCGVADIINGTSG---------------GAGVVPHYRFLPGEPKW  315
            TGILD +T   MM PRCGV DIINGTS                    V HY F PG+PKW
Sbjct  101  TGILDTQTVSNMMMPRCGVPDIINGTSSMRSGKQSHPPPNHHHKGHTVAHYAFFPGKPKW  160

Query  316  PADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGD  492
            PA K  LT+ F  GTP     PV  A   W +   F F +  R    D+  +  R  HGD
Sbjct  161  PASKYHLTYAFLRGTPTAAKGPVARAFNTWAAHTQFKFSQAPRNQKPDLTVSFHRRSHGD  220

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G PFDGPGG  AH+F P +G  H+DADE W+  G       +++VALHEIGHLLGL HS 
Sbjct  221  GHPFDGPGGILAHSFAPKDGRFHYDADEKWS-VGVVRGAFHLETVALHEIGHLLGLGHSS  279

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
               A+MY     GE +  L  DD  G+KALY+
Sbjct  280  VRRAIMYPTISSGETKG-LNRDDIQGIKALYH  310



>ref|XP_004139164.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66657.1| hypothetical protein Csa_1G654860 [Cucumis sativus]
Length=314

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 158/278 (57%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN---DLSYNSSSPDA-DYFSDQLESAIRTYQTRH  168
            LQG KKGD VKG+  LK + + +GY+N   + + +    DA D F D+LESAI+TYQ   
Sbjct  37   LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDIDANDIFDDRLESAIKTYQQYF  96

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSGGA-----------------GVVPHYRFL  297
            HLN TG L+AET  Q+  PRCG  DIIN T+G                     V HY F 
Sbjct  97   HLNPTGSLNAETLSQLATPRCGNPDIINETTGRMLSEDIDNVSSHDHHHLPHAVSHYAFF  156

Query  298  PGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLF  474
            PG  +WP+ K RLT+ F PGT      PV  A   W     F F     Y  AD+K   +
Sbjct  157  PGRLRWPSTKYRLTYAFLPGTRADAKAPVARAFATWARNTHFKFTLVTNYRRADLKIGFY  216

Query  475  RGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLL  654
            RG+HGDG PFDGPGG+ AHAF PT+G  H+D+ E WA  G      D+Q+VALHEIGHLL
Sbjct  217  RGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWA-VGAVRGRYDLQTVALHEIGHLL  275

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            GL HS   +A+MY   + G  +  L  DD  G+K LYN
Sbjct  276  GLGHSTVKNAIMYPYIKSGSTKG-LNVDDIKGIKVLYN  312



>ref|XP_009368959.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
 ref|XP_009342471.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=320

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 160/274 (58%), Gaps = 23/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + D F D LESAI++YQ   HLN 
Sbjct  48   LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDDEFDDLLESAIKSYQKSFHLNV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGA-----------GVVPHYRFLPGEPKWPADK  327
            TG LD  T +QMM PRCGV D++NGT  G            GV  +  F PG  +WP  K
Sbjct  106  TGSLDTTTVKQMMVPRCGVPDVVNGTRKGTKNHNRKLKSIHGVSYYEFFFPGPLRWPPTK  165

Query  328  RRLTFGFA------PGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
              L + FA      PGT +        A + W  V  F F +    ++ADI     RG H
Sbjct  166  THLRYRFASSASQVPGT-ENVRSICAQAFQKWAQVTSFTFEEVPATSSADITIGFHRGAH  224

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GD  PFDG  G+ AHA PPT GN HFDADE W+   P  N +D++SVA+HEIGHLLGLDH
Sbjct  225  GDMAPFDGFKGALAHANPPTGGNFHFDADEKWSA-NPGPNEVDLESVAVHEIGHLLGLDH  283

Query  667  SEN-PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            + + PDA+MY +F YG  +R LT DD +G++ALY
Sbjct  284  NLDLPDAIMYPKFSYGIVKRDLTGDDIDGIRALY  317



>ref|XP_009351242.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=317

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 160/274 (58%), Gaps = 23/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + D F D LESAI++YQ   HLN 
Sbjct  45   LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDDEFDDLLESAIKSYQKSFHLNV  102

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGA-----------GVVPHYRFLPGEPKWPADK  327
            TG LD  T +QMM PRCGV D++NGT  G            GV  +  F PG  +WP  K
Sbjct  103  TGSLDTTTVKQMMVPRCGVPDVVNGTRKGTKNHNRKLKSIHGVSYYEFFFPGPLRWPPTK  162

Query  328  RRLTFGFA------PGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
              L + FA      PGT +        A + W  V  F F +    ++ADI     RG H
Sbjct  163  THLRYRFASSASQVPGT-ENVRSICAQAFQRWAQVTSFTFEEVPATSSADITIGFHRGAH  221

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GD  PFDG  G+ AHA PPT GN HFDADE W+   P  N +D++SVA+HEIGHLLGLDH
Sbjct  222  GDMAPFDGFKGALAHANPPTGGNFHFDADEKWSA-NPGPNEVDLESVAVHEIGHLLGLDH  280

Query  667  SEN-PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            + + PDA+MY +F YG  +R LT DD +G++ALY
Sbjct  281  NLDLPDAIMYPKFSYGIVKRDLTGDDIDGIRALY  314



>ref|XP_011073059.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 152/269 (57%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND-----LSYNSSSPDADYFSDQLESAIRTYQTR  165
            L G++KG   KG+  LKKYL  FGY+N      L++ +     D+F D LE AI++YQT 
Sbjct  49   LVGTRKGTTSKGISQLKKYLSHFGYMNHKNNIILAHQTD----DFFDDNLELAIKSYQTF  104

Query  166  HHLNSTGILDAETARQMMKPRCGVADIINGTSGGA------GVVPHYRFLPGEPKWPADK  327
              L   GI+DA T  QM  PRCGV D  N             +  HY F PGEPKWP  K
Sbjct  105  FKLEVNGIMDANTITQMSPPRCGVPDSFNLNRSHELYLRIPTLASHYIFFPGEPKWPPTK  164

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPF  504
            R LT+ F  G P      +  A + W SV PF F Y   Y  ADIK +    DHGDG PF
Sbjct  165  RSLTYSFPSGAPTDVTNSILHATQIWASVSPFTFSYTPDYDQADIKISFQNRDHGDGNPF  224

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG  AHA+ P++G  HFD DE W +   P    D+Q+V LHE+GH+LGL HS +  A
Sbjct  225  DGPGGILAHAYAPSDGRLHFDGDERWVDGVTP-GAFDLQTVGLHELGHVLGLGHSNDTGA  283

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            VMY     G  R+VL  DD NG+KALY F
Sbjct  284  VMYPYIGDG-LRKVLGQDDINGIKALYQF  311



>ref|XP_009624303.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=365

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 154/278 (55%), Gaps = 28/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI  LS  +     D F D LESA++TYQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLSNFT-----DDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-----------GAGVVPHYRFLPGEPKWPADK  327
            TG+LDA T + +++PRCG AD++NGTS                V HY F PG P+WPA K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSPSMHTVAHYSFFPGRPRWPASK  161

Query  328  RRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
              LT+ F P  G  D      + A   W  V P  F +   + +ADIK   F GDH DG+
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFERWSEVTPLTFSETASFQSADIKIGFFAGDHNDGE  221

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN---------GLDIQSVALHEIGHL  651
            PFDGP G+ AHAF P  G+ H D DENW   G P +          +D++SVA+HEIGHL
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVINGVPIDEGNFFSILSAVDLESVAVHEIGHL  281

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   D++MY     G +R  L  DD  G++ LY
Sbjct  282  LGLGHSSVEDSIMYPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52414.1| hypothetical protein Csa_5G632130 [Cucumis sativus]
Length=316

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 160/274 (58%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSPDADYFSDQLESAIRTYQTRHHLN  177
            L G KKGD+V+G++ +K+YL+ FGY+N+   N S S D D F   LESAI+TYQ  ++L 
Sbjct  43   LNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  102

Query  178  STGILDAETARQMMKPRCGVADIINGT----SGGAGV------------VPHYRFLPGEP  309
            +TG ++A+T   M +PRCG ADI++G     SG   V            V HY F  G P
Sbjct  103  ATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNP  162

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
            KWPA K  LT+GF PGTP K    +  A + W +   F F +  RY  ADIK +   GDH
Sbjct  163  KWPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETGDH  222

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG  FDG  G  AH F P +G  HFDA E+WA  G   +  D++++ALHEIGHLLGL H
Sbjct  223  GDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIADSFDLETIALHEIGHLLGLYH  281

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S    A+M+     G  +  L  DD  G+ ALYN
Sbjct  282  SSIERAIMWPSIMEGSTKG-LDADDIAGINALYN  314



>ref|XP_010255256.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=309

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 159/271 (59%), Gaps = 23/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G +KG+ VKGL  LK+YL+ FGY+N+   +    D       LE AI+TYQ  ++LN 
Sbjct  45   LEGCRKGETVKGLNELKRYLERFGYLNNHKDDDDFDDL------LELAIKTYQLNYNLNV  98

Query  181  TGILDAETARQMMKPRCGVADIINGT----SGGAGVVPH----------YRFLPGEPKWP  318
            TG LD ET +QM  PRCG  DI NGT    SG     PH          Y F  G P+WP
Sbjct  99   TGSLDPETLKQMSLPRCGAPDITNGTTSMRSGKEKKHPHERKTLHTVSRYSFFSGIPRWP  158

Query  319  ADKRRLTFGFAPGTPDKFFFPVT-TALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGD  492
              K  LT+ F PGTP     PV   A + W +V  F F + + Y  ADIK +  RGDHGD
Sbjct  159  PSKTLLTYAFLPGTPVSSMRPVCDRAFQRWAAVSRFRFQETQDYLTADIKISFERGDHGD  218

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
              PFDGPGG  AHA+ PT+G  H+DADE W   G   +G D++SVA+HEIGHLLGL HS 
Sbjct  219  KYPFDGPGGVLAHAYAPTDGRFHYDADEKWY-IGASLDGYDVESVAMHEIGHLLGLGHSS  277

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              +++MY     G ++  L  DD +G+++LY
Sbjct  278  VGNSIMYPSLLMGTQKLKLDQDDIDGIRSLY  308



>ref|XP_008458911.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 152/266 (57%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L GS+K D  +G++ +K YL+ +GY++D   N+ S DA  F D LESAI++YQ    LN 
Sbjct  40   LIGSRKNDNFEGIHKVKAYLQRYGYLSDEKENNLSIDA--FDDDLESAIKSYQKVFKLNV  97

Query  181  TGILDAETARQMMKPRCGVADII----------NGTSGGAGVVPHYRFLPGEPKWPADKR  330
            +G+LD ET +QM +PRCGV D            N T+   G   HY F P + KWP +KR
Sbjct  98   SGVLDRETLQQMARPRCGVTDDFILVAQQDHENNNTNIQIGG-SHYMFYPNKLKWPVEKR  156

Query  331  RLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFD  507
             LT+GF    P +    V  A   WE+   F F +  R   ADI  +  RGDHGDGKPFD
Sbjct  157  HLTYGFIHNYPPEHAAAVIRAFDTWEANTKFTFSHAARVQTADILLSFERGDHGDGKPFD  216

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAV  687
            GPGG+  HAF   +G  HFD DE W          D++SVALHEIGH LGL HS  P AV
Sbjct  217  GPGGALGHAFGAIDGRVHFDGDEQWETGSFWQEYFDVESVALHEIGHALGLGHSREPSAV  276

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            M+   + G  +  LT DD  G+ ALY
Sbjct  277  MWANMDSGVTKTHLTIDDIEGIHALY  302



>ref|XP_006482471.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=254

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 148/255 (58%), Gaps = 20/255 (8%)
 Frame = +1

Query  58   LKTFGYINDLSYNSSSPDA--DYFSDQLESAIRTYQTRHHLNSTGILDAETARQMMKPRC  231
            ++ FGY+N  +Y + S  A  D F + LESAI+TYQ  +HL STGILDA T  +M  PRC
Sbjct  1    MEKFGYLNYDNYKNQSKHANDDDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRC  60

Query  232  GVADIINGTSGGAG------------VVPHYRFLPGEPKWPADKRRLTFGFAPGTPDKFF  375
            GVADI+NGT+                 V HY F  G P+WPA K  LT+ F PGT     
Sbjct  61   GVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAI  120

Query  376  FPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFD---GPGGSYAHAFPP  543
             PV  A + W +   F F K   +ANADIK +   GDHGDG PFD   GP G  AHAF P
Sbjct  121  TPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAP  180

Query  544  TNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRR  723
            TNG  H+DADE WA  G      D+++VALHEIGHLLGL HS    A+MY     G K+ 
Sbjct  181  TNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAGVKKG  239

Query  724  VLTTDDKNGLKALYN  768
             L  DD  G++ LYN
Sbjct  240  -LHGDDIQGIRDLYN  253



>gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana]
Length=364

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 155/278 (56%), Gaps = 28/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI+ LS  +     D F D LESA++TYQ   +LN+
Sbjct  46   LLGCHAGQKVDGLAKIKKYFYNFGYISSLSNFT-----DDFDDALESALKTYQQNFNLNT  100

Query  181  TGILDAETARQMMKPRCGVADIINGTSG------GAG-----VVPHYRFLPGEPKWPADK  327
            TG+LDA T   +++PRCG AD++NGTS        AG      V H+ F PG P+WP   
Sbjct  101  TGVLDAPTIEHLIRPRCGNADVVNGTSTMNSGKPSAGSQNIHTVAHFSFFPGRPRWPESN  160

Query  328  RRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
            R LT+ F P  G  D      + A   W  V P  F +   + +ADIK   F GDH DG+
Sbjct  161  RDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLTFTEIASFQSADIKIGFFAGDHNDGE  220

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPP---------HNGLDIQSVALHEIGHL  651
            PFDGP G+ AHAF P  G+ H D DENW   G P          + +D++SVA+HEIGHL
Sbjct  221  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGAPIVEGNFFSILSAVDLESVAVHEIGHL  280

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   D++M+     G +R  L  DD  G++ LY
Sbjct  281  LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  318



>gb|EPS59674.1| hypothetical protein M569_15132, partial [Genlisea aurea]
Length=260

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 158/258 (61%), Gaps = 8/258 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSP--DADYFSDQLESAIRTYQTRHHL  174
            L+G + G+R +G++ +K+YL+ FGY   L Y  + P  D D+F ++L SA+R YQ  + L
Sbjct  9    LEGCRLGNRSEGIHGVKRYLERFGY---LRYEGNDPHSDDDFFDERLYSAVRVYQANYRL  65

Query  175  NSTGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAP  354
            N TG LDA TA  M   RCGV DI+NGT+      P++ F P   +WP  K  L++ +  
Sbjct  66   NVTGELDAATASVMSLQRCGVPDIVNGTNLMISWRPYFSFFPDRQRWPPKKTHLSYLYLT  125

Query  355  GTPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGKPFDGPGGSYAHA  534
              P ++   +  A  +W SV  F F++    ++DI    F GDHGDG PFDGPGG  AH+
Sbjct  126  NVPPEYIPAIDRAFESWASVTRFTFHRVE-DSSDITVGYFSGDHGDGVPFDGPGGVLAHS  184

Query  535  FPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGE  714
            F PT+G  HFDA E W +   P +  D+ S+A+HEIGHLLGL HS   +A+M+  F  GE
Sbjct  185  FAPTDGRMHFDAAEPWFDGVKP-DRFDVHSIAMHEIGHLLGLGHSSVREAIMWAYFGLGE  243

Query  715  KRRVLTTDDKNGLKALYN  768
             RR +  DD +G+KALYN
Sbjct  244  -RRTIQPDDIDGIKALYN  260



>ref|XP_006376166.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
 gb|ERP53963.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
Length=304

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 155/266 (58%), Gaps = 17/266 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  +S      F D LESA++TYQ   HLN
Sbjct  43   LEGVRKGQTVEGLVELKQYLKRFGYYPSDVNLMTSD-----FDDLLESALKTYQNYFHLN  97

Query  178  STGILDAETARQMMKPRCGVADII-NGTSGGAG---VVPHYRFLPGEPKWPADKRRLTFG  345
             TGILD  T +QMM PRCG+ DI  N T        +V HY F  G PKW   K  LT+ 
Sbjct  98   VTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYT  157

Query  346  FAPG-----TPDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGKPFD  507
            F          D      + A + W  V P  F +    A+A+I    +RGDHGDG PFD
Sbjct  158  FGSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYPFD  217

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAV  687
            GPG   AHAF P NG  H+DADE W+   P  + +D++SVA+HEIGHLLGL HS + +AV
Sbjct  218  GPGKILAHAFSPENGRFHYDADEKWST-NPAMDQIDLESVAVHEIGHLLGLAHSSDSNAV  276

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            MY     G K+R L  DD +G+ ALY
Sbjct  277  MYPSIAAGTKKRNLAQDDIDGIHALY  302



>gb|ABK95950.1| unknown [Populus trichocarpa]
Length=304

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 155/266 (58%), Gaps = 17/266 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  +S      F D LESA++TYQ   HLN
Sbjct  43   LEGVRKGQTVEGLVELKQYLKRFGYYPSDVNLMTSD-----FDDLLESALKTYQNYFHLN  97

Query  178  STGILDAETARQMMKPRCGVADII-NGTSGGAG---VVPHYRFLPGEPKWPADKRRLTFG  345
             TGILD  T +QMM PRCG+ DI  N T        +V HY F  G PKW   K  LT+ 
Sbjct  98   VTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYT  157

Query  346  FAPG-----TPDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGKPFD  507
            F          D      + A + W  V P  F +    A+A+I    +RGDHGDG PFD
Sbjct  158  FGSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYPFD  217

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAV  687
            GPG   AHAF P NG  H+DADE W+   P  + +D++SVA+HEIGHLLGL HS + +AV
Sbjct  218  GPGKILAHAFSPENGRFHYDADEKWST-NPAMDQIDLESVAVHEIGHLLGLAHSSDSNAV  276

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            MY     G K+R L  DD +G+ ALY
Sbjct  277  MYPSIAAGTKKRNLAQDDIDGIHALY  302



>ref|XP_010091950.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB47730.1| Metalloendoproteinase 1 [Morus notabilis]
Length=370

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 165/303 (54%), Gaps = 49/303 (16%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN---------------DLSYNS--SSPDADYFSD  129
            L+GSKKGD+V+G+ +LKKYL+ FGY+N               D S N+  S+ +   F D
Sbjct  67   LEGSKKGDKVQGIRDLKKYLQHFGYLNPTQITKTQITGHSLNDNSINNDISTANDSTFDD  126

Query  130  QLESAIRTYQTRHHLNSTGILDAETARQMMKPRCGVADIING------------------  255
             LE+AI+TYQT ++L  TG LD++T  +MM PRC VADIIN                   
Sbjct  127  LLEAAIKTYQTNYNLKPTGTLDSQTLSKMMMPRCAVADIINNDTRMRSKKKSTTSSTKNH  186

Query  256  -----------TSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRN  402
                       ++     V HY F  G+PKWP+ K  LT+ FA G   +    V  A + 
Sbjct  187  VHRKLLGQKYVSTDDLQTVSHYSFFSGKPKWPSSKYSLTYSFAEGMLSEDVEAVGRAFQT  246

Query  403  WESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADEN  579
            W S   F F + +    ADI+ +  RGDHGDG  FDG GG  AHAF PT+G  HFDADE 
Sbjct  247  WASNTHFSFSRAQGNTKADIRVSFERGDHGDGDAFDGAGGVLAHAFSPTDGRLHFDADET  306

Query  580  WAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKA  759
            WA  G   +  D+++VALHEIGH+LGL HS    A+MY +   G  +  L  DD  G+ A
Sbjct  307  WA-IGEVADAFDVETVALHEIGHILGLLHSSVEGAIMYPQIGSGLTKG-LNADDIQGINA  364

Query  760  LYN  768
            LYN
Sbjct  365  LYN  367



>ref|XP_011085796.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=314

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 154/273 (56%), Gaps = 21/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG++ KG+++LK YL  FGY++    N    + D F D LESA++TYQ  +H+  
Sbjct  45   LEGCHKGNKTKGIHHLKHYLHQFGYLD--YPNQIHANDDDFDDLLESALKTYQHNYHIKP  102

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEPK  312
            TG LD ET  +++ PRCG  DI+NGT+                     V HY F  G P+
Sbjct  103  TGTLDTETITKLVTPRCGNPDIVNGTNTMLPRSKKTQNSSSSPSSIHTVSHYSFFRGNPR  162

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHG  489
            WP  K  LT+GF+  TP     PV  A   W+S   F F + +     D+     R DHG
Sbjct  163  WPPSKTHLTYGFSANTPTNAIDPVVRAFEKWDSATHFTFSRAQNNQRPDLVIGFHRRDHG  222

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDGPGG+ AHAF PT+G  H+D++E W+   P  N   +++VALHEIGHLLGL HS
Sbjct  223  DGAPFDGPGGTIAHAFAPTDGRFHYDSEETWS-IAPNANAFHLETVALHEIGHLLGLGHS  281

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
                A+MY R + G  +  L  DD  G++ LYN
Sbjct  282  SVEGAIMYARIQRGATKN-LHADDIQGIRVLYN  313



>ref|XP_006856883.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
 gb|ERN18350.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
Length=357

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 154/285 (54%), Gaps = 34/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L G  KG+ V GL  +K+YL TFGYI  +L++       D F D LESAI+TYQ    LN
Sbjct  43   LSGCHKGEHVPGLTAIKQYLHTFGYIPQNLNFT------DDFDDSLESAIKTYQQNFRLN  96

Query  178  STGILDAETARQMMKPRCGVADIINGT-----SGGAGVVPHYRFLPGEPKWPADKRRLTF  342
            +TG LD+ T RQMM PRCGV D++NGT     S G   V  Y F PG P+WP  KR LT+
Sbjct  97   ATGSLDSGTVRQMMSPRCGVPDVVNGTTTMMRSRGLSSVMRYTFFPGNPRWPVWKRNLTY  156

Query  343  GFAPGT--------------PDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRG  480
               PGT                   +   T L   ES          Y+ ADI+   F G
Sbjct  157  AIRPGTFSTSDDTAARAVFARAFARWAAATTLSFTEST--------SYSTADIRIAFFGG  208

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGL  660
            DHGDG+PFDG  G+ AHAF P +G  H DA E W   G    G+D++SVA+HEIGH+LGL
Sbjct  209  DHGDGEPFDGALGTLAHAFSPPDGRLHLDAAELWVVSGNSRLGIDLESVAVHEIGHVLGL  268

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF*QNRGQQC  795
             HS +  A+M+     G +R  L TDD  G++ LY    N G   
Sbjct  269  GHSSDEAAIMFPTITTGTRRVELATDDIMGIQELYGANSNAGSTA  313



>ref|XP_006448956.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
 gb|ESR62196.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
Length=314

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 153/272 (56%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN----------DLSYNSSSPDADYFSDQLESAIR  150
             QGS+KGD+VKG++ L+KYL++ GYIN          D S   S  + DYF + LESAI+
Sbjct  43   FQGSQKGDKVKGIHQLRKYLQSLGYINQNNISPSISLDNSDKESHIEDDYFGEDLESAIK  102

Query  151  TYQTRHHLNSTGILDAETARQMMKPRCGVADIINGT------SGGAGVVPHYRFLPGEPK  312
            TYQ   +LN+TG LD +T   M +PRCG+ DIINGT      S       HY F  G P+
Sbjct  103  TYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSADKKYDIHYAFFEG-PR  161

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP  K+ +TF F PGT      PV  AL  W +  PF F     Y NADIK +  RGDHG
Sbjct  162  WPLTKKTVTFAFQPGTRADIHEPVRVALLLWSNWAPFAFEGSNDYENADIKISFQRGDHG  221

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDGP  + AHAF       HF+ D NW   G    G D+Q+VALHE+GH+LGL HS
Sbjct  222  DGTPFDGPWHTLAHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGHVLGLSHS  280

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
                A M+     G  +  L  DD   +K LY
Sbjct  281  SVKAASMWPSTRAGTTKG-LNDDDIRRMKMLY  311



>ref|XP_006448955.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
 gb|ESR62195.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
Length=241

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 148/236 (63%), Gaps = 9/236 (4%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G++KGD VKG+  LKKYL T GY+++ ++N ++ D DYF + LESA++TYQ   +LN TG
Sbjct  1    GTQKGDTVKGINALKKYLHTLGYLSNHNHNHAA-DGDYFDENLESAVKTYQRNFNLNPTG  59

Query  187  ILDAETARQMMKPRCGVADIINGTS----GGAGVVPHYRFLPGEPKWPADKRRLTFGFAP  354
             +D +T   M KPRCGV D+IN T+    G A    HY F PG PKWPA K+ +++ F P
Sbjct  60   HMDLKTVSMMGKPRCGVPDVINRTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISYAFLP  119

Query  355  GTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPG--GSY  525
            GT      PV  A   W    PF + +   Y  ADIK +  RGDHGDG PF GPG     
Sbjct  120  GTRTDVQEPVRQAFLTWSKYTPFSYEFVQDYDAADIKISFQRGDHGDGYPFGGPGPYNLL  179

Query  526  AHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
            AH+F PT+G  H+D DENW     P   +D+Q+VALHE+GH+LGL HS    A+MY
Sbjct  180  AHSFSPTDGRAHYDGDENWTVVAVP-GAVDMQTVALHELGHVLGLAHSPVQAAIMY  234



>ref|XP_010278837.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=319

 Score =   214 bits (546),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 156/279 (56%), Gaps = 23/279 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS--SPDADYFSDQLESAIRTYQTRHHL  174
            L+G  KG  +KG++ LK+YL+ FGY+N    N S    D D F + LESA++TYQ  +HL
Sbjct  40   LEGCHKGQDLKGVHQLKRYLEKFGYLNYPPGNKSLTHADDDEFDELLESAVKTYQLNYHL  99

Query  175  NSTGILDAETARQMMKPRCGVADIINGTS---------------GGAGVVPHYRFLPGEP  309
              TG LD++T +QMM PRCG+ DIINGT+                    V HY F P  P
Sbjct  100  KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHGPSSLHTVSHYTFFPNNP  159

Query  310  KWPADKRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLF  474
            +WP  K  LT+ F          +     + A   W+ V  F F + +  A +DI     
Sbjct  160  RWPPSKTHLTYRFRSSVSVVGLQQLRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFH  219

Query  475  RGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLL  654
            RGDHGDG  FDG GG+ AHAF PT G  H+DADE+W+   P     D++SVA+HEIGHLL
Sbjct  220  RGDHGDGYSFDGRGGTLAHAFAPTVGRFHYDADESWST-NPQPGMFDLESVAVHEIGHLL  278

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            GL HS  P+A+MY     G  +R L  DD  G++ALY  
Sbjct  279  GLGHSSVPEAIMYPSIPDGAVKRNLHGDDVQGIRALYGL  317



>ref|XP_010273763.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=348

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 156/279 (56%), Gaps = 23/279 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDAD--YFSDQLESAIRTYQTRHHL  174
            L+G  KG  VKG++ LK+YL+ FGY+N    N S   AD   F + LESA++TYQ  +HL
Sbjct  69   LEGCHKGQDVKGVHQLKRYLEKFGYLNYPPGNKSLTHADDEEFDELLESAVKTYQLNYHL  128

Query  175  NSTGILDAETARQMMKPRCGVADIINGTS---------------GGAGVVPHYRFLPGEP  309
              TG LD++T +QMM PRCG+ DIINGT+                    V HY F P  P
Sbjct  129  KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHAPSSLHTVSHYTFFPNNP  188

Query  310  KWPADKRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLF  474
            +WP  K  LT+ F          +     + A   W+ V  F F + +  A +DI     
Sbjct  189  RWPPSKTHLTYRFRSSASVVGLQELRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFH  248

Query  475  RGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLL  654
            RGDHGDG  FDG GG+ AHAF PT G  H+DADE+W+   P     D++SVA+HEIGHLL
Sbjct  249  RGDHGDGYSFDGRGGTLAHAFAPTIGRFHYDADESWST-NPQPGVFDLESVAVHEIGHLL  307

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            GL HS  P+A+MY     G  +R L  DD  G++ALY  
Sbjct  308  GLGHSSVPEAIMYPSIPAGAVKRNLHGDDVQGIRALYGL  346



>gb|KDO75344.1| hypothetical protein CISIN_1g037265mg [Citrus sinensis]
Length=305

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 154/272 (57%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN----------DLSYNSSSPDADYFSDQLESAIR  150
             +GS+KGD+VKG++ L+KYL++ GY+N          D S N S  + DYF + LESAI+
Sbjct  34   FRGSQKGDKVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIK  93

Query  151  TYQTRHHLNSTGILDAETARQMMKPRCGVADIINGT------SGGAGVVPHYRFLPGEPK  312
            TYQ   +LN+TG LD +T   M +PRCG+ DIINGT      S       HY F  G P+
Sbjct  94   TYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSTDKKYDIHYAFFEG-PR  152

Query  313  WPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
            WP  K+ +T+ F PGT D    PV  AL  W +  PF F     Y NADIK +  RGDHG
Sbjct  153  WPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHG  212

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG PFDGP  +  HAF       HF+ D NW   G    G D+Q+VALHE+GH+LGL HS
Sbjct  213  DGTPFDGPWHTLGHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGHVLGLSHS  271

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
                A M+     G  +  L  DD   +K LY
Sbjct  272  SVKAASMWPSTRAGTTKG-LNDDDIRRMKMLY  302



>ref|XP_011072962.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/265 (46%), Positives = 150/265 (57%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDAD-YFSDQLESAIRTYQTRHHLN  177
            L G++KG   KG+  LKKYL  FGY+N  +    +   D +F D LE AI++YQT   L 
Sbjct  49   LIGTQKGTTSKGISQLKKYLSHFGYMNHKNNTILTHQTDDFFDDNLELAIKSYQTFFKLK  108

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGA------GVVPHYRFLPGEPKWPADKRRLT  339
              GI+DA    +M  PRCGV D  N             +  HY F PGEPKWP  KR LT
Sbjct  109  VNGIMDANIVAKMSHPRCGVPDSFNLNRSHKLYLRIPTLASHYTFFPGEPKWPPTKRSLT  168

Query  340  FGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPG  516
            + F  G P      +  A + W SV PF F Y+  Y  ADIK +    DHGDG PFDGPG
Sbjct  169  YSFPLGGPTNVNSSILHATQIWASVTPFRFSYRTNYDQADIKISFQYRDHGDGYPFDGPG  228

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
            G  AHAF P++G  HFD DE W + G      D+Q+V LHE+GH+LGL H+ +  A+MY 
Sbjct  229  GILAHAFAPSDGRLHFDGDERWVD-GVTLGAFDMQTVGLHELGHVLGLGHTNDTGAIMYP  287

Query  697  RFEYGEKRRVLTTDDKNGLKALYNF  771
                G  R+VL  DD NG+KALY F
Sbjct  288  YIGDG-LRKVLGQDDINGIKALYQF  311



>ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=457

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/274 (45%), Positives = 160/274 (58%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSPDADYFSDQLESAIRTYQTRHHLN  177
            L G KKGD+V+G++ +K+YL+ FGY+N+   N S S D D F   LESAI+TYQ  ++L 
Sbjct  184  LNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  243

Query  178  STGILDAETARQMMKPRCGVADIINGT----SGGAGV------------VPHYRFLPGEP  309
            +TG ++A+T   M +PRCG ADI++G     SG   V            V HY F  G P
Sbjct  244  ATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNP  303

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
            KWPA K  LT+GF PGTP K    +  A + W +   F F +  RY  ADIK +   GDH
Sbjct  304  KWPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETGDH  363

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG  FDG  G  AH F P +G  HFDA E+WA  G   +  D++++ALHEIGHLLGL H
Sbjct  364  GDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIADSFDLETIALHEIGHLLGLYH  422

