BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23382_g3_i1 len=908 path=[1537:0-58 3350:59-110 3402:111-145
3437:146-151 1689:152-187 5266:188-200 1738:201-256 966:257-626
1336:627-680 1361:681-743 1424:744-784 4965:785-835 5016:836-869
2405:870-907]

Length=908
                                                                      Score     E

gb|KDP45996.1|  hypothetical protein JCGZ_11899                         257   4e-80   
ref|XP_002517411.1|  Metalloendoproteinase 1 precursor, putative        254   8e-79   Ricinus communis
ref|XP_008230957.1|  PREDICTED: metalloendoproteinase 1-like            253   2e-78   
ref|XP_008230959.1|  PREDICTED: metalloendoproteinase 1-like            245   2e-75   
ref|XP_008230962.1|  PREDICTED: metalloendoproteinase 1-like            243   9e-75   
ref|XP_008458713.1|  PREDICTED: metalloendoproteinase 1-like            242   1e-74   
ref|XP_008230963.1|  PREDICTED: metalloendoproteinase 1-like            243   1e-74   
ref|XP_006482472.1|  PREDICTED: metalloendoproteinase 1-like            243   2e-74   
gb|KDO37621.1|  hypothetical protein CISIN_1g035681mg                   240   1e-73   
ref|XP_008458907.1|  PREDICTED: metalloendoproteinase 1-like            239   3e-73   
ref|XP_004142457.1|  PREDICTED: metalloendoproteinase 1-like            239   4e-73   
ref|XP_008458714.1|  PREDICTED: metalloendoproteinase 1-like            239   7e-73   
ref|XP_008352994.1|  PREDICTED: metalloendoproteinase 1-like            237   2e-72   
ref|XP_007216923.1|  hypothetical protein PRUPE_ppa018181mg             235   3e-72   
ref|XP_004142462.1|  PREDICTED: metalloendoproteinase 1-like            237   3e-72   
ref|XP_007014936.1|  Matrixin family protein, putative                  236   5e-72   
ref|XP_007216839.1|  hypothetical protein PRUPE_ppa022514mg             235   7e-72   
ref|XP_008230960.1|  PREDICTED: metalloendoproteinase 1-like            235   2e-71   
emb|CAN59960.1|  hypothetical protein VITISV_011608                     235   2e-71   Vitis vinifera
ref|XP_008230675.1|  PREDICTED: metalloendoproteinase 1-like            234   3e-71   
ref|XP_007216922.1|  hypothetical protein PRUPE_ppa018385mg             233   5e-71   
ref|XP_002517412.1|  Matrix metalloproteinase, putative                 234   6e-71   Ricinus communis
ref|XP_007010413.1|  Matrixin family protein                            233   8e-71   
ref|XP_008343421.1|  PREDICTED: metalloendoproteinase 1-like            233   1e-70   
ref|XP_007010415.1|  Matrixin family protein                            232   2e-70   
ref|XP_008361888.1|  PREDICTED: metalloendoproteinase 1-like            232   2e-70   
ref|XP_002275556.1|  PREDICTED: metalloendoproteinase 1-like            231   5e-70   Vitis vinifera
ref|XP_008368314.1|  PREDICTED: LOW QUALITY PROTEIN: metalloendop...    231   8e-70   
ref|XP_007216949.1|  hypothetical protein PRUPE_ppa016355mg             228   8e-70   
ref|XP_008365496.1|  PREDICTED: metalloendoproteinase 1-like            229   2e-69   
ref|XP_002280805.2|  PREDICTED: metalloendoproteinase 1-like            230   2e-69   Vitis vinifera
ref|XP_004296560.1|  PREDICTED: metalloendoproteinase 1-like            229   3e-69   
ref|XP_004142461.1|  PREDICTED: metalloendoproteinase 1-like            229   3e-69   
ref|XP_008230676.1|  PREDICTED: metalloendoproteinase 1-like            228   4e-69   
ref|XP_004288499.1|  PREDICTED: metalloendoproteinase 1-like            227   2e-68   
ref|XP_002280833.1|  PREDICTED: metalloendoproteinase 1                 227   2e-68   Vitis vinifera
gb|EYU34694.1|  hypothetical protein MIMGU_mgv1a023515mg                225   3e-68   
ref|XP_003633209.1|  PREDICTED: metalloendoproteinase 1-like            226   4e-68   
gb|EYU29748.1|  hypothetical protein MIMGU_mgv1a025409mg                224   5e-68   
emb|CBI34985.3|  unnamed protein product                                223   1e-67   
ref|XP_004159087.1|  PREDICTED: metalloendoproteinase 1-like            229   1e-67   
ref|XP_007010134.1|  Matrixin family protein, putative                  223   3e-67   
gb|EYU18042.1|  hypothetical protein MIMGU_mgv1a018853mg                223   3e-67   
gb|EYU34696.1|  hypothetical protein MIMGU_mgv11b016964mg               224   4e-67   
emb|CAN73130.1|  hypothetical protein VITISV_030258                     227   7e-67   Vitis vinifera
ref|XP_004296559.1|  PREDICTED: metalloendoproteinase 1-like            223   8e-67   
ref|XP_007217804.1|  hypothetical protein PRUPE_ppa024325mg             225   1e-66   
gb|KDP45419.1|  hypothetical protein JCGZ_09668                         221   1e-66   
gb|EPS59674.1|  hypothetical protein M569_15132                         220   2e-66   
ref|XP_010037507.1|  PREDICTED: metalloendoproteinase 1-like            222   2e-66   
ref|XP_010037506.1|  PREDICTED: metalloendoproteinase 1-like            221   2e-66   
ref|XP_008230961.1|  PREDICTED: metalloendoproteinase 1-like            221   3e-66   
emb|CAN73128.1|  hypothetical protein VITISV_030256                     221   3e-66   Vitis vinifera
ref|XP_009341183.1|  PREDICTED: metalloendoproteinase 1-like            220   1e-65   
ref|XP_008355534.1|  PREDICTED: metalloendoproteinase 1-like            219   3e-65   
ref|XP_010039144.1|  PREDICTED: metalloendoproteinase 1-like            219   4e-65   
ref|XP_010273763.1|  PREDICTED: metalloendoproteinase 1-like            219   4e-65   
ref|XP_009368959.1|  PREDICTED: metalloendoproteinase 1-like            218   5e-65   
ref|XP_010278837.1|  PREDICTED: metalloendoproteinase 1-like            218   6e-65   
ref|XP_009351242.1|  PREDICTED: metalloendoproteinase 1-like            218   6e-65   
ref|XP_006431003.1|  hypothetical protein CICLE_v10012543mg             216   7e-65   
ref|XP_006482471.1|  PREDICTED: metalloendoproteinase 1-like            216   8e-65   
ref|XP_007216020.1|  hypothetical protein PRUPE_ppa014830mg             216   1e-64   
ref|NP_001266203.1|  matrix metalloproteinase precursor                 218   2e-64   
ref|XP_006363533.1|  PREDICTED: metalloendoproteinase 1-like            218   3e-64   
ref|XP_011071055.1|  PREDICTED: metalloendoproteinase 1-like            218   4e-64   
ref|XP_002275671.1|  PREDICTED: metalloendoproteinase 1-like            216   4e-64   Vitis vinifera
emb|CBI34987.3|  unnamed protein product                                215   5e-64   
ref|XP_010255281.1|  PREDICTED: metalloendoproteinase 1-like            217   9e-64   
ref|XP_006448956.1|  hypothetical protein CICLE_v10017926mg             215   1e-63   
ref|XP_006856883.1|  hypothetical protein AMTR_s00055p00201730          216   1e-63   
ref|XP_010091950.1|  Metalloendoproteinase 1                            216   1e-63   
gb|KCW49215.1|  hypothetical protein EUGRSUZ_K02795                     217   2e-63   
ref|XP_004297896.1|  PREDICTED: metalloendoproteinase 1-like            214   3e-63   
gb|KDO75344.1|  hypothetical protein CISIN_1g037265mg                   213   3e-63   
ref|XP_004143787.1|  PREDICTED: metalloendoproteinase 1-like            214   7e-63   
ref|XP_008458715.1|  PREDICTED: metalloendoproteinase 1-like            213   9e-63   
ref|XP_008465718.1|  PREDICTED: metalloendoproteinase 1                 214   1e-62   
ref|XP_011073059.1|  PREDICTED: metalloendoproteinase 1-like            210   6e-62   
ref|XP_004139164.1|  PREDICTED: metalloendoproteinase 1-like            210   8e-62   
ref|XP_007153680.1|  hypothetical protein PHAVU_003G055800g             211   1e-61   
ref|XP_006495379.1|  PREDICTED: metalloendoproteinase 1-like            207   1e-61   
ref|XP_006363534.1|  PREDICTED: metalloendoproteinase 1-like            211   2e-61   
gb|KDP32993.1|  hypothetical protein JCGZ_13024                         209   2e-61   
ref|XP_004139163.1|  PREDICTED: metalloendoproteinase 1-like            209   2e-61   
ref|XP_009624303.1|  PREDICTED: metalloendoproteinase 1-like            210   2e-61   
ref|XP_011086481.1|  PREDICTED: metalloendoproteinase 1-like            210   2e-61   
emb|CCH68443.1|  matrix metalloproteinase precursor                     209   5e-61   
ref|XP_002325947.1|  hypothetical protein POPTR_0019s10230g             207   5e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011085796.1|  PREDICTED: metalloendoproteinase 1-like            208   5e-61   
ref|XP_004237082.2|  PREDICTED: metalloendoproteinase 1                 209   7e-61   
ref|XP_006602365.1|  PREDICTED: metalloendoproteinase 1-like            209   7e-61   
ref|XP_008376281.1|  PREDICTED: metalloendoproteinase 1-like            209   9e-61   
ref|XP_010272073.1|  PREDICTED: metalloendoproteinase 1                 209   1e-60   
ref|XP_006438497.1|  hypothetical protein CICLE_v10031870mg             209   1e-60   
ref|XP_007044491.1|  Matrixin family protein, putative                  208   1e-60   
gb|EYU28648.1|  hypothetical protein MIMGU_mgv1a008442mg                208   1e-60   
ref|XP_003530663.1|  PREDICTED: metalloendoproteinase 1-like            208   2e-60   
ref|XP_010110202.1|  Metalloendoproteinase 1                            207   2e-60   
ref|XP_008458911.1|  PREDICTED: metalloendoproteinase 1-like            206   2e-60   
ref|XP_008222422.1|  PREDICTED: metalloendoproteinase 1-like            206   2e-60   
ref|XP_006376166.1|  hypothetical protein POPTR_0013s10410g             206   2e-60   
gb|KDO37628.1|  hypothetical protein CISIN_1g039411mg                   203   3e-60   
emb|CDP00221.1|  unnamed protein product                                208   3e-60   
gb|ABK95950.1|  unknown                                                 206   3e-60   Populus trichocarpa [western balsam poplar]
gb|EYU38312.1|  hypothetical protein MIMGU_mgv11b017434mg               204   4e-60   
ref|XP_010255256.1|  PREDICTED: metalloendoproteinase 1-like            205   5e-60   
ref|XP_011072962.1|  PREDICTED: metalloendoproteinase 1-like            205   6e-60   
ref|XP_008233236.1|  PREDICTED: metalloendoproteinase 1-like            207   6e-60   
ref|XP_008458910.1|  PREDICTED: metalloendoproteinase 1-like            204   8e-60   
ref|NP_001267680.1|  metalloendoproteinase 1-like precursor             205   8e-60   
ref|XP_006387200.1|  hypothetical protein POPTR_1544s00200g             204   1e-59   
gb|EYU35921.1|  hypothetical protein MIMGU_mgv1a019701mg                204   1e-59   
gb|ADD21635.1|  matrix metalloprotease 1                                205   2e-59   Nicotiana benthamiana
ref|XP_007226174.1|  hypothetical protein PRUPE_ppa015434mg             204   2e-59   
ref|XP_004167464.1|  PREDICTED: metalloendoproteinase 1-like            203   2e-59   
ref|XP_004142466.1|  PREDICTED: metalloendoproteinase 1-like            203   2e-59   
gb|ABF58910.1|  matrix metalloprotease 1                                205   3e-59   Nicotiana tabacum [American tobacco]
ref|XP_009758591.1|  PREDICTED: metalloendoproteinase 1-like            205   3e-59   
ref|XP_004142465.1|  PREDICTED: metalloendoproteinase 1-like            202   3e-59   
ref|XP_004297959.1|  PREDICTED: metalloendoproteinase 1-like            202   6e-59   
gb|KDO82628.1|  hypothetical protein CISIN_1g021444mg                   202   8e-59   
gb|KDP21290.1|  hypothetical protein JCGZ_21761                         203   1e-58   
gb|EYU29749.1|  hypothetical protein MIMGU_mgv1a023711mg                200   1e-58   
ref|XP_003517862.1|  PREDICTED: metalloendoproteinase 1-like            203   1e-58   
ref|XP_008443669.1|  PREDICTED: metalloendoproteinase 1-like            201   2e-58   
ref|XP_011003818.1|  PREDICTED: metalloendoproteinase 1-like            201   2e-58   
ref|XP_004509890.1|  PREDICTED: metalloendoproteinase 1-like            203   2e-58   
ref|XP_002520211.1|  Metalloendoproteinase 1 precursor, putative        202   2e-58   Ricinus communis
gb|EPS61169.1|  matrixin family protein                                 201   2e-58   
ref|XP_007220919.1|  hypothetical protein PRUPE_ppb025548mg             201   3e-58   
ref|XP_006371427.1|  hypothetical protein POPTR_0019s10270g             200   6e-58   
ref|XP_004504503.1|  PREDICTED: metalloendoproteinase 1-like            201   7e-58   
ref|XP_011003815.1|  PREDICTED: metalloendoproteinase 1-like            199   7e-58   
gb|EYU31381.1|  hypothetical protein MIMGU_mgv1a023026mg                198   8e-58   
emb|CDY11609.1|  BnaC06g31300D                                          201   9e-58   
emb|CDX68356.1|  BnaA07g23960D                                          201   9e-58   
emb|CDY23516.1|  BnaC06g24850D                                          201   1e-57   
ref|XP_008244963.1|  PREDICTED: metalloendoproteinase 1                 202   1e-57   
dbj|BAE98757.1|  predicted GPI-anchored protein                         201   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177174.1|  matrix metalloproteinase                              201   1e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38799.1|  BnaA07g28710D                                          200   2e-57   
ref|XP_009360449.1|  PREDICTED: metalloendoproteinase 1                 200   2e-57   
ref|XP_009105693.1|  PREDICTED: metalloendoproteinase 1-like            200   3e-57   
ref|XP_008458917.1|  PREDICTED: metalloendoproteinase 1-like            197   3e-57   
gb|KCW49214.1|  hypothetical protein EUGRSUZ_K02794                     195   3e-57   
emb|CAN76268.1|  hypothetical protein VITISV_004096                     199   3e-57   Vitis vinifera
ref|XP_008353003.1|  PREDICTED: metalloendoproteinase 1-like            200   3e-57   
ref|XP_002267298.2|  PREDICTED: metalloendoproteinase 1                 199   4e-57   Vitis vinifera
ref|XP_009104967.1|  PREDICTED: metalloendoproteinase 1-like            199   4e-57   
ref|XP_003628627.1|  Matrix metalloproteinase-9                         199   4e-57   
ref|XP_006838196.1|  hypothetical protein AMTR_s00106p00141160          199   5e-57   
ref|XP_009626465.1|  PREDICTED: metalloendoproteinase 1-like            199   5e-57   
emb|CBI34986.3|  unnamed protein product                                197   5e-57   
ref|NP_176205.1|  Matrixin family protein                               199   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011080437.1|  PREDICTED: metalloendoproteinase 1-like            197   6e-57   
gb|KFK41437.1|  hypothetical protein AALP_AA2G130300                    199   6e-57   
ref|XP_011010763.1|  PREDICTED: metalloendoproteinase 1-like            197   9e-57   
ref|XP_002887284.1|  hypothetical protein ARALYDRAFT_476141             199   9e-57   
ref|XP_010255269.1|  PREDICTED: metalloendoproteinase 1-like            196   1e-56   
gb|KGN52417.1|  hypothetical protein Csa_5G633150                       196   2e-56   
ref|XP_007223246.1|  hypothetical protein PRUPE_ppa007227mg             198   2e-56   
ref|XP_010100525.1|  Metalloendoproteinase 1                            197   2e-56   