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S    A+M+     G  +  L  DD  G+ ALYN
Sbjct  423  SSIERAIMWPSIMEGSTKG-LDADDIAGINALYN  455


 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 87/166 (52%), Gaps = 7/166 (4%)
 Frame = +1

Query  346  FAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFDGPGGS  522
            F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG  FDGPGG 
Sbjct  2    FTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGGV  61

Query  523  YAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRF  702
              HAF PT+G  H D D++W+  G   N  ++ +VALHE+GH+LGL HS  P AVM+   
Sbjct  62   VGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGHVLGLAHSTLPQAVMWPYI  120

Query  703  EYGEKRRVLTTDDKNGLKALYNF*QNRGQQCM*QLLRFLIFYVVQI  840
            +    +  L  DD  GL AL    ++ G + +  +L  L F V+ +
Sbjct  121  DSNALKN-LNDDDIAGLHAL----ESHGIRNIIIILNDLFFLVIVL  161



>ref|XP_006438497.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
 ref|XP_006483764.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
 gb|ESR51737.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
Length=371

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 152/278 (55%), Gaps = 29/278 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   GD++ GL  LKKY   FGYI DL  N +    D F D LESA++TYQ   +L  TG
Sbjct  53   GCHPGDKMDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEPTG  108

Query  187  ILDAETARQMMKPRCGVADIINGTS-----------------GGAGVVPHYRFLPGEPKW  315
             LD++T + +++PRCG  DI+NGT+                 G    V HY F PG P+W
Sbjct  109  QLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRW  168

Query  316  PADKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDH  486
            P++KR LT+ F P     D+      TA   W       F +   Y  ADI+   F GDH
Sbjct  169  PSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDH  228

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA-----EFGPPHNGLDIQSVALHEIGHL  651
            GDG+PFDGP G+ AHAF P NG  H D DENW            + +D++SVA+HEIGHL
Sbjct  229  GDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHL  288

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   DA+MY     G ++  L  DD  G++ALY
Sbjct  289  LGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALY  326



>ref|XP_004142466.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=306

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 151/266 (57%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYFSNENENNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAGVV---------PHYRFLPGEPKWPADKR  330
             +G+LD ET +QM +PRCGVAD     +   G            H+ F PG+ KWP  K 
Sbjct  98   VSGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGSHFMFFPGKGKWPYRKW  157

Query  331  RLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFD  507
             LT+GF    P K    V  A   W +   F F   +R   ADI  +  RGDHGDGKPFD
Sbjct  158  HLTYGFVHNYPMKHAAAVVRAFDKWAANSKFTFSLAWRIQTADILLSFERGDHGDGKPFD  217

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN-GLDIQSVALHEIGHLLGLDHSENPDA  684
            G GG   HAF P +G  HFDADE WAE G   N   D +SVALHEIGH LGL HS  P A
Sbjct  218  GEGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGHALGLGHSIFPSA  277

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKAL  762
            VM+   E G  +  LT DD  G+ AL
Sbjct  278  VMWANMETGVNKTELTIDDIEGVHAL  303



>ref|XP_008222422.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=319

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 158/275 (57%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQ--LESAIRTYQTRHHL  174
            L+G  KGD + G+++LK YL+ FGY++  ++   +P AD       LE A++TYQ  +HL
Sbjct  45   LKGVHKGDHIPGIHDLKLYLEKFGYLS-YAHAKHNPHADDDDFDDFLELAVKTYQLNYHL  103

Query  175  NSTGILDAETARQMMKPRCGVADIING-TSGGAGV----------------VPHYRFLPG  303
             +TGILD +T  +MM PRCGVADIING TS  +G                 V HY F  G
Sbjct  104  KTTGILDTKTVSKMMMPRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFFKG  163

Query  304  EPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRG  480
            + KWP  K  LT+ F P TP +   P++ A R W +   F F + + Y  ADIK +   G
Sbjct  164  KLKWPRSKHHLTYAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFEYG  223

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGL  660
            DHGDG  FDGPGG  AHA+ PT G  H+DA+E W+  G      D+++VALHEIGHLLGL
Sbjct  224  DHGDGNSFDGPGGVLAHAYAPTYGKFHYDAEEPWS-VGALEGYYDLETVALHEIGHLLGL  282

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS    AVMY     G     L  DD  G+K LY
Sbjct  283  GHSSVEGAVMYPYIASGATNLYLHDDDIQGIKVLY  317



>ref|XP_004167464.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52408.1| hypothetical protein Csa_5G632070 [Cucumis sativus]
Length=306

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 151/266 (57%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYFSNENENNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAGVV---------PHYRFLPGEPKWPADKR  330
             +G+LD ET +QM +PRCGVAD     +   G            H+ F PG+ KWP  K 
Sbjct  98   VSGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGSHFMFFPGKGKWPYRKW  157

Query  331  RLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFD  507
             LT+GF    P K    V  A   W +   F F   +R   ADI  +  RGDHGDGKPFD
Sbjct  158  HLTYGFVHNYPMKHAAAVVRAFDKWAANSKFTFSLAWRIQTADILLSFERGDHGDGKPFD  217

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN-GLDIQSVALHEIGHLLGLDHSENPDA  684
            G GG   HAF P +G  HFDADE WAE G   N   D +SVALHEIGH LGL HS  P A
Sbjct  218  GEGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGHALGLGHSIFPSA  277

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKAL  762
            VM+   E G  +  LT DD  G+ AL
Sbjct  278  VMWANMETGVNKTELTIDDIEGVHAL  303



>ref|XP_007226174.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
 gb|EMJ27373.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
Length=321

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 158/275 (57%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQ--LESAIRTYQTRHHL  174
            L+G  KGD ++G+++LK YL+ FGY++  ++   +P AD       LE A++TYQ  +HL
Sbjct  47   LKGVHKGDHIQGIHDLKLYLEKFGYLS-YAHAKHNPHADDDDFDDFLELAVKTYQLNYHL  105

Query  175  NSTGILDAETARQMMKPRCGVADIING-TSGGAGV----------------VPHYRFLPG  303
             +TG LDA+T  +MM  RCGVADIING TS  +G                 V HY F  G
Sbjct  106  KTTGTLDAKTVSKMMMSRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFFKG  165

Query  304  EPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRG  480
            + KWP  K  LTF F P TP +   P++ A R W +   F F + + Y  ADIK +   G
Sbjct  166  KLKWPRSKHHLTFAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFEYG  225

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGL  660
            DHGDG  FDGPGG  AHA+ PT G  H+DA+E W+  G      D+++VALHEIGHLLGL
Sbjct  226  DHGDGSSFDGPGGVLAHAYAPTYGKFHYDAEEPWS-VGALEGYYDLETVALHEIGHLLGL  284

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS    AVMY     G     L  DD  G+K LY
Sbjct  285  GHSSVEGAVMYPYIASGATNLYLHDDDIRGIKVLY  319



>ref|XP_002325947.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
 gb|EEF00329.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
Length=308

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 158/273 (58%), Gaps = 25/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  SS      F D LE A++TYQ   HLN
Sbjct  43   LEGIQKGQTVEGLIELKQYLKKFGYYPSDITLTSSD-----FDDHLELALKTYQEYFHLN  97

Query  178  STGILDAETARQMMKPRCGVADIINGTSGG----------AGVVPHYRFLPGEPKWPADK  327
             TG LD+ T +QMM PRCG+ DIIN  S              VV HY F  G  KWP  K
Sbjct  98   VTGNLDSSTIQQMMIPRCGMPDIINTPSAKPNSTKSKHKKVHVVAHYAF--GAQKWPPSK  155

Query  328  RRLTFGFAPGT----PDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGD  492
              LT+ F  G      D      + A + W  V  F F +    A+ADI    F GDHGD
Sbjct  156  YALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFREATGGASADIVIEFFSGDHGD  215

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
              PFDGPG   AHAF P +G  H+DADENW+   P  + +D+++V +HEIGHLLGL HS+
Sbjct  216  QSPFDGPGNQLAHAFYPQDGRLHYDADENWST-DPAMDQIDLETVTVHEIGHLLGLYHSK  274

Query  673  N-PDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            + P+A+MY   + G K+R L  DD +G+ ALY+
Sbjct  275  DHPEAIMYPTTQRGSKKRDLAQDDIDGIHALYS  307



>gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum]
Length=365

 Score =   213 bits (543),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 153/278 (55%), Gaps = 28/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI  LS  +     D F D LESA++TYQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLSNFT-----DDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-----------GAGVVPHYRFLPGEPKWPADK  327
            TG+LDA T + +++PRCG AD++NGTS                V H+ F PG P+WP  K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  328  RRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
              LT+ F P  G  D      + A   W  V P  F +   + +ADIK   F GDH DG+
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPP---------HNGLDIQSVALHEIGHL  651
            PFDGP G+ AHAF P  G+ H D DENW   G P          + +D++SVA+HEIGHL
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGHL  281

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   D++M+     G +R  L  DD  G++ LY
Sbjct  282  LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_009758591.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana sylvestris]
Length=365

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 153/278 (55%), Gaps = 28/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI  LS  +     D F D LESA++TYQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLSNFT-----DDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-----------GAGVVPHYRFLPGEPKWPADK  327
            TG+LDA T + +++PRCG AD++NGTS                V H+ F PG P+WP  K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  328  RRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
              LT+ F P  G  D      + A   W  V P  F +   + +ADIK   F GDH DG+
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPP---------HNGLDIQSVALHEIGHL  651
            PFDGP G+ AHAF P  G+ H D DENW   G P          + +D++SVA+HEIGHL
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGHL  281

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   D++M+     G +R  L  DD  G++ LY
Sbjct  282  LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_010255281.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=378

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 148/271 (55%), Gaps = 22/271 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   G+RV GL  LKKY + FGYI D    S S   D F D  ESA++ YQ   +LN+TG
Sbjct  61   GCHSGERVDGLAGLKKYFQHFGYIPD----SPSNFTDDFDDAFESALKKYQQNFNLNATG  116

Query  187  ILDAETARQMMKPRCGVADIINGTSG-----------GAGVVPHYRFLPGEPKWPADKRR  333
            +LD  T +QM++PRCGVADIINGTS                V HY F P  P WP  KR 
Sbjct  117  VLDESTIQQMVRPRCGVADIINGTSTMNSGKSAKSTHSIHTVAHYSFFPYRPTWPPSKRD  176

Query  334  LTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPF  504
            LT+ F P     D        +   W +V P  F +   Y  ADIK   FRGDH DG+PF
Sbjct  177  LTYAFLPANQLSDTVKAVFAHSFARWSAVTPLSFTESSVYLTADIKIAFFRGDHNDGEPF  236

Query  505  DGPGGSYAHAFPPTNGNCHFDADENW----AEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            DG  G+ AHAF P +G  H D  ENW    A      + +D++SVA+HEIGHLLGL HS 
Sbjct  237  DGVLGTLAHAFSPPDGRFHLDGAENWVVDDARKSSIPSAVDLESVAVHEIGHLLGLGHSS  296

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              +A+M+     G K+  L  DD  G++ LY
Sbjct  297  QEEAIMFPTISSGMKKVELANDDIQGIQFLY  327



>ref|XP_006431003.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
 gb|ESR44243.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
Length=254

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 146/255 (57%), Gaps = 20/255 (8%)
 Frame = +1

Query  58   LKTFGYINDLSYNSSSPDADYFS--DQLESAIRTYQTRHHLNSTGILDAETARQMMKPRC  231
            ++ FGY+N  +Y + S  AD     + LESAI+TYQ  +HL STG+LDA T  +M  PRC
Sbjct  1    MEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHLKSTGVLDANTVAKMTIPRC  60

Query  232  GVADIINGTSGGAG------------VVPHYRFLPGEPKWPADKRRLTFGFAPGTPDKFF  375
            GVADI+NGT+                 V HY F P  PKWPA K  LT+ F PGT     
Sbjct  61   GVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWPASKFSLTYAFRPGTRSDAI  120

Query  376  FPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFD---GPGGSYAHAFPP  543
             PV  A + W +   F F K   +ANADIK +   GDHGDG PFD   GP G  AHAF P
Sbjct  121  TPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAP  180

Query  544  TNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRR  723
            TNG  H+DADE WA  G      D+++VALHEIGHLLGL HS    A+MY     G  + 
Sbjct  181  TNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLHHSSVEGAIMYPSISAGVTKG  239

Query  724  VLTTDDKNGLKALYN  768
             L  DD  G++ LYN
Sbjct  240  -LHGDDIQGIRDLYN  253



>gb|EYU29749.1| hypothetical protein MIMGU_mgv1a023711mg, partial [Erythranthe 
guttata]
Length=265

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 145/258 (56%), Gaps = 8/258 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQGS KGDR+ G+  LK YL+ FGY+++L+   ++   + F D LESAI+TYQ   ++N 
Sbjct  15   LQGSVKGDRILGISVLKNYLQKFGYLDNLN---NTQINNEFDDALESAIKTYQQNFNINP  71

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG+LDA T           +   N   G    V HY F  G PKWP  K  LT+GF    
Sbjct  72   TGVLDAATPAGTENHESSSS---NNQLGHIHTVSHYTFFSGNPKWPPSKYNLTYGFLSNV  128

Query  361  PDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
            P     P   A +NW++   F F +      AD+     RGDHGDG  FDGPGG  AHAF
Sbjct  129  PANAVAPAERAFQNWDNATHFTFKRASSGQTADLIIGFQRGDHGDGSSFDGPGGILAHAF  188

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PTNG  H+DADE W+   P  N + +++VALHEIGHLLGL HS    A+MY     G  
Sbjct  189  APTNGRLHYDADERWS-VDPVANTIHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGTA  247

Query  718  RRVLTTDDKNGLKALYNF  771
            +  L  DD  G+KALYN 
Sbjct  248  KIKLNADDIQGIKALYNM  265



>ref|XP_008376281.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=362

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 158/274 (58%), Gaps = 23/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG  V GL  LKK+L  FGY N    +S   D D F D LESAI++YQ  +HL  
Sbjct  90   LEGCHKGQNVSGLQELKKHLTKFGYFN--YDHSKHADNDEFDDLLESAIKSYQKSYHLKV  147

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGV----------VPHYR-FLPGEPKWPADK  327
            TG LD  TA+QMM PRCGV D++NGT  G+            V HY  F PG  +WP+ +
Sbjct  148  TGSLDTTTAKQMMVPRCGVPDVVNGTRKGSKKYNRKLKSLHGVSHYEFFFPGPLRWPSTQ  207

Query  328  RRLTFGFA------PGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
              L + FA      PGT +        A + W  V  F F +    + ADI     RG+H
Sbjct  208  THLRYRFASSARQVPGT-ENVRSICAQAFQRWAQVTTFTFEEVPSTSAADITIGFHRGNH  266

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GD  PFDG  G+YAHA PP  GN HFDA E W+   P  N +D++SV++HEIGHLLGL+H
Sbjct  267  GDRSPFDGFKGTYAHANPPGGGNFHFDAXETWSA-NPGPNEIDLESVSVHEIGHLLGLNH  325

Query  667  SEN-PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              + PD +MY  FEYG  +R L  DD +G++ALY
Sbjct  326  XPDLPDXIMYPYFEYGMVKRDLNRDDIDGIRALY  359



>ref|XP_004297959.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 150/267 (56%), Gaps = 15/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+   KGD+VKG+++LKKYL  FG ++ +++  S  + D+F   LE A+RTYQ   +LN 
Sbjct  48   LKCCHKGDKVKGIHDLKKYLHKFGCLDYMNHIHS--NDDHFDQFLEEAVRTYQLNFNLNP  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-----------GAGVVPHYRFLPGEPKWPADK  327
            TG LD +T   MMKP CGV DIINGT+                  HY    G+ KWP  K
Sbjct  106  TGTLDEKTISMMMKPHCGVPDIINGTTSMRSAKIKHQHRAIHTTVHYTLPDGDYKWPPSK  165

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGDGKPF  504
             +LTFGF PGTP      +  A   W+    F F +     NAD+K +  + DHGDG PF
Sbjct  166  YQLTFGFLPGTPSAATGSIVQAFAIWQKSTHFKFSQSNNPQNADLKISFHKRDHGDGDPF  225

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG  AHA  PT G  H+DA+E W+    P   +D  SV LHEIGHLLGL HS    A
Sbjct  226  DGPGGQLAHAAYPTGGTLHYDAEETWSAGAKP-GAMDYGSVGLHEIGHLLGLGHSSVEGA  284

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VM+     G   + L  DD  G+KALY
Sbjct  285  VMFPTVTEGVAYKGLHQDDIQGIKALY  311



>ref|XP_008458910.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=296

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 154/269 (57%), Gaps = 22/269 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+GS+ G+ ++G+Y++K YLK +GY+     N+ S D   F   LESAI+T+Q  H LN 
Sbjct  34   LKGSRIGNNIEGIYSVKLYLKRYGYLITNVPNTDSNDT--FDVLLESAIKTFQKYHSLNV  91

Query  181  TGILDAETARQMMKPRCGVADII--------NGTSGGAGVVPHYRFLPGEPKWPADKRRL  336
            +G+LD ET   M  PRCG++DI+        N     +    HY FLPG PKWP  K  L
Sbjct  92   SGVLDKETLTLMSLPRCGISDIVHNNNVMDNNIQMNSSSFHSHYTFLPGNPKWPISKYNL  151

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYAN------ADIKFTLFRGDHGDGK  498
             + F  G P+ F  PV  A+  W      +F  FR++        DI F   RG+HGDG 
Sbjct  152  KYTFLEGFPNDFKEPVMNAMDQWA-----LFSLFRFSETIGGEEVDITFNFVRGNHGDGH  206

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDG GG  AHAF P +G  HFD DE+WA+ G     +++  VALHE+GH+LGL HS   
Sbjct  207  PFDGKGGVLAHAFGPLDGRVHFDWDEDWAD-GSVGGFINVGMVALHELGHVLGLAHSTIR  265

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            DA+M+     GE+ R L  DD  G++ LY
Sbjct  266  DAIMWPYMHVGEQTRGLQFDDIEGIQTLY  294



>ref|XP_002311051.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
 gb|EEE88418.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
Length=295

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 150/266 (56%), Gaps = 22/266 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L  S+KG  V  L+ +K+YLK FGY+          D D  +D+LESAIRTYQ   HL  
Sbjct  39   LVESQKGQSVSKLHLVKQYLKKFGYL----------DYDLSNDRLESAIRTYQQNFHLEV  88

Query  181  TGILDAETARQMMKPRCGVADIINGT-------SGGAGVVPHYRFLPGEPKWPADKRRLT  339
            TG LD  T  QMMKPRCGVADI N T       S        Y F PG P+W +   + T
Sbjct  89   TGRLDKRTVNQMMKPRCGVADIFNSTKHHNSSKSSDGVANADYSFFPGAPRWSSKHLKYT  148

Query  340  FG--FAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDG  510
            FG        +        + + W  V  F F +    A+ADIK   ++ DHGD +PFDG
Sbjct  149  FGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEPFDG  208

Query  511  PGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN-PDAV  687
            PGG +AH F PT G  HFDADE W+   P    LD++SVA+HEIGHL  L HSE+ PDA+
Sbjct  209  PGGIFAHGFRPTIGMLHFDADETWSS-NPGSLELDLESVAVHEIGHLPELGHSEDHPDAI  267

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            MY  F+YG+ +R L  DD  G++ LY
Sbjct  268  MYPYFDYGKTKRSLQEDDIEGIRDLY  293



>ref|XP_006387200.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
 gb|ABK94796.1| unknown [Populus trichocarpa]
 gb|ERP46114.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
Length=309

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 157/274 (57%), Gaps = 26/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI--NDLSYNSSSPDADYFSDQLESAIRTYQTRHHL  174
            L+G KKG  V+GL  LK+YLK  GY   +D++  SS      F D LE A++TYQ   HL
Sbjct  43   LEGVKKGQTVQGLIELKQYLKKLGYYPSDDITLTSSD-----FDDHLELALKTYQEYFHL  97

Query  175  NSTGILDAETARQMMKPRCGVADIINGTSGG----------AGVVPHYRFLPGEPKWPAD  324
            N TG LD+ T +QM+ PRCG  DIIN  S              +V HY F  G  KWP  
Sbjct  98   NVTGNLDSSTIQQMVIPRCGTPDIINTPSTKPNSTKSKHKKVHMVAHYAF--GAEKWPPS  155

Query  325  KRRLTFGFAPGT----PDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHG  489
            K  LT+ F  G      D      + A + W  V  F F +    A+ADI    + GDHG
Sbjct  156  KYALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFQEATAGASADIVIEFYSGDHG  215

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            D  PFDGPG + AHAF P +G  H+DADENW+   P  +  D++SV +HEIGHLLGL HS
Sbjct  216  DRYPFDGPGKTLAHAFYPQDGRLHYDADENWST-DPAMDQTDLESVTVHEIGHLLGLHHS  274

Query  670  -ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
             ++P+A+MY   E G+K+R L  DD +G+ ALY+
Sbjct  275  TDHPEAIMYPTIEAGKKKRDLAQDDIDGIHALYS  308



>ref|XP_008443669.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=313

 Score =   209 bits (532),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 154/278 (55%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSPDADYFSDQLESAIRTYQTRH  168
            LQG KKGD VKG+  LK + + +GY    IN   +   +   D F D+LE AI+TYQ   
Sbjct  36   LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDTDADDTFDDRLEFAIKTYQQYF  95

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSGGA-----------------GVVPHYRFL  297
            HLN TG L+AET  Q+  PRCG  DIIN ++G                     V HY F 
Sbjct  96   HLNPTGSLNAETISQLATPRCGNPDIINESTGRMLSEHNNNDSSHDHHHLPHAVSHYAFF  155

Query  298  PGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLF  474
            PG  +WP+ K RLT+ F PGT      PVT A   W     F F     Y  AD+K   +
Sbjct  156  PGRRRWPSTKYRLTYAFLPGTRADAKAPVTRAFATWARNTHFKFSLITNYRRADLKIGFY  215

Query  475  RGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLL  654
            RG+HGDG PFDGPGG+ AHAF PT+G  H+D+ E WA  G      D+Q+VALHEIGHLL
Sbjct  216  RGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWA-VGAVKGRYDLQTVALHEIGHLL  274

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            GL HS   +A+MY     G  +  L  DD  G+K LYN
Sbjct  275  GLGHSTVRNAIMYPYIRSGSTKG-LNADDIKGIKVLYN  311



>ref|XP_007044491.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY00323.1| Matrixin family protein, putative [Theobroma cacao]
Length=369

 Score =   211 bits (536),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/274 (42%), Positives = 157/274 (57%), Gaps = 25/274 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G + G++  GL  LK+Y   FGYI     NS +  +D F+D+LE A++ YQ   +LN TG
Sbjct  53   GCQSGEKRDGLSKLKQYFNNFGYIP----NSPTNFSDDFNDELEKALKIYQQNFNLNVTG  108

Query  187  ILDAETARQMMKPRCGVADIINGT-------------SGGAGVVPHYRFLPGEPKWPADK  327
             LD +T +Q+++PRCG ADI+NGT             +G      HY F PG P WPA++
Sbjct  109  QLDDQTLQQIVRPRCGNADIVNGTSSMNSGKSSSFHTTGHFRTTAHYAFFPGRPFWPANR  168

Query  328  RRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGK  498
            R LT+GF P     D+     T A   W +V P  F +   + +ADIK   + GDHGDG+
Sbjct  169  RDLTYGFLPANELSDEVKAVFTRAFEKWSAVTPLTFTQTDSFFSADIKIAFYSGDHGDGE  228

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLD  663
            PFDG  G+ AHAF PTNG  H D  ENW   G        + +D++SVA+HEIGHLLGL 
Sbjct  229  PFDGVLGTLAHAFSPTNGRFHLDLAENWVVSGDVTTSSLSSAVDLESVAVHEIGHLLGLG  288

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HS   DA+M+       ++  L  DD +G+++LY
Sbjct  289  HSSVEDAIMFPTISSRTRKVELANDDVDGIQSLY  322



>ref|XP_006495379.1| PREDICTED: metalloendoproteinase 1-like, partial [Citrus sinensis]
Length=235

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 136/234 (58%), Gaps = 18/234 (8%)
 Frame = +1

Query  115  DYFSDQLESAIRTYQTRHHLNSTGILDAETARQMMKPRCGVADIINGTSGGAG-------  273
            D F + LESAI+TYQ  +HL STGILDA T  +M  PRCGVADI+NGT+           
Sbjct  3    DDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQH  62

Query  274  -----VVPHYRFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF  438
                  V HY F  G P+WPA K  LT+ F PGT      PV  A + W +   F F K 
Sbjct  63   NHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKI  122

Query  439  R-YANADIKFTLFRGDHGDGKPFD---GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN  606
              +ANADIK +   GDHGDG PFD   GP G  AHAF PTNG  H+DADE WA  G    
Sbjct  123  EDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQG  181

Query  607  GLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
              D+++VALHEIGHLLGL HS    A+MY     G K+  L  DD  G++ LYN
Sbjct  182  AFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAGVKKG-LHGDDIQGIRDLYN  234



>ref|XP_006371427.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
 gb|ERP49224.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
Length=308

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 157/273 (58%), Gaps = 25/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  SS      F D LE A++TYQ   HLN
Sbjct  43   LEGVQKGQTVQGLVELKQYLKKFGYYPSDITLTSSD-----FDDHLELALKTYQEYFHLN  97

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAG----------VVPHYRFLPGEPKWPADK  327
             TG LD+ T +QMM PRCG+ DIIN  S              +V HY F  G  KWP  K
Sbjct  98   VTGNLDSSTIQQMMIPRCGMPDIINTPSTKPNSTTSKHNKFHMVVHYDF--GTRKWPPSK  155

Query  328  RRLTFGFAPGT----PDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDHGD  492
              LT+ F  G      D      + A + W  V PF F +    A+ADI    F GDHGD
Sbjct  156  YALTYRFGSGVQVVGSDTLRSVCSNAFQTWAKVSPFTFQEATDGASADIVIEFFSGDHGD  215

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
              PFDGPG   AH F P +G  H+DADENW+   P  +  D++SV +HEIGHLLGL HS+
Sbjct  216  QDPFDGPGKQLAHGFFPQDGRLHYDADENWST-DPAMDQTDLESVTVHEIGHLLGLYHSK  274

Query  673  N-PDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            + P+A+MY     G+K+R L  DD +G+ ALY+
Sbjct  275  DHPEAIMYPTIAPGKKKRDLAQDDIDGIHALYS  307



>gb|KDO82628.1| hypothetical protein CISIN_1g021444mg [Citrus sinensis]
Length=312

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 148/271 (55%), Gaps = 29/271 (11%)
 Frame = +1

Query  28   VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDAETA  207
            + GL  LKKY   FGYI DL  N +    D F D LESA++TYQ   +L  TG LD++T 
Sbjct  1    MDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEPTGQLDSQTM  56

Query  208  RQMMKPRCGVADIINGTS-----------------GGAGVVPHYRFLPGEPKWPADKRRL  336
            + +++PRCG  DI+NGT+                 G    V HY F PG P+WP++KR L
Sbjct  57   QHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDL  116

Query  337  TFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFD  507
            T+ F P     D+      TA   W       F +   Y  ADI+   F GDHGDG+PFD
Sbjct  117  TYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFD  176

Query  508  GPGGSYAHAFPPTNGNCHFDADENWA-----EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            GP G+ AHAF P NG  H D DENW            + +D++SVA+HEIGHLLGL HS 
Sbjct  177  GPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSS  236

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+MY     G ++  L  DD  G++ALY
Sbjct  237  VEDAIMYPSISSGSRKVELANDDIQGIQALY  267



>ref|XP_010272073.1| PREDICTED: metalloendoproteinase 1 [Nelumbo nucifera]
Length=371

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 154/271 (57%), Gaps = 22/271 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G + G++V GL  LK+Y   FGYI D    S S   D F D +ESA++ YQ   +LN+TG
Sbjct  56   GCRNGEQVDGLGKLKEYFHHFGYIPD----SPSNFTDDFDDTMESALKKYQQNFNLNATG  111

Query  187  ILDAETARQMMKPRCGVADIINGT----SGGAG-------VVPHYRFLPGEPKWPADKRR  333
            +LD  T +Q+++PRCGVADIINGT    SG +         V HY F P +P WP+ +  
Sbjct  112  VLDNSTIQQLIRPRCGVADIINGTNTMSSGKSAASTHSLHTVGHYTFFPHQPTWPSSRLD  171

Query  334  LTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPF  504
            LT+GF P     D        A   W +V P  F     Y+ ADIK   + GDH DG+PF
Sbjct  172  LTYGFLPDNQLSDTVKAVFAKAFARWAAVTPLTFTMTDSYSMADIKIAFYTGDHSDGEPF  231

Query  505  DGPGGSYAHAFPPTNGNCHFDADENW----AEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            DG  G+ AHAF PT+G  H D  ENW    A      + +D++SVA+HEIGHLLGL HS 
Sbjct  232  DGVLGTLAHAFSPTDGRFHLDGAENWVVDDASKSSISSAVDLESVAVHEIGHLLGLGHSS  291

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+MY     G K+  L +DD  G++ LY
Sbjct  292  YGDAIMYPTISSGTKKVELWSDDIEGIQLLY  322



>ref|XP_004139163.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66654.1| hypothetical protein Csa_1G654840 [Cucumis sativus]
Length=315

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/282 (44%), Positives = 154/282 (55%), Gaps = 31/282 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSPDADYFSDQLESAIRTYQTRH  168
            LQGSKKGD VKG+  LK + + +GY    IN   +       D F D+ ESA++TYQ   
Sbjct  35   LQGSKKGDNVKGISKLKNFFRRYGYLNHQINVTGHLIDHDADDTFDDRFESAVKTYQQYF  94

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSGG------------------AGVVPHYRF  294
            HLNSTG L+AET  Q+  PRCG  DI+N  +G                   +  VPHY F
Sbjct  95   HLNSTGSLNAETLSQLATPRCGNPDILNEATGRMLLENNNNDSSHDHYHQLSHAVPHYSF  154

Query  295  LPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYAN----ADIK  462
             PG P+WP  K  LT+ F P T      PVT A   W        +KF  A     AD+K
Sbjct  155  FPGRPRWPPTKYHLTYEFLPNTHADAKAPVTRAFATWAR---HTHFKFSLATNSRRADLK  211

Query  463  FTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEI  642
               +RG+HGDG PFDG GG+ AHAF PT+G  HFD+ E W   G      D+++VALHEI
Sbjct  212  IGFYRGNHGDGYPFDGSGGTLAHAFTPTDGRVHFDSTEKWV-VGAVRGRFDLETVALHEI  270

Query  643  GHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            GHLLGL HS   +A+MY   E G  +  L  DD  G++ LYN
Sbjct  271  GHLLGLGHSRVKNAIMYPTIESGSTKG-LNADDIEGIEVLYN  311



>ref|XP_011071055.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=374

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 153/273 (56%), Gaps = 22/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G KKG +  GL  LK+Y + FGY+N     S S  +D F D LE A++TYQ   +LN+
Sbjct  51   LVGCKKGQKADGLPKLKEYFQYFGYLN----TSYSDFSDEFDDSLEIAVKTYQLNFNLNA  106

Query  181  TGILDAETARQMMKPRCGVADIINGTSG----------GAGVVPHYRFLPGEPKWPADKR  330
            TG +DAET ++++ PRCG  DI+NGTS               V HY F P  P+WP  K 
Sbjct  107  TGQIDAETIKRIVVPRCGNPDIVNGTSAMHPGKPSANSTIHTVAHYSFFPNRPRWPPSKS  166

Query  331  RLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDGKP  501
            +LT+ F P     D      + A   W  V    F +    N ADI+   F  +HGDG+P
Sbjct  167  QLTYAFLPENQLSDVVKTVFSRAFERWSEVTTLTFTEISSFNRADIRIGFFSREHGDGEP  226

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWA---EF--GPPHNGLDIQSVALHEIGHLLGLDH  666
            FDG  G+ AHAF P  G CHFD +ENW    +F  G P + +D++SVA+HEIGH+LGL H
Sbjct  227  FDGVLGTLAHAFSPPTGRCHFDGEENWVIDGDFLNGAPLSAVDLESVAVHEIGHILGLGH  286

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            S   +A+MY     G ++  L  DD  G++ LY
Sbjct  287  SSVEEAIMYPSISSGTRKVELADDDIMGIQELY  319



>ref|XP_004297896.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 153/267 (57%), Gaps = 15/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSPDADYFSDQLESAIRTYQTRH  168
            L+GS KGD ++G+ +LK +L+ FGY   LSY    N    D D F D LESA++ YQ   
Sbjct  49   LKGSHKGDHIQGILDLKLFLEKFGY---LSYGNDKNHIHADDDDFDDVLESAVKDYQHYF  105

Query  169  HLNSTGILDAETARQMMKPRCGVADIIN------GTSGGAGVVPHYRFLPGEPKWPADKR  330
            HL +TG LD +T  +M KPRCGV+D I               V HY F   + KWP  K 
Sbjct  106  HLRTTGTLDGKTVSKMTKPRCGVSDHIGVHKIDYSKKDHIHEVSHYSFFSSKQKWPPSKY  165

Query  331  RLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFD  507
             LT+ FAPGT  +   P+  A + W +   F F + R Y  ADIK +  +GDHGDG  FD
Sbjct  166  HLTYAFAPGTLSEAMTPIAQAFQTWAASTHFKFRRHRDYKKADIKISFEQGDHGDGSSFD  225

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAV  687
            G GG  AHA+ PT G  H+DADE W+  G      D+++VALHEIGHLLGL HS   DA+
Sbjct  226  GTGGILAHAYAPTYGKLHYDADEPWS-IGALEGYYDLETVALHEIGHLLGLAHSSEEDAI  284

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALYN  768
            MY     G  +  L  DD +G++ALY 
Sbjct  285  MYPYISSGVTKLDLHHDDIHGIRALYK  311



>ref|XP_007153680.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
 gb|ESW25674.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
Length=376

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 152/278 (55%), Gaps = 26/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G  +G+   GL NLK Y + FGY     +   S  +D F D LESAI+TYQ   +LN 
Sbjct  53   LTGCHRGENYDGLANLKSYFERFGY---FPHAPPSNFSDEFDDALESAIKTYQKNFNLNV  109

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAG--------------VVPHYRFLPGEPKW  315
            TG+LD  T +Q++ PRCGVADIINGT+   AG               V H+   PG P+W
Sbjct  110  TGVLDDATLQQIVLPRCGVADIINGTTTMNAGKQNETASFSKPRFHTVAHFALFPGNPRW  169

Query  316  PADKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
            P     LT+ F PG    +       +A   W  V    F +   Y NADI+   F GDH
Sbjct  170  PEGTEELTYAFNPGNDLSNTVKGVFASAFARWAEVTSLTFRETASYFNADIRIGFFSGDH  229

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHL  651
            GDG+PFDG  G+ AHAF PTNG  H DADE+W   G        + +D++SVA+HEIGHL
Sbjct  230  GDGEPFDGSLGTLAHAFSPTNGRFHLDADEDWVVSGDVTQSALSSAVDLESVAVHEIGHL  289

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   +AVM+       K+ VL  DD  G++ LY
Sbjct  290  LGLGHSSVEEAVMFPTISSRRKKVVLAQDDIEGIQFLY  327



>gb|KDP45419.1| hypothetical protein JCGZ_09668 [Jatropha curcas]
Length=270

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 151/271 (56%), Gaps = 26/271 (10%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDA  198
            G++ K ++ LK+YL+ FGY+N     S S D++ F   LESAI+TYQ  + L+ TG LD+
Sbjct  2    GEKNKKIHQLKEYLEQFGYMN--KKGSVSLDSNSFDGDLESAIKTYQLNYRLDPTGTLDS  59

Query  199  ETARQMMKPRCGVADIINGTS---------------------GGAGVVPHYRFLPGEPKW  315
            ET   M+KPRCGV DIINGT+                          V HY F PG PKW
Sbjct  60   ETVETMIKPRCGVPDIINGTNRMQNGNISPSSSPSPSPSSSPNSFHTVSHYAFFPGTPKW  119

Query  316  PADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHGD  492
             A K  LT+ F P TP      ++ A + W +   F F +      ADIK    + DHGD
Sbjct  120  EASKYHLTYEFGPQTPPIAIEVISQAFQTWANNSHFTFERGTDITTADIKIRFRKRDHGD  179

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G PFDG GG  AHA+ P +G  HFDA+ENW   G      D+ +VALHEIGHLLGL+HS 
Sbjct  180  GIPFDGRGGILAHAYSPQDGRFHFDAEENWVT-GAREGAYDLGTVALHEIGHLLGLEHSS  238

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              +A+MY     G  +  L  DD +G++ALY
Sbjct  239  VEEAIMYPTIPSGATKG-LHKDDIDGIQALY  268



>ref|XP_008233236.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=381

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 161/278 (58%), Gaps = 31/278 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + D F D LESAI++YQ  +HL  
Sbjct  110  LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDDEFDDILESAIKSYQKSYHLKV  167

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGV----------VPHYR-FLPGEPKWPADK  327
            TG LDA T +QMM PRCGV D++NGT  G+            V HY  FLPG  +W   K
Sbjct  168  TGTLDASTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHEVAHYEFFLPGPLRW--SK  225

Query  328  RRLTFGF------APGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
              LT+ F       PGT +        A + W  V  F F +    + ADI     RG+H
Sbjct  226  THLTYRFRSSVNQVPGTQNVRSI-CAQAFQRWAQVTSFTFEEVPATSAADITIGFHRGNH  284

Query  487  GDG--KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGL  660
            GDG    FDGP G++AHA PP+ GN H+DADE W+   P  N +D++SVA+HEIGHLLGL
Sbjct  285  GDGPHNAFDGPRGTFAHANPPSGGNFHYDADERWSS-NPGPNEVDLESVAVHEIGHLLGL  343

Query  661  DHSENP---DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            DH  NP   DA+MY  F+YG  +R L  DD +G++ LY
Sbjct  344  DH--NPDLRDAIMYPYFDYGIIKRDLHRDDIDGIRVLY  379



>gb|KCW49214.1| hypothetical protein EUGRSUZ_K02794, partial [Eucalyptus grandis]
Length=227

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 146/262 (56%), Gaps = 41/262 (16%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQG  KG+   G+  LK+YL+ F                      E A++TYQ  +HLN 
Sbjct  2    LQGCHKGNHTGGIRELKRYLEKF----------------------EFAVKTYQLNYHLNV  39

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LD +T  +MM+PRCGVADIINGT+               P+WPA    LT+GF PGT
Sbjct  40   TGTLDPQTTSKMMRPRCGVADIINGTTRMG------------PRWPASNYHLTYGFLPGT  87

Query  361  PDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDG--KPFDGPGGSYAH  531
            P+    PV  A   W SV  F F Y   +  A+I+    RGDHGDG    FDGPGG+ AH
Sbjct  88   PEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARGDHGDGAHNSFDGPGGTLAH  147

Query  532  AFPPTNGNCHFDADENWAEFGPPHN--GLDIQSVALHEIGHLLGLDHSENPDAVMYYRFE  705
            AFPPT G  H+DADE WA   PP      ++++VALHEIGHLLGL HS+   A+MY    
Sbjct  148  AFPPTVGLFHYDADEKWA-VDPPSGSAAFNVETVALHEIGHLLGLGHSDVEGAIMYSSIA  206

Query  706  YGEKRRVLTTDDKNGLKALYNF  771
             G  +  L  DD  G+KALYNF
Sbjct  207  PGTTKG-LHADDIQGIKALYNF  227



>gb|KDP21290.1| hypothetical protein JCGZ_21761 [Jatropha curcas]
Length=371

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 154/279 (55%), Gaps = 30/279 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G + G ++ GL  LK+Y   FGYI +   N +    D F D LESA++TYQ   +LN 
Sbjct  53   LSGCRAGQKLDGLNKLKQYFHDFGYIPNTFANFT----DDFDDALESALKTYQQNFNLNV  108

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG--------------VVPHYRFLPGEPKWP  318
            TG LD +T  Q++KPRCG ADI+NGT+                   V HY F PG P+WP
Sbjct  109  TGELDEQTLSQLIKPRCGNADIVNGTTAMNSGKWTPPFNTTSHFHTVGHYTFFPGSPRWP  168

Query  319  ADKRRLTFGFAPG----TPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGD  483
              KR LT+ F PG    T  K  F  T A   W +V P  F +   +  ADI+   F GD
Sbjct  169  DSKRDLTYAFWPGNNLTTEAKSVF--TRAFDRWSTVIPMTFAETDSFTIADIRIGFFSGD  226

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN-----GLDIQSVALHEIGH  648
            HGDG+PFDG  G+ AHAF P +G  H D DENW   G   +      +D++SVA+HEIGH
Sbjct  227  HGDGEPFDGVLGTLAHAFSPPSGRFHLDGDENWVVSGDISDSSIISAVDLESVAVHEIGH  286

Query  649  LLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LLGL HS   DA+MY       ++  L  DD +G++ LY
Sbjct  287  LLGLGHSSVEDAIMYPTIPSRTRKVELAQDDIDGVQQLY  325



>ref|XP_011010763.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=308

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 152/269 (57%), Gaps = 15/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDADYFSDQLE--SAIRTYQTRHH  171
            L  S+KG  V  L+ +K+YLK FGY++ DLS N +    D         SAIRTYQ   H
Sbjct  39   LVESQKGQSVSKLHLVKQYLKKFGYLDYDLSSNKNRNQVDDDEFDDLLESAIRTYQQNFH  98

Query  172  LNSTGILDAETARQMMKPRCGVADIINGT-------SGGAGVVPHYRFLPGEPKWPADKR  330
            L  TG LD  T  QMMKPRCGVADI N T       S        Y F PG P+W     
Sbjct  99   LEVTGRLDKRTVNQMMKPRCGVADIFNSTKHRNSSKSSDGVANADYSFFPGAPRWSKKHL  158

Query  331  RLTFG--FAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKP  501
            + TFG        +        + + W  V  F F +    A+ADIK   ++ DHGD +P
Sbjct  159  KYTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEP  218

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS-ENP  678
            FDGPGG +AH F PT G  HFDADE W+   P    LD++SVA+HEIGHLLGL HS ++P
Sbjct  219  FDGPGGIFAHGFRPTIGMLHFDADETWSS-NPGRLELDLESVAVHEIGHLLGLGHSGDHP  277

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            DA+MY  F+YG+ +R L  DD +G++ LY
Sbjct  278  DAIMYPYFDYGKTKRNLQEDDIDGIRDLY  306



>emb|CAN76268.1| hypothetical protein VITISV_004096 [Vitis vinifera]
Length=364

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 149/273 (55%), Gaps = 26/273 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   GD+  GL  LK+Y   FGYI++ +Y       D F D  E A++TYQ   +LN+TG
Sbjct  51   GCHAGDKADGLAKLKEYFHYFGYIHNSNYT------DDFDDAFEQALKTYQLNFNLNTTG  104

Query  187  ILDAETARQMMKPRCGVADIING------------TSGGAGVVPHYRFLPGEPKWPADKR  330
             LD  T  Q++ PRCG ADI NG            TSG    V HY F  G+P WP  KR
Sbjct  105  QLDXATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPESKR  164

Query  331  RLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKP  501
             LT+GF P     D      T+A   W +V P  F +   Y +AD++   + GDHGDG+ 
Sbjct  165  NLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDGEA  224

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDH  666
            FDG  G+ AHAF PTNG  H D +ENW   G        + +D++SVA+HEIGHLLGL H
Sbjct  225  FDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHLLGLGH  284

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            S   +A+MY       K+  L +DD  G++ LY
Sbjct  285  SSVEEAIMYPTITSRTKKVELASDDIQGIQELY  317



>ref|XP_002267298.2| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
Length=373

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 149/273 (55%), Gaps = 26/273 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   GD+  GL  LK+Y   FGYI++ +Y       D F D  E A++TYQ   +LN+TG
Sbjct  60   GCHAGDKADGLAKLKEYFHYFGYIHNSNYT------DDFDDAFEQALKTYQLNFNLNTTG  113

Query  187  ILDAETARQMMKPRCGVADIING------------TSGGAGVVPHYRFLPGEPKWPADKR  330
             LD  T  Q++ PRCG ADI NG            TSG    V HY F  G+P WP  KR
Sbjct  114  QLDEATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPESKR  173

Query  331  RLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKP  501
             LT+GF P     D      T+A   W +V P  F +   Y +AD++   + GDHGDG+ 
Sbjct  174  NLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDGEA  233

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDH  666
            FDG  G+ AHAF PTNG  H D +ENW   G        + +D++SVA+HEIGHLLGL H
Sbjct  234  FDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHLLGLGH  293

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            S   +A+MY       K+  L +DD  G++ LY
Sbjct  294  SSVEEAIMYPTITSRTKKVELASDDIQGIQELY  326



>ref|XP_007220919.1| hypothetical protein PRUPE_ppb025548mg [Prunus persica]
 gb|EMJ22118.1| hypothetical protein PRUPE_ppb025548mg [Prunus persica]
Length=315

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 159/275 (58%), Gaps = 26/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + + F D LESAI++YQ  +HL  
Sbjct  44   LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDEEFDDILESAIKSYQKSYHLKV  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGV----------VPHYRFLPGEPKWPADKR  330
            TG LD  T +QMM PRCGV D++NGT  G+            V HY F PG  +W   K 
Sbjct  102  TGTLDTTTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHGVAHYEFFPGPRRW--SKT  159

Query  331  RLTFGFA------PGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHG  489
             LT+ F+      PGT +        A + W  V  F F +    + ADI     RG+HG
Sbjct  160  HLTYRFSSSVNQVPGTQNVRSI-CAQAFQRWAQVTSFTFEEVPATSAADITIGFHRGNHG  218

Query  490  D--GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLD  663
            D  G  FDGP G+ AHA PP  GN H+DADE W+   P  N +D++SV +HEIGHLLGL+
Sbjct  219  DGPGNAFDGPRGTLAHANPPRGGNFHYDADERWSS-NPGPNEVDLESVTVHEIGHLLGLN  277

Query  664  HSEN-PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            H+ + PDA+MY  F++G  +R L  DD +G++ALY
Sbjct  278  HNPDLPDAIMYPYFDHGIIKRDLHRDDIDGIRALY  312



>gb|KDP32993.1| hypothetical protein JCGZ_13024 [Jatropha curcas]
Length=306

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 152/261 (58%), Gaps = 8/261 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQG  KGD++KG+  LK+YLK FGY+     N +  + DYF D LESAI+ YQ  + L +
Sbjct  50   LQGCHKGDKIKGIQELKEYLKYFGYLR--YKNRAHANDDYFDDVLESAIKMYQQNYRLKT  107

Query  181  TGILDAETARQMMKPRCGVADIINGT---SGGAGVVPHYRFLPGEPKWPADKRRLTFGFA  351
            TG L +ET  +MM PRCGVAD+ NGT   S  A     Y F PG PKWPA K  LT+   
Sbjct  108  TGSLTSETVSKMMMPRCGVADLTNGTIKKSSNAYHTSGYTFFPGNPKWPASKYALTYELR  167

Query  352  PGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPGGSYA  528
              TP     P+  A + W +V PF F  F    N DI   L++GDHGDG PFD  G   A
Sbjct  168  YDTPPHLIPPLQNAFQAWANVTPFTFSPFHGRGNPDITIGLYKGDHGDGYPFDAFGAIAA  227

Query  529  HAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEY  708
            H++PP +G  HF++   +   G   N  D  +VA HEIGHLLGL HS + +A+MY    +
Sbjct  228  HSWPPQDGRLHFNSYGRFC-IGAFPNLYDFGTVASHEIGHLLGLGHSRDEEAIMYPVAPF  286

Query  709  GEKRRVLTTDDKNGLKALYNF  771
            G  + +   D + G++ALY F
Sbjct  287  GRVKGIHQYDIE-GVRALYEF  306



>ref|XP_007219827.1| hypothetical protein PRUPE_ppa026649mg, partial [Prunus persica]
 gb|EMJ21026.1| hypothetical protein PRUPE_ppa026649mg, partial [Prunus persica]
Length=344

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 122/272 (45%), Positives = 156/272 (57%), Gaps = 35/272 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + + F D LESAI++YQ  +HL  
Sbjct  89   LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDEEFDDILESAIKSYQKSYHLKV  146

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGV----------VPHYRFLPGEPKWPADKR  330
            TG LD  T +QMM PRCGV D++NGT  G+            V HY F PG  +W   K 
Sbjct  147  TGTLDTTTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHGVAHYEFFPGPRRW--SKT  204

Query  331  RLTFGFA------PGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHG  489
             LT+ F+      PGT ++           W  V  F F +    + ADI     RG+HG
Sbjct  205  HLTYRFSSSVNQVPGTQNR-----------WAQVTSFTFEEVPATSAADITIGFHRGNHG  253

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHS  669
            DG  FDGP G++AHA PP  GN H+DADE W+   P  N +D++SVA+HEIGHLLGL+H+
Sbjct  254  DGSAFDGPRGTFAHANPPRGGNFHYDADERWSS-NPGPNEVDLESVAVHEIGHLLGLNHN  312

Query  670  EN-PDAVMYYRFEYGEKRRVLTTDDKNGLKAL  762
             + PDA+MY  F YG  +R L  DD NG+  L
Sbjct  313  PDLPDAIMYPYFNYGSIKRNLHRDD-NGMLTL  343



>ref|XP_008458715.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=317

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 149/267 (56%), Gaps = 14/267 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQ-LESAIRTYQTRHHLN  177
            LQG   GD  +G+  +KKYL+ FGYI       S+P  D   DQ LESA++TYQT H+L 
Sbjct  51   LQGCHLGDTKQGIQQIKKYLQRFGYITTNIQKHSNPIFDDTFDQVLESALKTYQTNHNLA  110

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAGV----------VPHYRFLPGEPKWPADK  327
             +GILD+ T  Q+ KPRCGV D+I                   V H+ F  G  KWP+ K
Sbjct  111  PSGILDSNTLAQIAKPRCGVQDVIKNKKRNQNYKNNGHIHFHKVSHFTFFEGNLKWPSSK  170

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPF  504
              L++GF P  P +   PV+ A   W     F F +   Y  ADIK +  RG+HGD  PF
Sbjct  171  FHLSYGFLPNYPIEAIKPVSRAFSKWSLNTHFKFSHVVDYRKADIKISFERGEHGDNAPF  230

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DG GG  AHA+PPT+G  HFD DE W+  G      D+++VALHEIGH+LGL HS   +A
Sbjct  231  DGVGGVLAHAYPPTDGRLHFDGDEAWS-VGAISGYFDVETVALHEIGHILGLQHSTIEEA  289

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +M+     G  +  L  DD  G+K LY
Sbjct  290  IMFPSIPEGVTKG-LHGDDIAGIKTLY  315



>ref|XP_002275671.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=303

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 156/268 (58%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSPDA-DYFSDQLESAIRTYQTRHHL  174
            LQGS+KGD+V+G++ +KKYL+ FGY+    S   +  D+ D+F D LESAI+ +QT +HL
Sbjct  39   LQGSQKGDKVEGIHKVKKYLQHFGYLGSTHSQTETQVDSEDHFDDALESAIKAFQTYYHL  98

Query  175  NSTGILDAETARQMMKPRCGVAD---IINGTSGGA----GVVPHYRFLPGEPKWPADKRR  333
              TGILDA TA QM + RCGV D   + N  +        +  HY F P +P+WPA KR 
Sbjct  99   KPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRH  158

Query  334  LTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF---RYANADIKFTLFRGDHGDGKPF  504
            L +     +  +    V  A   W  V  F F +    + AN  I F +   DHGDG+PF
Sbjct  159  LLYSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKV--RDHGDGRPF  216

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DG GG  AHAF PT+G  HFD DE W   G   N +D+Q+VA HEIGHLLGL H+   +A
Sbjct  217  DGRGGILAHAFAPTDGRFHFDGDETWV-IGAVANSMDLQTVARHEIGHLLGLAHTPVQEA  275

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            +MY     G  +  L  DD +G++ALY 
Sbjct  276  IMYAIISPGVTKG-LNQDDIDGIRALYT  302



>emb|CBI34987.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 156/268 (58%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSPDA-DYFSDQLESAIRTYQTRHHL  174
            LQGS+KGD+V+G++ +KKYL+ FGY+    S   +  D+ D+F D LESAI+ +QT +HL
Sbjct  32   LQGSQKGDKVEGIHKVKKYLQHFGYLGSTHSQTETQVDSEDHFDDALESAIKAFQTYYHL  91

Query  175  NSTGILDAETARQMMKPRCGVAD---IINGTSGGA----GVVPHYRFLPGEPKWPADKRR  333
              TGILDA TA QM + RCGV D   + N  +        +  HY F P +P+WPA KR 
Sbjct  92   KPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRH  151

Query  334  LTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF---RYANADIKFTLFRGDHGDGKPF  504
            L +     +  +    V  A   W  V  F F +    + AN  I F +   DHGDG+PF
Sbjct  152  LLYSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKV--RDHGDGRPF  209

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DG GG  AHAF PT+G  HFD DE W   G   N +D+Q+VA HEIGHLLGL H+   +A
Sbjct  210  DGRGGILAHAFAPTDGRFHFDGDETWV-IGAVANSMDLQTVARHEIGHLLGLAHTPVQEA  268

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            +MY     G  +  L  DD +G++ALY 
Sbjct  269  IMYAIISPGVTKG-LNQDDIDGIRALYT  295



>ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=364

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 153/276 (55%), Gaps = 27/276 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G + GD+++GL  LK Y   FGYI     N+ S   D F D LESAI+TYQ   +LN 
Sbjct  50   LAGCRAGDKLEGLSKLKNYFHYFGYIP----NTLSNFTDDFDDALESAIKTYQQNFNLNV  105

Query  181  TGILDAETARQMMKPRCGVADIING-----------TSGGAGVVPHYRFLPGEPKWPADK  327
            TG LD +T  Q+++PRCG ADIING           T+     V HY F PG P+WP  K
Sbjct  106  TGELDEQTLDQLVRPRCGNADIINGSTTMNSGKWQTTTTSFHAVGHYSFFPGTPRWPDSK  165

Query  328  RRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGD  492
            R LT+ F P       +K  F  T A   W +V P  F +   Y  ADI+   F GDHGD
Sbjct  166  RDLTYAFWPSNQLTEVEKSVF--TRAFDRWSTVIPMNFTETESYNVADIRIGFFSGDHGD  223

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLG  657
            G+PFDG  G+ AHAF P +G  H D +ENW   G        + +D++SVA+HEIGHLLG
Sbjct  224  GEPFDGVLGTLAHAFSPPSGRFHLDGEENWVVSGDISSSTISSAVDLESVAVHEIGHLLG  283

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +A+MY       ++  L  DD  G++ LY
Sbjct  284  LGHSSVEEAIMYPTIPSRTRKIELANDDIQGIQYLY  319



>ref|XP_011003818.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/274 (42%), Positives = 155/274 (57%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G +KG  VKGL  LK +LK  GY     +      +D F +  ESA++TYQ  + LN 
Sbjct  39   LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLNV  97

Query  181  TGILDAETARQMMKPRCGVADIIN-GTSGGAG------------VVPHYRFLPGEPKWPA  321
            TG LD++T +++M PRCGV D IN  TS  AG             V HY F  G P+WP+
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  322  DKRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDH  486
             K  LT+ F+         +     + A + W  V  F F +    + ADI      GDH
Sbjct  158  SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG PFDGPG   AHAF PT+G  H+DADE W+   P  + +D++SVA+HEIGHLLGLDH
Sbjct  218  GDGDPFDGPGRILAHAFAPTDGRLHYDADEKWST-NPSTDEVDLESVAVHEIGHLLGLDH  276

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S + +++M+     G  +R L  DD +G++ALY+
Sbjct  277  SMDQNSIMFAEIPQGTIKRELGQDDIDGIRALYS  310



>ref|XP_004142465.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52409.1| hypothetical protein Csa_5G632080 [Cucumis sativus]
Length=295

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 150/264 (57%), Gaps = 13/264 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQGS+ G+ ++G++N+K YLK +GY+ ++   +S+   D     LESAI+T+Q  H LN 
Sbjct  34   LQGSRIGNNIEGIHNVKLYLKRYGYLTNVESTNSNNTFDVL---LESAIKTFQKYHSLNV  90

Query  181  TGILDAETARQMMKPRCGVADII--------NGTSGGAGVVPHYRFLPGEPKWPADKRRL  336
            +G++D ET   M  PRCG+ DI+        N     +    H+ F P   KWP  K  L
Sbjct  91   SGVIDEETLTLMSLPRCGIPDIMHNINVMDNNVQMNSSSFHSHFTFFPDNLKWPVSKYNL  150

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDGKPFDGP  513
             + F    P+ F  PV  A+  W     F F +   A  ADI F   RG+HGDG PFDG 
Sbjct  151  RYTFLDDFPNDFKEPVMNAMEQWALFSLFRFSEAVEAQEADITFNFVRGNHGDGYPFDGK  210

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
            GG  AHAF P +G  HFD DE+WA+ G     +++  VALHE+GH+LGL HS   DA+M+
Sbjct  211  GGVLAHAFGPLDGRVHFDWDEDWAD-GSVGGFINVGMVALHELGHVLGLAHSTIRDAIMW  269

Query  694  YRFEYGEKRRVLTTDDKNGLKALY  765
               E GE+ R L  DD  G++ LY
Sbjct  270  PYMEAGEQTRGLQFDDIEGIQTLY  293



>ref|XP_004509890.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=377

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 153/283 (54%), Gaps = 34/283 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G +  GL NLK Y + FGYI   S+      +D F D LE+AI+TYQ   +LN 
Sbjct  53   FTGCHHGVKYDGLSNLKNYFQHFGYI---SHAPQLNFSDNFDDALENAIKTYQKNFNLNI  109

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAG----------------VVPHYRFLPGEP  309
            TG LD  T RQ++ PRCGVADIINGT+   AG                 + H+   PG+P
Sbjct  110  TGELDDNTLRQIVLPRCGVADIINGTTAMNAGKEKETTSYGHSKPKFHTLSHFTVFPGQP  169

Query  310  KWPADKRRLTFGFAPG-----TPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTL  471
            +WP  K+ LT+ F PG     T    F    TA   W  V    F +   Y++AD+K   
Sbjct  170  RWPEGKQELTYAFFPGNDLSKTVKSVF---ATAFARWSEVTTLTFTETESYSSADMKIGF  226

Query  472  FRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVALH  636
            F GDHGDG+PFDG  G+ AHAF PTNG  H DA E+W   G          +D++SVA+H
Sbjct  227  FEGDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDISKSSLPTAVDLESVAVH  286

Query  637  EIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            EIGHLLGL HS   DA+M+       K+ VL  DD  G++ LY
Sbjct  287  EIGHLLGLGHSSVEDAIMFPTISSRMKKVVLAEDDVRGIQYLY  329



>gb|EYU38312.1| hypothetical protein MIMGU_mgv11b017434mg [Erythranthe guttata]
Length=251

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 139/233 (60%), Gaps = 17/233 (7%)
 Frame = +1

Query  115  DYFSDQLESAIRTYQTRHHLNSTGILDAETARQMMKPRCGVADIING-------------  255
            D+ +   ESAI+TYQ  +H+  TGILDA T  +M  PRCG ADI+NG             
Sbjct  15   DFINQLEESAIKTYQRNYHIAPTGILDATTVSKMTTPRCGYADIVNGINTMQLNKGKKYL  74

Query  256  -TSGGAGVVPHYRF-LPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIF  429
             ++     V HYRF +P   +WP  K  LT+ F P TP+    PV+ A + W S+  F F
Sbjct  75   NSNNDIHTVSHYRFTVPRNRRWPRSKANLTYRFLPNTPEIAVGPVSRAFQKWHSISGFSF  134

Query  430  YKFR-YANADIKFTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN  606
             + +  ++ D+    F+  HGDG PFDGPGG  AHAF PT+G  H+DADE W++ GP  +
Sbjct  135  SRVQDSSSTDLVIGFFKRSHGDGAPFDGPGGVTAHAFRPTDGRLHYDADEKWSD-GPAPD  193

Query  607  GLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             +D++S+A+HEIGHLLGL HS+   A+MY    YG  +     DD NG+KALY
Sbjct  194  AMDLESIAVHEIGHLLGLGHSDVKAAIMYSYLNYGMNKTKFDADDINGIKALY  246



>gb|EYU46222.1| hypothetical protein MIMGU_mgv1a027058mg, partial [Erythranthe 
guttata]
Length=284

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 151/266 (57%), Gaps = 11/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA--DYFSDQLESAIRTYQTRHHL  174
            L G +KG   KGL +LK YL   GY+N        P A  D F + LE AIR YQ+   L
Sbjct  21   LVGIRKGTTAKGLSHLKSYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFFKL  80

Query  175  NSTGILDAETARQMMKPRCGVAD---IINGT---SGGAGVVPHYRFLPGEPKWPADKRRL  336
              TG+LD +T +Q+M+PRCGVAD   ++N T   S    +   Y F PG+P WPA KR L
Sbjct  81   KVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKRSL  140

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGP  513
            T+ F PGT       +  A   W +   F F Y   YANAD+K +    DHGDG PFDGP
Sbjct  141  TYSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDGP  200

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
             G  AHAF PT+G  H D DE W + G      D+Q+V LHE+GH+LGL H+ +  AVM 
Sbjct  201  LGILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGHILGLMHTGDVGAVM-  258

Query  694  YRFEYGEKRRVLTTDDKNGLKALYNF  771
            Y +     R+ L  DD +G+KALY F
Sbjct  259  YPYIGPNSRKGLGQDDVDGIKALYPF  284



>gb|EYU46221.1| hypothetical protein MIMGU_mgv1a010535mg [Erythranthe guttata]
Length=309

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 152/266 (57%), Gaps = 11/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA--DYFSDQLESAIRTYQTRHHL  174
            L G +KG+  KGL +LK YL   GY+N        P A  D F + LE AIR YQ+   L
Sbjct  46   LVGIRKGNSAKGLSHLKNYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFFKL  105

Query  175  NSTGILDAETARQMMKPRCGVAD---IINGT---SGGAGVVPHYRFLPGEPKWPADKRRL  336
              TG+LD +T +Q+M+PRCGVAD   ++N T   S    +   Y F PG+P WPA KR L
Sbjct  106  KVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKRSL  165

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGP  513
            T+ F PGT       +  A   W +   F F Y   YANAD+K +    DHGDG PFDGP
Sbjct  166  TYSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDGP  225

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
             G  AHAF PT+G  H D DE W + G      D+Q+V LHE+GH+LGL H+ +  AVM 
Sbjct  226  LGILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGHILGLMHTGDVGAVM-  283

Query  694  YRFEYGEKRRVLTTDDKNGLKALYNF  771
            Y +     R+ L  DD +G+KALY F
Sbjct  284  YPYIGPNSRKGLGQDDVDGIKALYPF  309



>ref|XP_006602365.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=368

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 153/281 (54%), Gaps = 31/281 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G  +GD+  GL NLK Y + FGYI      S+   +D F D LESAI+TYQ   +LN 
Sbjct  43   FTGCHRGDKYDGLANLKSYFERFGYIPHAPPPSNF--SDEFDDALESAIKTYQKNFNLNV  100