ref|XP_006448955.1|  hypothetical protein CICLE_v10017519mg             194   2e-56   
ref|XP_011085865.1|  PREDICTED: metalloendoproteinase 1-like            195   2e-56   
ref|XP_006300509.1|  hypothetical protein CARUB_v10020468mg             197   2e-56   
ref|XP_008389591.1|  PREDICTED: metalloendoproteinase 1-like            197   3e-56   
ref|XP_010415694.1|  PREDICTED: metalloendoproteinase 1-like            197   3e-56   
ref|XP_010414620.1|  PREDICTED: metalloendoproteinase 1-like            197   3e-56   
ref|XP_004159085.1|  PREDICTED: metalloendoproteinase 1-like            195   3e-56   
gb|EYU34695.1|  hypothetical protein MIMGU_mgv1a024051mg                192   4e-56   
ref|XP_006390919.1|  hypothetical protein EUTSA_v10018701mg             197   4e-56   
ref|XP_010553642.1|  PREDICTED: metalloendoproteinase 1                 196   5e-56   
gb|KGN51345.1|  hypothetical protein Csa_5G522910                       194   8e-56   
ref|XP_003519796.1|  PREDICTED: metalloendoproteinase 1-like            196   9e-56   
ref|XP_002319607.2|  hypothetical protein POPTR_0013s03350g             194   9e-56   Populus trichocarpa [western balsam poplar]
gb|EYU22461.1|  hypothetical protein MIMGU_mgv1a008611mg                196   9e-56   
ref|XP_004297678.1|  PREDICTED: metalloendoproteinase 1-like            196   1e-55   
gb|EYU46220.1|  hypothetical protein MIMGU_mgv1a010241mg                194   1e-55   
ref|XP_011002109.1|  PREDICTED: metalloendoproteinase 1-like            195   1e-55   
ref|XP_004159086.1|  PREDICTED: matrix metalloproteinase-9-like         193   2e-55   
ref|NP_001235535.1|  metalloendoproteinase 1 precursor                  193   2e-55   
ref|XP_002888162.1|  predicted protein                                  194   2e-55   
ref|XP_004142459.1|  PREDICTED: matrix metalloproteinase-9-like         192   3e-55   
gb|AES96374.2|  matrix metalloproteinase                                194   3e-55   
ref|XP_002311051.2|  hypothetical protein POPTR_0008s02790g             192   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_007219827.1|  hypothetical protein PRUPE_ppa026649mg             193   5e-55   
ref|XP_010471013.1|  PREDICTED: metalloendoproteinase 1-like            194   5e-55   
ref|XP_010512095.1|  PREDICTED: metalloendoproteinase 1                 194   5e-55   
ref|XP_003613416.1|  Matrix metalloproteinase-9                         194   7e-55   
ref|XP_008458912.1|  PREDICTED: metalloendoproteinase 1-like            191   1e-54   
gb|KCW56124.1|  hypothetical protein EUGRSUZ_I01878                     191   1e-54   
gb|KHN28682.1|  Metalloendoproteinase 1                                 193   2e-54   
ref|XP_002322292.2|  hypothetical protein POPTR_0015s11510g             192   2e-54   Populus trichocarpa [western balsam poplar]
ref|NP_173824.2|  putative metalloproteinase                            193   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458915.1|  PREDICTED: metalloendoproteinase 1-like            191   2e-54   
ref|XP_004142460.1|  PREDICTED: metalloendoproteinase 1-like            190   2e-54   
ref|XP_010552627.1|  PREDICTED: metalloendoproteinase 1                 192   2e-54   
ref|XP_010030761.1|  PREDICTED: metalloendoproteinase 1-like            191   2e-54   
gb|AAC00572.1|  similar to zinc metalloproteinases                      192   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20327.1|  unknown                                                 190   3e-54   Glycine max [soybeans]
gb|KCW85819.1|  hypothetical protein EUGRSUZ_B02562                     192   3e-54   
ref|XP_007157519.1|  hypothetical protein PHAVU_002G076600g             192   3e-54   
ref|XP_008458914.1|  PREDICTED: metalloendoproteinase 1-like            189   4e-54   
ref|XP_004142468.1|  PREDICTED: metalloendoproteinase 1-like            189   5e-54   
ref|XP_006416025.1|  hypothetical protein EUTSA_v10007920mg             191   6e-54   
ref|XP_008458913.1|  PREDICTED: metalloendoproteinase 1-like            189   9e-54   
ref|XP_004142843.1|  PREDICTED: metalloendoproteinase 1-like            188   1e-53   
ref|XP_006300514.1|  hypothetical protein CARUB_v10020497mg             190   2e-53   
gb|EYU46223.1|  hypothetical protein MIMGU_mgv1a025538mg                187   2e-53   
ref|XP_008798076.1|  PREDICTED: metalloendoproteinase 1-like            191   2e-53   
ref|XP_010510985.1|  PREDICTED: metalloendoproteinase 1-like            189   2e-53   
ref|XP_002893327.1|  hypothetical protein ARALYDRAFT_889959             190   2e-53   
ref|XP_010913461.1|  PREDICTED: metalloendoproteinase 1-like            189   2e-53   
ref|XP_006304956.1|  hypothetical protein CARUB_v10011449mg             189   3e-53   
ref|XP_009418044.1|  PREDICTED: metalloendoproteinase 1-like            189   3e-53   
gb|ACJ24812.1|  matrix metalloproteinase                                189   4e-53   Pinus taeda
ref|XP_010264870.1|  PREDICTED: metalloendoproteinase 1-like            187   5e-53   
gb|KFK40830.1|  hypothetical protein AALP_AA2G047000                    188   6e-53   
gb|KFK44477.1|  hypothetical protein AALP_AA1G261400                    188   1e-52   
ref|XP_010043822.1|  PREDICTED: metalloendoproteinase 1-like            190   2e-52   
ref|XP_002533939.1|  Metalloendoproteinase 1 precursor, putative        183   2e-52   Ricinus communis
ref|XP_004142467.1|  PREDICTED: matrix metalloproteinase-9-like         185   2e-52   
ref|XP_007033356.1|  Matrixin family protein, putative                  187   2e-52   
ref|XP_002318762.2|  MATRIX METALLOproteinASE                           187   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_010470167.1|  PREDICTED: metalloendoproteinase 1-like            186   3e-52   
gb|EYU46221.1|  hypothetical protein MIMGU_mgv1a010535mg                185   3e-52   
gb|EYU46222.1|  hypothetical protein MIMGU_mgv1a027058mg                184   4e-52   
gb|KCW49213.1|  hypothetical protein EUGRSUZ_K02793                     182   5e-52   
ref|XP_011042944.1|  PREDICTED: metalloendoproteinase 1-like            186   6e-52   
ref|XP_006357274.1|  PREDICTED: metalloendoproteinase 1-like            184   1e-51   
ref|XP_009113266.1|  PREDICTED: metalloendoproteinase 1                 185   1e-51   
emb|CDY45157.1|  BnaA09g14350D                                          184   2e-51   
dbj|BAJ94792.1|  predicted protein                                      184   3e-51   
ref|XP_011019812.1|  PREDICTED: metalloendoproteinase 1-like            182   3e-51   
emb|CDY30915.1|  BnaC09g14910D                                          184   3e-51   
gb|EYU42526.1|  hypothetical protein MIMGU_mgv1a011887mg                180   6e-51   
ref|XP_010477738.1|  PREDICTED: metalloendoproteinase 1                 183   8e-51   
gb|KHN16358.1|  Metalloendoproteinase 1                                 181   8e-51   
ref|XP_006367952.1|  PREDICTED: metalloendoproteinase 1-like            182   1e-50   
ref|XP_004953898.1|  PREDICTED: metalloendoproteinase 1-like            181   3e-50   
ref|XP_010460187.1|  PREDICTED: metalloendoproteinase 1-like            181   3e-50   
ref|XP_004965108.1|  PREDICTED: metalloendoproteinase 1-like            181   4e-50   
ref|XP_010498935.1|  PREDICTED: metalloendoproteinase 1-like            182   5e-50   
emb|CBI34984.3|  unnamed protein product                                186   5e-50   
ref|XP_004965107.1|  PREDICTED: metalloendoproteinase 1-like            179   5e-50   
emb|CDY16241.1|  BnaA09g29750D                                          180   1e-49   
gb|KDO75343.1|  hypothetical protein CISIN_1g043086mg                   176   2e-49   
ref|XP_007033352.1|  Matrixin family protein                            176   2e-49   
gb|ACB59207.1|  matrixin family protein                                 179   2e-49   Brassica oleracea
gb|EYU29520.1|  hypothetical protein MIMGU_mgv1a018504mg                176   3e-49   
gb|EAY87473.1|  hypothetical protein OsI_08881                          179   3e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_009115471.1|  PREDICTED: metalloendoproteinase 1                 179   3e-49   
ref|NP_001048075.1|  Os02g0740700                                       179   4e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24565.1|  hypothetical protein OsJ_08327                          178   4e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010695886.1|  PREDICTED: metalloendoproteinase 1-like            177   6e-49   
ref|XP_009410261.1|  PREDICTED: metalloendoproteinase 1                 178   6e-49   
gb|KHN16360.1|  Metalloendoproteinase 1                                 176   6e-49   
ref|XP_010320628.1|  PREDICTED: metalloendoproteinase 1                 177   8e-49   
ref|XP_003554856.1|  PREDICTED: metalloendoproteinase 1-like            175   1e-48   
ref|XP_010440122.1|  PREDICTED: metalloendoproteinase 1-like            177   1e-48   
ref|XP_002452573.1|  hypothetical protein SORBIDRAFT_04g028370          177   2e-48   Sorghum bicolor [broomcorn]
emb|CDY66521.1|  BnaCnng51190D                                          176   2e-48   
ref|XP_007215990.1|  hypothetical protein PRUPE_ppa011783mg             171   2e-48   
ref|XP_006647869.1|  PREDICTED: metalloendoproteinase 1-like            176   2e-48   
ref|XP_010451026.1|  PREDICTED: metalloendoproteinase 1-like            176   3e-48   
ref|XP_006603838.1|  PREDICTED: metalloendoproteinase 1-like            175   3e-48   
ref|XP_010695895.1|  PREDICTED: metalloendoproteinase 1-like            176   4e-48   
ref|NP_001151749.1|  metalloendoproteinase 1 precursor                  175   6e-48   Zea mays [maize]
gb|KHN16355.1|  Metalloendoproteinase 1                                 172   7e-48   
ref|XP_003560867.1|  PREDICTED: metalloendoproteinase 1-like            175   9e-48   
ref|XP_009136800.1|  PREDICTED: metalloendoproteinase 1-like            174   1e-47   
ref|XP_010449738.1|  PREDICTED: metalloendoproteinase 1-like            174   2e-47   
dbj|BAJ93963.1|  predicted protein                                      174   2e-47   
ref|XP_010434790.1|  PREDICTED: metalloendoproteinase 1-like            174   2e-47   
ref|XP_002274477.1|  PREDICTED: metalloendoproteinase 1                 173   3e-47   Vitis vinifera
ref|XP_003618349.1|  Interstitial collagenase                           172   4e-47   
ref|XP_002436777.1|  hypothetical protein SORBIDRAFT_10g008650          173   5e-47   Sorghum bicolor [broomcorn]
ref|NP_001142095.1|  hypothetical protein precursor                     173   5e-47   Zea mays [maize]
ref|XP_006283956.1|  hypothetical protein CARUB_v10005079mg             173   5e-47   
emb|CDX90504.1|  BnaA03g42770D                                          172   8e-47   
ref|XP_002870142.1|  hypothetical protein ARALYDRAFT_493212             171   1e-46   
dbj|BAJ98922.1|  predicted protein                                      171   1e-46   
gb|EAY79487.1|  hypothetical protein OsI_34615                          171   1e-46   
emb|CAN66084.1|  hypothetical protein VITISV_024635                     171   3e-46   
ref|XP_010089255.1|  Metalloendoproteinase 1                            170   3e-46   
ref|NP_001065361.2|  Os10g0557900                                       170   3e-46   
ref|XP_007052204.1|  Matrixin family protein                            169   8e-46   
ref|NP_193397.1|  Matrixin family protein                               169   1e-45   
gb|AAO42162.1|  putative proteinase                                     169   1e-45   
ref|XP_003574325.2|  PREDICTED: metalloendoproteinase 1-like            171   1e-45   
ref|XP_010910625.1|  PREDICTED: metalloendoproteinase 1-like            169   2e-45   
ref|XP_011020982.1|  PREDICTED: metalloendoproteinase 1-like            166   2e-45   
ref|XP_010444942.1|  PREDICTED: metalloendoproteinase 1-like            167   5e-45   
dbj|BAJ94176.1|  predicted protein                                      167   5e-45   
ref|XP_004152428.1|  PREDICTED: metalloendoproteinase 1-like            166   1e-44   
ref|XP_004169198.1|  PREDICTED: metalloendoproteinase 1-like            165   1e-44   
gb|AAM62476.1|  proteinase like protein                                 166   2e-44   
ref|XP_011080438.1|  PREDICTED: metalloendoproteinase 1-like            164   2e-44   
gb|KDP28814.1|  hypothetical protein JCGZ_14585                         166   2e-44   
ref|XP_008802827.1|  PREDICTED: metalloendoproteinase 1-like            166   2e-44   
ref|XP_004301194.1|  PREDICTED: metalloendoproteinase 1-like            166   2e-44   
ref|XP_010264331.1|  PREDICTED: metalloendoproteinase 1-like            165   3e-44   
ref|XP_010325488.1|  PREDICTED: metalloendoproteinase 1                 165   4e-44   
ref|NP_001057259.1|  Os06g0239100                                       165   6e-44   
gb|AET01165.2|  matrix metalloproteinase                                164   6e-44   
ref|XP_006355432.1|  PREDICTED: metalloendoproteinase 1-like            164   6e-44   
gb|EAZ00310.1|  hypothetical protein OsI_22327                          165   6e-44   
ref|XP_002969781.1|  hypothetical protein SELMODRAFT_13930              162   8e-44   
gb|KGN50256.1|  hypothetical protein Csa_5G162050                       164   1e-43   
ref|XP_003626689.1|  Matrix metalloproteinase-27                        164   2e-43   
ref|XP_002511639.1|  Metalloendoproteinase 1 precursor, putative        163   2e-43   
ref|XP_006440301.1|  hypothetical protein CICLE_v10024210mg             162   3e-43   
ref|XP_008379873.1|  PREDICTED: metalloendoproteinase 1-like            161   3e-43   
ref|XP_006414320.1|  hypothetical protein EUTSA_v10025551mg             162   3e-43   
ref|XP_007039816.1|  Matrixin family protein                            162   4e-43   
ref|XP_009334548.1|  PREDICTED: metalloendoproteinase 1                 162   4e-43   
emb|CDY40518.1|  BnaC01g19940D                                          162   5e-43   
ref|XP_006477577.1|  PREDICTED: metalloendoproteinase 1-like            162   5e-43   
ref|XP_006375259.1|  hypothetical protein POPTR_0014s05720g             162   6e-43   
ref|XP_008437072.1|  PREDICTED: metalloendoproteinase 1                 162   6e-43   
ref|XP_009610496.1|  PREDICTED: metalloendoproteinase 1-like            161   7e-43   
ref|XP_008369492.1|  PREDICTED: metalloendoproteinase 1                 161   8e-43   
ref|XP_010647716.1|  PREDICTED: metalloendoproteinase 1-like            160   8e-43   
ref|XP_009397655.1|  PREDICTED: metalloendoproteinase 1-like            161   9e-43   
gb|KHN25070.1|  Metalloendoproteinase 1                                 161   1e-42   
ref|XP_002534615.1|  Metalloendoproteinase 1 precursor, putative        160   1e-42   
ref|XP_007219228.1|  hypothetical protein PRUPE_ppa017777mg             162   1e-42   
emb|CAN65266.1|  hypothetical protein VITISV_040133                     159   2e-42   
ref|XP_008373793.1|  PREDICTED: metalloendoproteinase 1-like            160   2e-42   
ref|XP_011033214.1|  PREDICTED: metalloendoproteinase 1                 160   2e-42   
emb|CDP09976.1|  unnamed protein product                                159   2e-42   
ref|XP_009145660.1|  PREDICTED: metalloendoproteinase 1-like            160   2e-42   
ref|XP_006583548.1|  PREDICTED: metalloendoproteinase 1-like            160   2e-42   
gb|EYU34693.1|  hypothetical protein MIMGU_mgv1a025583mg                154   2e-42   
ref|XP_004983677.1|  PREDICTED: metalloendoproteinase 1-like            160   2e-42   
ref|XP_010053954.1|  PREDICTED: metalloendoproteinase 1                 160   3e-42   
ref|XP_006577655.1|  PREDICTED: metalloendoproteinase 1-like            160   3e-42   
ref|XP_009398117.1|  PREDICTED: metalloendoproteinase 1                 160   3e-42   
ref|XP_006387815.1|  hypothetical protein POPTR_0547s00200g             159   4e-42   
gb|EYU19330.1|  hypothetical protein MIMGU_mgv1a010192mg                159   4e-42   
ref|XP_006361512.1|  PREDICTED: metalloendoproteinase 1-like            159   5e-42   
gb|KDP39879.1|  hypothetical protein JCGZ_03410                         159   1e-41   
ref|XP_006369019.1|  senescence-specific family protein                 159   1e-41   
ref|XP_003573113.1|  PREDICTED: metalloendoproteinase 1-like            159   1e-41   
ref|XP_009780227.1|  PREDICTED: metalloendoproteinase 1-like            158   1e-41   
ref|XP_007134548.1|  hypothetical protein PHAVU_010G056300g             158   2e-41   
ref|XP_002464938.1|  hypothetical protein SORBIDRAFT_01g029150          158   2e-41   
ref|XP_004511690.1|  PREDICTED: metalloendoproteinase 1-like            157   2e-41   
ref|XP_010538414.1|  PREDICTED: metalloendoproteinase 1                 157   3e-41   
gb|EYU31934.1|  hypothetical protein MIMGU_mgv1a021000mg                157   4e-41   
ref|XP_007216495.1|  hypothetical protein PRUPE_ppa023859mg             152   4e-41   
ref|XP_011001486.1|  PREDICTED: metalloendoproteinase 1-like            157   4e-41   
ref|XP_010524412.1|  PREDICTED: metalloendoproteinase 1                 157   4e-41   
ref|XP_008658321.1|  PREDICTED: metalloendoproteinase 1-like            157   5e-41   
ref|XP_011094514.1|  PREDICTED: metalloendoproteinase 1                 156   6e-41   
ref|XP_007010972.1|  Matrixin family protein                            154   1e-40   
emb|CDP09487.1|  unnamed protein product                                155   1e-40   
ref|XP_004963649.1|  PREDICTED: metalloendoproteinase 1-like            155   2e-40   
ref|XP_002979138.1|  hypothetical protein SELMODRAFT_110370             155   2e-40   
gb|KGN52411.1|  hypothetical protein Csa_5G632100                       154   2e-40   
gb|KCW77797.1|  hypothetical protein EUGRSUZ_D02088                     155   2e-40   
emb|CAN66781.1|  hypothetical protein VITISV_013507                     155   3e-40   
ref|XP_009629020.1|  PREDICTED: metalloendoproteinase 1-like            155   3e-40   
ref|XP_008238512.1|  PREDICTED: metalloendoproteinase 1                 154   3e-40   
ref|XP_007157295.1|  hypothetical protein PHAVU_002G058000g             154   4e-40   
ref|XP_007151139.1|  hypothetical protein PHAVU_004G021000g             152   4e-40   
ref|XP_004248606.1|  PREDICTED: metalloendoproteinase 1-like            154   4e-40   
ref|XP_010053486.1|  PREDICTED: metalloendoproteinase 1-like            155   4e-40   
ref|XP_007210794.1|  hypothetical protein PRUPE_ppa018176mg             154   5e-40   
ref|XP_011010768.1|  PREDICTED: metalloendoproteinase 1-like            149   6e-40   
ref|XP_001774956.1|  predicted protein                                  152   6e-40   
ref|XP_003635123.1|  PREDICTED: metalloendoproteinase 1                 152   7e-40   
ref|XP_003611315.1|  Matrix metalloproteinase-28                        153   1e-39   
ref|XP_002988587.1|  hypothetical protein SELMODRAFT_128150             153   1e-39   
ref|XP_006431002.1|  hypothetical protein CICLE_v10013597mg             148   2e-39   
ref|XP_010692448.1|  PREDICTED: metalloendoproteinase 1                 152   2e-39   
gb|EYU29746.1|  hypothetical protein MIMGU_mgv1a022148mg                147   2e-39   
ref|XP_010055492.1|  PREDICTED: metalloendoproteinase 1                 152   3e-39   
ref|XP_002309553.2|  hypothetical protein POPTR_0006s25750g             150   4e-39   
ref|XP_003538740.1|  PREDICTED: metalloendoproteinase 1-like            151   5e-39   
gb|EPS70970.1|  hypothetical protein M569_03790                         150   5e-39   
ref|XP_011081262.1|  PREDICTED: metalloendoproteinase 1-like            151   8e-39   
gb|AGT16050.1|  metalloendoproteinase                                   151   8e-39   
ref|XP_004167465.1|  PREDICTED: metalloendoproteinase 1-like            146   9e-39   
ref|XP_006371425.1|  hypothetical protein POPTR_0019s10250g             146   1e-38   
ref|XP_011032037.1|  PREDICTED: metalloendoproteinase 1                 152   1e-38   
gb|EYU20655.1|  hypothetical protein MIMGU_mgv1a025968mg                145   1e-38   
gb|EYU29747.1|  hypothetical protein MIMGU_mgv1a025729mg                145   1e-38   
ref|XP_007041108.1|  Matrix metalloproteinase, putative                 148   1e-38   
gb|KHN34932.1|  Metalloendoproteinase 1                                 150   1e-38   
ref|WP_001265815.1|  hypothetical protein                               147   1e-38   
ref|XP_007157294.1|  hypothetical protein PHAVU_002G058000g             148   2e-38   
ref|XP_002440092.1|  hypothetical protein SORBIDRAFT_09g025870          150   2e-38   
ref|XP_003516663.2|  PREDICTED: metalloendoproteinase 1-like            149   3e-38   
gb|EYU34692.1|  hypothetical protein MIMGU_mgv1a022100mg                143   4e-38   
ref|XP_003562240.2|  PREDICTED: metalloendoproteinase 1                 149   4e-38   
ref|XP_010647717.1|  PREDICTED: metalloendoproteinase 1-like            146   9e-38   
ref|XP_004510108.1|  PREDICTED: metalloendoproteinase 1-like            147   1e-37   
ref|XP_010647721.1|  PREDICTED: metalloendoproteinase 1-like            145   1e-37   
ref|XP_002304280.1|  hypothetical protein POPTR_0003s07510g             144   7e-37   
gb|KDO37620.1|  hypothetical protein CISIN_1g039712mg                   140   2e-36   
ref|XP_007157518.1|  hypothetical protein PHAVU_002G076500g             143   2e-36   
gb|KHN01125.1|  Metalloendoproteinase 1                                 140   8e-36   
ref|XP_008458908.1|  PREDICTED: metalloendoproteinase 1-like            140   3e-35   
ref|XP_004167463.1|  PREDICTED: metalloendoproteinase 1-like            136   4e-35   
gb|KFK37298.1|  hypothetical protein AALP_AA4G239100                    140   4e-35   
ref|XP_003613392.1|  Matrix metalloprotease                             139   8e-35   
ref|XP_006293383.1|  hypothetical protein CARUB_v10023542mg             139   1e-34   
ref|WP_035319307.1|  hypothetical protein                               136   2e-34   
ref|XP_010676950.1|  PREDICTED: metalloendoproteinase 1-like            139   3e-34   
ref|XP_007215299.1|  hypothetical protein PRUPE_ppa005073mg             140   4e-34   
ref|XP_006397684.1|  hypothetical protein EUTSA_v10001525mg             138   4e-34   
ref|XP_001779172.1|  predicted protein                                  135   4e-34   
gb|EYF01915.1|  Interstitial collagenase precursor                      139   4e-34   
ref|XP_005149869.1|  PREDICTED: matrilysin                              135   5e-34   
ref|XP_007217818.1|  hypothetical protein PRUPE_ppb019632mg             135   7e-34   
ref|XP_010508218.1|  PREDICTED: metalloendoproteinase 1-like            137   1e-33   
ref|WP_000775479.1|  hypothetical protein                               134   1e-33   
emb|CBI32079.3|  unnamed protein product                                136   1e-33   
ref|XP_009143096.1|  PREDICTED: metalloendoproteinase 1                 137   2e-33   
prf||1905425A  metalloprotease                                          131   3e-33
gb|KFO69571.1|  Stromelysin-1                                           133   3e-33   
ref|XP_009554452.1|  PREDICTED: matrilysin                              134   3e-33   
gb|KDO61427.1|  hypothetical protein CISIN_1g037540mg                   135   3e-33   
emb|CDX74706.1|  BnaA05g04520D                                          135   4e-33   
ref|XP_004142464.1|  PREDICTED: metalloendoproteinase 1-like            134   5e-33   
emb|CDY18956.1|  BnaC04g03940D                                          134   5e-33   
gb|AAC31167.1|  metalloproteinase                                       134   1e-32   
ref|NP_182030.1|  matrixin family protein                               134   1e-32   
gb|KFQ46681.1|  Matrilysin                                              131   2e-32   
ref|XP_010009153.1|  PREDICTED: matrilysin                              131   2e-32   
ref|XP_007890011.1|  PREDICTED: neutrophil collagenase-like             134   3e-32   
ref|XP_002880153.1|  matrix metalloproteinase                           132   3e-32   
gb|KHN28681.1|  Metalloendoproteinase 1                                 130   5e-32   
gb|KFO07157.1|  Matrilysin                                              130   5e-32   
ref|XP_009509073.1|  PREDICTED: matrilysin                              130   6e-32   
ref|XP_010302293.1|  PREDICTED: matrilysin                              130   6e-32   
gb|KFW77959.1|  Stromelysin-1                                           130   7e-32   
ref|XP_010518113.1|  PREDICTED: metalloendoproteinase 1-like            132   7e-32   
ref|NP_062344.1|  stromelysin-2 precursor                               133   7e-32   
ref|XP_005346835.1|  PREDICTED: stromelysin-2                           133   8e-32   
ref|XP_009640064.1|  PREDICTED: matrilysin                              129   9e-32   
gb|KFP18449.1|  Stromelysin-1                                           129   9e-32   
ref|XP_009936824.1|  PREDICTED: matrilysin                              129   9e-32   
gb|KFP62029.1|  Stromelysin-1                                           129   1e-31   
gb|KFR13852.1|  Matrilysin                                              129   1e-31   
ref|XP_002892736.1|  predicted protein                                  127   1e-31   
gb|KFP52111.1|  Matrilysin                                              129   1e-31   
ref|XP_009958192.1|  PREDICTED: matrilysin                              129   1e-31   
ref|XP_009708511.1|  PREDICTED: matrilysin                              129   1e-31   
gb|KFQ16528.1|  Stromelysin-1                                           129   1e-31   
gb|KFV41114.1|  Stromelysin-1                                           129   2e-31   
ref|XP_009805940.1|  PREDICTED: matrilysin                              129   2e-31   
ref|XP_010377363.1|  PREDICTED: stromelysin-2                           132   2e-31   
ref|XP_006983829.1|  PREDICTED: stromelysin-2                           132   2e-31   
ref|XP_003496181.1|  PREDICTED: stromelysin-2                           132   2e-31   
ref|XP_007637742.1|  PREDICTED: stromelysin-2                           132   2e-31   
ref|WP_014642607.1|  M10 family peptidase                               130   3e-31   
gb|KGL80216.1|  Matrilysin                                              128   3e-31   
ref|XP_001635715.1|  predicted protein                                  128   3e-31   
ref|XP_009973912.1|  PREDICTED: matrilysin                              128   4e-31   
gb|KFV43873.1|  Stromelysin-2                                           127   4e-31   
ref|XP_003780849.1|  PREDICTED: stromelysin-2                           131   4e-31   
ref|XP_002873690.1|  predicted protein                                  125   5e-31   
ref|XP_010217214.1|  PREDICTED: matrilysin                              128   6e-31   
ref|XP_010788063.1|  PREDICTED: matrix metalloproteinase-19-like        127   6e-31   
ref|XP_004052079.1|  PREDICTED: matrix metalloproteinase-20             130   6e-31   
ref|WP_037696766.1|  hypothetical protein                               127   7e-31   
ref|NP_001006278.1|  matrilysin precursor                               127   7e-31   
ref|NP_598198.1|  stromelysin-2 precursor                               130   8e-31   
gb|KGL96791.1|  Stromelysin-1                                           127   8e-31   
gb|EDL78531.1|  rCG31835                                                130   8e-31   
ref|XP_003219339.1|  PREDICTED: stromelysin-1-like                      130   9e-31   
gb|KFF99256.1|  hypothetical protein IQ62_20055                         129   9e-31   
ref|XP_009887715.1|  PREDICTED: matrilysin                              127   9e-31   
gb|EGV95531.1|  Stromelysin-2                                           133   1e-30   
ref|XP_007434824.1|  PREDICTED: macrophage metalloelastase-like         127   1e-30   
ref|XP_005346833.1|  PREDICTED: stromelysin-1                           129   1e-30   
ref|XP_009490287.1|  PREDICTED: matrilysin                              126   1e-30   
gb|KFV87419.1|  Matrilysin                                              126   1e-30   
ref|XP_009685061.1|  PREDICTED: matrilysin                              126   1e-30   
gb|KFQ57727.1|  Stromelysin-1                                           126   1e-30   
ref|NP_001165700.1|  matrix metalloproteinase-28 a precursor            129   1e-30   
ref|XP_006983827.1|  PREDICTED: stromelysin-1                           129   2e-30   
pdb|1SLM|A  Chain A, Crystal Structure Of Fibroblast Stromelysin-...    126   2e-30   
dbj|BAA83518.1|  matrilysin                                             126   2e-30   
ref|XP_003739756.1|  PREDICTED: matrix metalloproteinase-16-like        130   2e-30   
gb|EOB07965.1|  Matrilysin                                              125   2e-30   
gb|KFV96739.1|  Stromelysin-1                                           125   2e-30   
ref|XP_009083841.1|  PREDICTED: matrilysin                              127   2e-30   
gb|EFB17312.1|  hypothetical protein PANDA_010999                       125   2e-30   
ref|XP_005010554.1|  PREDICTED: matrilysin isoform X2                   126   2e-30   
ref|XP_009571839.1|  PREDICTED: matrilysin                              125   2e-30   
gb|EYU29523.1|  hypothetical protein MIMGU_mgv1a020428mg                124   3e-30   
ref|XP_008424216.1|  PREDICTED: matrilysin-like                         128   3e-30   
ref|XP_010129608.1|  PREDICTED: matrilysin                              125   3e-30   
ref|NP_001083604.1|  matrix metalloproteinase-28 b precursor            128   3e-30   
ref|XP_005010553.1|  PREDICTED: matrilysin isoform X1                   125   3e-30   
ref|XP_007562840.1|  PREDICTED: matrix metalloproteinase-20-like        128   3e-30   