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAG--------------VVPHYRFLPGEPKW  315
            TG+LD  T ++++ PRCGVADIINGT+   AG               V H+   PG P+W
Sbjct  101  TGVLDDATLQKIVLPRCGVADIINGTTTMNAGKENETASFSKPKFHTVAHFSLFPGMPRW  160

Query  316  PADKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFR----YANADIKFTLFR  477
            P   + LT+ F PG    D       TA   W  V      KFR    Y  ADI+   F 
Sbjct  161  PEGTQELTYAFFPGNELSDTVKGVFATAFARWAEVTSL---KFRESASYFGADIRIGFFS  217

Query  478  GDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVALHEI  642
            GDHGDG+PFDG  G+ AHAF PTNG  H DA E+W   G          +D++SVA+HEI
Sbjct  218  GDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTLSALPTAVDLESVAVHEI  277

Query  643  GHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            GHLLGL HS   +AVM+      +K+ VL  DD  G++ LY
Sbjct  278  GHLLGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  318



>ref|XP_011085865.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=283

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/274 (42%), Positives = 153/274 (56%), Gaps = 25/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G  KG++ K +++LK YL  FGY   L Y N    + + F D LESA++ YQ  +++N
Sbjct  16   LEGCHKGNKTKDIHHLKHYLHQFGY---LDYPNQIHANNNDFDDLLESALKEYQRYYNIN  72

Query  178  STGILDAETARQMMKPRCGVADIINGT----------------SGGAGVVPHYRFLPGEP  309
             TG +DAET  +M+ PRCG  DI++GT                +     V  Y F PG  
Sbjct  73   PTGAVDAETIAKMVIPRCGNRDIVHGTNTMLPRPNKKENSNSSTNSIHTVSQYSFFPGNL  132

Query  310  KWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDH  486
            +W   K  LT+GF+P TP     PV  A   W+S   F F + +     D+     R DH
Sbjct  133  RW--SKTHLTYGFSPNTPTATIDPVIRAFAKWDSATHFTFSRAQNNQRPDLIIGFHRRDH  190

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG PFDGPGG+ AHAF P++G  H+D+DE W+   P  N   +++VALHEIGHLLGL H
Sbjct  191  GDGSPFDGPGGTIAHAFAPSDGRFHYDSDEAWS-MSPVGNAFHLETVALHEIGHLLGLGH  249

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S   DA+MY     G  +  L  DD  G+KALYN
Sbjct  250  SSVADAIMYPSISRGATKN-LHADDIQGIKALYN  282



>ref|XP_003530663.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=370

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 148/278 (53%), Gaps = 25/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G  +GD+  GL NLK Y + FGY        SS  +D F D LESAI+TYQ   +LN 
Sbjct  50   FTGCHRGDKYDGLANLKSYFERFGYFPHAP--PSSNFSDEFDDALESAIKTYQKNFNLNV  107

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG---------------VVPHYRFLPGEPKW  315
            TG+LD  T +Q++ PRCGVADIINGT+                    V H+   PG P+W
Sbjct  108  TGVLDDATVQQIVLPRCGVADIINGTTTMNAAKENETASFSKPKFHTVAHFTLFPGMPRW  167

Query  316  PADKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDH  486
            P   + LT+ F PG    D        A   W  V    F +   Y  ADI+   F GDH
Sbjct  168  PEGTQELTYAFFPGNGLSDAVKGVFAAAFARWAEVTSLKFRETASYFGADIRIGFFSGDH  227

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVALHEIGHL  651
            GDG+PFDG  G+ AHAF PTNG  H DA E+W   G          +D++SVA+HEIGHL
Sbjct  228  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTRSALPTAVDLESVAVHEIGHL  287

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LGL HS   +AVM+      +K+ VL  DD  G++ LY
Sbjct  288  LGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  325



>ref|XP_008465718.1| PREDICTED: metalloendoproteinase 1 [Cucumis melo]
Length=362

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 157/271 (58%), Gaps = 22/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD-ADYFSDQLESAIRTYQTRHHLN  177
            L+G + GDR+ GL NLK YL  FGYI        SP+  D F   L+SA++TYQT  +LN
Sbjct  46   LKGCRPGDRLNGLSNLKTYLNHFGYI------PPSPNFTDLFDPLLQSALKTYQTNFNLN  99

Query  178  STGILDAETARQMMKPRCGVADIIN-GTSGGAG-------VVPHYRFLPGEPKWPADKRR  333
            +TG+LD +T  Q+  PRCG+ DIIN  TS  +G        V HY F PG P WPA +R 
Sbjct  100  ATGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGRHSPHFHSVSHYTFFPGRPIWPAHRRD  159

Query  334  LTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPF  504
            LT+ FAP  P  ++       A   W +V P  F     +  ADI+   + GDHGDG+PF
Sbjct  160  LTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRTADIRIGFYAGDHGDGEPF  219

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFG----PPHNGLDIQSVALHEIGHLLGLDHSE  672
            DG  G+ AHAF P +G+ H D DE+W   G     P   +D++SVA+HEIGHLLGL HS 
Sbjct  220  DGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGLGHSS  279

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              +++M+       ++  L  DD NG++ LY
Sbjct  280  VEESIMFPTITSRTRKVDLAADDINGIQELY  310



>ref|XP_011003815.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 155/274 (57%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G +KG  VKGL  LK +L+  GY     +      +D F +  ESA++TYQ  + LN 
Sbjct  39   LEGCQKGQNVKGLKELKHHLRNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLNV  97

Query  181  TGILDAETARQMMKPRCGVADIIN-GTSGGAG------------VVPHYRFLPGEPKWPA  321
            TG LD++T +++M PRCGV D IN  TS  AG             V HY F  G P+WP+
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  322  DKRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGDH  486
             K  LT+ F+         +     + A + W  V  F F +    + ADI      GDH
Sbjct  158  SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
            GDG PFDGPG   AHAF PT+G  H+DADE W+   P  + +D++SVA+HEIGHLLGLDH
Sbjct  218  GDGDPFDGPGRILAHAFAPTDGRLHYDADEKWST-NPRTDEVDLESVAVHEIGHLLGLDH  276

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            S + +++M+     G  +R L  DD +G++ALY+
Sbjct  277  SMDQNSIMFAEIPQGTIKRELGQDDIDGIRALYS  310



>ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=373

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 150/277 (54%), Gaps = 26/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G +KG +  GL  LKKY + FGY+N+ SY++ S D   F D LE AIRTYQ   +L +
Sbjct  52   LDGCRKGVKADGLAKLKKYFQLFGYLNN-SYDNFSDD---FDDYLEKAIRTYQLNFNLYA  107

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------------GGAGVVPHYRFLPGEPKWP  318
            TG LDA T + ++ PRCG  D++NGTS                   V HY F P  P+WP
Sbjct  108  TGELDAPTLKHIVLPRCGNPDVVNGTSTMRSGKPSNRYSANSTIHTVAHYSFFPNRPRWP  167

Query  319  ADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHG  489
              + RLT+ F P     D        A   W  V P  F +   +  AD++   F GDHG
Sbjct  168  PGRTRLTYAFLPENQLSDVVKGVFARAFERWSEVTPLTFTETSSFYGADLRIGFFSGDHG  227

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLL  654
            DG+PFDG  G+ AHAF P  G  H D DENW   G      P + +D++SVA+HEIGHLL
Sbjct  228  DGEPFDGVLGTLAHAFSPPAGRFHLDGDENWVIDGDFLNSSPMSAVDLESVAVHEIGHLL  287

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            GL HS   DA+MY     G ++  L  DD  G++ LY
Sbjct  288  GLGHSSVEDAIMYPTISSGTRKVELANDDIMGIQELY  324



>ref|XP_004143787.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004157318.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN51182.1| hypothetical protein Csa_5G484630 [Cucumis sativus]
Length=366

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 158/275 (57%), Gaps = 26/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD-ADYFSDQLESAIRTYQTRHHLN  177
            L+G + GDR  GL NLK YL  FGYI       SSP+  D F   L+SA++TYQT  +LN
Sbjct  46   LKGCRPGDRFNGLSNLKTYLNRFGYI------PSSPNFTDLFDPLLQSALKTYQTNFNLN  99

Query  178  STGILDAETARQMMKPRCGVADIIN-GTSGGAG-----------VVPHYRFLPGEPKWPA  321
            +TG+LD +T  Q+  PRCG+ DIIN  TS  +G            V HY F PG P WPA
Sbjct  100  ATGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGQPTGRQSPHFHSVSHYSFFPGRPIWPA  159

Query  322  DKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGD  492
             +R LT+ FAP  P  ++       A   W +V P  F     + +ADI+   + GDHGD
Sbjct  160  HRRDLTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRSADIRIGFYAGDHGD  219

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG----PPHNGLDIQSVALHEIGHLLGL  660
            G+PFDG  G+ AHAF P +G+ H D DE+W   G     P   +D++SVA+HEIGHLLGL
Sbjct  220  GEPFDGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGL  279

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS   +++M+       ++  L  DD NG++ LY
Sbjct  280  GHSSVEESIMFPTITSRTRKVDLAADDINGIQELY  314



>ref|XP_003517862.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/275 (43%), Positives = 149/275 (54%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G + G    GL NLK Y   FGYI+++S  SS+  +D F D LE+A+R YQ   +LN 
Sbjct  59   FTGCRPGKTYNGLSNLKNYFHYFGYISNVSSKSSNF-SDDFDDALEAAVRAYQKNFNLNI  117

Query  181  TGILDAETARQMMKPRCGVADIINGT----SGGAG--------VVPHYRFLPGEPKWPAD  324
            TG LD  T  Q++KPRCGVADIINGT    SG            V HY F  G+P+WP  
Sbjct  118  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKTNTTDSPTFHTVAHYSFFDGQPRWPVG  177

Query  325  KRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDG  495
             + LT+ F P     D        A   W  V    F +   Y  ADI+   + GDHGDG
Sbjct  178  TQELTYAFDPDNALDDVIKTVFGNAFSRWSEVTTISFRETASYVAADIRIGFYGGDHGDG  237

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGL  660
            +PFDG  G+ AHAF PTNG  H D+ E+W   G        N +D++SVA+HEIGHLLGL
Sbjct  238  EPFDGVLGTLAHAFSPTNGMFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLLGL  297

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS   DA+MY       ++  L  DD  G++ LY
Sbjct  298  GHSSVEDAIMYPTITARTRKVELNEDDIQGIQVLY  332



>ref|XP_006838196.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
 gb|ERN00765.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
Length=355

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 153/265 (58%), Gaps = 13/265 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
             Q +  G  + G+  LKKY + FGY+ +   NSS    D F ++ ESA+RTYQ R  L+ 
Sbjct  50   FQDAPLGSNITGMVELKKYFQRFGYLLN-PPNSSETLTDCFDEEFESAVRTYQARLSLSV  108

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LD +T  Q+M PRCG+ D   G  G    V HY F PG PKWP  K+ LT+G +P  
Sbjct  109  TGRLDPDTLAQVMTPRCGMPD--KGLGGPFHEVGHYAFFPGVPKWPRGKKALTYGISPTN  166

Query  361  PDKFF------FPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPGG  519
               +         ++ A   W +V P  F + + Y  ADIK   F GDHGDG+PFDG  G
Sbjct  167  MVNYLDMEDVRMALSRAFDRWSNVIPLNFTETQDYYGADIKIGFFSGDHGDGQPFDGVLG  226

Query  520  SYAHAFPPTNGNCHFDADENWA-EFGPPHN--GLDIQSVALHEIGHLLGLDHSENPDAVM  690
              AHAF P+NGN H DA E W+ +FG   +   +D++SVA HEIGHLLGL HS+  +A+M
Sbjct  227  ILAHAFSPSNGNFHLDASETWSTDFGVQKSRVAIDLESVATHEIGHLLGLGHSKEKEAIM  286

Query  691  YYRFEYGEKRRVLTTDDKNGLKALY  765
            Y       K+  L +DD  G+++LY
Sbjct  287  YPSLSPRTKKMELRSDDIIGVQSLY  311



>gb|KGN52417.1| hypothetical protein Csa_5G633150 [Cucumis sativus]
Length=294

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 149/267 (56%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSP------DADYFSDQLESAIRTYQT  162
            L G +KGD V+G++N+KKYL+ +GY   LS+N+S+       +++ F D LESAIR YQ 
Sbjct  32   LNGCRKGDNVEGIHNIKKYLQRYGY---LSHNTSTDSNIIELNSNKFDDSLESAIRLYQK  88

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADK  327
              HLN +GILD ET  QM + RCG+ D+    S         +  HY   P   KWP  K
Sbjct  89   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYK  148

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPF  504
            R LT+ F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG  F
Sbjct  149  RHLTYMFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAF  208

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG   HAF PT+G  H D D++W+  G   N  ++ +VALHE+GH+LGL HS  P A
Sbjct  209  DGPGGVVGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGHVLGLAHSTLPQA  267

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VM+   +    +  L  DD  GL ALY
Sbjct  268  VMWPYIDSNALKN-LNDDDIAGLHALY  293



>ref|XP_004159085.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 150/264 (57%), Gaps = 11/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSS--SPDADYFSDQLESAIRTYQTRHH  171
            L G +KGD V+G+ N+KKYL+ +GY++ ++S +S     +++ F D LESAI+ YQ   H
Sbjct  33   LYGCRKGDNVEGIRNIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKWTH  92

Query  172  LNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADKRRL  336
            LN +G+LD ET  QM KPRCGV D+    S         +  HY   PG P+WP  KR L
Sbjct  93   LNVSGVLDQETLDQMFKPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNPQWPDYKRHL  152

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFDGP  513
            T+ F    P  F   VT A+  W     F F +   A +ADI  +    DH DG PFDGP
Sbjct  153  TYVFTNNFPIDFVPSVTEAMARWAGQSLFTFSEASDAQSADINISFQIKDHADGLPFDGP  212

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
            GG   HAF PT+G  H D D++W+  G     +++ + ALHE+GH+LGL HS  P AVM+
Sbjct  213  GGIVGHAFAPTDGRLHLDGDDSWSA-GLEEKKVNVMNAALHELGHVLGLAHSTLPQAVMW  271

Query  694  YRFEYGEKRRVLTTDDKNGLKALY  765
               E    +  L  DD  GL ALY
Sbjct  272  PYIESNALKN-LNDDDIAGLHALY  294



>ref|XP_010255269.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=316

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/275 (43%), Positives = 153/275 (56%), Gaps = 27/275 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+GS+KGDRVKGL   K+YL  FGY++  + +            LESAI+TYQ  ++LN 
Sbjct  46   LEGSRKGDRVKGLNEAKRYLHRFGYLDHHNDDDDF------DHHLESAIKTYQLYYNLNE  99

Query  181  TGILDAETARQMMKPRCGVADIINGTS------------GG----AGVVPHYRFLPGEPK  312
            TG LD ET +QMM PRCG  DIING +            GG     G   HY F     K
Sbjct  100  TGSLDFETVKQMMLPRCGFPDIINGETWMRSGKEKNRRLGGRKTAVGFSSHYAFFNNSLK  159

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVT-TALRNWESVGPFIFYK-FRYANADIKFTLFRG  480
            WP  K  L +      P  D    P+   A   W ++  F F + +  ++ADI  + F+G
Sbjct  160  WPPSKMHLKYALDTNVPFDDVVMNPLCYVAFDKWAAISDFTFERTYDLSSADILISFFKG  219

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGL  660
            DHGDG  FDGPGG  AH+F PT G  H+D +ENW   G      D++SVA+HEIGHLLGL
Sbjct  220  DHGDGHLFDGPGGVLAHSFAPTGGRLHYDLEENWVA-GIRAGSFDLESVAVHEIGHLLGL  278

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             H+   +AVM+   + G ++  L  DD +GL+ALY
Sbjct  279  WHTPVTEAVMFAYLKDGTQKVNLHQDDIDGLRALY  313



>gb|KGN51345.1| hypothetical protein Csa_5G522910 [Cucumis sativus]
Length=295

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 150/267 (56%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS------SPDADYFSDQLESAIRTYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N+S        +++ F D LESAI+ YQ 
Sbjct  33   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNTSIDSHIIELNSNKFDDSLESAIKLYQK  89

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADK  327
              HLN +GILD ET  QM KPRCGV D+    S         +  HY   PG  KWP  K
Sbjct  90   WSHLNVSGILDQETLDQMFKPRCGVRDVFKFNSNKNLEDDLEMSSHYTLFPGNLKWPDYK  149

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPF  504
            R LT+ F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG PF
Sbjct  150  RHLTYVFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLPF  209

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG   HAF PT+G  H D D+ W+  G     +++ +VALHE+GH+LGL HS  P A
Sbjct  210  DGPGGVVGHAFAPTDGRLHLDGDDTWSA-GMEVQKVNVMNVALHELGHVLGLAHSTLPQA  268

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VM+   +    +  L  DD  GL ALY
Sbjct  269  VMWPYIDSNALKN-LNDDDIAGLHALY  294



>ref|XP_004159086.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 149/265 (56%), Gaps = 15/265 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----PDADYFSDQLESAIRTYQTRH  168
            L G +KGD V+G++N+KKYL+ +GY   LS+N+ S     +++ F D LESAI+ YQ   
Sbjct  33   LYGCRKGDNVEGIHNIKKYLQRYGY---LSHNTDSHIIELNSNKFDDSLESAIKLYQKWS  89

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADKRR  333
            HLN +GILD ET  QM +PRCGV D+    S         +  HY   PG  KWP  KR 
Sbjct  90   HLNVSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRH  149

Query  334  LTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFDG  510
            LT+ F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG PFDG
Sbjct  150  LTYVFTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDG  209

Query  511  PGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVM  690
            PGG   HAF P +G  H D D++W+  G     +++ + ALHE+GH+LGL HS  P AVM
Sbjct  210  PGGVVGHAFAPIDGRLHLDGDDSWSA-GLEEKKVNVMNAALHELGHVLGLAHSTLPQAVM  268

Query  691  YYRFEYGEKRRVLTTDDKNGLKALY  765
            +   E    +  +  DD  GL ALY
Sbjct  269  WPYIESNALKN-MNDDDIAGLHALY  292



>gb|EYU46220.1| hypothetical protein MIMGU_mgv1a010241mg [Erythranthe guttata]
Length=318

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 155/267 (58%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDA--DYFSDQLESAIRTYQTRHH  171
            L G++KG+  KGL +LK YL   GY+N D      SP+   D F + LE A+R YQ+   
Sbjct  54   LVGTRKGNTAKGLSHLKGYLSNLGYMNIDSIIAKPSPEQNNDSFDENLELAVRAYQSFFK  113

Query  172  LNSTGILDAETARQMMKPRCGVAD---IINGT---SGGAGVVPHYRFLPGEPKWPADKRR  333
            L  TG+LDA T  QMM+PRCGVAD   ++N T   +    +  HY F PG+P W   K  
Sbjct  114  LKVTGVLDAATVNQMMQPRCGVADNFSVLNQTHLMTESPVIAKHYTFFPGKPVWWPGKTD  173

Query  334  LTFGFAPGTP---DKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGKPF  504
            LT+ F  G     D+  F   T L N  S+  F + K  Y  AD+K +    DHGD  PF
Sbjct  174  LTYSFPAGASYDLDEGIFE-ATGLWNNNSIFKFAYIK-DYDKADVKISFQVWDHGDRAPF  231

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG  AHAF PT+G  HFD  E W + G      D+QSV LHE+GH+LGL HS + +A
Sbjct  232  DGPGGVLAHAFAPTDGRLHFDGSEKWVD-GVKDGAFDVQSVGLHELGHILGLGHSADANA  290

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VM+  F+  ++R+ L  DD +G+KALY
Sbjct  291  VMWPTFQ-TKQRKGLGQDDIDGIKALY  316



>ref|XP_004142459.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 149/265 (56%), Gaps = 15/265 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----PDADYFSDQLESAIRTYQTRH  168
            L G +KGD V+G++N+KKYL+ +GY   LS+N+ S     +++ F D LESAI+ YQ   
Sbjct  33   LYGCRKGDNVEGIHNIKKYLQRYGY---LSHNTDSHIIELNSNKFDDSLESAIKLYQKWS  89

Query  169  HLNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADKRR  333
            HLN +GILD ET  QM +PRCGV D+    S         +  HY   PG  KWP  KR 
Sbjct  90   HLNVSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRH  149

Query  334  LTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFDG  510
            LT+ F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG PFDG
Sbjct  150  LTYVFTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDG  209

Query  511  PGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVM  690
            PGG   HAF P +G  H D D++W+  G     +++ + ALHE+GH+LGL HS  P AVM
Sbjct  210  PGGVVGHAFAPIDGRLHLDGDDSWSA-GLEEKKVNVMNAALHELGHVLGLAHSTLPQAVM  268

Query  691  YYRFEYGEKRRVLTTDDKNGLKALY  765
            +   +    +  L  DD  GL ALY
Sbjct  269  WPYIDSNALKN-LNDDDIAGLHALY  292



>ref|XP_008353003.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=377

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 148/269 (55%), Gaps = 23/269 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L   + + D   F   LE+A++TYQ   +LN TG LD 
Sbjct  60   GEKVDGLSKLKKYFNRFGYIPNLPTTNLTDD---FDGDLEAALKTYQKNFNLNVTGELDG  116

Query  199  ETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWPADKRRLTF  342
             T   ++KPRCG ADI+NGT+                 V HY F PG P WP ++R LT+
Sbjct  117  PTLEHLVKPRCGNADIVNGTTTMNSGKPASYNSTKFHSVSHYSFFPGTPVWPQNRRDLTY  176

Query  343  GFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGP  513
             F P     D+       A + W +  P  F +   + +ADIK   F GDHGDG+PFDG 
Sbjct  177  AFLPENELSDEVKTVFVGAFQRWSAATPLTFQETTSFYSADIKIGFFVGDHGDGEPFDGV  236

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSENP  678
             G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLLGL HS   
Sbjct  237  LGTLAHAFSPPSGRFHLDGDENWVITGDISKFSVESAVDLESVAVHEIGHLLGLGHSSVE  296

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            DA+MY       K+  L +DD  G++ LY
Sbjct  297  DAIMYPTISSRTKKVELASDDVLGIQTLY  325



>ref|XP_010110202.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXC25440.1| Metalloendoproteinase 1 [Morus notabilis]
Length=332

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 156/294 (53%), Gaps = 41/294 (14%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSP--------DADYFSDQLESAIRTY  156
            L G  KG+ V GL  LK+YL+ FGY++  +  + +           DYF D LESAI+ Y
Sbjct  43   LTGGHKGEIVPGLSELKQYLQRFGYLDSEAVENVAEAQNYDDVNSIDYFDDVLESAIKAY  102

Query  157  QTRHHLNSTGILDAETARQMMKPRCGVADIINGTSGGAGV--------------------  276
            Q  ++LN TG LD  T RQMM PRCG  D +NGT+                         
Sbjct  103  QRNYNLNVTGTLDPPTVRQMMLPRCGFPDTVNGTTSFPISHDHDHDHDHNHDHDHVHKQL  162

Query  277  ---VPHYRFLPGEPKWPADKRRLTFGFA-----PGTPDKFFFPVTTALRNWESVGPFIFY  432
               V HY F  G P+W  +K +LT+ F      PGT +     V  A + W  V  F F 
Sbjct  163  IHGVRHYSFFRGSPRW--NKYQLTYRFVAGVQVPGTSNIRSI-VYRAFQRWARVTRFTFT  219

Query  433  KFRY-ANADIKFTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNG  609
            +      +DI    FRG HGD  PFDG GG+ AHA+ P+ G  H+DADE W+E  P +  
Sbjct  220  EVASNVQSDISIGFFRGYHGDNAPFDGTGGTIAHAYAPSVGWFHYDADEYWSE-NPNYYQ  278

Query  610  LDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            +D++SVA+HEIGHLLGLDHS    A+MY     G  +R L  DD NG++ALY F
Sbjct  279  MDLESVAVHEIGHLLGLDHSTVAAAIMYPSINSGAIKRELNADDINGIRALYAF  332



>ref|NP_001267680.1| metalloendoproteinase 1-like precursor [Cucumis sativus]
 emb|CAB76364.1| matrix metalloproteinase [Cucumis sativus]
 gb|KGN52412.1| hypothetical protein Csa_5G632110 [Cucumis sativus]
Length=320

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 150/270 (56%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD-ADYFSDQLESAIRTYQTRHHLN  177
            LQG   GD  +G++ +KKYL+ FGYI       S+P   D F   LESA++TYQT H+L 
Sbjct  51   LQGCHLGDTKQGIHQIKKYLQRFGYITTNIQKHSNPIFDDTFDHILESALKTYQTNHNLA  110

Query  178  STGILDAETARQMMKPRCGVADII----------NGTSGGAG---VVPHYRFLPGEPKWP  318
             +GILD+ T  Q+  PRCGV D+I          N T+ G      V H+ F  G  KWP
Sbjct  111  PSGILDSNTIAQIAMPRCGVQDVIKNKKTKKRNQNFTNNGHTHFHKVSHFTFFEGNLKWP  170

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            + K  L++GF P  P     PV+ A   W     F F     Y  ADIK +  RG+HGD 
Sbjct  171  SSKLHLSYGFLPNYPIDAIKPVSRAFSKWSLNTHFKFSHVADYRKADIKISFERGEHGDN  230

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
             PFDG GG  AHA+ PT+G  HFD D+ W+  G      D+++VALHEIGH+LGL HS  
Sbjct  231  APFDGVGGVLAHAYAPTDGRLHFDGDDAWS-VGAISGYFDVETVALHEIGHILGLQHSTI  289

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             +A+M+     G  +  L  DD  G+KALY
Sbjct  290  EEAIMFPSIPEGVTKG-LHGDDIAGIKALY  318



>ref|XP_008458915.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=303

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 154/269 (57%), Gaps = 21/269 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ + N+ S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENDNNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDAETARQMMKPRCGVADII------------NGTSGGAGVVPHYRFLPGEPKWPA  321
             +G+LD +T   M K RCGV D              N   GG+    HY F      WPA
Sbjct  98   VSGVLDRKTLEHMYKFRCGVKDTFVSAAQEHENKNTNIEIGGS----HYTFYFNNVSWPA  153

Query  322  DKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFY-KFRYANADIKFTLFRGDHGDGK  498
            +++ L++GF    P +F  P+  A + WE    F F+   R   ADI  +  RG+HGD  
Sbjct  154  ERKHLSYGFIHNYPPQFIDPLVRAFQTWEDNTKFSFFLASRVQTADILVSFERGEHGDID  213

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPGG+ AH+    +G  HFDADE W E  P    +D++SVALHE+GH LGL HS +P
Sbjct  214  PFDGPGGTLAHSLGAIDGRVHFDADEQW-EGEPSEERIDLESVALHELGHTLGLGHSSDP  272

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             AVM+   E    +  LT+DD  G++ALY
Sbjct  273  SAVMFAYMEPDTYKTTLTSDDIEGIRALY  301



>gb|EYU34695.1| hypothetical protein MIMGU_mgv1a024051mg, partial [Erythranthe 
guttata]
Length=224

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 129/227 (57%), Gaps = 19/227 (8%)
 Frame = +1

Query  139  SAIRTYQTRHHLNSTGILDAETARQMMKPRCGVADIING----------------TSGGA  270
            SA++TYQ  +H+N TG LDA T  +M  PRCGV DII+G                +S   
Sbjct  1    SAVKTYQRNYHINPTGTLDATTVSKMTTPRCGVPDIIDGKNTMQKHGTKEHESNSSSKHI  60

Query  271  GVVPHYRFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYAN  450
              V HY F  G P+WP  K  LT+ F P TP     PV+ A + W S   F F     ++
Sbjct  61   HTVSHYSFFQGNPRWPPSKTHLTYRFLPNTPGAAVGPVSRAFQKWASSTHFTF-SLAQSS  119

Query  451  ADIKFTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVA  630
            AD+     RGDHGDG PFDG GG+ AHAF PTNG  H+DADE W+  GP  +  D+++VA
Sbjct  120  ADLVIGFHRGDHGDGNPFDGRGGTLAHAFAPTNGRFHYDADEQWS-VGPVQDAFDLETVA  178

Query  631  LHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            LHEIGHLLGL HS    A+MY     G  +  L  DD  G++ALYN 
Sbjct  179  LHEIGHLLGLGHSSVEAAIMYSGIGAGVTKG-LHADDIQGIRALYNI  224



>ref|XP_003519796.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/275 (43%), Positives = 149/275 (54%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G + G    GL NLK Y + FGYI+  + + SS   D F D LE+AI+ YQ   +LN 
Sbjct  58   FTGCRPGKTYNGLSNLKNYFQYFGYISK-ALSKSSNFTDDFDDALEAAIKAYQKNFNLNI  116

Query  181  TGILDAETARQMMKPRCGVADIINGT----SGGAGV--------VPHYRFLPGEPKWPAD  324
            TG LD  T  Q++KPRCGVADIINGT    SG +          V HY F  G+P+WP  
Sbjct  117  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKSNTTDSPKFHSVAHYSFFDGQPRWPEG  176

Query  325  KRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
             + LT+ F P     D        A   W  V    F +   YA ADI+   + GDHGDG
Sbjct  177  TQELTYAFDPDNALDDVSKTVFGNAFSRWSEVTTISFRETSSYAAADIRIGFYGGDHGDG  236

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGL  660
            +PFDG  G+ AHAF PTNG  H D+ E+W   G        N +D++SVA+HEIGHLLGL
Sbjct  237  EPFDGVLGTLAHAFSPTNGRFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLLGL  296

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS   DA+MY       ++  L  DD  G++ LY
Sbjct  297  GHSSVEDAIMYPTITARTRKVELNEDDILGIQVLY  331



>gb|AAC00572.1| similar to zinc metalloproteinases [Arabidopsis thaliana]
Length=377

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 153/282 (54%), Gaps = 29/282 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G +  GLY LK+Y + FGYI +   N S    D F D L++A+  YQ    LN 
Sbjct  42   FTGCHAGKKYDGLYMLKQYFQHFGYITET--NLSGNFTDDFDDILKNAVEMYQRNFQLNV  99

Query  181  TGILDAETARQMMKPRCGVADIINGTS-------------GGAG----VVPHYRFLPGEP  309
            TG+LD  T + ++ PRCG  D++NGTS              G G     V HY F PGEP
Sbjct  100  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  159

Query  310  KWPADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRG  480
            +WP ++R LT+ F P     ++     + A   WE V P  F +  R++ +DI    + G
Sbjct  160  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSG  219

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNG-------LDIQSVALHE  639
            +HGDG+PFDGP  + AHAF P  G+ H D +ENW   G   +G       +D++SVA+HE
Sbjct  220  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHE  279

Query  640  IGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            IGHLLGL HS    ++MY     G ++  LTTDD  G++ LY
Sbjct  280  IGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  321



>ref|NP_173824.2| putative metalloproteinase [Arabidopsis thaliana]
 gb|AAU90055.1| At1g24140 [Arabidopsis thaliana]
 gb|AEE30482.1| putative metalloproteinase [Arabidopsis thaliana]
Length=384

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 153/282 (54%), Gaps = 29/282 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G +  GLY LK+Y + FGYI +   N S    D F D L++A+  YQ    LN 
Sbjct  49   FTGCHAGKKYDGLYMLKQYFQHFGYITET--NLSGNFTDDFDDILKNAVEMYQRNFQLNV  106

Query  181  TGILDAETARQMMKPRCGVADIINGTS-------------GGAG----VVPHYRFLPGEP  309
            TG+LD  T + ++ PRCG  D++NGTS              G G     V HY F PGEP
Sbjct  107  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  166

Query  310  KWPADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRG  480
            +WP ++R LT+ F P     ++     + A   WE V P  F +  R++ +DI    + G
Sbjct  167  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSG  226