>gb|KDP45996.1| hypothetical protein JCGZ_11899 [Jatropha curcas]
 gb|KDP45997.1| hypothetical protein JCGZ_11900 [Jatropha curcas]
Length=309

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 175/271 (65%), Gaps = 15/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQGSKKGD++KG++ LKKYLK FGY++    N S ++ D F D LESA+++YQ  +HLN+
Sbjct  43   LQGSKKGDKIKGIHELKKYLKHFGYLS--CENQSFADDDEFDDVLESALKVYQLNYHLNT  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEPKWPA  327
            TG LD +T   MM PRCG+ DIING+ R   G+           +V HY F+  +PKWP 
Sbjct  101  TGFLDYETMSIMMMPRCGIPDIINGSTRMLSGKNNHRHSSSSFHMVSHYTFFRGKPKWPV  160

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
            +K +LTYGF P TP++    VA A + W  V ++   S   +  ADLK   + GEHGDG+
Sbjct  161  SKYNLTYGFEPSTPTEARGAVANAFETWATVTKFKFTSVQDYKTADLKIGFYRGEHGDGL  220

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
            PFDG GG  AHAF P+ G  H+DADE +   G      D+++VALHEIGHLLGL HS  +
Sbjct  221  PFDGPGGITAHAFAPQDGRFHYDADEKYA-VGAVQGAFDLKTVALHEIGHLLGLQHSSLQ  279

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
             AVM+     G  K DLTADD+ GIRALY+F
Sbjct  280  AAVMYAYTSRGVTK-DLTADDVQGIRALYNF  309



>ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=311

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 169/272 (62%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSSEADYFSDQLESAIRIYQTRHHLN  177
            LQG  KGD +KG+++LKKYL+ FGY   LSY N S S  D F D LE A++ YQ  +HLN
Sbjct  44   LQGCHKGDNLKGIHDLKKYLENFGY---LSYKNQSHSNDDDFDDLLEYALKTYQFNYHLN  100

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKW  321
             TG LD++T  +MM PRCGVADIINGT R                  V HY F+P  P+W
Sbjct  101  VTGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSSTSFHTVSHYEFFPGNPRW  160

Query  322  PANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHG  498
            PA+K HLTYGF PGTP++ + PVA A + W     +F F+R   +  AD+      G+HG
Sbjct  161  PASKYHLTYGFLPGTPNQAMEPVAKAFQTW-AANTHFRFTRVQDYRAADITIGFHRGDHG  219

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG PFDGRGG+ AHAF P+ G  H+D DEHW   G      D+++VALHEIGHLLGL HS
Sbjct  220  DGSPFDGRGGTLAHAFAPQDGRFHYDGDEHWA-VGATQGAFDVETVALHEIGHLLGLGHS  278

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
                A+M    + G  K  L +DDI GIRALY
Sbjct  279  SVEGAIMHPSIQSGATK-GLHSDDIQGIRALY  309



>ref|XP_008230957.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=310

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 169/269 (63%), Gaps = 20/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N    N      D F DQLE+AI+ YQ  +HL +
Sbjct  49   LKGCHKGDKVQGIQDLKKYLERFGYLNGDINN------DDFDDQLEAAIKTYQINYHLKA  102

Query  181  TGILDADTARQMMKPRCGVADIINGT-------RRRP---GGEVVPHYRFYPDEPKWPAN  330
            TG LD  T  +MM PRCGV DIINGT       +R P   GG  V HY F+   PKWPAN
Sbjct  103  TGTLDTKTISKMMMPRCGVPDIINGTTAMRSGKKRHPHHHGGHTVAHYAFFQGSPKWPAN  162

Query  331  KRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGV  507
            K HLTYGFA GTP+  +  V  A   W     +FSFSR    + ADLK +  SGEHGDG 
Sbjct  163  KYHLTYGFARGTPANAVGAVTRAFATWAG-NTHFSFSRAKSVDSADLKISFGSGEHGDGR  221

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
            PFDG GG  AHA+ P  G  H+DADE WV  G  P G+D+++VALHEIGHLLGL+HS   
Sbjct  222  PFDGPGGVLAHAYAPTNGRFHYDADETWV-VGAVPGGMDLETVALHEIGHLLGLEHSSVE  280

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             AVM      G   + L ADDI GI+ALY
Sbjct  281  GAVMLPGIRAGF-TQSLHADDIQGIKALY  308



>ref|XP_008230959.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 166/271 (61%), Gaps = 20/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ NLK YL+ FGY+N  + N      DYF D+LE AI+ YQ  +HL  
Sbjct  50   LKGCHKGDKVQGIQNLKIYLEKFGYLNGNTNND-----DYFDDELELAIKTYQINYHLKV  104

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG LDA T ++M  PRCGV DIINGT     G           V HY F+   PKWPANK
Sbjct  105  TGTLDAKTVKKMEIPRCGVPDIINGTTSMRSGNKRGGHGSTHTVGHYAFFQGNPKWPANK  164

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGV-  507
             HLTYGF  GTPS+ +  VA A   W     +F+FS+   F +ADLK     G+HGDG  
Sbjct  165  YHLTYGFLQGTPSEAVGAVARAFATWQG-NTHFTFSQAQSFESADLKIGFGRGDHGDGAN  223

Query  508  -PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
              FDG G + AHAFPP  G  H+DADE WV  G  P G D+++VALHEIGHLLGLDHS  
Sbjct  224  NAFDGPGKTIAHAFPPSDGRFHYDADETWV-VGAVPGGFDLETVALHEIGHLLGLDHSSV  282

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALYH  777
              AVM  +   G   + L ADD+ GIRALY+
Sbjct  283  SGAVMQSQIPSG-YTQSLHADDVQGIRALYN  312



>ref|XP_008230962.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=314

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 164/271 (61%), Gaps = 16/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+     D F DQLESAI+ YQ  +HL +
Sbjct  47   LKGCHKGDKVQGIKDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQINYHLKA  104

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEPKWPA  327
            TG LDA T   MM PRCGVADIINGT     G+            V HY F+   PKWPA
Sbjct  105  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGKKRHPHHHHGGHTVAHYSFFQGNPKWPA  164

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDG  504
            +K HLTY F  GTP++ + PV++A + W     +F+FS      N DL  +   G HGDG
Sbjct  165  SKYHLTYAFLQGTPAEAMGPVSSAFQTW-AANTHFTFSEVQSNQNPDLTVSFHRGNHGDG  223

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG GG+ AHAF P  G  H+DA E W   G      D+QSVALHEIGHLLGL HS  
Sbjct  224  APFDGPGGTIAHAFAPTNGRFHYDAAEAWA-VGAVSGAFDLQSVALHEIGHLLGLGHSSV  282

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            + A+M+     G  ++ L  DDI GI+ALY+
Sbjct  283  QGAIMFPSIGTGVTEQSLHGDDIQGIKALYN  313



>ref|XP_008458713.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=282

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 166/273 (61%), Gaps = 18/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G KKGD+V+G++ +KKYL+ FGY+N+  +  S S  D F + LE A++ YQ  ++L +
Sbjct  10   LNGCKKGDKVEGIHQMKKYLQHFGYMNNDVHIHSKSSDDEFDEILEFAVKTYQINYNLKA  69

Query  181  TGILDADTARQMMKPRCGVADIING-TRRRPGGEVV-------------PHYRFYPDEPK  318
            TG LD  T  QM KPRCGVADIING T  + G  +V              H+ F+    K
Sbjct  70   TGTLDNSTISQMSKPRCGVADIINGRTGMKSGKRLVNRHRKIIGHFHEVSHFAFFEGNLK  129

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEH  495
            WP +K HLTYGF PGTPS+ I PV  A   W     +FSFS+ + + NAD+K     G+H
Sbjct  130  WPNSKSHLTYGFLPGTPSEAISPVNRAFTTW-AANTHFSFSQESNYENADIKVTFERGDH  188

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFD  GG  AHAF P  G  HFDA EHW + G  PN  D+++VALHEIGHLLGL H
Sbjct  189  GDGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWAD-GAVPNSYDMETVALHEIGHLLGLHH  247

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    A+MW     G   + L ADDI GI+ LY
Sbjct  248  SSVEGAIMWPSI-MGGTTKGLHADDIEGIKVLY  279



>ref|XP_008230963.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 165/271 (61%), Gaps = 17/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY   LS N+     D F DQLESAI+ YQ  +HL +
Sbjct  47   LKGCHKGDKVQGIQDLKKYLGKFGY---LSSNNGHLNDDDFDDQLESAIKTYQINYHLKA  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEPKWPA  327
            TG LDA T   MM PRCGVADIINGT     G+            V +Y F+   P WPA
Sbjct  104  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGQKRHPHHHHRGHTVANYSFFQGNPTWPA  163

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDG  504
            +K HLTY F  GTP++ + PV++A + W     +F+FS      N DL  +   G+HGDG
Sbjct  164  SKYHLTYAFLQGTPAEAMGPVSSAFQTW-AANTHFTFSEAQNNQNPDLTVSFNRGDHGDG  222

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG GG+ AHAF P  G  H+DADE +   G      D +++ALHEIGHLLGL HS  
Sbjct  223  TPFDGPGGTIAHAFAPTNGRLHYDADERF-SVGAVSGAYDFETIALHEIGHLLGLGHSSV  281

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            +EA+M+     GE ++ L  DDI GI+ALY+
Sbjct  282  QEAIMFPSVRSGETQQSLHGDDIQGIKALYN  312



>ref|XP_006482472.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=320

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 169/274 (62%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEA--DYFSDQLESAIRIYQTRHHL  174
            L+G  KGD++KG++ LKKY++ FGY+N  +Y + S+ A  D F + LESAI+ YQ  +HL
Sbjct  48   LKGCHKGDKIKGIHELKKYMEKFGYLNYDNYKNQSTHANDDDFDELLESAIKTYQLNYHL  107

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWP  324
             STGILDA+T  +M  PRCGVADI+NGT +   G+           V HY F+   P+WP
Sbjct  108  KSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWP  167

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGD  501
            A+K  LTY F PGT S  I PVA A + W      F FS+   F NAD+K +  SG+HGD
Sbjct  168  ASKFSLTYAFRPGTRSDAITPVARAFQTW-AANTQFKFSKIEDFANADIKISFESGDHGD  226

Query  502  GVPFDGRGGS---YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            G PFDGRGG     AHAF P  G  H+DADE W   G      D+++VALHEIGHLLGL 
Sbjct  227  GNPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLH  285

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS    A+M+     G KK  L  DDI GIR LY
Sbjct  286  HSSVEGAIMYPSIAAGVKK-GLHGDDIQGIRDLY  318



>gb|KDO37621.1| hypothetical protein CISIN_1g035681mg [Citrus sinensis]
Length=320

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/274 (49%), Positives = 168/274 (61%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFS--DQLESAIRIYQTRHHL  174
            L+G  KGD++KG++ LK+Y++ FGY+N  +Y + S+ AD     + LESAI+ YQ  +HL
Sbjct  48   LKGCHKGDKIKGIHELKEYMEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHL  107

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWP  324
             STG+LDA+T  +M  PRCGVADI+NGT R   G+           V HY F+P  PKWP
Sbjct  108  KSTGVLDANTVAKMTIPRCGVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWP  167

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGD  501
            A+K  LTY F PGT S  I PVA A + W      F FS+   F NAD+K +  SG+HGD
Sbjct  168  ASKFSLTYAFRPGTRSDAITPVARAFQTW-AANTQFKFSKIEDFANADIKISFESGDHGD  226

Query  502  GVPFDGRGGS---YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            G PFDGRGG     AHAF P  G  H+DADE W   G      D+++VALHEIGHLLGL 
Sbjct  227  GNPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLH  285

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS    A+M+     G  K  L  DDI GIR LY
Sbjct  286  HSSVEGAIMYPSISAGVTK-GLHGDDIQGIRDLY  318



>ref|XP_008458907.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=316

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 165/274 (60%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS-EADYFSDQLESAIRIYQTRHHLN  177
            L G +KGD+V G++ +K+YL+ FGY+N+   N S S + D F   LESAI+ YQ  ++L 
Sbjct  43   LNGCRKGDKVAGIHQIKEYLQHFGYLNNYLQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  102

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEP  315
            +TG LDA T   M KPRCGVADII+G  R   G+               V HY F+   P
Sbjct  103  ATGTLDAKTLDLMSKPRCGVADIIDGKTRMKSGKKMVNQHRKINGHFHTVSHYAFFDGNP  162

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGE  492
            KWPA+K HLTYGF PGTPSK + PV  A K W     +F+FSR + +  AD+K +  SG+
Sbjct  163  KWPASKFHLTYGFLPGTPSKAVAPVGRAFKTW-GAHTHFNFSRASKYKKADIKISFRSGD  221

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG  FDG GG  AH F P  G  HFDA E W   G   +  D+++VALHEIGHLLGL 
Sbjct  222  HGDGHSFDGVGGVIAHGFAPTDGRLHFDAIESWA-VGAVADSFDLETVALHEIGHLLGLH  280

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS    A+MW     G  K  L ADDI GI ALY
Sbjct  281  HSSVEGAIMWPSIMEGTTK-GLDADDIAGINALY  313



>ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52418.1| hypothetical protein Csa_5G633160 [Cucumis sativus]
Length=313

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 164/273 (60%), Gaps = 18/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G KKGD+V+G++ +KKYL+ FGY+N+  +  S S  D F + LE A++ YQ  ++L  
Sbjct  41   LKGCKKGDKVEGIHQMKKYLQHFGYLNNDVHIRSESSDDEFDEILEFAVKTYQINYNLKV  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LD  T  QM KPRCGVADIING      G+               V H+ F+    +
Sbjct  101  TGTLDNSTLMQMSKPRCGVADIINGKTSMKSGKRFVNQHRKISGHFHEVSHFAFFEGNLR  160

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEH  495
            WP +K HLTYGF PGTPS+ I PV  A   W     +FSFS+ + + NAD+K +   G+H
Sbjct  161  WPDSKSHLTYGFLPGTPSEAISPVNRAFTTW-AANTHFSFSQESKYENADIKISFEKGDH  219

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFD  GG  AHAF P  G  HFDA EHW + G  P   D+++VALHEIGHLLGL H
Sbjct  220  GDGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWAD-GAVPKSYDMETVALHEIGHLLGLHH  278

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    A+MW     G   + L ADDI GI+ LY
Sbjct  279  SSVEGAIMWPSI-MGGATKGLHADDIEGIKVLY  310



>ref|XP_008458714.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=319

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 167/273 (61%), Gaps = 18/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L GS+KGD+V+G++ LKKYL  FGY+N+ +   S ++ D F + LESAI+ YQ  ++L  
Sbjct  46   LHGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENKDDEFDELLESAIKTYQKNYNLKV  105

Query  181  TGILDADTARQMMKPRCGVADIING------TRRRPGGE--------VVPHYRFYPDEPK  318
            TG LDA T  QM+KPRCGVADII+G      +++R   E         V H+ F+   PK
Sbjct  106  TGTLDAMTIAQMLKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHRVSHFAFFDGNPK  165

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEH  495
            WPA K HLTYGF PGTP + + PVA A   W     +F+FS+      +D+     SG+H
Sbjct  166  WPATKSHLTYGFLPGTPPETVSPVARAFATW-AANSHFTFSQALDNQTSDITIGFESGDH  224

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDG GG  AHAF P  G  H DADE W   G      D+++VALHEIGHLLGL H
Sbjct  225  GDGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN-GVVSGSFDLETVALHEIGHLLGLQH  283

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    A+MW +   G  K  L ADDI GI+ALY
Sbjct  284  SSIEGAIMWPQVPEGASK-GLHADDIAGIKALY  315



>ref|XP_008352994.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 165/274 (60%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S N      D F D LESAI+ YQ  +HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHSDN------DDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LDA T  +MM PRCGV DIINGT     G+               V HY F+P  PK
Sbjct  98   TGTLDAKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEH  495
            WP++K HLTY F   TP++    VA A   W     +FSFS++  + NADL  +  SG+H
Sbjct  158  WPSSKYHLTYAFDQTTPTEARDAVARAFATWAG-NTHFSFSQSQTYENADLTISFASGDH  216

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDGRGG+ AHAF P  G  H+DADE W   G      D+++VALHEIGHLLGL H
Sbjct  217  GDGNPFDGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGAYDLETVALHEIGHLLGLRH  275

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            S    AVM      G   + L ADDI GI+ALY+
Sbjct  276  SSVEGAVMSSTVRTG-FAQSLHADDIQGIKALYN  308



>ref|XP_007216923.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
 gb|EMJ18122.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
Length=264

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 160/262 (61%), Gaps = 20/262 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N    N      D F DQLE+AI+ YQ  +HL +
Sbjct  17   LKGCHKGDKVQGIQDLKKYLERFGYLNGDINN------DDFDDQLEAAIKTYQINYHLKA  70

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRP---GGEVVPHYRFYPDEPKWPANKRHLTYG  351
            TG LD  T  +MM PRCG        +R P   GG  V HY F+    KWPANK HLTYG
Sbjct  71   TGTLDTKTVSKMMMPRCG-------KKRHPHHHGGHTVAHYAFFQGSAKWPANKYHLTYG  123

Query  352  FAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFDGRGG  528
            FA GTP+  +  V  A   W     +FSFSR    + ADLK +  SGEHGDG PFDG GG
Sbjct  124  FAQGTPANAVGAVTRAFATWAG-NTHFSFSRAKSVDSADLKISFGSGEHGDGQPFDGPGG  182

Query  529  SYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEE  708
              AHA+ P  G  H+DADE WV  G  P G+D+++VALHEIGHLLGL HS    AVM   
Sbjct  183  VLAHAYAPTNGRFHYDADETWV-VGAVPGGMDLETVALHEIGHLLGLAHSSVEGAVMLPG  241

Query  709  FEYGEKKRDLTADDINGIRALY  774
               G   + L ADDI GI+ALY
Sbjct  242  IRAGF-TQSLHADDIQGIKALY  262



>ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52413.1| hypothetical protein Csa_5G632120 [Cucumis sativus]
Length=319

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 167/274 (61%), Gaps = 18/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L GS+KGD+V+G++ LKKYL  FGY+N+ +   S +  D F + LE+AI+ YQ  ++L  
Sbjct  46   LYGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENNDDEFDELLETAIKTYQKNYNLKV  105

Query  181  TGILDADTARQMMKPRCGVADIING------TRRRPGGE--------VVPHYRFYPDEPK  318
            TG LDA T  QM KPRCGVADII+G      +++R   E         V H+ F+   PK
Sbjct  106  TGTLDAMTIAQMSKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHSVSHFAFFDGNPK  165

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEH  495
            WPA K HLTYGF PGTPS+ + PVA A   W     +F+FS+      +D+     +G+H
Sbjct  166  WPATKSHLTYGFLPGTPSETVSPVARAFATW-AANSHFTFSQALDNQTSDITIGFETGDH  224

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDG GG  AHAF P  G  H DADE W   G   +  D+++VALHEIGHLLGL H
Sbjct  225  GDGYPFDGVGGVVAHAFSPSDGRFHLDADESWAN-GVVSDSFDLETVALHEIGHLLGLQH  283

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            S    A+MW +   G  K  L  DDI GI+ALY+
Sbjct  284  SSTEGAIMWPQVPVGASK-GLHVDDIAGIKALYN  316



>ref|XP_007014936.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY32555.1| Matrixin family protein, putative [Theobroma cacao]
Length=310

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 164/271 (61%), Gaps = 17/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQG  KG++VK ++ LKKYL++FGY++  S N + +  D F D LESAIR YQ  ++L +
Sbjct  42   LQGCHKGEKVKDIHKLKKYLESFGYLS-YSKNETHANDDDFDDFLESAIRTYQLNYNLKT  100

Query  181  TGILDADTARQMMKPRCGVADIINGT--------RRRPGGE----VVPHYRFYPDEPKWP  324
            TG LD+ T  +MM  RC VADI NGT        R+ P G      V HY F+P  PKWP
Sbjct  101  TGTLDSKTVSKMMTSRCAVADITNGTTGMRSGKKRQHPAGSKSFHTVAHYAFFPGNPKWP  160

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGD  501
             +K HLTY F PGT +  I PV  A + W     +FSFSRT  + NAD+  +  S +H D
Sbjct  161  DSKSHLTYAFLPGTRADAINPVVRAFQTW-AANTHFSFSRTQDYTNADITISFESRDHAD  219

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSE  681
            G PFDG  G+ AHAF P  G  H+DADE W      P    ++++ALHEIGHLLGL HS 
Sbjct  220  GNPFDGPDGTLAHAFAPTNGRFHYDADEQW-SVSVTPGAYHLETIALHEIGHLLGLHHSS  278

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               A+M+  F  GE K  L  DDI GIRALY
Sbjct  279  VEGAIMYPTFMAGESK-GLHGDDIQGIRALY  308



>ref|XP_007216839.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
 gb|EMJ18038.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
Length=296