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNG-------LDIQSVALHE  639
            +HGDG+PFDGP  + AHAF P  G+ H D +ENW   G   +G       +D++SVA+HE
Sbjct  227  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHE  286

Query  640  IGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            IGHLLGL HS    ++MY     G ++  LTTDD  G++ LY
Sbjct  287  IGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>gb|EYU35921.1| hypothetical protein MIMGU_mgv1a019701mg [Erythranthe guttata]
Length=304

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 147/263 (56%), Gaps = 9/263 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G +KG + KGL  LK +L   GY+ + +  + + + D F D LE AI+ YQ   HLN 
Sbjct  45   LVGVRKGQKAKGLVELKTHLSNLGYMKNNNNEAKA-NNDLFDDDLELAIKKYQVFFHLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG-----AGVVPHYRFLPGEPKWPADKRRLTFG  345
             GILDA+T   ++ PRCGVAD +N  +         +  HY F PGEPKWP  K  LT+ 
Sbjct  104  NGILDAKTVEHLLLPRCGVADFVNLNASQFKNEIPTIASHYTFFPGEPKWPPGKTNLTYS  163

Query  346  FAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPGGS  522
            F PG  ++    +  A + W  V  F F Y   Y +ADIK +    DH DG  FDG GG 
Sbjct  164  FPPGASNEVMQAIKDATQLWAGVTHFKFTYITDYDHADIKISFQVWDHKDGAAFDGRGGI  223

Query  523  YAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRF  702
             AHAF P++G  HFD DE W +   P    D+Q V LHE+GH+LGL H+ +  A+M    
Sbjct  224  LAHAFAPSDGRLHFDGDEVWVDGVVP-GKFDLQMVGLHELGHVLGLGHTTDGGAIMTPTL  282

Query  703  EYGEKRRVLTTDDKNGLKALYNF  771
              G  R+ L  DD NG+KALY+ 
Sbjct  283  GSGF-RKGLGQDDINGIKALYHL  304



>gb|EPS61169.1| matrixin family protein, partial [Genlisea aurea]
Length=313

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 154/276 (56%), Gaps = 27/276 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G KKG +  G+  +KKYL+ FGY+ND SY   S   D F + L++A+R YQ   +L  
Sbjct  7    LVGCKKGIKAAGIGLMKKYLQYFGYLND-SYRDFS---DEFDENLDAAVRDYQLNFNLGV  62

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGA---------GV--VPHYRFLPGEPKWPADK  327
            TG LD  T   M +PRCG  D+INGTS  A         G+  V  + F P  P+WP  +
Sbjct  63   TGELDESTVDLMAQPRCGNLDVINGTSTMASGKSSDTFRGIRNVGRHSFFPNRPRWPPGR  122

Query  328  RRLTFGFAPG----TPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGD  492
             RLT+ F P      P +  F    A R W +V P  F +   +  ADI+   FRGDHGD
Sbjct  123  DRLTYAFLPENRLPAPTRSAF--ARAFRRWSAVTPLSFVETEAFEGADIRIAFFRGDHGD  180

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLG  657
            G+PFDG  G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLLG
Sbjct  181  GEPFDGLLGTLAHAFSPPSGRFHLDGDENWVVDGDFLDATRTSAVDLESVAVHEIGHLLG  240

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +A+MY    +G ++  L  DD  G++ LY
Sbjct  241  LGHSSVREAIMYPTIAFGTRKVDLVDDDIAGIQELY  276



>gb|KDO37628.1| hypothetical protein CISIN_1g039411mg [Citrus sinensis]
Length=222

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 132/222 (59%), Gaps = 16/222 (7%)
 Frame = +1

Query  145  IRTYQTRHHLNSTGILDAETARQMMKPRCGVADIINGTS----------GGAG---VVPH  285
            ++TYQ  +HLNSTG+LD  T   M +PRCGVADI+NGT+           GA     V H
Sbjct  1    MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSH  60

Query  286  YRFLPGEPKWPADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIK  462
            Y F PG P+WP     LT+ F PGTP +    V  A + W ++  F F + + Y NA++K
Sbjct  61   YEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLK  120

Query  463  FTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEI  642
             +  RG HGD  PFDG GG+ AHA PP  G   +DADE WA    P    D+++VALHEI
Sbjct  121  ISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAVGARP-GAFDLETVALHEI  179

Query  643  GHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            GHLLGLDHS    A+MY   + G  +  L TDD  G++ALYN
Sbjct  180  GHLLGLDHSLVEGAIMYAYIDPGATKG-LHTDDVQGIRALYN  220



>ref|XP_008244963.1| PREDICTED: metalloendoproteinase 1 [Prunus mume]
Length=425

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 148/269 (55%), Gaps = 24/269 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDA  198
            GD+V+GL  LKKY   FGYI +L  N +    D F D L+SA++TYQ   +LN TG LD 
Sbjct  110  GDKVEGLAKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  165

Query  199  ETARQMMKPRCGVADIINGTS------------GGAGVVPHYRFLPGEPKWPADKRRLTF  342
             T + ++KPRCG  DI+NGT+                 V HY   PG P WP ++R LT+
Sbjct  166  PTIQHLVKPRCGNPDIVNGTTTMNSGKPSSSNTSNLHTVAHYSTFPGTPVWPLNRRDLTY  225

Query  343  GFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGP  513
             F P     D        A   W +  P  F +   +  ADIK   FRGDHGDG+PFDG 
Sbjct  226  AFLPENKLADDVKAVFLRAFERWSAATPLNFSETTSFYTADIKIGFFRGDHGDGEPFDGV  285

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSENP  678
             G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLLGL HS   
Sbjct  286  LGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGHSSVE  345

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +A+M+       K+  L +DD  G+++LY
Sbjct  346  EAIMFPTISSRTKKVELASDDVLGIQSLY  374



>ref|XP_003628627.1| Matrix metalloproteinase-9 [Medicago truncatula]
 gb|AET03103.1| matrix metalloproteinase [Medicago truncatula]
Length=373

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/284 (43%), Positives = 153/284 (54%), Gaps = 40/284 (14%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADY---FSDQLESAIRTYQTRHHLN  177
            G ++G+   GL NLK Y + FGYI        SP +++   F D L+ AI+TYQ   +LN
Sbjct  51   GCRQGENYNGLSNLKNYFQHFGYI------PRSPKSNFSDDFDDDLQEAIKTYQKNFNLN  104

Query  178  STGILDAETARQMMKPRCGVADIINGTSG-GAG----------------VVPHYRFLPGE  306
             TG LD  T RQ+M PRCGVADIINGT+   AG                 V H+   PG+
Sbjct  105  VTGELDDMTLRQVMLPRCGVADIINGTTTMNAGKDTETTSNSDSKLRFHTVSHFTVFPGQ  164

Query  307  PKWPADKRRLTFGFAPG-----TPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFT  468
            P+WP  K+ LT+ F PG     T    F    TA   W  V    F +   Y+ ADIK  
Sbjct  165  PRWPEGKQELTYAFFPGNELTETVKSVF---ATAFARWSEVTTLKFTETTLYSGADIKIG  221

Query  469  LFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVAL  633
             F GDHGDG+PFDG  G+ AHAF P NG  H DA E+W   G          +D++SVA+
Sbjct  222  FFNGDHGDGEPFDGSLGTLAHAFSPRNGRFHLDAAEDWVVSGDVSKSSLPTAVDLESVAV  281

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS   +A+M+       K+ VL  DD  G++ LY
Sbjct  282  HEIGHLLGLGHSSEEEAIMFPTISSRMKKVVLADDDVRGIQYLY  325



>ref|XP_008458913.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 151/270 (56%), Gaps = 22/270 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S D   F + LESAI++YQ    L 
Sbjct  40   LIGSSKNDNIVEGIHKVKAYLQRYGYFSNENANTLSTDV--FDNDLESAIKSYQKFSKLK  97

Query  178  STGILDAETARQMMKPRCGVADII-------------NGTSGGAGVVPHYRFLPGEPKWP  318
             +G+LD ET +QM KPRCGV D               N   GG+    HY F      WP
Sbjct  98   VSGVLDRETLQQMSKPRCGVRDTFVSVAQQEHENKNTNIEIGGS----HYTFYFNNVTWP  153

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDG  495
            A+K+ L++GF    P +F  P+  A   WE    F F+   R   ADI  +  RGDHGD 
Sbjct  154  AEKKHLSYGFIHNYPPQFVDPLVRAFETWEDNTKFSFFLAPRVQTADILVSFERGDHGDY  213

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
            + FDG GG  AH+    +G  HFDADE W E GP  + +D++SVALHE+GH LGL HS  
Sbjct  214  QAFDGEGGILAHSLGAVDGRVHFDADEPW-ESGPIEDRVDLESVALHELGHTLGLGHSRE  272

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            P AVMY   + G  +  LT DD  G+ ALY
Sbjct  273  PSAVMYAFMDPGVYKTHLTIDDIEGICALY  302



>ref|XP_004297678.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=373

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 152/272 (56%), Gaps = 24/272 (9%)
 Frame = +1

Query  10   SKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGI  189
             + G++V GL  LKKY   FGYI +L  N +    D F D+L+SA++TYQ   +LN TG 
Sbjct  57   CRPGEKVDGLAKLKKYFNYFGYIPNLPTNCT----DEFDDELQSALKTYQKNFNLNVTGE  112

Query  190  LDAETARQMMKPRCGVADIINGTS---GGAGV---------VPHYRFLPGEPKWPADKRR  333
            LD +T   +++PRCG  DI+NGT+    G  V         V HY F PG P WP  +R 
Sbjct  113  LDDQTINHLVRPRCGNPDIVNGTTTMHSGKPVTFNNSKLHTVGHYSFFPGTPVWPTGRRD  172

Query  334  LTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPF  504
            LTF F P     D+       A + W +V P  F +   Y +ADIK   + GDHGDG+ F
Sbjct  173  LTFAFLPDNELSDEAKSVFVGAFQKWSTVIPMTFTETTSYYSADIKIGFYVGDHGDGEAF  232

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHS  669
            DG  G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLLGL HS
Sbjct  233  DGVLGTLAHAFSPPSGLFHLDGDENWVIGGDISTSTVTSAIDLESVAVHEIGHLLGLGHS  292

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               +++MY       K+  L  DD  G+++LY
Sbjct  293  SVEESIMYPTITSKTKKVDLANDDVEGIQSLY  324



>gb|EYU31381.1| hypothetical protein MIMGU_mgv1a023026mg, partial [Erythranthe 
guttata]
Length=267

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 151/263 (57%), Gaps = 11/263 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G++KG + K +  LKK+L   GY+   + N +    D F D LE AI+ YQ   HL+ 
Sbjct  10   LIGARKGHKAKSVLELKKHLSNIGYMKH-NNNEAKEKTDLFDDDLELAIKKYQVFFHLDV  68

Query  181  TGILDAETARQMMKPRCGVADIIN-GTSGGAGVVP----HYRFLPGEPKWPADKRRLTFG  345
            TGILDA+T + ++ PRCGVAD +N   S     +P    HY F PGEPKWP  K  LT+ 
Sbjct  69   TGILDAKTVKNLLLPRCGVADFVNLNASQFKNKIPTLASHYTFFPGEPKWP--KTNLTYS  126

Query  346  FAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPGGS  522
            F PGT       +  A + W SV  F F Y   Y +ADIK +    +HGDG PFDG GG+
Sbjct  127  FPPGTRADALQAIKDATQMWASVSNFKFTYIADYDHADIKISFQVWEHGDGTPFDGRGGA  186

Query  523  YAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRF  702
             AH+  P +   HFD DE WA+   P    D+Q++ LHE+GH LGL H+ +  A+MY   
Sbjct  187  LAHSSGPYDSLLHFDGDELWADGVVP-GKYDLQTIGLHELGHKLGLGHTNDGGAIMYPTI  245

Query  703  EYGEKRRVLTTDDKNGLKALYNF  771
              G  R+ L  DD +G+KALY+ 
Sbjct  246  GSGF-RKGLGKDDIDGIKALYHL  267



>gb|ACJ24812.1| matrix metalloproteinase [Pinus taeda]
Length=364

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 155/268 (58%), Gaps = 21/268 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L  + KGDR++GL +LK+Y + FGY++  + N+ + D   F + +ESA+RTYQ    LN 
Sbjct  59   LTNACKGDRMQGLPDLKRYFRRFGYLS--AQNNVTED---FDEAVESAVRTYQKNFGLNV  113

Query  181  TGILDAETARQMMKPRCGVADIINGTSG--GAGVVPHYRFLPGEPKWPADKRRLTFGFAP  354
            TG+LD  T  Q+M PRCG  DIING+S   G G+ P   F PG P+W  DKR L++ F+P
Sbjct  114  TGVLDEATISQLMVPRCGREDIINGSSAMRGRGLFP---FFPGSPRWGPDKRVLSYAFSP  170

Query  355  G-------TPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDG  510
                    +  +    V  A + W  V P  F +   Y++ADIK   + GDHGDG PFDG
Sbjct  171  DHEVLSEISLAELSTVVGRAFKRWADVIPITFTESSDYSSADIKVGFYSGDHGDGHPFDG  230

Query  511  PGGSYAHAFPPTNGNCHFDADENWA---EFGPPHNGLDIQSVALHEIGHLLGLDHSENPD  681
            P G+ AH+F P +G  H DA E+W            +D++S+A HEIGHLLGL H+    
Sbjct  231  PLGTLAHSFSPPDGRFHLDAAESWTVDLSSDSAATAIDLESIATHEIGHLLGLGHTTEKA  290

Query  682  AVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            AVMY       ++  L  DD +G++ +Y
Sbjct  291  AVMYPSIAPRTRKVDLVLDDVDGVQYVY  318



>ref|XP_011080437.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=308

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 148/262 (56%), Gaps = 9/262 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNS-SSPDADYFSDQLESAIRTYQTRHHLN  177
            L G++KG   KG+  LKKYL   GY+ND ++ + ++   D+F D+LE AI+ YQT   L 
Sbjct  47   LIGARKGTTSKGIPQLKKYLSRLGYMNDNNHTTPANQTNDFFDDKLELAIKRYQTFFKLT  106

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAGV-VP----HYRFLPGEPKWPADKRRLTF  342
               I+D  T  QM +PRCGV D    TS    + +P    HY FLP +P WP  KR LT+
Sbjct  107  VNRIMDDNTVTQMSRPRCGVPDFNLNTSNELFLQIPTSASHYTFLPNKPTWPRTKRNLTY  166

Query  343  GFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPGG  519
             F        +  +  A   W     F F Y   Y  ADIK +   G+HGDG PFDG GG
Sbjct  167  SFPVIARRDVYPAIEHATELWAFFSSFKFSYTQNYDRADIKISFQYGNHGDGYPFDGRGG  226

Query  520  SYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYR  699
               HA PPT G  H+DADENW   G      D+Q++ LHE+GH+LGL H+ +  A+MY  
Sbjct  227  ILGHALPPTIGILHYDADENWVN-GETPGAFDLQTIGLHELGHILGLGHTNDVRAIMYPN  285

Query  700  FEYGEKRRVLTTDDKNGLKALY  765
             + G  R+VL  DD +G+KALY
Sbjct  286  MDPGV-RKVLGQDDMDGIKALY  306



>gb|KCW85819.1| hypothetical protein EUGRSUZ_B02562 [Eucalyptus grandis]
Length=374

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 149/277 (54%), Gaps = 28/277 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G+R  GL NLKKY + FGYI +   N +    D F D L SAI+TYQ   +L  
Sbjct  55   FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  110

Query  181  TGILDAETARQMMKPRCGVADIINGT----SGGAG--------VVPHYRFLPGEPKWPAD  324
            TG LD  T  Q+++PRCG  DI+NG+    SG A          V HY F PG P+WP  
Sbjct  111  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  170

Query  325  KRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHG  489
            K  LT+ F P       +K  F  + A + W +V P  F     Y  ADIK   F GDHG
Sbjct  171  KSDLTYAFLPANQLSDDEKAVF--SRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHG  228

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLL  654
            DG+ FDG  G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLL
Sbjct  229  DGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHLL  288

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            GL HS   +++MY       K+  L TDD  G++ LY
Sbjct  289  GLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  325



>gb|EYU46223.1| hypothetical protein MIMGU_mgv1a025538mg [Erythranthe guttata]
Length=293

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 152/256 (59%), Gaps = 9/256 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G+ KGD+ KGL  LK+YLK  GYIN  S   ++   D+F D LE AI+ YQ  +++  
Sbjct  44   LSGTHKGDKSKGLNKLKEYLKNLGYIN--SKIPTNKYDDFFDDTLELAIKKYQEFYNIKI  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG LD ET   M+KPRCGVAD++  T+       +Y  L G   WP +KR LT+     T
Sbjct  102  TGFLDPETVTLMLKPRCGVADLL--TTNRTPFRSYYN-LSGY-SWPPNKRNLTYSLPKDT  157

Query  361  PDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPGGSYAHAF  537
                + P+  AL  W SV PF F +   + N+D+K +    DHGDG PFDGP G   H+F
Sbjct  158  RKDAYTPIVKALIKWVSVSPFNFTFTDDFENSDVKISFETRDHGDGYPFDGPYGVLGHSF  217

Query  538  PPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEYGEK  717
             PT+G  HFDA+ENW  F        + +VALHE+GH+LGL HS++  ++MY     GE 
Sbjct  218  YPTDGRLHFDAEENWKPFAEA-GSFYLGTVALHELGHILGLAHSQDEKSIMYAYIGEGEN  276

Query  718  RRVLTTDDKNGLKALY  765
            +  LT DD +G+K++Y
Sbjct  277  KD-LTQDDIHGIKSIY  291



>ref|XP_007157519.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
 gb|ESW29513.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
Length=377

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/275 (41%), Positives = 147/275 (53%), Gaps = 28/275 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADY---FSDQLESAIRTYQTRHHLN  177
            G + G    GL NLK Y   FGYI       ++P +++   F D LE+A++ YQ   +LN
Sbjct  62   GCRHGKAYDGLSNLKNYFHYFGYI------PTAPPSNFTDDFDDALEAAVKAYQKNFNLN  115

Query  178  STGILDAETARQMMKPRCGVADIINGTSGGAG-----------VVPHYRFLPGEPKWPAD  324
             TG LD  T +Q+++PRCGVAD+INGT+   G            V HY F  G P+WP  
Sbjct  116  ITGELDDATMQQIVRPRCGVADVINGTTTMNGKSNTTTTPKFHTVAHYSFFDGMPRWPQG  175

Query  325  KRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
               LT+ F P  G  D      + A + W  V    F +   YA ADI    + GDHGDG
Sbjct  176  TEELTYAFEPDNGLDDTVKGVFSNAFKRWAEVTTISFSEASSYAVADITIGFYSGDHGDG  235

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGL  660
            +PFDG  G+ AHAF PTNG  H D  E+W   G        N +D++SVA+HEIGHLLGL
Sbjct  236  EPFDGVLGTLAHAFSPTNGMFHLDEAEDWVATGDVTEASMSNAVDLESVAVHEIGHLLGL  295

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS   +A+MY       ++  L  DD  G++ LY
Sbjct  296  GHSSIEEAIMYPTISAKTRKVELAEDDIEGIQVLY  330



>gb|KHN28682.1| Metalloendoproteinase 1 [Glycine soja]
Length=400

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 145/268 (54%), Gaps = 23/268 (9%)
 Frame = +1

Query  16   KGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILD  195
            +G   KGL N+K Y    GYI +    ++ P  D F D L SAI+T+Q  ++L+ TG LD
Sbjct  47   RGHNYKGLSNVKNYFHHLGYIPN---PNAPPLDDKFDDTLVSAIKTFQKNYNLDITGKLD  103

Query  196  AETARQMMKPRCGVADIINGTSGGAG------VVPHYRFLPGEPKWPADKRRLTFGFAP-  354
              T RQ+  PRCGV DIIN  +           V HY F  G P+WPA  R+LT+ F+P 
Sbjct  104  NNTLRQLTTPRCGVPDIINTNTTTQHTQLHIHTVSHYSFFNGAPRWPAGTRQLTYAFSPE  163

Query  355  ---GTPDKFFFPVTTALRNWESVGPFIFYKF---RYANADIKFTLFRGDHGDGKPFDGPG  516
                +  K  F    A   W  V    FY+     Y  A+IK     GDH DG PFDGP 
Sbjct  164  LNLNSAAKSLF--ARAFNRWTQVVNIAFYEIASSSYQTANIKIAFLSGDHNDGLPFDGPL  221

Query  517  GSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSENPD  681
            G + HAF PTNG CHFDADE W   G     P    +D++S+A+HEIGHLLGL HS +  
Sbjct  222  GEWTHAFAPTNGWCHFDADEYWVASGDVTQSPVARAVDLESIAVHEIGHLLGLHHSSDQR  281

Query  682  AVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            A+MY       ++  L  DD NG++ LY
Sbjct  282  AIMYAYLPPRTRKVNLAQDDINGIRHLY  309



>ref|XP_009626465.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 145/274 (53%), Gaps = 25/274 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   G +V+GL  +K+Y + FGYIN LS N S    D F D L SA++TYQ   +LN+TG
Sbjct  52   GCHVGQKVEGLAKIKQYFQHFGYINSLSKNFS----DEFDDVLFSAVKTYQLNFNLNTTG  107

Query  187  ILDAETARQMMKPRCGVADIINGTSG-----------GAGVVPHYRFLPGEPKWPADKRR  333
              DA T + M+KPRCG  DI+NGT+                + H+ F  G P+WP  K  
Sbjct  108  EFDAVTLQHMIKPRCGNPDIVNGTTSMNSGNSPANSPAMHTMAHFSFFEGRPRWPPSKTN  167

Query  334  LTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPF  504
            L + F P     D        A   W  V P  F +   Y  ADI+     GDHGDG PF
Sbjct  168  LNYAFLPENQLTDSVKAAFGRAFDKWSEVTPLSFTETGSYRTADIRIGFLVGDHGDGNPF  227

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFG-------PPHNGLDIQSVALHEIGHLLGLD  663
            DGP    AHAF P  G  H D +ENW   G          +G+D++SVA+HEIGHLLGLD
Sbjct  228  DGPMKILAHAFSPPTGFFHLDGEENWVVDGGFLKEPVLEISGVDLESVAVHEIGHLLGLD  287

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HS   +A+M+     G ++  L++DD  G+  LY
Sbjct  288  HSSKKEAIMFPTLGAGVRKVELSSDDIKGVHMLY  321



>ref|XP_010100525.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB82659.1| Metalloendoproteinase 1 [Morus notabilis]
Length=374

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 146/279 (52%), Gaps = 31/279 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G + G +  GL  LK Y K FGYI D  +N +    D F D+LESAI+TYQ   +LN 
Sbjct  53   FTGCRPGQKSDGLSKLKDYFKNFGYIPDSQHNFT----DDFDDELESAIKTYQKNFNLNV  108

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-------------VVPHYRFLPGEPKWPA  321
            TG LD +T   +MK RCG ADI+NGTS                  V HY F  G P WP 
Sbjct  109  TGELDDKTIENLMKSRCGNADIVNGTSTMNSGKPASSNSSLNFHAVRHYSFFEGRPTWPE  168

Query  322  DKRRLTFGFAP-----GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGD  483
              R LT+ F P      T  + F   T A   W +V    F +   Y  AD+K   + GD
Sbjct  169  YHRDLTYAFLPDNELSNTTKEVF---TRAFERWAAVTTLTFTETDSYYEADLKVAFYTGD  225

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGH  648
            HGDG+PFDG  G+ AHAF PT+G  H D  E W   G        + +D++SVA+HEIGH
Sbjct  226  HGDGEPFDGVLGTLAHAFSPTSGRFHLDGAETWVAEGDVTKSSTSSAIDLESVAVHEIGH  285

Query  649  LLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LLGL HS   +A+MY       ++  L +DD  G++ LY
Sbjct  286  LLGLGHSSVEEAIMYPTISAKTRKVELASDDIQGIQELY  324



>ref|XP_002319607.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
 gb|EEE95530.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
Length=312

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/275 (41%), Positives = 152/275 (55%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G +KG  VKGL  LK +LK  GY     +      +D F +  ESA++TYQ  + L  
Sbjct  39   LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLKV  97

Query  181  TGILDAETARQMMKPRCGVADIIN--GTSGGAG------------VVPHYRFLPGEPKWP  318
            TG LD++T +++M PRCGV D IN   TS  AG             V HY F  G P+WP
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHVDTSKQAGRTEHDSKSSKFHTVSHYSFFGGTPRWP  157

Query  319  ADKRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKFRY-ANADIKFTLFRGD  483
            + K  LT+ F+         +     + A + W  V  F F +    + ADI      GD
Sbjct  158  SSKFHLTYTFSSSVQVIDMQELRSACSRAFQKWADVTQFTFQEASEGSQADIVIGFQSGD  217

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLD  663
            HGD  PFDGPG   AHAF PT+G  H+DADE W+   P  + +D++SVA+HEIGHLLGLD
Sbjct  218  HGDRYPFDGPGRILAHAFAPTDGRFHYDADEKWST-NPSADEVDLESVAVHEIGHLLGLD  276

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            HS + +++M+     G  +R L  DD  G++ALY+
Sbjct  277  HSMDQNSIMFAEIPQGTIKRDLGQDDIAGIRALYS  311



>ref|XP_008458917.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=295

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/265 (42%), Positives = 148/265 (56%), Gaps = 13/265 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS--SPDADYFSDQLESAIRTYQTRHHL  174
            L G +KGD V+G++++KKYL  +GY++  +  SS    +++ F D LESA++ YQ    L
Sbjct  33   LYGCRKGDNVEGIHSIKKYLHRYGYLSHNTNTSSHIELNSNTFDDTLESAVKLYQKWSKL  92

Query  175  NSTGILDAETARQMMKPRCGVADII------NGTSGGAGVVPHYRFLPGEPKWPADKRRL  336
            N +GILD +T  Q+ KPRCG+ D+I        T     +  HY   PG  KWP  KR L
Sbjct  93   NVSGILDQQTLDQIFKPRCGLPDVIMKSNSNKNTEDDLEISSHYALFPGNQKWPDYKRHL  152

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYANA-DIKFTLFRGDHGDGKPFDGP  513
            T+ F    P  F   VT A++ W +   F F +       DI  +   GDHGDG PFDGP
Sbjct  153  TYTFTNNFPIDFVPSVTEAMKEWAAHSLFTFSQAADDQVPDINISFQVGDHGDGVPFDGP  212

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
            GG   HAF PT+G  H D D+ W+  G     +++ + ALHE+GH+LGL HS    AVM+
Sbjct  213  GGVVGHAFAPTDGRLHLDGDDKWSA-GLETQKVNVMNAALHELGHVLGLAHSTVQQAVMW  271

Query  694  -YRFEYGEKRRVLTTDDKNGLKALY  765
             Y   Y  K   LT DD  GL ALY
Sbjct  272  PYIDVYALK--ALTDDDIAGLTALY  294



>ref|XP_004142460.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=294

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 149/264 (56%), Gaps = 11/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSS--SPDADYFSDQLESAIRTYQTRHH  171
            L G +KGD V+G++++KKYL+ +GY++ ++S +S     +++ F D LESAI+ YQ   H
Sbjct  32   LYGCRKGDNVEGIHSIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKWSH  91

Query  172  LNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADKRRL  336
            LN +GILD ET  QM + RCG+ D+    S         +  HY   P   KWP  KR L
Sbjct  92   LNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNEKWPDYKRHL  151

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFDGP  513
            T+ F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG  FDGP
Sbjct  152  TYMFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGP  211

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMY  693
            GG   HAF PT+G  H D D++W+  G   N  ++ +VALHE+GH+LGL HS  P AVM+
Sbjct  212  GGVVGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGHVLGLAHSTLPQAVMW  270

Query  694  YRFEYGEKRRVLTTDDKNGLKALY  765
               +    +  L  DD  GL ALY
Sbjct  271  PYIDSNALKN-LNDDDIAGLHALY  293



>emb|CDP00221.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 148/274 (54%), Gaps = 25/274 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   G +V GL  LK+Y + FGYI+    N +    D F D L SA++TYQ   +LN TG
Sbjct  61   GCHTGQKVDGLAKLKQYFQRFGYIDTSLLNFT----DDFDDYLGSALKTYQRNFNLNETG  116

Query  187  ILDAETARQMMKPRCGVADIINGT----SGGAG--------VVPHYRFLPGEPKWPADKR  330
             LDA T + + +PRCG  DI+NGT    SG            V HY F PG P+WPA K 
Sbjct  117  ELDAPTLQHITRPRCGNPDIVNGTTSMNSGKVANANSLRPHTVAHYSFFPGMPRWPAGKT  176

Query  331  RLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKP  501
             LT+ F P     D        A   W  V    F +   ++ ADIK  +F GDHGDG+P
Sbjct  177  DLTYAFLPENQVEDVVRRVFANAFDRWSEVTTLNFTETASFSLADIKIGIFSGDHGDGEP  236

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWAE----FGPPH--NGLDIQSVALHEIGHLLGLD  663
            FDG  G+ AHAF P +G  H D DENW      F  P   + +D++SVA+HEIGHLLGL 
Sbjct  237  FDGVLGTLAHAFSPPSGRLHLDGDENWVIDGDFFSAPSLASAVDLESVAVHEIGHLLGLG  296

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HS   +A+MY       ++  LT DD  G++ LY
Sbjct  297  HSSVEEAIMYPSIGSATRKVELTKDDIQGIQMLY  330



>ref|XP_002893327.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69586.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 154/284 (54%), Gaps = 33/284 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI--NDLSYNSSSPDADYFSDQLESAIRTYQTRHHL  174
              G   G +  GLY LK+Y + FGYI   DLS N +    D F D L++A+  YQ    L
Sbjct  49   FTGCHAGKKYDGLYKLKQYFQHFGYIPETDLSGNFT----DDFDDILKNAVEMYQRNFQL  104

Query  175  NSTGILDAETARQMMKPRCGVADIINGTS-------------GGAG----VVPHYRFLPG  303
            N TG+LD  T + ++ PRCG  D++NGTS              G G     V HY F PG
Sbjct  105  NVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRRTFEVSFAGRGQRFHTVKHYSFFPG  164

Query  304  EPKWPADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLF  474
            EP+WP ++R LT+ F P     ++     + A   W  V P  F +  R++ +DI    +
Sbjct  165  EPRWPRNRRDLTYAFDPRNSLTEEVKSVFSRAFARWAEVTPLTFTRVERFSTSDISIGFY  224

Query  475  RGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNG-------LDIQSVAL  633
             G+HGDG+PFDGP  + AHAF P  G+ H D +ENW   G   +G       +D++SVA+
Sbjct  225  SGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVDEAVDLESVAV  284

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS    ++MY     G ++  LTTDD  G++ LY
Sbjct  285  HEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>ref|XP_010414620.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=369

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 147/271 (54%), Gaps = 19/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  + ++ + D   F D L+SAI TYQ   +L  
Sbjct  54   LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVDNCTDD---FDDVLQSAIDTYQKNFNLKV  110

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LD+ T RQ++KPRCG  D+I+G S   G         Y F PG+P+WP  KR LT+ 
Sbjct  111  TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  170

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            F P     D+       A   W  V PF F +      ADI    F G+HGDG+PFDG  
Sbjct  171  FVPQNNLTDEVKRVFARAFTRWSEVTPFNFTRSESLVGADIVIGFFSGEHGDGEPFDGAM  230

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D+DE+W            P  + +D++SV +HEIGHLLGL HS 
Sbjct  231  GTLAHASSPPTGMLHLDSDEDWLISDGGISRRILPVTSVVDLESVVVHEIGHLLGLGHSS  290

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+M+     G+++  L  DD  G++ LY
Sbjct  291  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  321



>ref|XP_007033356.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY04282.1| Matrixin family protein, putative [Theobroma cacao]
Length=384