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 159/259 (61%), Gaps = 15/259 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++    N+     D F DQLESAI+ YQ  +HL +
Sbjct  50   LKGCHKGDKVQGIKDLKKYLGKFGYLS--RNNNGHFNDDDFDDQLESAIKTYQINYHLKA  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TG LDA T   MM PRCGVADIIN          V HY F+   PKWPA+K HLTY F  
Sbjct  108  TGTLDAKTVSNMMMPRCGVADIIN----------VAHYSFFQGNPKWPASKYHLTYAFLQ  157

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGRGGSYA  537
            GTP++ + PV++A + W    ++F+FS      N DL  +   G HGDG PFDG GG+ A
Sbjct  158  GTPAEAMGPVSSAFQTW-AANKHFTFSEVQSNQNPDLTVSFHRGNHGDGAPFDGPGGTIA  216

Query  538  HAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
            HAF P  G  H+DA E W   G      D+QSVALHEIGHLLGL HS  + A+M+     
Sbjct  217  HAFAPTNGRFHYDAAEAWA-VGAVTGAFDLQSVALHEIGHLLGLGHSSVQGAIMFPSIGT  275

Query  718  GEKKRDLTADDINGIRALY  774
            G  ++ L  DDI GI+ALY
Sbjct  276  GVTQQSLHGDDIQGIKALY  294



>ref|XP_008230960.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/271 (48%), Positives = 164/271 (61%), Gaps = 18/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+     D F DQLESAI+ YQ  +HL +
Sbjct  48   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQLNYHLKA  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKWP  324
            TG LDA+T   MM PRCGVADIINGT     G+             V HY F+   PKWP
Sbjct  106  TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            A+K HLTY F  GTP++   PVA A + W     +F+FS++   N DL  +   G HGDG
Sbjct  166  ASKYHLTYAFLQGTPAEATGPVARAFQTW-AANTHFTFSQSN-QNPDLTVSFHRGNHGDG  223

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG GG+ AHAF P  G  H+DADE +   G      D+++VALHEIGHLLGL HS  
Sbjct  224  SPFDGPGGTIAHAFAPTNGRFHYDADERF-SVGAVSGAYDLETVALHEIGHLLGLGHSSV  282

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALYH  777
              A+M+     G  K  L  DDI GI+ALY+
Sbjct  283  LGAIMYPTISPGATK-GLHGDDIQGIKALYN  312



>emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera]
Length=319

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 166/273 (61%), Gaps = 16/273 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G +KG +VK ++ LKKYL+ FGY++   S + + ++ D F D LE AI+ YQT ++L 
Sbjct  38   LEGCQKGHKVKDIHKLKKYLQQFGYLSYSHSEHQTHADNDDFDDLLEFAIKTYQTNYYLK  97

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEPKWP  324
            ++G LD++T   M+KPRCGVADIINGT R   G             V HY F    P+WP
Sbjct  98   ASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSFHTVAHYSFLAGSPRWP  157

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGD  501
             +K HLTY F  GTPS  +  V  A   W +    FSF+ T  + NAD+K     G+HGD
Sbjct  158  PSKTHLTYAFLSGTPSTTMSAVTRAFGQWASATN-FSFAETQDYTNADMKIGFQRGDHGD  216

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSE  681
            G PFDG GG+ AH+FPP  G  HFD DE WV  G      D+++VALHEIGHLLGL HS 
Sbjct  217  GHPFDGPGGTIAHSFPPTDGRLHFDGDESWV-VGAVAGAFDVETVALHEIGHLLGLGHSS  275

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
               A+M+    YG  K  L  DDI GI+ALY+F
Sbjct  276  VEGAIMFPTIAYGVTK-GLNEDDIQGIQALYNF  307



>ref|XP_008230675.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=305

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 163/270 (60%), Gaps = 18/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+     D F DQLESAI+ YQ  +HL +
Sbjct  40   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQLNYHLKA  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKWP  324
            TG LDA+T   MM PRCGVADIINGT     G+             V HY F+   PKWP
Sbjct  98   TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  157

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            A+K HLTY F  GTP++   PVA A + W     +F+FS++   N DL  +   G HGDG
Sbjct  158  ASKYHLTYAFLQGTPAEATGPVARAFQTW-AANTHFTFSQSN-QNPDLTVSFHRGNHGDG  215

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG GG+ AHAF P  G  H+DADE +   G      D+++VALHEIGHLLGL HS  
Sbjct  216  SPFDGPGGTIAHAFAPTNGRFHYDADERF-SVGAVSGAYDLETVALHEIGHLLGLGHSSV  274

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALY  774
              A+M+     G  K  L  DDI GI+ALY
Sbjct  275  LGAIMYPTISPGATK-GLHGDDIQGIKALY  303



>ref|XP_007216922.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
 gb|EMJ18121.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
Length=297

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 160/260 (62%), Gaps = 16/260 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY   LS N+     D F DQLESAI+ YQ  +HL +
Sbjct  52   LKGCHKGDKVQGIQDLKKYLGKFGY---LSSNNGHLNDDDFDDQLESAIKTYQINYHLKA  108

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TG LDA T   MM PRCGVADIIN          V +Y F+ + P WPA+K HLTY F  
Sbjct  109  TGTLDAKTVSNMMMPRCGVADIIN----------VANYSFFEENPTWPASKYHLTYAFLQ  158

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGRGGSYA  537
            GTP++ + PV++A + W     +F+FS      N DL  +   G+HGDG PFDG GG+ A
Sbjct  159  GTPAEAMGPVSSAFQTW-AANTHFTFSEAQNNQNPDLTVSFNRGDHGDGTPFDGPGGTIA  217

Query  538  HAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
            HAF P  G  H+DADE +   G      D ++VALHEIGHLLGL HS  + A+M+     
Sbjct  218  HAFAPTNGRLHYDADERF-SVGAVSGAYDFETVALHEIGHLLGLRHSSVQGAIMFPSVRA  276

Query  718  GEKKRDLTADDINGIRALYH  777
            G  ++ L  DDI GI+ALY+
Sbjct  277  GVTQQSLHGDDIQGIKALYN  296



>ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis]
 gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis]
Length=321

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 171/286 (60%), Gaps = 32/286 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEAD-----YFSDQLESAIRIYQTR  165
            LQG  KGD++KG+  LKKYLK FGY   LSYN + S A+      F D LESAIR YQ  
Sbjct  41   LQGCHKGDKLKGVGELKKYLKHFGY---LSYNKNQSHANEDDDDDFDDPLESAIRTYQLN  97

Query  166  HHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEV--------------------V  285
            +HLN +G+LD++TA +MM PRCGVADIINGT     G                      V
Sbjct  98   YHLNVSGLLDSETASKMMMPRCGVADIINGTTWMESGRKHHRHPHRHHHRRHGPKSLHKV  157

Query  286  PHYRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNA  462
             HY F+   PKWP +K HLTY F PG P+  + PVA A + W     +FSFS T  + N+
Sbjct  158  SHYSFFSGNPKWPPSKYHLTYSFLPGFPTAAVNPVANAFETW-AANTHFSFSWTRDYINS  216

Query  463  DLKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVAL  642
            D+  + + G+HGDG PFDG GG+ AHAF P+ G  H+DADE W   G      D+++ AL
Sbjct  217  DILISFYRGDHGDGHPFDGPGGTLAHAFAPQNGLFHYDADERW-SIGAVLGAYDLETTAL  275

Query  643  HEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
            HEIGHLLGL HS    A+M+ +   GE  R L +DD+ GIR LY+ 
Sbjct  276  HEIGHLLGLGHSSVEGAIMYPQIFAGE-TRGLHSDDLEGIRTLYNI  320



>ref|XP_007010413.1| Matrixin family protein [Theobroma cacao]
 ref|XP_007099564.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19223.1| Matrixin family protein [Theobroma cacao]
 gb|EOY20464.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   233 bits (594),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 161/273 (59%), Gaps = 18/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQG  KGD+VK +  LKKYL+ FGY++  S N + +  D F D LESAI+ YQ   HLNS
Sbjct  42   LQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDDDFDDLLESAIKTYQLNFHLNS  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP-------------HYRFYPDEPKW  321
             G LD +T  +MM PRCGVADIINGT     G+  P             HY F+P  P+W
Sbjct  101  NGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRW  160

Query  322  PANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHG  498
            P +K HLTY F PGT +  + PVA A + W     +F FSR   + +AD+       +HG
Sbjct  161  PPSKSHLTYAFLPGTRADAVNPVAGAFQTW-AANTHFRFSRIDNYRDADITIGFQRRDHG  219

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG PFDG GG+ AHAF P  G  H+DADE W      P  + +++VALHEIGHLLGL HS
Sbjct  220  DGNPFDGPGGTLAHAFAPTLGRFHYDADETW-SVSARPGTMHLETVALHEIGHLLGLGHS  278

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
                A+M+     G  K  L  DDI GI+ALY+
Sbjct  279  SIENAIMYPSITAGTSK-GLARDDIEGIKALYN  310



>ref|XP_008343421.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 161/273 (59%), Gaps = 24/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S N      D F D LESAI+ YQ  +HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHSDN------DDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LD  T  +MM PRCGV DIINGT     G+               V HY F+P  PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEH  495
            WP++K HLTY F   TP+     VA A   W     +FSFS++  + NADL  +  SG+H
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAG-NTHFSFSQSQTYENADLTISFASGDH  216

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PF GRGG+ AHAF P  G  H+DADE W   G      D+++VALHEIGHLLGL H
Sbjct  217  GDGXPFXGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGAYDLETVALHEIGHLLGLRH  275

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    AVM      G   + L ADDI GI+ALY
Sbjct  276  SSVEGAVMSSTVRTGF-AQSLHADDIQGIKALY  307



>ref|XP_007010415.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19225.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 161/273 (59%), Gaps = 18/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQG  KGD+VK +  LKKYL+ FGY++  S N + +  + F D LESAI+ YQ   HLNS
Sbjct  42   LQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDNDFDDLLESAIKTYQLNFHLNS  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP-------------HYRFYPDEPKW  321
             G LD +T  +MM PRCGVADIINGT     G+  P             HY F+P  P+W
Sbjct  101  NGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRW  160

Query  322  PANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHG  498
            P +K HLTY F PGT +  + PVA A + W     +F FSR   + +AD+       +HG
Sbjct  161  PPSKSHLTYAFLPGTRADAVNPVAGAFQTW-AANTHFRFSRIDNYRDADITIGFQRRDHG  219

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG PFDG GG+ AHAF P  G  H+DADE W      P  + +++VALHEIGHLLGL HS
Sbjct  220  DGNPFDGPGGTLAHAFAPTIGRFHYDADETW-SVSARPGTMHLETVALHEIGHLLGLSHS  278

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
                A+M+     G  K  L  DDI GI+ALY+
Sbjct  279  SIENAIMYPSITAGTSK-GLARDDIEGIKALYN  310



>ref|XP_008361888.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 161/273 (59%), Gaps = 24/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S N      D F D LESAI+ YQ  +HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHSDN------DDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LD  T  +MM PRCGV DIINGT     G+               V HY F+P  PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEH  495
            WP++K HLTY F   TP+     VA A   W     +FSFS++  + NADL  +  SG+H
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAG-NTHFSFSQSQTYENADLTISFASGDH  216

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PF GRGG+ AHAF P  G  H+DADE W   G      D+++VALHEIGHLLGL H
Sbjct  217  GDGXPFXGRGGTLAHAFAPTNGRFHYDADEPWA-VGAVEGXYDLETVALHEIGHLLGLRH  275

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    AVM      G   + L ADDI GI+ALY
Sbjct  276  SSVEGAVMSSTVRTGF-AQSLHADDIQGIKALY  307



>ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=315

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 162/273 (59%), Gaps = 20/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----SEADYFSDQLESAIRIYQTRH  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S     +  D F D +ESAI+ YQT +
Sbjct  46   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  102

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTR-----------RRPGGEVVPHYRFYPDEP  315
            HLN+TG LD++T  QM+KPRCG ADIINGT                   V HY F+   P
Sbjct  103  HLNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRTVAHYSFFSGSP  162

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            +WP +K +LTY F PGTPS  + PV+ A   W +   +   S     +AD+  +    +H
Sbjct  163  RWPPSKTYLTYAFLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDH  222

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDG GG+ AHAF P  G  H+D DE W   G  PN +D+++VALHEIGHLLGL H
Sbjct  223  GDGYPFDGPGGTIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVALHEIGHLLGLGH  281

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S  + A+M+     G  K  L  DDI GI ALY
Sbjct  282  SSVQNAIMFPSISSGVTK-GLHEDDIQGISALY  313



>ref|XP_008368314.1| PREDICTED: LOW QUALITY PROTEIN: metalloendoproteinase 1-like 
[Malus domestica]
Length=309

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 163/274 (59%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N        S++D F D LESAI+ YQ  +H  +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLN------GHSDSDDFDDILESAIKTYQVNYHXKA  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LDA T  +M+ PRCGVADIINGT     G+               V HY F    PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFXTGNPK  157

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEH  495
            WP++K HLTY F   TP++    VA A   W     +FSFS++  + NADL  +   G+H
Sbjct  158  WPSSKYHLTYAFDQSTPTEARDAVARAFATWAG-NTHFSFSQSQNYKNADLTISFGKGDH  216

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDGRGG  AHAFPP     H+DADE W   G   +  D+++VALHEIGHLLGL H
Sbjct  217  GDGNPFDGRGGILAHAFPPTNXRFHYDADEXWA-VGAVADAYDLETVALHEIGHLLGLQH  275

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            S    AVM      G   + L ADDI GI+ALY+
Sbjct  276  SSVEGAVMSPGVRSGF-TQSLHADDIQGIKALYN  308



>ref|XP_007216949.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
 gb|EMJ18148.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
Length=252

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 158/258 (61%), Gaps = 8/258 (3%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G + GD+V G+ +LKKYL  FGY   LS N++ +  D F DQL SAI+ YQ  ++L +TG
Sbjct  1    GFQNGDKVPGIQDLKKYLGRFGY---LSSNNNQTTDD-FDDQLASAIKTYQLNYNLKTTG  56

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAPGT  366
            ILDA T   MM PRCGV DIINGT     G+ + HY F+P +PKWPA+K HLTY F  GT
Sbjct  57   ILDAQTVSNMMMPRCGVPDIINGTSSMRSGKQIAHYTFFPGKPKWPASKYHLTYAFLRGT  116

Query  367  PSKFIVPVATALKAWHNVGEY-FSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGSYAHA  543
            P+    PVA A   W    ++ FS +R      DL  +     HGDG PFDG GG  AH+
Sbjct  117  PTAAKGPVARAFNTWAAHTQFKFSQARRN-QKPDLTVSFHRRSHGDGHPFDGPGGILAHS  175

Query  544  FPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGE  723
            F P+ G  H+DADE W   G       +++VALHEIGHLLGL HS  R A+M+     GE
Sbjct  176  FAPKDGRFHYDADEKW-SVGVVRGAFHLETVALHEIGHLLGLGHSSVRRAIMYPTISSGE  234

Query  724  KKRDLTADDINGIRALYH  777
             K  L  DDI GI+ALYH
Sbjct  235  TK-GLNRDDIQGIKALYH  251



>ref|XP_008365496.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=319

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 163/274 (59%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N        S++D F D LESAI+ YQ  +H  +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLN------GHSDSDDFDDILESAIKTYQVNYHXKA  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LDA T  +M+ PRCGVADIINGT     G+               V HY F+   PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFFTGNPK  157

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEH  495
            WP++K HLTY F   TP++    VA A   W     +FSFS++  + NADL  +   G+H
Sbjct  158  WPSSKYHLTYAFDQSTPTEAXDAVARAFATWAG-NTHFSFSQSQNYKNADLTISFGKGDH  216

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDGRGG  AHAFPP     H+DADE W   G   +  D+++VALHEI HLLGL H
Sbjct  217  GDGNPFDGRGGILAHAFPPTNXRFHYDADEAWA-VGAVADAYDLETVALHEIXHLLGLQH  275

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            S    AVM      G   + L ADDI GI+ALY+
Sbjct  276  SSVEGAVMSPGXRSGF-TQSLHADDIQGIKALYN  308



>ref|XP_002280805.2| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=335

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 173/278 (62%), Gaps = 25/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S         DYF D LESAI+ YQT
Sbjct  63   LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  119

Query  163  RHHLNSTGILDADTARQMMKPRCGVADIINGT-------RRRPGGE----VVPHYRFYPD  309
             +HL +TG LD++T  +MM+ RCGVADI+NGT       +R   G      V HY+F+P 
Sbjct  120  NYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPG  179

Query  310  EPKWP-ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALF  483
             P+WP +N  HLTY F PGTP +  +PV+ A   W +    F+F++T    NA+L  +  
Sbjct  180  SPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATS-FTFAQTEDHRNANLTISFH  238

Query  484  SGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLL  663
            S  HGD  PFDG GG+ AHA+ P  G  H+DADE W   G  P  LD+++VALHEIGHLL
Sbjct  239  SLLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEW-SVGAVPGALDVETVALHEIGHLL  297

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            GL HS  REA+M+     G  K  L  DDI GIRALY+
Sbjct  298  GLGHSSVREAIMFPSISTGVTK-GLHRDDIEGIRALYN  334



>ref|XP_004296560.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 165/268 (62%), Gaps = 15/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+VKG+ +LKKYL+ +GY+N    N S S+ D F D LE A++ YQ  +HL S
Sbjct  44   LKGCHKGDKVKGINDLKKYLEKYGYLN--YKNHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  181  TGILDADTARQMMKPRCGVADIINGT-------RRRPGGEV--VPHYRFYPDEPKWPANK  333
            TG LD+ T  +M  PRCGVADIINGT       +R   G +    HY F+   PKWP++K
Sbjct  102  TGTLDSKTVSKMTTPRCGVADIINGTSSMRSAKKRHHHGSLHTTAHYSFFQGNPKWPSSK  161

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVP  510
             HLTYGF P TPS+    VA A   W     +F+FS+   + NADLK     G HGDG  
Sbjct  162  YHLTYGFLPNTPSEATGAVARAFATWEG-NTHFTFSQAQSYENADLKIGFQRGNHGDGAA  220

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG+ AHAF P +G  H+DADE W   G  P   D+++VALHEIGHLLGL HS  + 
Sbjct  221  FDGPGGTLAHAFSPTHGIFHYDADETW-SVGAVPGATDLETVALHEIGHLLGLGHSSVKG  279

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            A+M      GE  R L  DD+ GI+ALY
Sbjct  280  AIMEPTLPTGE-TRGLHGDDVQGIKALY  306



>ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52414.1| hypothetical protein Csa_5G632130 [Cucumis sativus]
Length=316

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 164/275 (60%), Gaps = 19/275 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS-EADYFSDQLESAIRIYQTRHHLN  177
            L G KKGD+V+G++ +K+YL+ FGY+N+   N S S + D F   LESAI+ YQ  ++L 
Sbjct  43   LNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  102

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEP  315
            +TG ++A T   M +PRCG ADI++G  R   G+               V HY F+   P
Sbjct  103  ATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNP  162

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGE  492
            KWPA+K HLTYGF PGTPSK +  +  A K W     +F+FS+T  +  AD+K +  +G+
Sbjct  163  KWPASKSHLTYGFLPGTPSKAVATIGRAFKTW-GANTHFNFSQTSRYKKADIKISFETGD  221

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG  FDG  G  AH F P  G  HFDA E W   G   +  D++++ALHEIGHLLGL 
Sbjct  222  HGDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIADSFDLETIALHEIGHLLGLY  280

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            HS    A+MW     G  K  L ADDI GI ALY+
Sbjct  281  HSSIERAIMWPSIMEGSTK-GLDADDIAGINALYN  314



>ref|XP_008230676.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=299

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 161/268 (60%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            ++G +KGD V+G+ ++KK+L+ FGY+      S  S+ D F DQLE AI+ YQ  ++L +
Sbjct  39   VKGCRKGDNVQGILDVKKHLEKFGYL------SGHSQNDDFDDQLELAIKTYQLNYNLEA  92

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPG-------GEVVPHYRFYPDEPKWPANKRH  339
            TG LD  T   MM PRCGV DIINGT            G  V  Y F+   PKWP+ K  
Sbjct  93   TGRLDVKTVSNMMIPRCGVPDIINGTTSMISRKIQHHEGLTVSKYSFFSGNPKWPSAKYR  152

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFD  516
            LTY F  GTP++   PV  A ++W N  + F+FS+   +   DL  +    +HGDG PFD
Sbjct  153  LTYAFLQGTPNQAKDPVKRAFQSWANNTQ-FTFSQVEAYETPDLTISFQRLDHGDGYPFD  211

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            GRGG  AHAF P  G  H+DADE WV  G    G+D+QS+A+HEIGHLLGL+HS   EA+
Sbjct  212  GRGGVTAHAFSPTDGRFHYDADEMWV-VGSVNGGMDLQSIAVHEIGHLLGLNHSSVEEAI  270

Query  697  MWEEFEYGEKKRDLTADDINGIRALYHF  780
            M+        KR+L  DDI GI+ LY+ 
Sbjct  271  MYPFLNTATVKRNLKPDDIQGIKNLYNI  298



>ref|XP_004288499.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 156/269 (58%), Gaps = 13/269 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G +KGD+ KGL +LK YL+ FGY+N   Y + S   D F D LE AI+ YQ  + L  
Sbjct  46   LKGRQKGDKFKGLNDLKNYLEKFGYLN---YKNRSLFNDDFDDLLEEAIKTYQINYRLEV  102

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPH---------YRFYPDEPKWPANK  333
            TG LD  T  +MM PRCGV DIINGT          H         Y F+P  PKWP++K
Sbjct  103  TGKLDNKTVSKMMMPRCGVPDIINGTSFMRSANKGHHHGSIHTTALYSFFPGSPKWPSSK  162

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPF  513
             HLTYGF PGT S+    VA A   W     +       ++NADLK +   G+HGDGVPF
Sbjct  163  YHLTYGFLPGTRSEATAAVARAFATWAKSSRFTFSPAQSYYNADLKISFQRGDHGDGVPF  222

Query  514  DGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREA  693
            DG GG  AH+F P  G  H+DAD+ W   G  P   D++SVALHEIGHLLGL HS    A
Sbjct  223  DGPGGILAHSFCPSDGRFHYDADDTWT-VGAKPGAFDLESVALHEIGHLLGLQHSSLPGA  281

Query  694  VMWEEFEYGEKKRDLTADDINGIRALYHF  780
            VM      G  K  LT DD+ GI+ALY+F
Sbjct  282  VMAPGIPPGVTKTSLTEDDVQGIKALYNF  310



>ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
 emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera]
Length=319

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 168/276 (61%), Gaps = 20/276 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            LQG  KGD V G+  LKKYL+ FGY++   S N + ++ D F D LESAI+ YQ  +HL 
Sbjct  46   LQGCHKGDEVNGIQKLKKYLEQFGYLSYSRSKNQTHADDDDFDDLLESAIKTYQANYHLE  105

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDE  312
            +TG LD++T  +M+KPRCGVADIINGT     G+                V HY F+P  
Sbjct  106  ATGDLDSETVSEMVKPRCGVADIINGTNWMLSGKKRQYHGHGHGHGSLRTVAHYSFFPGS  165

Query  313  PKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTG-FFNADLKFALFSG  489
            P+WP +K +LTY F PGTP+  + PV+ A   W +   +F+F     + +AD+  +    
Sbjct  166  PRWPPSKTYLTYAFLPGTPNWAMSPVSRAYGRW-DSATHFTFGWIQDYTSADMTISFHRL  224

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGL  669
            +HGDG PFDG GG+ AHAF P  G  H+D DE W   G  PN +D+++VALHEIGHLLGL
Sbjct  225  DHGDGSPFDGPGGTIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVALHEIGHLLGL  283

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
             HS  + A+M+     G  K  L  DDI GIRALY+
Sbjct  284  GHSSVQNAIMFPSISTGVTK-GLHEDDIQGIRALYN  318



>gb|EYU34694.1| hypothetical protein MIMGU_mgv1a023515mg, partial [Erythranthe 
guttata]
Length=261

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 159/259 (61%), Gaps = 18/259 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSSEADYFSDQLESAIRIYQTRHHLN  177
            LQG  KG++ K +++LK YL  FGY   L Y N + +  D F + LESA++ YQ  +H+N
Sbjct  18   LQGCHKGNKSKDIHHLKNYLHQFGY---LQYPNETHANNDDFDETLESAVKTYQRNYHIN  74

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFA  357
             TG LDA T  +M  PRCGV DII+          V HY F+   P+WP +K HLTY F 
Sbjct  75   PTGTLDATTVSKMTTPRCGVPDIID----------VSHYSFFQGNPRWPPSKTHLTYRFL  124

Query  358  PGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGSYA  537
            P TP+  + PV+ A + W +   +F+FSR    +ADL      G+HGDG PFDGRGG+ A
Sbjct  125  PNTPAPAVGPVSRAFQKWAS-STHFTFSRAQN-SADLVIGFHRGDHGDGFPFDGRGGTLA  182

Query  538  HAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
            HAF P  G  H+DADE W   GP  +  D+++VALHEIGHLLGL HS    A+M+     
Sbjct  183  HAFAPTNGRFHYDADERW-SVGPVQDAFDLETVALHEIGHLLGLGHSSVEAAIMYSGIGA  241

Query  718  GEKKRDLTADDINGIRALY  774
            G  K +L ADDI GIRALY
Sbjct  242  GVTK-NLHADDIQGIRALY  259



>ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=319

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 126/276 (46%), Positives = 165/276 (60%), Gaps = 22/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----SEADYFSDQLESAIRIYQTRH  168
            L+G +KG +VK ++ LKKYL+ FGY   LSY+ S     ++ D F D LE AI+ YQT +
Sbjct  38   LEGCQKGHKVKDIHKLKKYLQQFGY---LSYSHSEYQTHADNDDFDDLLEFAIKTYQTNY  94

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEP  315
            +L ++G LD++T   M+KPRCGVADIINGT R   G             V HY F+   P
Sbjct  95   YLKASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSLHTVAHYSFFAGSP  154

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGE  492
            +WP +  HLTY F  GT S  +  V  A   W +  + F+F+ T  + NAD+K     G+
Sbjct  155  RWPPSNTHLTYAFLSGTSSTTMSAVTRAFGQWASATD-FTFAETQDYTNADMKIGFQRGD  213

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG PFDG GG+ AH+F P  G  HFD DE WV  G      D+++VALHEIGHLLGL 
Sbjct  214  HGDGFPFDGPGGTIAHSFSPTDGRLHFDGDESWV-VGAVAGAFDVETVALHEIGHLLGLG  272

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
            HS    A+++    +G  K  L  DDI GI+ALY+F
Sbjct  273  HSSVEGAIIFPTIAFGVTK-GLNEDDIQGIQALYNF  307



>gb|EYU29748.1| hypothetical protein MIMGU_mgv1a025409mg, partial [Erythranthe 
guttata]
Length=262

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 152/261 (58%), Gaps = 16/261 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQGS KG+R  G+  +K YL+ FGY+++L+   ++   + F D LESAI+ YQ   ++N 
Sbjct  17   LQGSVKGNRALGISGIKNYLQKFGYLDNLN---NTQVNNLFDDALESAIKTYQQNFNINP  73

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TGILDA T   M+ PRCGV DIIN          V HY F+   PKWP +K +LTYGF  
Sbjct  74   TGILDASTVSTMIIPRCGVPDIIN----------VSHYTFFSGNPKWPPSKYNLTYGFLS  123