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 154/264 (58%), Gaps = 15/264 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            LQG++KG +VKGL ++K+Y K FGY     Y +     D + D LESA++ YQ  + L  
Sbjct  128  LQGAQKGYKVKGLNHVKQYFKAFGY-----YPNHINLTDDYDDSLESALKKYQENYRLKV  182

Query  181  TGILDAETARQMMKPRCGVADIINGTSG---GAGVVPHYRFLPGEPKWPADKRRLTFGFA  351
            TG +D +T ++M+ PRCGVADI N ++       +V +Y F  G PKW   KR+LT+ F 
Sbjct  183  TGRIDPDTIKEMLIPRCGVADIFNESNSEYDKLDMVANYTFFDGMPKWS--KRQLTYTFR  240

Query  352  PG----TPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGPG  516
                  +  +    +  A   W +V  F F +   +  ADI     R  H D  PFDGPG
Sbjct  241  SSAIVISVQQLRPIIARAFEKWAAVSQFTFRQAPTFTQADIVIGFHRRFHWDNYPFDGPG  300

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
               AHAF P +G  H+DADENW+      N +D++SVA+HEIGHLLGL HS +P+A+M+ 
Sbjct  301  NVLAHAFAPQDGRFHYDADENWSTNPTTVNQIDVESVAVHEIGHLLGLGHSRDPNAIMFA  360

Query  697  RFEYGEKRRVLTTDDKNGLKALYN  768
             +  G  +R L  DD +G++ALY+
Sbjct  361  LYMPGTIKRNLGQDDIDGMRALYS  384



>ref|XP_006416025.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
 gb|ESQ34378.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
Length=382

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 151/282 (54%), Gaps = 32/282 (11%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G   G +V GLY LK+Y + FGYI      + + D   F D L++A+ TYQ   HLN TG
Sbjct  51   GCHAGMKVNGLYKLKQYFQHFGYIRQTLPKNFTDD---FDDILKNAVETYQRNFHLNITG  107

Query  187  ILDAETARQMMKPRCGVADIINGTS--------------GGAG----VVPHYRFLPGEPK  312
             LD  T + ++ PRCGV DI+NGTS               G G     V  Y F PGEP+
Sbjct  108  ELDELTLKHVVMPRCGVPDIVNGTSTMHNGRRRTYEVSFSGKGPRFHAVKRYSFFPGEPR  167

Query  313  WPADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGD  483
            WP   R LT+ F P     ++     + A   W  V P  F +   ++ +DI+   + GD
Sbjct  168  WPERNRDLTYAFDPRNSLTEEVKSVFSRAFVRWAEVIPVTFTRVEVFSISDIRIGFYSGD  227

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG--------PPHNGLDIQSVALHE  639
            HGDG+PFDG  G+ AHAF P NG+ H D DENW   G             +D++SVA+HE
Sbjct  228  HGDGEPFDGVMGTLAHAFSPPNGHFHLDGDENWIVSGDVGGDRLLSVTAAVDLESVAVHE  287

Query  640  IGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            IGHLLGL HS   D++MY     G ++  LT+DD  G++ LY
Sbjct  288  IGHLLGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  329



>gb|EYU28648.1| hypothetical protein MIMGU_mgv1a008442mg [Erythranthe guttata]
Length=374

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/283 (41%), Positives = 149/283 (53%), Gaps = 27/283 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G  KG + +GL  LKKY + FGY+N    NS +  +D F + LESA+++YQ   +LN 
Sbjct  56   LTGCHKGVKSQGLPKLKKYFQFFGYLN----NSYTNFSDDFDEYLESAVKSYQLNFNLNV  111

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------------GGAGVVPHYRFLPGEPKWP  318
            TG LDA T   ++ PRCG ADI+NGTS                   V HY F P  P+WP
Sbjct  112  TGQLDAPTLNHIVLPRCGNADIVNGTSIMRSGKSPNTYSANSTIHTVAHYSFFPDRPRWP  171

Query  319  ADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHG  489
                +LT+ F P     D      + A   W  V  F F +   + +AD+K   F GDHG
Sbjct  172  PGTTQLTYAFLPENQLSDAVKGVFSRAFERWSEVTAFTFVETASFYDADLKIAFFGGDHG  231

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG------PPHNGLDIQSVALHEIGHL  651
            DG+PFDG  G+ AHAF P  G  H D DENW   G           +D++SVA+HEIGHL
Sbjct  232  DGEPFDGVMGTLAHAFAPPAGRFHLDGDENWVIDGNFLGAAASVAAVDLESVAVHEIGHL  291

Query  652  LGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF*QN  780
            LGL HS   +A+MY       ++  L  DD  G++ LY   QN
Sbjct  292  LGLGHSSVEEAIMYPTISSSTRKVELANDDIMGIQELYGSNQN  334



>gb|KHN16358.1| Metalloendoproteinase 1 [Glycine soja]
Length=292

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 150/265 (57%), Gaps = 21/265 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+G  KG +  G+  L+ YL+ FGY+ +          D F + +ESA++ YQ  +HL S
Sbjct  41   LRGVHKGQKANGVGELRSYLQHFGYLTN-----GDSSNDNFDNNVESALKHYQEFNHLRS  95

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVP--HYRFLPGEPKWPADKRRLTFGFAP  354
            TG++D ET ++M  PRCG+ DI+   +    +V   +Y F PG+PKW   K  LT+G   
Sbjct  96   TGVVDDETIKRMSLPRCGMPDIVTQPNANQLLVAPNNYSFFPGQPKW--RKFALTYGHMS  153

Query  355  GT--PDKFFFPVTTA----LRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGKPFDGPG  516
                 + FF  V  A    L+ W  V  F F + R   ADI +   RGDHGDG PFDGP 
Sbjct  154  SVVLSNNFFSSVRAAKLRALQTWARVTNFTFTE-RAPPADIVYGFHRGDHGDGYPFDGPY  212

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
            G  AHAF P NG CH+DADE W   G     +D ++VALHE GHLLGL HS    +VM  
Sbjct  213  GVLAHAFAPQNGRCHYDADEPWNFNG---QNIDFETVALHECGHLLGLGHSNTRGSVM--  267

Query  697  RFEYGEKRRVLTTDDKNGLKALYNF  771
               Y  +RR LT DD +G++ALY F
Sbjct  268  EATYAGQRRSLTQDDIDGIRALYQF  292



>ref|XP_009360449.1| PREDICTED: metalloendoproteinase 1 [Pyrus x bretschneideri]
Length=375

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 148/271 (55%), Gaps = 27/271 (10%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L   + + D   F D LE+A++TYQT  +LN TG LD 
Sbjct  60   GEKVDGLGKLKKYFNRFGYIPNLPTANLTDD---FDDDLEAALKTYQTNFNLNVTGELDG  116

Query  199  ETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWPADKRRLTF  342
             T   ++KPRCG  DI+NGT+                 V HY F PG P WP ++R LT+
Sbjct  117  PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYTFFPGTPVWPQNRRDLTY  176

Query  343  GFAP----GTPDKFFFPVTTALRNW-ESVGPFIFYKFRYANADIKFTLFRGDHGDGKPFD  507
             F P      P K  F    A + W E+          + +ADIK   F+GDHGDG+PFD
Sbjct  177  AFVPENELSDPVKAVF--VGAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEPFD  234

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSE  672
            G  G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLLGL HS 
Sbjct  235  GVLGTLAHAFSPPSGRFHLDGDENWVIAGDISKSSVTSAVDLESVAVHEIGHLLGLGHSS  294

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               A+MY       K+  L  DD  G+++LY
Sbjct  295  VEGAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_004504503.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=374

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 146/284 (51%), Gaps = 35/284 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G    GL  LK Y + FGYI +   ++ + D   F D LESA+R YQ   +LN 
Sbjct  54   FTGCSPGKTYDGLSKLKNYFQRFGYITNAPPSNFTDD---FDDALESAVRAYQQNFNLNV  110

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG------------------VVPHYRFLPGE  306
            TG LD  T   ++KPRCGVADIINGT+                       V HY F PGE
Sbjct  111  TGELDNATMNYIVKPRCGVADIINGTTSMNSGKFNFNNTSENKENPKFHTVAHYSFFPGE  170

Query  307  PKWPADKRRLTFGFAPG-----TPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFT  468
            P+WPA  + LT+ F P      T  + F     A   W  V    F +   ++ ADIK  
Sbjct  171  PRWPAGTKSLTYAFDPNENLDETTKQVF---ANAFNQWSKVTTITFSETTSFSTADIKIG  227

Query  469  LFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVAL  633
             + GDHGDG+ FDG  G+ AHAF PT+G  H D  E+W   G        N +D++SVA+
Sbjct  228  FYSGDHGDGEAFDGVLGTLAHAFSPTDGRFHLDKAEDWVVSGDVTESTLSNAVDLESVAV  287

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS   +A+MY       ++  L  DD +G++ LY
Sbjct  288  HEIGHLLGLGHSSVEEAIMYPTISSKTRKVELVNDDIDGIQQLY  331



>ref|XP_004965108.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=368

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 145/271 (54%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +G+  LK YL  FGY+ +     SS   D F   LE AI+ YQ    LN 
Sbjct  53   LTGCHFGEEQQGVAKLKDYLAHFGYLPE-----SSGFTDIFDADLEEAIKVYQRNFGLNI  107

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAGVVPH----YRFLPGEPKWPADKRRLTFG  345
            TG++DA T  QMM PRCGVAD+INGTS  GA    H    Y + PG P WP  K+RLT+ 
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNLYSYFPGSPSWPRSKKRLTYA  167

Query  346  F---APGTPDKFFFP--VTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFD  507
                A  T D+         A   W +     F +   A +ADI      GDHGDG+ FD
Sbjct  168  ITDTAATTIDRATLSRVFARAFARWSAATTLNFTETASARDADITIGFHAGDHGDGEAFD  227

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN-----GLDIQSVALHEIGHLLGLDHSE  672
            GP G+ AHAF PT+G  H DA E W   G          +D++SVA+HEIGHLLGL HS 
Sbjct  228  GPLGTLAHAFSPTDGRFHLDAAEAWVAAGDVSRASSDVAVDLESVAVHEIGHLLGLGHSS  287

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             P A+MY       ++  L +DD  G+++LY
Sbjct  288  EPGAIMYPTITSRTRKVDLASDDVVGIQSLY  318



>ref|XP_004142843.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 147/267 (55%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS------SPDADYFSDQLESAIRTYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N+S        +++ F D LESAI+ YQ 
Sbjct  33   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNTSIDSHIIELNSNKFDDSLESAIKLYQK  89

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADK  327
              HLN +GILD ET  QM + RCG+ D+    S         +  HY   P   KWP  K
Sbjct  90   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYK  149

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPF  504
            R LT+ F    P  F   VT A+  W +   F F +   A +ADI  +    DH DG PF
Sbjct  150  RHLTYMFTNNFPIDFMPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLPF  209

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG   HAF PT+G  H D D+ W+  G     +++ + ALHE+GH+LGL HS  P A
Sbjct  210  DGPGGVVGHAFAPTDGRLHLDGDDTWSA-GMEVQKVNVMNAALHELGHVLGLAHSTLPQA  268

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VM+   +    +  L  DD  GL ALY
Sbjct  269  VMWPYIDSNALKN-LNDDDIAGLHALY  294



>ref|XP_010264870.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=318

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/280 (41%), Positives = 151/280 (54%), Gaps = 32/280 (11%)
 Frame = +1

Query  4    QGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNST  183
            +G  KGDRVKGL  +K+YL+ FGY++  + +    D       LESAI+TYQ  ++L  T
Sbjct  42   EGCHKGDRVKGLNQVKRYLQRFGYLDHHNDDDDDFDH-----HLESAIKTYQLNYNLKET  96

Query  184  GILDAETARQMMKPRCGVADIINGTS--------------------GGAGVVPHYRFLPG  303
            G LD  T +QMM PRCGV DII G +                       G   HY F   
Sbjct  97   GSLDVATVKQMMLPRCGVPDIIKGETWMRSGKEKKEKRLLGVSGRKTTLGFSSHYTFFNN  156

Query  304  EP--KWPADKRRLTFGFAPGTP--DKFFFPVT-TALRNWESVGPFIFYKFR-YANADIKF  465
             P  KWP  K  L +      P  D    P+   A   W +V  F F + +  ++ADI+F
Sbjct  157  TPTPKWPPYKMHLKYVLDSTVPVDDLLMHPLCYVAFARWAAVSNFTFEETQDLSSADIRF  216

Query  466  TLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIG  645
            + F+GDHGDG PFDGPGG  AHA+ P +G  HFD++E W   G   + +D  SVA+HEIG
Sbjct  217  SFFKGDHGDGNPFDGPGGVLAHAYAPIDGRVHFDSEERWTT-GIRADWIDTASVAMHEIG  275

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS    AVM+   + G ++  L  DD  G+++LY
Sbjct  276  HLLGLGHSSEHGAVMFPYIDVGSQKVNLHPDDIQGIQSLY  315



>ref|NP_176205.1| Matrixin family protein [Arabidopsis thaliana]
 gb|AAD14473.1| Strong similarity to gi|2829864 F3I6.6 zinc metalloproteinase 
homolog from Arabidopsis thaliana BAC gb|AC002396. EST gb|Z26412 
comes from this gene [Arabidopsis thaliana]
 dbj|BAD44472.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ABF19013.1| At1g59970 [Arabidopsis thaliana]
 gb|AEE33645.1| Matrixin family protein [Arabidopsis thaliana]
Length=360

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/271 (41%), Positives = 144/271 (53%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+ + GL  LK+Y + FGYI      ++    D F D L+SAI TYQ   +L  
Sbjct  48   LAGCHIGENINGLSKLKQYFRRFGYIT-----TTGNCTDDFDDVLQSAINTYQKNFNLKV  102

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LD+ T RQ++KPRCG  D+I+G S   G         Y F PG+P+WP  KR LT+ 
Sbjct  103  TGKLDSSTLRQIVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYA  162

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            FAP     D+     + A   W  V P  F +      ADI    F G+HGDG+PFDG  
Sbjct  163  FAPQNNLTDEVKRVFSRAFTRWAEVTPLNFTRSESILRADIVIGFFSGEHGDGEPFDGAM  222

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D DE+W            P    +D++SVA+HEIGHLLGL HS 
Sbjct  223  GTLAHASSPPTGMLHLDGDEDWLISNGEISRRILPVTTVVDLESVAVHEIGHLLGLGHSS  282

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+M+     G+++  L  DD  G++ LY
Sbjct  283  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  313



>ref|XP_004965107.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=321

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 144/271 (53%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +G+  LK YL  FGY+ +     SS   D F   LE AI+ YQ    LN 
Sbjct  53   LTGCHFGEEQQGVAKLKDYLAHFGYLPE-----SSGFTDIFDADLEEAIKVYQRNFGLNI  107

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAGVVPH----YRFLPGEPKWPADKRRLTFG  345
            TG++DA T  QMM PRCGVAD+INGTS  GA    H    Y + PG P WP  K+RLT+ 
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNLYSYFPGSPSWPRSKKRLTYA  167

Query  346  F---APGTPDKFFFP--VTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFD  507
                A  T D+         A   W +     F +   A +ADI      GDHGDG+ FD
Sbjct  168  ITDTAATTIDRATLSRVFARAFARWSAATTLNFTETASARDADITIGFHAGDHGDGEAFD  227

Query  508  GPGGSYAHAFPPTNGNCHFDADENWAEFGPPHN-----GLDIQSVALHEIGHLLGLDHSE  672
            GP G+ AHAF PT+G  H DA E W   G           D++SVA+HEIGHLLGL HS 
Sbjct  228  GPLGTLAHAFAPTDGRFHLDAAEAWVAAGDVSRASSDVAYDLESVAVHEIGHLLGLGHSS  287

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             P A+MY       ++  L +DD  G+++LY
Sbjct  288  EPGAIMYPSITPRTRKVDLASDDVVGIQSLY  318



>gb|KCW49213.1| hypothetical protein EUGRSUZ_K02793, partial [Eucalyptus grandis]
Length=236

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 147/267 (55%), Gaps = 42/267 (16%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-----PDADYFSDQLESAIRTYQTR  165
            LQG  KGD   G+  LK+YL+ FGY+N   YN S       D D F D LE A++TYQ  
Sbjct  2    LQGCHKGDHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  58

Query  166  HHLNSTGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFG  345
            +HLN TG LD +T  +MM+P                           P+WPA    LT+G
Sbjct  59   YHLNVTGTLDPQTTSKMMRP---------------------------PRWPASNYHLTYG  91

Query  346  FAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDG--KPFDGPG  516
            F PGTP+    PV  A   W SV  F F Y   +  A+I+    RGDHGDG    FDGPG
Sbjct  92   FLPGTPEAATAPVARAFAKWTSVTRFTFSYVQDHQFANIQIGFARGDHGDGAHNSFDGPG  151

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHN--GLDIQSVALHEIGHLLGLDHSENPDAVM  690
            G+ AHAFPPT+G  H+DADE WA   PP      ++++VALHEIGHLLGL HS+   A+M
Sbjct  152  GTLAHAFPPTSGLFHYDADEKWA-VDPPSGSAAFNVETVALHEIGHLLGLGHSDVEAAIM  210

Query  691  YYRFEYGEKRRVLTTDDKNGLKALYNF  771
            Y     G  +  L  DD  G+KALYNF
Sbjct  211  YSSIAPGTTKG-LHADDIQGIKALYNF  236



>ref|XP_010552627.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=376

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 149/279 (53%), Gaps = 29/279 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G + GD+V GLY LK+Y + FGYI +   N S    D F D L  AI  YQ    LN +G
Sbjct  51   GCRSGDKVDGLYKLKQYFQRFGYIPE---NFSGNFTDDFDDILRHAIEMYQRNFRLNVSG  107

Query  187  ILDAETARQMMKPRCGVADIINGTSGGAG-----------------VVPHYRFLPGEPKW  315
             LD  T R ++ PRCG  DI+NG+S   G                  +  Y   PGEP+W
Sbjct  108  ELDELTVRHLVIPRCGNPDIVNGSSAMHGGKKYEVNFAGRRGQRFHALKRYSLFPGEPRW  167

Query  316  PADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDH  486
            P D+R+LT+ F P     ++       A   W +V    F +   + ++DI    + GDH
Sbjct  168  PEDRRQLTYAFDPRNALTEEVKGVFGRAFARWAAVTKLTFTRVETFPDSDITIGFYTGDH  227

Query  487  GDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG------PPHNGLDIQSVALHEIGH  648
            GDG+PFDG  G+ AHAF P +G  H D+DENW   G         + +D++SVA+HEIGH
Sbjct  228  GDGEPFDGVLGTLAHAFSPPSGRFHLDSDENWVVSGDVGGILSMTSAVDLESVAVHEIGH  287

Query  649  LLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            LLGL HS   D++MY     G ++  LT DD +G++ LY
Sbjct  288  LLGLGHSTIEDSIMYPTISTGRRKVELTRDDIDGIQYLY  326



>emb|CBI34986.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 152/268 (57%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSP--DADYFSDQLESAIRTYQTRHHL  174
            LQGSKKGD+V+G++ ++ YL+ FGY++     + S     D+F D LESAI+ +QT +HL
Sbjct  39   LQGSKKGDKVEGIHKVRNYLQRFGYLSSTHSKTESQVDGDDHFDDDLESAIQAFQTYYHL  98

Query  175  NSTGILDAETARQMMKPRCGVAD---IINGTSGGA----GVVPHYRFLPGEPKWPADKRR  333
              TGILDA TA  M +PRCGV D   + N T+        +  H+ F P  P+WP  +  
Sbjct  99   KPTGILDAPTAALMSRPRCGVPDNPSVTNNTNSHGHSHLNIGTHFAFFPNNPRWPPGQTH  158

Query  334  LTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR---YANADIKFTLFRGDHGDGKPF  504
            L +    G+  +    V  A   W ++  F F +      AN +I F +   +HGDG PF
Sbjct  159  LLYVLDSGSHSEAADAVGKAFGAWAAISKFTFEQTSDPTVANLNISFQI--REHGDGSPF  216

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG+ AHA PPT+G  HFD DE W   G   N +D+Q+VA HEIGHLLGL HS    A
Sbjct  217  DGPGGTIAHAAPPTDGRFHFDGDETWV-VGAVANSIDLQTVATHEIGHLLGLAHSSVEAA  275

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            +M+     G  +  L  DD  G+ ALY 
Sbjct  276  IMFAYIAPGATKG-LNQDDIAGITALYT  302



>ref|XP_002533939.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28446.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=226

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 133/224 (59%), Gaps = 18/224 (8%)
 Frame = +1

Query  142  AIRTYQTRHHLNSTGILDAETARQMMKPRCGVADII--NGTSGGAG--------VVPHYR  291
            AIR YQ  +HL  TGILD  T  QMMKPRCG+ D++  NGT   +          + HY+
Sbjct  2    AIRNYQHNYHLKDTGILDNYTVSQMMKPRCGMPDVVTNNGTKHQSHNRKLMSIHSLVHYK  61

Query  292  FLPGEPKWPADKRRLTFGF-----APGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANA  453
            F  GEP+WPA++  L + F      PGT +        A + W  V  F F +    A A
Sbjct  62   FFHGEPRWPAERTHLRYRFRSSTQVPGTQN-IGSICARAFQKWAEVTHFTFEEVASNAQA  120

Query  454  DIKFTLFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVAL  633
            +I+    R  HGDG PFDG  G+ AHA  PT G  HFD DENW+E  P  N +D++SVA+
Sbjct  121  EIEIGFHRRSHGDGHPFDGRSGTLAHATAPTGGMFHFDGDENWSE-NPEANEVDLESVAV  179

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS++P+AVMY  F YG  +R L +DD  G++ALY
Sbjct  180  HEIGHLLGLHHSDDPNAVMYATFRYGITKRDLDSDDVQGIRALY  223



>ref|XP_007223246.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
 gb|EMJ24445.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
Length=377

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 146/269 (54%), Gaps = 24/269 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDA  198
            GD+V+GL  LKKY   FGYI +L  N +    D F D L+SA++TYQ   +LN TG LD 
Sbjct  62   GDKVEGLSKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  117

Query  199  ETARQMMKPRCGVADIINGTS------------GGAGVVPHYRFLPGEPKWPADKRRLTF  342
             T + ++K RCG  DI+NGT+                 V HY   PG P WP  +R LT+
Sbjct  118  RTIQHLVKRRCGNPDIVNGTTTMNSGKPTSSNTSNLHTVAHYSTFPGTPVWPPSRRDLTY  177

Query  343  GFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGP  513
             F P     D        A + W +  P  F +   +  ADIK   F GDHGDG+PFDG 
Sbjct  178  AFLPENKLADDVKAVFLRAFQRWSAATPLNFSETTSFYTADIKIGFFSGDHGDGEPFDGV  237

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSENP  678
             G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLLGL HS   
Sbjct  238  LGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGHSSVE  297

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +A+M+       K+  L +DD  G+++LY
Sbjct  298  EAIMFPTISSRTKKVELASDDVLGIQSLY  326



>emb|CDY11609.1| BnaC06g31300D [Brassica napus]
Length=373

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/277 (40%), Positives = 146/277 (53%), Gaps = 24/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYSGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWPAD  324
            TG LDA T + ++ PRCG  D++NGTS                 V HY   PGEP+WP D
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  325  KRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            +R LT+ F P  P  D+       A   W  V    F     +  +DI    + GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIGHLLG  657
            +PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYN  768
            L HS   +++MY     G+++  LT+DD  G++ LY+
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLYD  320



>ref|XP_004142468.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159089.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52406.1| hypothetical protein Csa_5G631560 [Cucumis sativus]
Length=295

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 147/267 (55%), Gaps = 17/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSP------DADYFSDQLESAIRTYQT  162
            L G +K D V+G++++KKYL+ +GY   LS+N+S+       +++ F D LESAIR YQ 
Sbjct  33   LYGCRKDDNVEGIHSIKKYLQRYGY---LSHNTSTDSNIIELNSNKFDDSLESAIRLYQK  89

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTSG-----GAGVVPHYRFLPGEPKWPADK  327
              HLN +GI+D ET  QM +PRCGV D+    S         +  HY   P   KWP  K
Sbjct  90   WSHLNVSGIIDQETLDQMFQPRCGVPDVFKFNSSKNLEDDLEMSSHYALFPNNEKWPDYK  149

Query  328  RRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPF  504
            R LT+ F    P  F   +T A+  W +   F F +   A +ADI  +    DH DG  F
Sbjct  150  RHLTYMFTNNFPIDFVPSMTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGFAF  209

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDA  684
            DGPGG   HAF PT+G  H D D+ W+  G     +++ + ALHE+GH+LGL HS  P A
Sbjct  210  DGPGGVVGHAFAPTDGRLHLDGDDTWSA-GLEEKKVNVMNAALHELGHVLGLAHSTLPQA  268

Query  685  VMYYRFEYGEKRRVLTTDDKNGLKALY  765
            VM+   E    +  L  DD  G+ ALY
Sbjct  269  VMWPYIESNALKN-LNDDDIAGIHALY  294



>ref|XP_008458912.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 152/270 (56%), Gaps = 22/270 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ + N+ S DA  F D LESAI++YQ    + 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENENNLSTDA--FDDDLESAIKSYQKFSKIK  97

Query  178  STGILDAETARQMMKPRCGVADII-------------NGTSGGAGVVPHYRFLPGEPKWP  318
             +G+LD ET +QM  PRCGV D               N   GG+    HY F     KWP
Sbjct  98   VSGVLDRETLQQMSTPRCGVRDTFVSVAQQEHENKSTNIEIGGS----HYTFYYNNVKWP  153

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDG  495
            A+K+ L++GF    P +    V  A + WE    F F+   R   ADI  +  RG+HGD 
Sbjct  154  AEKKHLSYGFIHNFPPQHVPTVLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGEHGDD  213

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
            +PFDGPGG  AH+    +G  HFDADE W E GP     D++++ALHE+GH LGL HS +
Sbjct  214  EPFDGPGGILAHSLGAVDGRVHFDADEQW-EGGPVEKRYDLETLALHELGHALGLGHSSS  272

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              AVM+     G  +  LT DD  G++ALY
Sbjct  273  SLAVMWAYMYAGFPKTRLTIDDIEGIRALY  302



>ref|XP_010043822.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=499

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 149/277 (54%), Gaps = 28/277 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G+R  GL NLKKY + FGYI +   N +    D F D L SAI+TYQ   +L  
Sbjct  180  FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  235

Query  181  TGILDAETARQMMKPRCGVADIINGT----SGGAG--------VVPHYRFLPGEPKWPAD  324
            TG LD  T  Q+++PRCG  DI+NG+    SG A          V HY F PG P+WP  
Sbjct  236  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  295

Query  325  KRRLTFGFAPGTP----DKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHG  489
            K  LT+ F P       +K  F  + A + W +V P  F     Y  ADIK   F GDHG
Sbjct  296  KSDLTYAFLPANQLSDDEKAVF--SRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHG  353

Query  490  DGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLL  654
            DG+ FDG  G+ AHAF P +G  H D DENW   G        + +D++SVA+HEIGHLL
Sbjct  354  DGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHLL  413

Query  655  GLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            GL HS   +++MY       K+  L TDD  G++ LY
Sbjct  414  GLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  450



>ref|XP_008458914.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 149/270 (55%), Gaps = 22/270 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY N+ + N+ S DA  F D+LESAI+ YQ   +L 
Sbjct  40   LIGSSKNDNIVEGIHKVKAYLQRYGYFNNENDNNLSTDA--FDDRLESAIKLYQKFSNLK  97

Query  178  STGILDAETARQMMKPRCGVADII-------------NGTSGGAGVVPHYRFLPGEPKWP  318
             +G+LD ET +QM KPRCGV D               N   GG+     Y F      WP
Sbjct  98   VSGVLDRETLQQMSKPRCGVRDTFASIAQQEHENKNTNIEIGGS----RYTFFFNNVSWP  153

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDG  495
            A+++ L++GF    P +F  P+  A + WE    F F+   R   ADI  +  RG HGD 
Sbjct  154  AERKHLSYGFIHNYPPQFVDPLLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGAHGDY  213

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
            + FDG GG  AH+    +G  HFDADE W    P    +D++SVALHE+GH LGL HS  
Sbjct  214  QAFDGEGGILAHSLGAIDGRVHFDADEAWERI-PIEQRVDLESVALHELGHTLGLGHSSE  272

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              AVM+   E G  +  LT DD  G++ALY
Sbjct  273  ISAVMFAYMEPGLYKTRLTIDDIEGIRALY  302



>emb|CDY38799.1| BnaA07g28710D [Brassica napus]
Length=370

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 145/276 (53%), Gaps = 24/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYSGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWPAD  324
            TG LDA T + ++ PRCG  D++NGTS                 V HY   PGEP+WP D
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  325  KRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            +R LT+ F P  P  D+       A   W  V    F     +  +DI    + GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIGHLLG  657
            +PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +++MY     G+++  LT+DD  G++ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>gb|KFK41437.1| hypothetical protein AALP_AA2G130300 [Arabis alpina]
Length=380

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 148/284 (52%), Gaps = 32/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GLY LKKY + FGYI +     S    D F D L++A+  YQ    L+ 
Sbjct  47   FTGCHHGQTVDGLYRLKKYFQRFGYIPE---TFSGNFTDDFDDVLKTAVELYQKNFQLDV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAG----VVPHYRFLP  300
            TG LDA T + M+ PRCG  D++NGTS                GG G       HY   P
Sbjct  104  TGELDALTIKHMVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSPGGRGPRLHTFKHYTLFP  163

Query  301  GEPKWPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTL  471
            GEP+WP ++R LT+ F P  P  ++     + A + W  V    F     +  +DI    
Sbjct  164  GEPRWPRNRRDLTYAFDPRNPLTEEVKGVFSRAFQRWSDVTALNFTLIDSFTRSDITIGF  223

Query  472  FRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVAL  633
            + GDHGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+
Sbjct  224  YSGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS   D++MY     G+++  LT DD  G++ LY
Sbjct  284  HEIGHLLGLGHSSVEDSIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>gb|AES96374.2| matrix metalloproteinase [Medicago truncatula]
Length=368

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/274 (41%), Positives = 142/274 (52%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G  +G    GL  LK Y   FGYI +      S   D F + LESA+RTYQ   +LN 
Sbjct  55   FTGCSRGKTYDGLSKLKNYFNHFGYIPN---GPPSNFTDDFDEALESAVRTYQKNFNLNI  111

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----------VVPHYRFLPGEPKWPADK  327
            TG LD  T   ++KPRCGVADIINGT+                V HY F PG+P+WP   
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  328  RRLTFGFAPG--TPDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHGDGK  498
            + LT+ F P     D        A   W  V    F +   Y+++DIK   + GDHGDG+
Sbjct  172  QTLTYAFDPSENLDDATKQVFANAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDHGDGE  231

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLD  663
             FDG  G+ AHAF PT+G  H D  E+W   G        N +D++SV +HEIGHLLGL 
Sbjct  232  AFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGHLLGLG  291

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HS   +A+MY       K+  L +DD  G++ LY
Sbjct  292  HSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>emb|CDY23516.1| BnaC06g24850D [Brassica napus]
Length=373

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 146/276 (53%), Gaps = 24/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI      + + D   F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPQTYTGNFTDD---FDDILKAAVELYQKNFGLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------GG----AGVVPHYRFLPGEPKWPAD  324
            TG LDA T + ++ PRCG  D++NGTS        GG       V HY   PGEP+WP D
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  325  KRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            +R LT+ F P  P  D+       A   W  V    F     +  +DI    + GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIGHLLG  657
            +PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +++MY     G+++  LT DD  G++ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>ref|XP_006357274.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=338

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/266 (41%), Positives = 142/266 (53%), Gaps = 17/266 (6%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD-ADYFSDQLESAIRTYQTRHHLNST  183
            G + G ++KGL  +K+Y K FGYI+    NS S D  D F   L SA++TYQ   +LN T
Sbjct  60   GCRVGQKIKGLAKIKQYFKHFGYID----NSLSNDFTDEFDQLLFSALKTYQLNFNLNIT  115

Query  184  GILDAETARQMMKPRCGVADIINGTSGGAG-------VVPHYRFLPGEPKWPADKRRLTF  342
            G  D  T + M+KPRCG  DI+NGT+            V H+ F  G+P+WP+ K +L +
Sbjct  116  GEFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKY  175

Query  343  GFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGP  513
             F P     D        A   W  V P  F +   Y   DI+   F  DHGDG PFDGP
Sbjct  176  AFLPENQLTDSVKVAFRRAFDKWSKVTPLTFKEMDSYRLVDIRIRFFVRDHGDGNPFDGP  235

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGP--PHNGLDIQSVALHEIGHLLGLDHSENPDAV  687
                AHAF P     H D +ENW   G       +D++SVA+HEIGHLLGLDH    +A+
Sbjct  236  MKILAHAFAPPTRFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIGHLLGLDHLSEKEAI  295

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            M+   E G ++  L+ DD  G++ LY
Sbjct  296  MFPTIEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_010913461.1| PREDICTED: metalloendoproteinase 1-like [Elaeis guineensis]
Length=366

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 150/273 (55%), Gaps = 27/273 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G  +GD   GL +LK YL  FGY+   ++       D F + LE A++TYQ    LN+
Sbjct  53   LSGCHRGDNRTGLADLKDYLSRFGYLPTANFT------DAFDEALEEALKTYQQNFGLNA  106

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG-AGVVPH---YRFLPGEPKWPADKRRLTFGF  348
            TG LD  T  Q++ PRCGVADIINGTS   +  +P    Y + PG P WP+ KR LT+  
Sbjct  107  TGSLDDSTVSQLIIPRCGVADIINGTSSMRSAKLPGRNLYAYFPGSPTWPSWKRDLTYAL  166

Query  349  APGTPDKFFFPVTTALRN--------WESVGPFIFYKF-RYANADIKFTLFRGDHGDGKP  501
               +        T+ALR         W +     F +    ++ADI+   + GDHGDG+P
Sbjct  167  VSTSAVSI---DTSALRTVFARAFGRWAAATTLTFTESDSVSDADIQIGFYSGDHGDGEP  223

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDH  666
            FDG  G+ AHAF PT+G  H DA E W   G       +  +D++SVA+HEIGHLLGL H
Sbjct  224  FDGVLGTLAHAFSPTDGRFHLDAAEQWVADGDVTQASSNVAVDLESVAVHEIGHLLGLGH  283

Query  667  SENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            S   +A+MY   +   K+  L +DD  G++ LY
Sbjct  284  SSVEEAIMYPTIKTKTKKVELASDDVEGIQNLY  316



>ref|XP_010553642.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=375

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 147/284 (52%), Gaps = 32/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GDRV GL  LK+Y + FGYI   +  + + D   F D LESAIR YQ    L  
Sbjct  47   LAGCHAGDRVSGLSKLKQYFRRFGYITTAATGNFTDD---FDDVLESAIRIYQKNFDLKV  103

Query  181  TGILDAETARQMMKPRCGVADIING---------------TSGGAGV--VPHYRFLPGEP  309
            TG LDA T RQ++ PRCG +D+I+G               T+G A +     Y F PG+P
Sbjct  104  TGELDAATLRQIVLPRCGNSDVIDGSSDMNAGKGFQKTAMTAGAARIRTTKRYSFFPGKP  163

Query  310  KWPADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRG  480
            +WPA KR L + F P     +      + A   W +V P  F +      ADI    F G
Sbjct  164  RWPARKRDLIYAFVPQNNLTEDVKRVFSRAFDRWANVTPLRFTRSGSLLRADIVIGFFSG  223

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA---------EFGPPHNGLDIQSVAL  633
            DHGDG+PFDG  G+ AHA  P  G  H D DE+W                + +D++SVA+
Sbjct  224  DHGDGEPFDGAMGTLAHASSPPTGMFHLDGDEDWLISDGGGENRRILSVTSLVDLESVAV  283

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS   DA+MY     G+++  L  DD  G++ LY
Sbjct  284  HEIGHLLGLGHSSVKDAIMYPTIAGGDRKVELAKDDIEGIQHLY  327



>ref|XP_003613416.1| Matrix metalloproteinase-9 [Medicago truncatula]
Length=393

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 142/272 (52%), Gaps = 22/272 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G  +G    GL  LK Y   FGYI +      S   D F + LESA+RTYQ   +LN TG
Sbjct  57   GCSRGKTYDGLSKLKNYFNHFGYIPN---GPPSNFTDDFDEALESAVRTYQKNFNLNITG  113

Query  187  ILDAETARQMMKPRCGVADIINGTSGGAG-----------VVPHYRFLPGEPKWPADKRR  333
             LD  T   ++KPRCGVADIINGT+                V HY F PG+P+WP   + 
Sbjct  114  ELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGTQT  173

Query  334  LTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYK-FRYANADIKFTLFRGDHGDGKPF  504
            LT+ F P     D        A   W  V    F +   Y+++DIK   + GDHGDG+ F
Sbjct  174  LTYAFDPSENLDDATKQVFANAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDHGDGEAF  233

Query  505  DGPGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHS  669
            DG  G+ AHAF PT+G  H D  E+W   G        N +D++SV +HEIGHLLGL HS
Sbjct  234  DGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGHLLGLGHS  293

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               +A+MY       K+  L +DD  G++ LY
Sbjct  294  SIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_002318762.2| MATRIX METALLOproteinASE [Populus trichocarpa]
 gb|EEE96982.2| MATRIX METALLOproteinASE [Populus trichocarpa]
Length=373

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 112/275 (41%), Positives = 145/275 (53%), Gaps = 26/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G++  GL  LK Y + FGYI     NS S   D F D LESA+RTYQ   +LN 
Sbjct  58   LSGCHAGEKYDGLAKLKSYFQYFGYIP----NSLSNFTDDFDDSLESALRTYQQNFNLNI  113

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG------------AGVVPHYRFLPGEPKWPAD  324
            TG LD +T   +++PRCG  DI+NG+S                 V HY F  G P+W   
Sbjct  114  TGQLDDQTVNHIVRPRCGNPDIVNGSSSMNSGKTHNTSSSHVHTVSHYSFFTGMPRW--R  171

Query  325  KRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDG  495
            K+ LT+ F PG    D+     + A   W +V P  F +    N ADI    + GDHGDG
Sbjct  172  KQALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIPLTFTQADSINAADIGIGFYSGDHGDG  231

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVALHEIGHLLGL  660
            +PFDG  G+ AH+F P +G  H D DENW   G          +D++SVA+HEIGHLLGL
Sbjct  232  EPFDGVLGTLAHSFSPPSGQFHLDGDENWVVTGDVRTSSLTTAVDLESVAVHEIGHLLGL  291

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS   +++MY       K+  L  DD  G++ LY
Sbjct  292  GHSSVEESIMYPTISSRTKKVELADDDIQGIQVLY  326



>gb|KCW56124.1| hypothetical protein EUGRSUZ_I01878 [Eucalyptus grandis]
Length=294

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 147/269 (55%), Gaps = 15/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G  KG   +G+  +K+YL+ FGY   +   N  +   D F + LESA+++YQ  +HL 
Sbjct  25   LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  84

Query  178  STGILDAETARQMMKPRCGVADII-------NGTS-GGAGVVPHYRFLPGEPKWPADKRR  333
             TG LDA+T  QM  PRCGV D +       N T      +V  Y F P +P+WP  K  
Sbjct  85   VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  144

Query  334  LTFGFAP---GTPDKFFFPVTT-ALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGK  498
            L + F P     P +    V + A + W  V  F F +       D+    +RGDHGDG 
Sbjct  145  LNYAFGPVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGDGY  204

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPG   AH+F PT+G  H+D +E W+   P     D++SV LHEIGHLLGL H+ + 
Sbjct  205  PFDGPGKILAHSFSPTDGRFHYDVEEQWST-NPSSTQFDLESVTLHEIGHLLGLAHTPDQ  263

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +AVM+     G ++R L  DD +G+ ALY
Sbjct  264  NAVMFATISPGAQKRDLRQDDIDGIHALY  292



>dbj|BAE98757.1| predicted GPI-anchored protein [Arabidopsis thaliana]
Length=378

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 148/280 (53%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQT  +LN 
Sbjct  47   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG----------------VVPHYRFLPGEPK  312
            TG LDA T + ++ PRCG  D++NGTS   G                 V  Y   PGEP+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGD  483
            WP ++R LT+ F P  P  ++     + A   W  V    F     ++ +DI    + GD
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIG  645
            HGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS   +++MY     G+++  LT DD  G++ LY
Sbjct  284  HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|XP_009105693.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=378

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 148/284 (52%), Gaps = 32/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +    + + D   F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPETYTGNFTDD---FDDILKNAVELYQKNFRLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------------GGAGVVP------HYRFLP  300
            TG LDA T + ++ PRCG  D++NGTS                 G VP      HY   P
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVNFSPGGKVPRLHTVKHYTLFP  163

Query  301  GEPKWPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTL  471
            GEP+WP D+R LT+ F P  P  D+       A   W  V    F     +  +DI    
Sbjct  164  GEPRWPRDRRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGF  223

Query  472  FRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVAL  633
            + GDHGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS   +++MY     G+++  LT+DD  G++ LY
Sbjct  284  HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  327



>ref|XP_008389591.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=387

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 146/269 (54%), Gaps = 23/269 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L    ++   D F D LE+A++TYQ   +LN TG LD 
Sbjct  60   GEKVDGLGKLKKYFNRFGYIPNLP---TANLTDEFDDDLEAALKTYQKNFNLNVTGELDG  116

Query  199  ETARQMMKPRCGVADIINGTSGGAG------------VVPHYRFLPGEPKWPADKRRLTF  342
             T   ++KPRCG  DI+NGT+                 V HY F PG P WP ++R LT+
Sbjct  117  PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYSFFPGTPVWPENRRDLTY  176

Query  343  GFAPGT--PDKFFFPVTTALRNW-ESVGPFIFYKFRYANADIKFTLFRGDHGDGKPFDGP  513
             F       D        A + W E+          + +ADIK   F+GDHGDG+PFDG 
Sbjct  177  AFVSENELSDTVKAVFVGAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEPFDGV  236

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSENP  678
             G+ AHAF P +G  H DA+ENW   G        + +D++SVA+HEIGHLLGL HS   
Sbjct  237  LGTLAHAFSPPSGRFHLDAEENWVITGDISKTSVTSAVDLESVAVHEIGHLLGLGHSSVE  296

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +A+MY       K+  L  DD  G+++LY
Sbjct  297  EAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_010030761.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=311

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 147/269 (55%), Gaps = 15/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+G  KG   +G+  +K+YL+ FGY   +   N  +   D F + LESA+++YQ  +HL 
Sbjct  42   LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  101

Query  178  STGILDAETARQMMKPRCGVADII-------NGTS-GGAGVVPHYRFLPGEPKWPADKRR  333
             TG LDA+T  QM  PRCGV D +       N T      +V  Y F P +P+WP  K  
Sbjct  102  VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  161

Query  334  LTFGFAP---GTPDKFFFPVTT-ALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGK  498
            L + F P     P +    V + A + W  V  F F +       D+    +RGDHGDG 
Sbjct  162  LNYAFGPVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGDGY  221

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENP  678
            PFDGPG   AH+F PT+G  H+D +E W+   P     D++SV LHEIGHLLGL H+ + 
Sbjct  222  PFDGPGKILAHSFSPTDGRFHYDVEEQWST-NPSSTQFDLESVTLHEIGHLLGLAHTPDQ  280

Query  679  DAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +AVM+     G ++R L  DD +G+ ALY
Sbjct  281  NAVMFATISPGAQKRDLRQDDIDGIHALY  309



>ref|XP_006304956.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
 gb|EOA37854.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
Length=381

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 152/282 (54%), Gaps = 30/282 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G++  GLY LK+Y + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  49   FTGCHAGNKYDGLYKLKQYFQHFGYIPE---TFSGNFTDDFDDILKNAVEMYQRNFRLNV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTS-------------GGAG----VVPHYRFLPGEP  309
            TG+LD  T +Q++ PRCG  D++NGTS              G G     V  Y F PGEP
Sbjct  106  TGVLDELTLKQVVIPRCGNPDVVNGTSTMHSGRRTYEVSFSGGGQRFHAVKRYSFFPGEP  165

Query  310  KWPADKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRG  480
            +WP  +R LT+ F P     ++     + A   W  V P  F +   ++N+DI    + G
Sbjct  166  RWPRHRRDLTYAFNPRNMLTEEVKTVFSRAFARWAEVTPLTFTRVESFSNSDIFIGFYSG  225

Query  481  DHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNG-------LDIQSVALHE  639
            +HGDG+PFDGP  + AHAF P  G+ H D +ENW   G   +G       +D++SVA+HE
Sbjct  226  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDREENWIISGEGGDGVISVPEAVDLESVAVHE  285

Query  640  IGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            IGHLLGL HS    ++MY     G+++  LTTDD  G++ LY
Sbjct  286  IGHLLGLGHSSVEGSIMYPTIMTGKRKVDLTTDDVEGVQYLY  327



>ref|XP_006603838.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
 gb|KHN16354.1| Metalloendoproteinase 1 [Glycine soja]
Length=328

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 155/290 (53%), Gaps = 38/290 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L+   KG RV+G+  LK YLK FGY   L+ N +S + ++F   +E A++ YQ  HHL  
Sbjct  42   LKDINKGQRVRGVGELKSYLKKFGY---LTTNDNSSNNNHFDKNVEFALKEYQVFHHLRP  98

Query  181  TGILDAETARQMMKPRCGVADII---NGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFA  351
            TG +DAET ++M  PRCGV DII   N    G  ++ +Y F  G PKW   KR LT+ F 
Sbjct  99   TGRVDAETIKRMGLPRCGVPDIITPQNHKLKGLVILANYSFFSGSPKWEESKRALTYTFV  158

Query  352  PGTPDKFFFPVTTALRN----WESVGPFIFYKF--RYAN-ADIKFTLFRGDHGDGKPFDG  510
                    + V  A RN    W     F F +    Y N A+I     RGDHGDG PFDG
Sbjct  159  SSANVLRMYDVRLATRNAFQSWARASNFTFMEMPSEYNNLANIVLGFHRGDHGDGYPFDG  218

Query  511  PGGSYAHAFPPTNGNCHFDADENWA------EFGPPHN-----------------GLDIQ  621
            PG   AH F P +G  HFDADE W+        GP  N                  +D+Q
Sbjct  219  PGQVLAHTFAPQDGRLHFDADEPWSIESTSWNVGPGWNVGWDWRRWVRPRWQSRRTIDLQ  278

Query  622  SVALHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
            +VALHEIGHLLGL HS  P ++MY  +E G KR  LT DD +G++ALY  
Sbjct  279  TVALHEIGHLLGLGHSNVPGSIMYPSYE-GVKRD-LTQDDVDGIRALYRL  326



>ref|NP_177174.1| matrix metalloproteinase [Arabidopsis thaliana]
 gb|AAB61099.1| Similar to Glycine metalloendoproteinase (gb|U63725) [Arabidopsis 
thaliana]
 gb|AEE35027.1| matrix metalloproteinase [Arabidopsis thaliana]
Length=378

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 148/280 (53%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQT  +LN 
Sbjct  47   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG----------------VVPHYRFLPGEPK  312
            TG LDA T + ++ PRCG  D++NGTS   G                 V  Y   PGEP+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGD  483
            WP ++R LT+ F P  P  ++     + A   W  V    F     ++ +DI    + GD
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIG  645
            HGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS   +++MY     G+++  LT DD  G++ LY
Sbjct  284  HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|XP_009113266.1| PREDICTED: metalloendoproteinase 1 [Brassica rapa]
Length=394

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 144/272 (53%), Gaps = 21/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI TYQ   +L  
Sbjct  90   LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAISTYQKNFNLKV  145

Query  181  TGILDAETARQMMKPRCGVADIINGTSG--GAG----VVPHYRFLPGEPKWPADKRRLTF  342
            TG LDA T  Q++KPRCG  D+I+GT+    AG     V  Y F PG+P+WP   R L++
Sbjct  146  TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSY  205

Query  343  GFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGP  513
             F P     ++       A   W  V P  F +      ADI    F GDHGDG+PFDGP
Sbjct  206  AFVPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGP  265

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFG--------PPHNGLDIQSVALHEIGHLLGLDHS  669
             G+ AHA  P  G  H D DE+W   G        P  + +D++SVA+HEIGHLLGL HS
Sbjct  266  MGTLAHASSPPTGMFHLDGDEDWLISGEDMSRQILPVTSVVDLESVAVHEIGHLLGLGHS  325

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               DA+MY     G ++  L  DD  G++ LY
Sbjct  326  SVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  357



>gb|EYU42526.1| hypothetical protein MIMGU_mgv1a011887mg [Erythranthe guttata]
Length=267

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 145/261 (56%), Gaps = 12/261 (5%)
 Frame = +1

Query  13   KKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            +KGD++KG+  LKKYL   GY+N  + S N      + F   L+ A++ YQ  ++LN TG
Sbjct  10   QKGDKIKGVVELKKYLTYLGYLNRNNCSNNQKIKSNNIFDKPLQLALKKYQKFYNLNVTG  69

Query  187  ILDAETARQMMKPRCGVADIINGTSGGAGVVPH---YRFLPGEPKWPADKRRLTFGFAPG  357
            ILD++T  +M KPRC + D  N +      +     Y FLPG+P+W   KR L + F+  
Sbjct  70   ILDSKTVAKMHKPRCAMPDFYNHSCKNVKFLTTDSLYAFLPGQPRW--KKRILKYAFSAS  127

Query  358  TPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG--GSYA  528
            TP +    +  A + W SV  F F   R +  A ++     G+HGD  PF GP   G  A
Sbjct  128  TPKEAILAIELAFKEWASVTNFKFEPTRKFDGAHVRILFLHGEHGDDLPFGGPEPIGGVA  187

Query  529  HAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEY  708
            H++PP  G  HFDA   W+  G   N  DI++V LHE+GH+LGL HS + +AVMY     
Sbjct  188  HSYPPPIGEVHFDAGLKWSNKG-ERNAFDIKTVGLHELGHILGLGHSSDANAVMYPLVHL  246

Query  709  GEKRRVLTTDDKNGLKALYNF  771
            GE ++ L  DD  G+KALY  
Sbjct  247  GETKK-LDADDIKGIKALYKL  266



>gb|KDO75343.1| hypothetical protein CISIN_1g043086mg [Citrus sinensis]
Length=257

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 138/230 (60%), Gaps = 28/230 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSP--DADYFSDQLESAIRTYQTRHHL  174
             QG++KGD VKG+  LKKYL T GY+++ ++N ++   D DYF + LESA++TYQ   +L
Sbjct  46   FQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNL  105

Query  175  NSTGILDAETARQMMKPRCGVADIINGTS----GGAGVVPHYRFLPGEPKWPADKRRLTF  342
            N TG +D +T   M KPRCGV D+INGT+    G A    HY F PG PKWPA K+ ++ 
Sbjct  106  NPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISC  165

Query  343  GFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYANADIKFTLFRGDHGDGKPFDGPG--  516
             F PGT      P                    Y  AD+K +  RGDHGDG PFDGPG  
Sbjct  166  AFLPGTRTDVQEP-------------------DYDAADVKISFQRGDHGDGYPFDGPGPY  206

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDH  666
               AH+FPPT+G  H+D DENW     P   +D+Q+VALHE+ H+LGL H
Sbjct  207  NLLAHSFPPTDGRFHYDGDENWTVGAVP-GAVDMQTVALHELRHVLGLAH  255



>ref|XP_006647869.1| PREDICTED: metalloendoproteinase 1-like [Oryza brachyantha]
Length=373

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 146/275 (53%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  53   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDALEAAIAAYQRNFGLNA  110

Query  181  TGILDAETARQMMKPRCGVADIINGTS-----GGAGVVPH---YRFLPGEPKWPADKRRL  336
            TG LD  T  QM+ PRCGVAD+INGTS       A  +     Y + PG P+WP  +R L
Sbjct  111  TGELDTTTVDQMVVPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPRWPPFRRNL  170

Query  337  TFGFAPGTPDKFFFPVTTAL-----RNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGK  498
             +     +         +A+       W +     F +   A NADI    + GDHGDG+
Sbjct  171  RYAITATSATSIDRATLSAVFARAFSRWAAATTLQFTEVASASNADITIGFYSGDHGDGE  230

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH------NGLDIQSVALHEIGHLLGL  660
             FDGP G+ AHAF PT+G  H DA E W   G           +D++SVA+HEIGHLLGL
Sbjct  231  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVANGDVSTASSFGTAVDLESVAVHEIGHLLGL  290

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS  PD++MY     G ++  L +DD +G+++LY
Sbjct  291  GHSSVPDSIMYPTIRTGSRKVELQSDDVSGIQSLY  325



>ref|XP_011002109.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=372

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 148/276 (54%), Gaps = 27/276 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G +  GL  LK Y + FGYI     NS S   D F D LESA+RTYQ   +LN 
Sbjct  55   LAGCHAGKKYDGLAKLKNYFQYFGYIP----NSLSNFTDDFDDNLESALRTYQQNFNLNV  110

Query  181  TGILDAETARQMMKPRCGVADIING-TSGGAG------------VVPHYRFLPGEPKWPA  321
            TG LD +T   +++PRCG  DIING TS  +G             V HY F  G+P+W  
Sbjct  111  TGQLDDQTVNHIVRPRCGNPDIINGSTSMNSGKTNNTSSSHHFHTVSHYSFFTGQPRWR-  169

Query  322  DKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGD  492
             K+ LT+ F P     D+     + A   W +V P  F +      ADI+   F GDHGD
Sbjct  170  -KQALTYVFLPENQLSDEVKAVFSRAFDRWSTVIPLNFSQTDSIYTADIRIAFFSGDHGD  228

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVALHEIGHLLG  657
            G+PFDG  G+ AHAF P NG  H D DE+W   G        + +D++SVA+HEIGHLLG
Sbjct  229  GEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTGDVRTSALTSAVDLESVAVHEIGHLLG  288

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +++MY       ++  L +DD  G++ LY
Sbjct  289  LGHSSVEESIMYPSISSRTRKVELASDDIEGIQTLY  324



>ref|XP_010320628.1| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=357

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 142/262 (54%), Gaps = 12/262 (5%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNSTG  186
            G + G ++KGL  +K+Y + FGYI+D   + S+   D F   L SA+++YQ   +LN TG
Sbjct  51   GCRVGQKIKGLAKIKQYFQRFGYIDD---SLSNDFTDEFDQLLLSALKSYQLNFNLNVTG  107

Query  187  ILDAETARQMMKPRCGVADIINGTSGGAG----VVPHYRFLPGEPKWPADKRRLTFGFAP  354
              D  T + M+KPRCG  DI     GG       V H+ F  G+ +WP+ K +L + F P
Sbjct  108  EFDFSTLQNMVKPRCGNPDIAKKGYGGKTPMDHTVAHFSFFEGQRRWPSSKSKLKYAFLP  167

Query  355  --GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGPGGSY  525
                 D        A   W  V P  F +   Y +ADI+   F  DHGDG PFDGP    
Sbjct  168  ENQLTDSVKLAFRRAFDKWSKVTPLTFKEMGSYRSADIRIGFFVRDHGDGNPFDGPMKVL  227

Query  526  AHAFPPTNGNCHFDADENWAEFGP--PHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYR  699
            AHAF P  G  H D +ENW   G       +D++SVA+HEIGHLLGLDHS   DAVM+  
Sbjct  228  AHAFAPPIGFFHLDGEENWMVDGEYLKEGMVDLESVAVHEIGHLLGLDHSFEKDAVMFPT  287

Query  700  FEYGEKRRVLTTDDKNGLKALY  765
             E G ++  L+ DD  G++ LY
Sbjct  288  LEDGTRKVELSRDDIEGVQMLY  309



>ref|XP_002888162.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/271 (40%), Positives = 143/271 (53%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+ + GL  LK+Y + FGYI       ++   D F D L+SAI TYQ   +L  
Sbjct  37   LAGCHIGENINGLSKLKQYFRRFGYIT-----GTNNCTDDFDDVLQSAINTYQKNFNLKV  91

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LD+ T RQ++KPRCG  D+I+G S   G         Y F PG+P+WP  KR LT+ 
Sbjct  92   TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGKKLRATERYSFFPGKPRWPKRKRDLTYA  151

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            + P     D+       A   W  V P  F +      ADI    F G+HGDG+PFDG  
Sbjct  152  YVPQNNLTDEVKRVFARAFTRWAEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  211

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D DE+W            P  + +D++SVA+HEIGHLLGL HS 
Sbjct  212  GTLAHASSPPTGMLHLDGDEDWLISDGEISRRVLPVTSVVDLESVAVHEIGHLLGLGHSS  271

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+M+     G+++  L  DD  G++ LY
Sbjct  272  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  302



>emb|CDY45157.1| BnaA09g14350D [Brassica napus]
Length=354

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/272 (42%), Positives = 144/272 (53%), Gaps = 21/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI TYQ   +L  
Sbjct  50   LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAITTYQKNFNLKV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSG--GAG----VVPHYRFLPGEPKWPADKRRLTF  342
            TG LDA T  Q++KPRCG  D+I+GT+    AG     V  Y F PG+P+WP   R L++
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKLRTVARYSFFPGKPQWPKRNRDLSY  165

Query  343  GFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGP  513
             F P     ++       A   W  V P  F +      ADI    F GDHGDG+PFDGP
Sbjct  166  AFFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGP  225

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFG--------PPHNGLDIQSVALHEIGHLLGLDHS  669
             G+ AHA  P  G  H D DE+W   G        P  + +D++SVA+HEIGHLLGL HS
Sbjct  226  MGTLAHASSPPTGMFHLDGDEDWLISGEDVSRQILPVTSVVDLESVAVHEIGHLLGLGHS  285

Query  670  ENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               DA+MY     G ++  L  DD  G++ LY
Sbjct  286  SVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  317



>emb|CDX68356.1| BnaA07g23960D [Brassica napus]
Length=373

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 147/276 (53%), Gaps = 24/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +    + + D   F D L++A+  YQ    L+ 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPETYTGNFTDD---FDDILKAAVELYQKNFRLDV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------GG----AGVVPHYRFLPGEPKWPAD  324
            TG LDA T + ++ PRCG  D++NGTS        GG       V HY   PGEP+WP D
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  325  KRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDG  495
            +R LT+ F P  P  ++       A   W  V    F     +  +DI    + GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTNEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIGHLLG  657
            +PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +++MY     G+++  LT DD  G++ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>ref|XP_009418044.1| PREDICTED: metalloendoproteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 144/266 (54%), Gaps = 16/266 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GD   GL  LK YLK FGY+   S NS+    D F D LE AI++YQ    LN+
Sbjct  47   LSGCHHGDDKPGLAGLKHYLKHFGYLPTSSMNST----DSFDDALEIAIQSYQRFFGLNA  102

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAPGT  360
            TG +D  T  Q+M PRCGVAD +NG+S   G    Y + P  P WP  +R L +     +
Sbjct  103  TGEIDEPTVDQLMAPRCGVADFVNGSSALPGR-NLYAYFPDAPTWPFWRRNLKYAITATS  161

Query  361  P---DKFFFPVT--TALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGPGGS  522
                D+         A   W S     F +    A+ADI    +RG+HGDG+PFDG  G+
Sbjct  162  DVPIDRAVLKAVFARAFGRWSSATTLTFEETDSAADADITIGFYRGEHGDGEPFDGVLGT  221

Query  523  YAHAFPPTNGNCHFDADENWAEFGPPHNG-----LDIQSVALHEIGHLLGLDHSENPDAV  687
              HAF PT+G  H DA E W   G    G     +D++SVA+HEIGHLLGL HS   DA+
Sbjct  222  LGHAFSPTDGRLHLDAAEAWVAEGDMTKGSSDVAVDLESVAVHEIGHLLGLGHSAAADAI  281

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            MY   +   ++  LTTDD  G+++LY
Sbjct  282  MYPAIKTRTRKVELTTDDVEGIQSLY  307



>dbj|BAJ94792.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92632.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 148/271 (55%), Gaps = 18/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GD   GL  LK YL  FGY+++    +SSP +D F  +LE+A+ TYQ    LN+
Sbjct  51   LSGCHMGDERDGLARLKDYLSHFGYLSEAP--TSSPFSDAFDAELEAAVATYQRNFGLNA  108

Query  181  TGILDAETARQMMKPRCGVADIINGTS------GGAGVVPH-YRFLPGEPKWPADKRRLT  339
            TG+LD  T  QM+ PRCGVAD+INGTS        AG   H Y + PG P WP  +R L 
Sbjct  109  TGVLDPPTVSQMVAPRCGVADVINGTSTMDRNASAAGHGRHLYTYFPGGPMWPPFRRELR  168

Query  340  FGF---APGTPDKFFFPVT--TALRNWESVGPFIFYK-FRYANADIKFTLFRGDHGDGKP  501
            +     A  + D+         A   W       F +    ++ADI    + G HGDG+ 
Sbjct  169  YAITATAATSIDRATLGAVFARAFARWSDATTLRFAEAASESDADITIGFYAGSHGDGEA  228

Query  502  FDGPGGSYAHAFPPTNGNCHFDADENWA---EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            FDGP G+ AHAF PT+G  H DA E W    + G     +D++SVA+HEIGHLLGL HS 
Sbjct  229  FDGPLGTLAHAFSPTDGRFHLDAAEAWVADGQGGDAPGAVDLESVAVHEIGHLLGLGHSS  288

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
               A+MY     G ++  L +DD  G+++LY
Sbjct  289  VQGAIMYPTIRTGTRKVDLESDDVQGIQSLY  319



>ref|XP_006390919.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
 gb|ESQ28205.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
Length=383

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 146/285 (51%), Gaps = 33/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL  +KKY + FGYI +     S    D F D L+SA+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLNRIKKYFQRFGYIPE---TFSGNFTDDFDDILKSAVELYQKNFRLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG---------------------VVPHYRFL  297
            TG LDA T + ++ PRCG  D++NGTS   G                      V  Y   
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSLMHGERRRKTFEVNFSPGGRRPRFHSVKRYTLF  163

Query  298  PGEPKWPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFT  468
            PGEP+WP+D+R LT+ F P  P  ++     + A   W  V    F K   ++ ADI   
Sbjct  164  PGEPRWPSDRRDLTYAFDPRNPLTEEVKSVFSRAFGRWSEVTELNFTKIESFSTADITIG  223

Query  469  LFRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVA  630
             + GDHGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA
Sbjct  224  FYTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVA  283

Query  631  LHEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            +HEIGHLLGL HS   +++MY     G ++  LT DD  G++ LY
Sbjct  284  VHEIGHLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  328



>ref|XP_002322292.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
 gb|EEF06419.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
Length=375

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 148/276 (54%), Gaps = 27/276 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G +  GL  LK Y + FGYI     NS S   D F D LESA+RTYQ   +LN 
Sbjct  58   LAGCHAGKKYDGLAKLKHYFQYFGYIP----NSLSNFTDDFDDYLESALRTYQQNFNLNV  113

Query  181  TGILDAETARQMMKPRCGVADIING-TSGGAG------------VVPHYRFLPGEPKWPA  321
            TG LD +T   +++PRCG  DIING TS  +G             V HY F  G+P+W  
Sbjct  114  TGELDDQTVNHVVRPRCGNPDIINGSTSMNSGKTNNTSSSHHLHTVSHYSFFTGQPRWR-  172

Query  322  DKRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGD  492
             K+ LT+ F+P     D+     + A   W +V P  F +      ADI+   F GDHGD
Sbjct  173  -KQALTYVFSPENQLSDEVKAVFSRAFDRWSTVIPLNFSQTDSIYTADIRIAFFSGDHGD  231

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENW-----AEFGPPHNGLDIQSVALHEIGHLLG  657
            G+PFDG  G+ AHAF P NG  H D DE+W            + +D++SVA+HEIGHLLG
Sbjct  232  GEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTDDVRTSTLTSAVDLESVAVHEIGHLLG  291

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS   +++MY       ++  L TDD  G++ LY
Sbjct  292  LGHSSVEESIMYPSISSRTRKVELATDDIEGIQTLY  327



>ref|XP_002452573.1| hypothetical protein SORBIDRAFT_04g028370 [Sorghum bicolor]
 gb|EES05549.1| hypothetical protein SORBIDRAFT_04g028370 [Sorghum bicolor]
Length=368

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 139/276 (50%), Gaps = 23/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F   LESAI TYQ    LN+
Sbjct  48   LSGCHMGEERQGLAGLKDYLSHFGYLPPPPPSSPFSDA--FDQDLESAIATYQRNFGLNA  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAGVVPH----------YRFLPGEPKWPADKR  330
            TG LDA T  QM+ PRCGVAD+INGTS  A               Y +  GEP WP  +R
Sbjct  106  TGALDASTVSQMVSPRCGVADVINGTSTMAKSSSSSADDAHGRHLYAYFAGEPTWPPFRR  165

Query  331  RLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRY------ANADIKFTLFRGDHGD  492
             L +     +         + +              R+      ++ADI    + G HGD
Sbjct  166  DLKYAITATSETSIDRSTLSDVFARAFARWAAATNLRFEETASESDADITIGFYAGSHGD  225

Query  493  GKPFDGPGGSYAHAFPPTNGNCHFDADENW-----AEFGPPHNGLDIQSVALHEIGHLLG  657
            G+PFDGP G+ AHAF PT+G  H DA E W              +D++SVA+HEIGHLLG
Sbjct  226  GEPFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGSDVSLSSTSGAVDLESVAVHEIGHLLG  285

Query  658  LDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            L HS  PDA+MY     G ++  L  DD  G+++LY
Sbjct  286  LGHSSVPDAIMYPTIRTGTRKVELEADDVQGIQSLY  321



>ref|XP_002887284.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63543.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 147/280 (53%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V+GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVEGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKTAVELYQRNFKLNV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG----------------VVPHYRFLPGEPK  312
            TG LDA T + ++ PRCG  D++NGTS   G                 V  Y   PGEP+
Sbjct  104  TGELDAMTIKHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGD  483
            WP ++R LT+ F P  P  ++     + A   W  V    F     ++ +DI    + GD
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSDSFSTSDITIGFYTGD  223

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIG  645
            HGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS   +++MY     G+++  LT DD  G++ LY
Sbjct  284  HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>gb|EYU22461.1| hypothetical protein MIMGU_mgv1a008611mg [Erythranthe guttata]
Length=368

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 148/271 (55%), Gaps = 20/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G +KG +  GL  LKKY + FGY+N    NS S  +D F + LESA+R YQ   +LN+
Sbjct  51   LAGCQKGRKADGLAKLKKYFQYFGYLN----NSYSDYSDDFDELLESAVRNYQLNFNLNA  106

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------GGAGVVPHYRFLPGEPKWPADKRRL  336
            TG LDA T   +++PRCG  D +NGTS             V HY F P  P+WPA K +L
Sbjct  107  TGKLDAPTLDHIVRPRCGNPDFVNGTSTMRRRDDHATIHTVAHYSFFPDRPRWPARKTQL  166

Query  337  TFGFAPGTPDKFFF--PVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFD  507
            T+ FAP              A   W       F +   Y  ADI+   F GDHGDG+PFD
Sbjct  167  TYAFAPENQLSAVVRGVFARAFERWSEATTLTFVETASYGRADIRIGFFGGDHGDGEPFD  226

Query  508  GPGGSYAHAFPPTNGNCHFDADENWA---EF--GPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G  G+ AHAF P NG  H D DENW     F  G P   +D++SVA+HEIGH+LGL HS 
Sbjct  227  GVLGTLAHAFAPPNGRFHLDGDENWVIDGNFLNGAPRTAVDLESVAVHEIGHVLGLGHST  286

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              +A+MY     G ++  L  DD  G++ LY
Sbjct  287  VEEAIMYPTISSGTRKVELANDDVLGIQELY  317



>ref|XP_009104967.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=381

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 147/284 (52%), Gaps = 32/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +    + + D   F D L++A+  YQ    L+ 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPETYTGNFTDD---FDDILKAAVELYQKNFRLDV  103

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GG----AGVVPHYRFLP  300
            TG LDA T + ++ PRCG  D++NGTS                GG       V HY   P
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSVMHNGRRKTFEVNFSPGGRIPRLHTVKHYTLFP  163

Query  301  GEPKWPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTL  471
            GEP+WP D+R LT+ F P  P  D+       A   W  V    F     +  +DI    
Sbjct  164  GEPRWPKDRRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGF  223

Query  472  FRGDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVAL  633
            + GDHGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  634  HEIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HEIGHLLGL HS   +++MY     G+++  LT DD  G++ LY
Sbjct  284  HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_011080438.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=306

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 148/263 (56%), Gaps = 14/263 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSPDADYFSDQLESAIRTYQTRHHLN  177
            +  + KG    GL  LKKYL   GYI+  +    +  + D F D LE+A+R YQ  ++L 
Sbjct  48   IDTTHKGHEADGLSELKKYLANLGYIDHTNPTIQTHLNDDVFDDTLETAVRKYQEFYNLQ  107

Query  178  STGILDAETARQMMKPRCGV------ADIINGTSGGAGVVPHYRFLPGEPKWPADKRRLT  339
             TG LD ET +Q+ +PRCG+      A++ +      G +  Y +L     WP  KR LT
Sbjct  108  ITGRLDKETVKQLQEPRCGLPDFHPNANLTSFVHNWTGAL--YTYL--GTTWPPGKRNLT  163

Query  340  FGFAPGTPDKFFFPVTTALRNWESVGPFIF-YKFRYANADIKFTLFRGDHGDGKPFDGPG  516
            F +     D    P+  A   W +V PF F Y+  + +AD+K +    DHGDG PFDGP 
Sbjct  164  FSYPESFRDDAKLPMALAFGRWITVSPFNFEYRSDFGSADVKVSFETRDHGDGSPFDGPN  223

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
            G  AHAF PT+G  HFDA+ENW  +       D+Q+V LHE+GH+LGL HS++P A M+ 
Sbjct  224  GILAHAFWPTDGRMHFDAEENWTPY-VAKGSYDLQTVGLHELGHILGLGHSQDPKASMFA  282

Query  697  RFEYGEKRRVLTTDDKNGLKALY  765
             F+ GE RR L  DD  G++ LY
Sbjct  283  YFQPGE-RRDLNEDDIRGIQTLY  304



>ref|XP_010470167.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=364

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 145/271 (54%), Gaps = 19/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  + ++ + D   F D L+SAI TYQ   +L  
Sbjct  49   LAGCHIGEKIDGLSKLKQYFHRFGYISAAAVDNCTDD---FDDVLQSAIDTYQKNFNLKV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LD+ T RQ++KPRCG  D+I+G S   G         Y F  G+P+WP  KR LT+ 
Sbjct  106  TGKLDSSTLRQIVKPRCGNLDMIDGVSEMNGRRKLRTTERYSFFHGKPRWPKRKRDLTYA  165

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            F P     ++       A   W  V P  F +      ADI    F G+HGDG+PFDG  
Sbjct  166  FVPQNNLTEEVKRVFERAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  225

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D+DE+W            P  + +D++SV +HEIGHLLGL HS 
Sbjct  226  GTLAHASSPPTGMLHLDSDEDWLISNGEISRRILPVTSVVDLESVVVHEIGHLLGLGHSS  285

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+M+     G+++  L  DD  G++ LY
Sbjct  286  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  316



>ref|XP_008798076.1| PREDICTED: metalloendoproteinase 1-like, partial [Phoenix dactylifera]
Length=410

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/270 (41%), Positives = 146/270 (54%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+   GL +LK YL  FGY+   ++       D F D LE A+RTYQ    LN+
Sbjct  48   LSGCHPGENRAGLADLKDYLSRFGYLPTSNFT------DAFDDALEEALRTYQQNFGLNA  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSGG-AGVVP---HYRFLPGEPKWPADKRRLTFGF  348
            TG LD  T  Q++ PRCGVADI+NGTS   +  +P    Y + PG P WP+ KR LT+  
Sbjct  102  TGSLDDSTVNQLIIPRCGVADIVNGTSSMRSAKLPGRNLYAYFPGNPTWPSWKRDLTYAL  161

Query  349  APGTPDKFFFPVTT-----ALRNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGKPFDG  510
               +         +     A   W +     F +   A +ADIK   + GDHGDG+PFDG
Sbjct  162  VSTSAVSIDTSAISTVFARAFGRWSAATTLTFTETDSASDADIKIGFYSGDHGDGEPFDG  221

Query  511  PGGSYAHAFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSEN  675
              G+ AHAF PT+G  H DA E W   G          +D++SVA+HEIGHLLGL HS  
Sbjct  222  VLGTLAHAFSPTDGRFHLDAAEQWVADGDVTEASSSVAVDLESVAVHEIGHLLGLGHSSE  281

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             +A+MY   +   K+  L +DD +G++ LY
Sbjct  282  AEAIMYPTIKTRTKKVELASDDVDGIQNLY  311



>ref|XP_006367952.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=369

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 143/266 (54%), Gaps = 17/266 (6%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD-ADYFSDQLESAIRTYQTRHHLNST  183
            G + G ++KGL  +K+Y + FGYI+    NS S D  D F   L SA++TYQ   +LN T
Sbjct  60   GCRVGQKIKGLAKIKQYFQHFGYID----NSLSNDFTDEFDQLLFSALKTYQLNFNLNIT  115

Query  184  GILDAETARQMMKPRCGVADIINGTSGGAG-------VVPHYRFLPGEPKWPADKRRLTF  342
            G  D  T + M+KPRCG  DI+NGT+            V H+ F  G+P+WP+ K +L +
Sbjct  116  GEFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKY  175

Query  343  GFAP--GTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGP  513
             F P     D        A   W  V P  F +   Y  ADI+   F  DHG+G PFDGP
Sbjct  176  AFLPENQLTDSVKVAFRRAFDKWSKVTPLTFKEMDSYRLADIRIGFFVRDHGNGNPFDGP  235

Query  514  GGSYAHAFPPTNGNCHFDADENWAEFGP--PHNGLDIQSVALHEIGHLLGLDHSENPDAV  687
                AH F P  G  H D +ENW   G       +D++SVA+HEI HLLGLDHS   +A+
Sbjct  236  MKILAHTFAPPTGFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIRHLLGLDHSFEKEAI  295

Query  688  MYYRFEYGEKRRVLTTDDKNGLKALY  765
            M+   E G ++  L+ DD  G++ LY
Sbjct  296  MFPTLEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_006300514.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
 gb|EOA33412.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
Length=370

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/271 (40%), Positives = 142/271 (52%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G + G+++ GL  LK+Y   FGYI  +   +     D F D L+SAI TYQ   +L  
Sbjct  53   LAGCQIGEKIDGLSKLKQYFHRFGYITTIKNCT-----DDFDDALQSAINTYQKNFNLKV  107

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LD+ T RQ++KPRCG  D+I+G S   G         Y F PG+P+WP  KR LT+ 
Sbjct  108  TGKLDSFTLRQIVKPRCGNPDMIDGFSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  167

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            F P     D+       A   W  V P  F +      ADI    F G+HGDG+PFDG  
Sbjct  168  FLPQNNLTDEVKRVFARAFTRWAEVTPLNFARSESLRGADIFIGFFSGEHGDGEPFDGAM  227

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D DE+W            P    +D++SV +HEIGHLLGL HS 
Sbjct  228  GTLAHASSPPTGMLHLDGDEDWLISDGAISRRILPVTTVVDLESVVVHEIGHLLGLGHSS  287

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+M+     G+++  L  DD  G++ LY
Sbjct  288  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  318



>gb|EAY87473.1| hypothetical protein OsI_08881 [Oryza sativa Indica Group]
Length=372

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 145/275 (53%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  50   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  181  TGILDAETARQMMKPRCGVADIINGTS-----GGAGVVPH---YRFLPGEPKWPADKRRL  336
            TG LD +T  QM+ PRCGVAD+INGTS       A  +     Y + PG P WP  +R L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPMWPPFRRNL  167

Query  337  TFGFAPGTPDKFFFPVTTAL-----RNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGK  498
             +     +         +A+       W +     F +   A NADI    + GDHGDG+
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH------NGLDIQSVALHEIGHLLGL  660
             FDGP G+ AHAF PT+G  H DA E W   G           +D++SVA+HEIGHLLGL
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLLGL  287

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS  PD++MY     G ++  L +DD  G+++LY
Sbjct  288  GHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>gb|KFK44477.1| hypothetical protein AALP_AA1G261400 [Arabis alpina]
Length=378

 Score =   187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 148/283 (52%), Gaps = 31/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G +V GLY +K+Y + FGYI +    + + D   F D L++A+  YQ    LN 
Sbjct  45   FTGCHTGMKVDGLYKIKQYFQHFGYIPETLPGNFTDD---FDDILKNAVEMYQRNFQLNV  101

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG------------------VVPHYRFLPGE  306
            TG LD  T   ++ PRCGV D++NGTS   G                   V  Y F PGE
Sbjct  102  TGELDELTLIHVVIPRCGVPDVVNGTSTMHGHGRRTYEVSFTGRGPRFHAVRRYSFFPGE  161

Query  307  PKWPADKRRLTFGFAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFR  477
            P+WP  +R LT+ F P     ++     + A   W  V P  F +   +  ADI+   + 
Sbjct  162  PRWPNHRRDLTYAFDPRNALTEEVKNVFSRAFVRWAEVTPLTFTRAESFLTADIRVGFYS  221

Query  478  GDHGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWAE-------FGPPHNGLDIQSVALH  636
            GDHGDG+PFDG  G+ AHAF P +G+ H D DENW         F      +D++SVA+H
Sbjct  222  GDHGDGEPFDGVMGTLAHAFSPPSGHFHLDGDENWVVSDSGGDGFLSVTAAVDLESVAVH  281

Query  637  EIGHLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            EIGH+LGL HS   D++MY     G ++  LT+DD  G++ LY
Sbjct  282  EIGHILGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  324



>gb|KFK40830.1| hypothetical protein AALP_AA2G047000 [Arabis alpina]
Length=364

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 145/271 (54%), Gaps = 17/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GD++ GL  LK+Y   FGY+   +   ++   D F D L+SAI TYQ   +L  
Sbjct  46   LAGCHVGDKIDGLSKLKQYFHRFGYLTTTTTAGTNFTDD-FDDILQSAINTYQKNFNLKV  104

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAG----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LDA T RQ++KPRCG  D+I+G S   AG        Y F PG+P+WP  KR LT+ 
Sbjct  105  TGNLDASTLRQIVKPRCGNPDMIDGVSEMNAGRKLRTTERYSFFPGKPRWPKRKRDLTYA  164

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            F P     D+       A   W  V P  F +      ADI    F G+HGDG+PFDG  
Sbjct  165  FVPQNNLTDEVKRVFARAFTRWSEVTPLNFTRSESILRADIVIGFFAGEHGDGEPFDGAM  224

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D DE+W            P  + +D++SVA+HEIGHLLGL HS 
Sbjct  225  GTLAHASSPPTGMFHLDGDEDWLISEDEISRGILPVTSVVDLESVAVHEIGHLLGLGHSS  284

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              D++MY     G+++  L  DD  G++ LY
Sbjct  285  VEDSIMYPAIAGGDRKVELGKDDIEGIQHLY  315



>emb|CDY30915.1| BnaC09g14910D [Brassica napus]
Length=353

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/273 (42%), Positives = 145/273 (53%), Gaps = 20/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI TYQ   +L  
Sbjct  50   LTGYHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLKSAISTYQKNFNLKV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTSG-GAG----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LDA T  Q++KPRCG  D+I+GTS   AG     V  Y F PG+P+WP   R L++ 
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSYA  165

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            F P     ++       A   W  V P  F +      ADI    F GDHGDG+PFDGP 
Sbjct  166  FFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGPM  225

Query  517  GSYAHAFPPTNGNCHFDADENWAEFG--------PPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D +E+W   G        P  + +D++SVA+HEIGHLLGL HS 
Sbjct  226  GTLAHASSPPTGMFHLDNEEDWLISGEDMSRQILPVTSVVDLESVAVHEIGHLLGLGHSS  285

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALYNF  771
              DA+MY     G ++  L  DD  G++ LY +
Sbjct  286  VEDAIMYPAISGGHRKVELAKDDIEGIQHLYGY  318



>gb|EAZ24565.1| hypothetical protein OsJ_08327 [Oryza sativa Japonica Group]
Length=372

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 145/275 (53%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  50   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  181  TGILDAETARQMMKPRCGVADIINGT------SGGAGVVPH--YRFLPGEPKWPADKRRL  336
            TG LD +T  QM+ PRCGVAD+INGT      S  A +     Y + PG P WP  +R L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSSAALRGRNLYSYFPGGPMWPPFRRNL  167

Query  337  TFGFAPGTPDKFFFPVTTAL-----RNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGK  498
             +     +         +A+       W +     F +   A NADI    + GDHGDG+
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH------NGLDIQSVALHEIGHLLGL  660
             FDGP G+ AHAF PT+G  H DA E W   G           +D++SVA+HEIGHLLGL
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLLGL  287

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS  PD++MY     G ++  L +DD  G+++LY
Sbjct  288  GHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>ref|NP_001048075.1| Os02g0740700 [Oryza sativa Japonica Group]
 dbj|BAD15762.1| putative zinc metalloproteinase [Oryza sativa Japonica Group]
 dbj|BAF09989.1| Os02g0740700 [Oryza sativa Japonica Group]
Length=372

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 145/275 (53%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  50   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  181  TGILDAETARQMMKPRCGVADIINGTS-----GGAGVVPH---YRFLPGEPKWPADKRRL  336
            TG LD +T  QM+ PRCGVAD+INGTS       A  +     Y + PG P WP  +R L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPMWPPFRRNL  167

Query  337  TFGFAPGTPDKFFFPVTTAL-----RNWESVGPFIFYKFRYA-NADIKFTLFRGDHGDGK  498
             +     +         +A+       W +     F +   A NADI    + GDHGDG+
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH------NGLDIQSVALHEIGHLLGL  660
             FDGP G+ AHAF PT+G  H DA E W   G           +D++SVA+HEIGHLLGL
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLLGL  287

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS  PD++MY     G ++  L +DD  G+++LY
Sbjct  288  GHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>ref|XP_011042944.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=373

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/275 (41%), Positives = 143/275 (52%), Gaps = 26/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G++  GL  LK Y + FGYI     NS S   D F D +ESAIRTYQ   +LN 
Sbjct  58   LSGCHAGEKYDGLAKLKSYFQYFGYIP----NSLSNFTDDFDDSIESAIRTYQQNFNLNI  113

Query  181  TGILDAETARQMMKPRCGVADIINGT------------SGGAGVVPHYRFLPGEPKWPAD  324
            TG LD +T   ++ PRCG  DI+NGT            S     V HY F  G P+W   
Sbjct  114  TGQLDDQTVNHIVLPRCGNPDIVNGTTSMNSGKTHNTSSRHVHTVSHYSFFTGMPRW--R  171

Query  325  KRRLTFGFAPGT--PDKFFFPVTTALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDG  495
            K+ LT+ F PG    D+     + A   W +V P  F +    N ADI    + GDHGDG
Sbjct  172  KKALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIPLTFTQTDSINTADIGIGFYSGDHGDG  231

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPH-----NGLDIQSVALHEIGHLLGL  660
            +PFDG  G+ AH+F P +G  H D DE+W   G          +D++SVA+HEIGHLLGL
Sbjct  232  EPFDGVLGTLAHSFSPPSGQFHLDGDESWVVTGDVRTSSLTTAVDLESVAVHEIGHLLGL  291

Query  661  DHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
             HS    ++MY       K+  L  DD  G++ LY
Sbjct  292  GHSSVEVSIMYPTISSRTKKVELADDDIQGIQVLY  326



>ref|XP_010415694.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 144/280 (51%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEPK  312
            TG LDA T + ++ PRCG  D++NGTS                     V  Y   PGEP+
Sbjct  105  TGELDAFTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRSRLHAVKRYTLFPGEPR  164

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGD  483
            WP D+R LT+ F P  P  ++       A   W  V    F +   ++ +DI    + GD
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIG  645
            HGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS   +++MY     G ++  LT DD  G++ LY
Sbjct  285  HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_004953898.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=372

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 143/274 (52%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F + LE+AI TYQ    LN+
Sbjct  53   LSGCHMGEERQGLAGLKDYLSHFGYLPPPPSSSPFTDA--FDEDLEAAIATYQRNFGLNA  110

Query  181  TGILDAETARQMMKPRCGVADIINGTS--------GGAGVVPHYRFLPGEPKWPADKRRL  336
            TG LDA T  QM+ PRCGVAD+INGTS         GA     Y + PG P+WP  +R L
Sbjct  111  TGALDASTVAQMVSPRCGVADVINGTSTMARNSSAAGAHGRHLYAYFPGGPRWPPFRRDL  170

Query  337  TFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFRYA------NADIKFTLFRGDHGDGK  498
             +     +         + +              R+A      +ADI    + G HGDG+
Sbjct  171  KYAITATSATSIDRSTLSDVFARAFAQWAAATNLRFAETASESDADITIGFYTGSHGDGE  230

Query  499  PFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNG-----LDIQSVALHEIGHLLGLD  663
            PFDGP G+ AHAF PT+G  H DA E W   G          +D++SVA+HEIGHLLGL 
Sbjct  231  PFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGGDVSRASSPGVVDLESVAVHEIGHLLGLG  290

Query  664  HSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HS  P+A+MY     G ++  L  DD  G+++LY
Sbjct  291  HSSVPEAIMYPTIRTGTRKVELEADDVQGIQSLY  324



>ref|NP_001235535.1| metalloendoproteinase 1 precursor [Glycine max]
 sp|P29136.2|MEP1_SOYBN RecName: Full=Metalloendoproteinase 1; AltName: Full=SMEP1; Flags: 
Precursor [Glycine max]
 gb|AAB26959.1| metalloproteinase [Glycine max]
Length=305

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 139/263 (53%), Gaps = 23/263 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSPDA----DYFSDQLESAIRTYQTRHHLNSTG  186
            G   KGL N+K Y    GYI         P+A    D F D L SAI+TYQ  ++LN TG
Sbjct  48   GQNYKGLSNVKNYFHHLGYI---------PNAPHFDDNFDDTLVSAIKTYQKNYNLNVTG  98

Query  187  ILDAETARQMMKPRCGVADIINGTSGGA--GVVPHYRFLPGEPKWPADKRRLTFGFAPG-  357
              D  T +Q+M PRCGV DII  T+     G++  Y F    P+W A   +LT+ F+P  
Sbjct  99   KFDINTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEP  158

Query  358  -TPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDGKPFDGPGGSYAH  531
               D F   +  A   W  V    F +   Y  A+IK      +HGD  PFDGPGG   H
Sbjct  159  RLDDTFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGH  218

Query  532  AFPPTNGNCHFDADENWAEFG-----PPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
            AF PT+G CHFDADE W   G     P  +  D++SVA+HEIGHLLGL HS +  A+MY 
Sbjct  219  AFAPTDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYP  278

Query  697  RFEYGEKRRVLTTDDKNGLKALY  765
                  ++  L  DD +G++ LY
Sbjct  279  SIPPRTRKVNLAQDDIDGIRKLY  301



>ref|XP_010512095.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=378

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 143/280 (51%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    L  
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLKV  104

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEPK  312
            TG LDA T + ++ PRCG  D++NGTS                     V  Y   PGEP+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGD  483
            WP D+R LT+ F P  P  ++       A   W  V    F +   ++ +DI    + GD
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIG  645
            HGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS   D++MY     G ++  LT DD  G++ LY
Sbjct  285  HLLGLGHSSVEDSIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_007033352.1| Matrixin family protein [Theobroma cacao]
 gb|EOY04278.1| Matrixin family protein [Theobroma cacao]
Length=275

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/261 (41%), Positives = 146/261 (56%), Gaps = 26/261 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L+ ++KGD + GL ++KKYL+ FGY  ND +        D+F D LESA++ +Q  ++L 
Sbjct  37   LERAQKGDTLNGLSHVKKYLRAFGYYPNDFNLID-----DHFDDSLESALKAHQQNYYLK  91

Query  178  STGILDAETARQMMKPRCGVADII-NGTSGGAGVVPHYRFLPGEPKWPADKRRLTFGFAP  354
             TG +D +T + MM PRCGV DII N TS   G  PH                    F  
Sbjct  92   VTGKIDPDTIKAMMTPRCGVPDIISNRTSNDTGETPHGVI-----------------FHL  134

Query  355  GTPDKFFFPVTT-ALRNWESVGPFIFYKFRYAN-ADIKFTLFRGDHGDGKPFDGPGGSYA  528
                +   P+   A + W +V PF F +    N ADI+   +R +HGDG PFDGPG   A
Sbjct  135  VISSQVLRPIIARAFQTWAAVSPFRFQEVAQGNRADIRIGFYRYEHGDGYPFDGPGNILA  194

Query  529  HAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYYRFEY  708
            HAF P +G  H+DADENW+      N +D+++VA+HEIGH LGL HS++  A+M+     
Sbjct  195  HAFAPQDGRFHYDADENWSPNPTAPNQIDLETVAVHEIGHNLGLGHSQDQAAIMFPSLPA  254

Query  709  GEKRRVLTTDDKNGLKALYNF  771
            G  +R L  DD  GL+ALY +
Sbjct  255  GATKRNLGQDDIVGLQALYGY  275



>ref|XP_006300509.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
 gb|EOA33407.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
Length=380

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/280 (39%), Positives = 143/280 (51%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  49   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDVLKTAVELYQRNFRLNV  105

Query  181  TGILDAETARQMMKPRCGVADIINGTS----------------GGAGVVPHYRFLPGEPK  312
            TG LDA T + ++ PRCG  D++NGTS                     V  Y   PGEP+
Sbjct  106  TGELDALTIKHIVIPRCGNPDVVNGTSLMHNGRRKTFEVNFSRSHLHAVKRYTLFPGEPR  165

Query  313  WPADKRRLTFGFAPGTP--DKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGD  483
            WP ++R LT+ F P  P  D+       A   W  V    F     + ++DI    + GD
Sbjct  166  WPRNRRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTPSEDFTSSDITIGFYTGD  225

Query  484  HGDGKPFDGPGGSYAHAFPPTNGNCHFDADENWA------EFGPPHNGLDIQSVALHEIG  645
            HGDG+PFDG  G+ AHAF P +G  H DADENW        F      +D++SVA+HEIG
Sbjct  226  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  285

Query  646  HLLGLDHSENPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
            HLLGL HS   +++MY     G ++  LT DD  G++ LY
Sbjct  286  HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  325



>emb|CBI34984.3| unnamed protein product [Vitis vinifera]
Length=682

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 146/245 (60%), Gaps = 24/245 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPD------ADYFSDQLESAIRTYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S +       DYF D LESAI++YQT
Sbjct  435  LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  491

Query  163  RHHLNSTGILDAETARQMMKPRCGVADIINGTSGGAGVVPHYRFLPGEPKWP-ADKRRLT  339
             +HL +TG LD+ET R             +   G    V HY+F PG P+WP ++   LT
Sbjct  492  NYHLKATGKLDSETKRH------------DQGHGSLHTVSHYQFFPGSPRWPTSNNAHLT  539

Query  340  FGFAPGTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            + F PGTPD+   PV+ A   W S   F F +   + NA++  +     HGD  PFDGPG
Sbjct  540  YAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHSLLHGDWNPFDGPG  599

Query  517  GSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSENPDAVMYY  696
            G+ AHA+ PT+G  H+DADE W+    P   LD+++VALHEIGHLLGL HS   +A+M+ 
Sbjct  600  GTIAHAYAPTDGRFHYDADEEWSVGAVP-GALDVETVALHEIGHLLGLGHSSVREAIMFP  658

Query  697  RFEYG  711
                G
Sbjct  659  SISTG  663



>ref|XP_010510985.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=367

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 142/271 (52%), Gaps = 19/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  +  + + D   F D L+SAI TYQ   +L  
Sbjct  51   LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVENCTDD---FDDVLQSAIDTYQKNFNLKV  107

Query  181  TGILDAETARQMMKPRCGVADIINGTSGGAG-----VVPHYRFLPGEPKWPADKRRLTFG  345
            TG LD+ T RQ++KPRCG  D+I+G S   G         Y F PG+P+WP  KR LT+ 
Sbjct  108  TGKLDSSTLRQIVKPRCGNPDMIDGFSEMNGGRKLRATERYSFFPGKPRWPKRKRYLTYA  167

Query  346  FAP--GTPDKFFFPVTTALRNWESVGPFIFYKFR-YANADIKFTLFRGDHGDGKPFDGPG  516
            F       ++       A   W  V P  F +      ADI    F G+HGDG+PFDG  
Sbjct  168  FVTQNNLTEEIKRVFARAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  227

Query  517  GSYAHAFPPTNGNCHFDADENWA--------EFGPPHNGLDIQSVALHEIGHLLGLDHSE  672
            G+ AHA  P  G  H D+DE+W               + +D++SV +HEIGHLLGL HS 
Sbjct  228  GTLAHASSPPTGMLHLDSDEDWLISDGGISRRISSVTSVVDLESVVVHEIGHLLGLGHSS  287

Query  673  NPDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              DA+M+     G ++  L  DD  G++ LY
Sbjct  288  VEDAIMFPAISGGHRKVELAKDDIEGIQHLY  318



>ref|XP_004142467.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
 gb|KGN52407.1| hypothetical protein Csa_5G632060 [Cucumis sativus]
Length=303

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 149/270 (55%), Gaps = 23/270 (9%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSPDADYFSDQLESAIRTYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ +    S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENEKKLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDAETARQMMKPRCGVADI-------------INGTSGGAGVVPHYRFLPGEPKWP  318
             +G+LD ET +QM +PRCGV D               N   GG+    HY F      WP
Sbjct  98   VSGVLDRETLQQMSRPRCGVRDTYVSVGQQEHENKNTNIEIGGS----HYTFYYNHVTWP  153

Query  319  ADKRRLTFGFAPGTPDKFFFPVTTALRNWESVGPFIFYKF-RYANADIKFTLFRGDHGDG  495
            A++R L++GF    P +    V  A + WE    F F+   R   ADI  +  RG+HGD 
Sbjct  154  AERRHLSYGFIHDFPPQHVDTVRRAFQTWEDNTKFSFFLSPRVQTADILVSFERGEHGDH  213

Query  496  KPFDGPGGSYAHAFPPTNGNCHFDADENWAEFGPPHNGLDIQSVALHEIGHLLGLDHSEN  675
            +PFDG GG  AH+    +G  HFDAD+ W   G P    D++++ALHEIGH LGL HS +
Sbjct  214  EPFDGEGGILAHSLGAVDGRVHFDADDRWE--GDPMERYDLETLALHEIGHALGLGHSSS  271

Query  676  PDAVMYYRFEYGEKRRVLTTDDKNGLKALY  765
              A+M+     G  +  LT DD  G++ALY
Sbjct  272  SLAIMWAYMYKGFPKTRLTIDDIEGIRALY  301



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1651846923090