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNA-DLKFALFSGEHGDGVPFDGRGGSYA  537
              P+  + P   A + W N   +F+F R       DL      G HGDG  FDG GG+ A
Sbjct  124  NVPANAVAPAERAFQNWDN-ATHFTFKRASSGQTPDLTIGFLRGNHGDGASFDGPGGTLA  182

Query  538  HAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
            HAF P  G  H+DADE W    P  N   +++VALHEIGHLLGL HS  + A+M+     
Sbjct  183  HAFAPTNGRLHYDADERW-SVDPVANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSA  241

Query  718  GEKKRDLTADDINGIRALYHF  780
            G+ K  L +DDI GI+ALY+ 
Sbjct  242  GQAKIKLNSDDIQGIKALYNM  262



>emb|CBI34985.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 158/262 (60%), Gaps = 22/262 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----SEADYFSDQLESAIRIYQTRH  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S     +  D F D +ESAI+ YQT +
Sbjct  17   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  73

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTY  348
            HLN+TG LD++T  QM+KPRCG ADIINGT              +   P+WP +K +LTY
Sbjct  74   HLNATGSLDSETVSQMVKPRCGAADIINGTN-------------WMRSPRWPPSKTYLTY  120

Query  349  GFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGG  528
             F PGTPS  + PV+ A   W +   +   S     +AD+  +    +HGDG PFDG GG
Sbjct  121  AFLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGDGYPFDGPGG  180

Query  529  SYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEE  708
            + AHAF P  G  H+D DE W   G  PN +D+++VALHEIGHLLGL HS  + A+M+  
Sbjct  181  TIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVALHEIGHLLGLGHSSVQNAIMFPS  239

Query  709  FEYGEKKRDLTADDINGIRALY  774
               G  K  L  DDI GI ALY
Sbjct  240  ISSGVTK-GLHEDDIQGISALY  260



>ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=457

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 164/275 (60%), Gaps = 19/275 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS-EADYFSDQLESAIRIYQTRHHLN  177
            L G KKGD+V+G++ +K+YL+ FGY+N+   N S S + D F   LESAI+ YQ  ++L 
Sbjct  184  LNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  243

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEP  315
            +TG ++A T   M +PRCG ADI++G  R   G+               V HY F+   P
Sbjct  244  ATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNP  303

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGE  492
            KWPA+K HLTYGF PGTPSK +  +  A K W     +F+FS+T  +  AD+K +  +G+
Sbjct  304  KWPASKSHLTYGFLPGTPSKAVATIGRAFKTW-GANTHFNFSQTSRYKKADIKISFETGD  362

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG  FDG  G  AH F P  G  HFDA E W   G   +  D++++ALHEIGHLLGL 
Sbjct  363  HGDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWA-VGAIADSFDLETIALHEIGHLLGLY  421

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            HS    A+MW     G  K  L ADDI GI ALY+
Sbjct  422  HSSIERAIMWPSIMEGSTK-GLDADDIAGINALYN  455


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 72/141 (51%), Gaps = 4/141 (3%)
 Frame = +1

Query  352  FAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFDGRGG  528
            F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG  FDG GG
Sbjct  2    FTNNFPVDFVPSVTEAMARW-AAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGG  60

Query  529  SYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEE  708
               HAF P  G  H D D+ W   G   N  ++ +VALHE+GH+LGL HS   +AVMW  
Sbjct  61   VVGHAFAPTDGRLHLDGDDSWSA-GLEENKFNVMNVALHELGHVLGLAHSTLPQAVMWPY  119

Query  709  FEYGEKKRDLTADDINGIRAL  771
             +    K +L  DDI G+ AL
Sbjct  120  IDSNALK-NLNDDDIAGLHAL  139



>ref|XP_007010134.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY18944.1| Matrixin family protein, putative [Theobroma cacao]
Length=288

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 159/270 (59%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSSEADY-FSDQLESAIRIYQTRHH  171
            LQG  KG  V+GL  LK+Y K  GY+N    SYN+     D  F D LESAI+ YQ  + 
Sbjct  21   LQGCHKGHTVEGLCELKQYFKKLGYLNYDHASYNAYKHGNDNEFDDHLESAIKAYQVNYK  80

Query  172  LNSTGILDADTARQMMKPRCGVADIINGTRRRPG-GEVVPHYRFYPDEPKWPANKRHLTY  348
            LN+TG LDADT +QMMK RCG+AD++N    R   G     Y F+   PKWP +K HLTY
Sbjct  81   LNATGNLDADTVKQMMKSRCGIADVMNSNNSRSIYGIGASRYEFFLGNPKWPLSKTHLTY  140

Query  349  GFAPGTPSKFIVPVAT--------ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
             F     S   VP+A         A + W NV  +       ++ AD++    SGEHGDG
Sbjct  141  NFH----SSVEVPLAENVRSVCVRAFQRWANVSRFTFEEVAEYYVADIEIGFHSGEHGDG  196

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG  G+ AHA PP  G  H+DADE W    P P+ +D++SV +HEIGHLLGL HS  
Sbjct  197  NPFDGPQGTLAHASPPTDGKLHYDADEDW-STNPGPDEVDLESVTVHEIGHLLGLQHSLV  255

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALY  774
             EAVM+  F+ G  KR L  DD++GIRALY
Sbjct  256  PEAVMYAYFDSGMIKRKLHMDDVHGIRALY  285



>gb|EYU18042.1| hypothetical protein MIMGU_mgv1a018853mg [Erythranthe guttata]
Length=287

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 151/259 (58%), Gaps = 16/259 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQGS KGDR  G+  LK YL+ FGY+ +L+   ++   + F D LESAI+ YQ   ++N 
Sbjct  42   LQGSVKGDRTLGISGLKSYLQKFGYLENLN---NTQVNNVFDDALESAIKTYQQNFNINP  98

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TGILDA T   M+ PRCGV DIIN          V HY F+   PKWPA+K +LTY F  
Sbjct  99   TGILDAATVSTMIIPRCGVPDIIN----------VSHYTFFLGNPKWPASKYNLTYEFLS  148

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRTGF-FNADLKFALFSGEHGDGVPFDGRGGSYA  537
              PS  + PV  A + W N   +F+F R+     ADL      G HGDG  FDG GG+ A
Sbjct  149  NVPSNAVAPVERAFQNWDN-ATHFTFRRSSSDQTADLIIEFQRGYHGDGASFDGPGGTLA  207

Query  538  HAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
            HAF P  G  H+DADE W    P  N   +++VALHEIGHLLGL HS  + A+M+     
Sbjct  208  HAFAPTNGRFHYDADERW-SVDPVANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSA  266

Query  718  GEKKRDLTADDINGIRALY  774
            G  K  L  DDI GI+ALY
Sbjct  267  GTAKIKLNTDDIQGIKALY  285



>gb|EYU34696.1| hypothetical protein MIMGU_mgv11b016964mg [Erythranthe guttata]
Length=312

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 166/274 (61%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSSEADYFSDQLESAIRIYQTRHHLN  177
            +QG  KG++ K ++NLKKYL  FGY   L Y N + +  D F + LESA++ YQ  +++N
Sbjct  45   VQGCHKGNKTKEIHNLKKYLHKFGY---LQYPNQTHANNDDFDEALESAVKTYQRNYNIN  101

Query  178  STGILDADTARQMMKPRCGVADIING--TRRRPGGE------------VVPHYRFYPDEP  315
             TG LDA T  +M  PRCGV DIING  T ++ G +             V HY F P  P
Sbjct  102  PTGTLDATTVSKMTTPRCGVPDIINGKNTMQKHGTKEHESNSSSKHIHTVSHYSFLPGNP  161

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            +WP +K HLTY F+  TP+  + PV+ A + W +   +F+FS     +ADL     SG+H
Sbjct  162  RWPRSKTHLTYMFSANTPAAAVGPVSRAFQKWAS-STHFTFSLAQS-SADLVIGFHSGDH  219

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDGRGG+ AHAF P  G  H+DADE W   GP  +  D+++VALHEIGHLLGL H
Sbjct  220  GDGNPFDGRGGTLAHAFAPTNGRFHYDADELW-SVGPVQDAFDLETVALHEIGHLLGLGH  278

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            S    A+M+     G  K +L  DDI GI++LY+
Sbjct  279  SAVEAAIMYSGIGAGVTK-NLHPDDIQGIKSLYN  311



>emb|CAN73130.1| hypothetical protein VITISV_030258 [Vitis vinifera]
Length=437

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 137/277 (49%), Positives = 172/277 (62%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S         DYF D LESAI+ YQT
Sbjct  49   LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  105

Query  163  RHHLNSTGILDADTARQMMKPRCGVADIINGT-------RRRPGGE----VVPHYRFYPD  309
             +HL +TG LD++T  +MM+ RCGVADI+NGT       +R   G      V HY+F+P 
Sbjct  106  NYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPG  165

Query  310  EPKWP-ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALF  483
             P+WP +N  HLTY F PGTP +  +PV+ A   W +    F+F++T    NA+L  +  
Sbjct  166  SPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATS-FTFAQTEDHRNANLTISFH  224

Query  484  SGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLL  663
            S  HGD  PFDG GG+ AHA+ P  G  H+DADE W   G  P  LD+++VALHEIGHLL
Sbjct  225  SLLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEW-SVGAVPGXLDVETVALHEIGHLL  283

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS  REA+M+     G  K  L  DDI GIRA+Y
Sbjct  284  GLGHSSVREAIMFPSISTGVTK-GLHRDDIEGIRAVY  319



>ref|XP_004296559.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 163/268 (61%), Gaps = 15/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+VKG+ +LKKYL+ FGY+N    N S S+ D F D LE A++ YQ  +HL S
Sbjct  44   LKGCHKGDKVKGINDLKKYLEKFGYLN--YKNHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  181  TGILDADTARQMMKPRCGVADIINGT-------RRRPGGEV--VPHYRFYPDEPKWPANK  333
            TG LD  T  +MM PRCG+ DIINGT       +R   G +    HY F    PKWP++K
Sbjct  102  TGTLDGKTVAKMMMPRCGLPDIINGTSSMRSAKKRHHHGSIHTTAHYAFPAGNPKWPSSK  161

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVP  510
             HLTYGF PGTPS+    VA A   W     +F+FS+   + NADLK     G+HGDG  
Sbjct  162  YHLTYGFLPGTPSEATGAVARAFATWAG-NTHFTFSQAQNYENADLKIGFEKGDHGDGSA  220

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG  AHAF P  G  H+DADE+W   G  P   D++++ALHEIGHLLGLDHS    
Sbjct  221  FDGPGGVLAHAFYPTDGRFHYDADENW-SVGAKPGAFDLETLALHEIGHLLGLDHSSVEG  279

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            A+M      G   R L  DD+ GI+ALY
Sbjct  280  AIMSSGIPAGV-TRGLHGDDVQGIKALY  306



>ref|XP_007217804.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
 gb|EMJ19003.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
Length=406

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 162/264 (61%), Gaps = 22/264 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  + N      D+F D+LESAI+ YQ  +HL  
Sbjct  157  LKGCHKGDKVQGIQDLKKYLEKFGYLNGNTNND-----DHFDDELESAIKTYQINYHLKV  211

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPG---GEVVPHYRFYPDEPKWPANKRHLTYG  351
            TG LDA T ++M  PRCG        ++R G      V HY F+   PKWPANK HLTYG
Sbjct  212  TGTLDAKTVKKMEMPRCG--------KKRGGHGSTHTVGHYAFFQGNPKWPANKYHLTYG  263

Query  352  FAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGV--PFDGR  522
            F  GT S+ +  VA A   W +   +F+FS+   F +ADLK     G+HGDG    FDG 
Sbjct  264  FLQGTQSEAVGAVARAFATWQS-NTHFTFSQAQSFESADLKIGFGRGDHGDGANNAFDGP  322

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMW  702
            G + AHAF P  G  H+DADE WV  G  P G D+++VALHEIGHLLGLDHS    AVM 
Sbjct  323  GKTIAHAFRPTNGRFHYDADETWV-VGAVPGGFDLETVALHEIGHLLGLDHSSVPGAVMQ  381

Query  703  EEFEYGEKKRDLTADDINGIRALY  774
             +   G   + L ADD+ GIRALY
Sbjct  382  SQIPPG-YTQSLHADDVQGIRALY  404



>gb|KDP45419.1| hypothetical protein JCGZ_09668 [Jatropha curcas]
Length=270

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 161/272 (59%), Gaps = 25/272 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            G++ K ++ LK+YL+ FGY+N     S S +++ F   LESAI+ YQ  + L+ TG LD+
Sbjct  2    GEKNKKIHQLKEYLEQFGYMN--KKGSVSLDSNSFDGDLESAIKTYQLNYRLDPTGTLDS  59

Query  199  DTARQMMKPRCGVADIINGTRRRPGGEV-------------------VPHYRFYPDEPKW  321
            +T   M+KPRCGV DIINGT R   G +                   V HY F+P  PKW
Sbjct  60   ETVETMIKPRCGVPDIINGTNRMQNGNISPSSSPSPSPSSSPNSFHTVSHYAFFPGTPKW  119

Query  322  PANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHG  498
             A+K HLTY F P TP   I  ++ A + W N   +F+F R T    AD+K      +HG
Sbjct  120  EASKYHLTYEFGPQTPPIAIEVISQAFQTWAN-NSHFTFERGTDITTADIKIRFRKRDHG  178

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG+PFDGRGG  AHA+ P+ G  HFDA+E+WV  G      D+ +VALHEIGHLLGL+HS
Sbjct  179  DGIPFDGRGGILAHAYSPQDGRFHFDAEENWVT-GAREGAYDLGTVALHEIGHLLGLEHS  237

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               EA+M+     G  K  L  DDI+GI+ALY
Sbjct  238  SVEEAIMYPTIPSGATK-GLHKDDIDGIQALY  268



>gb|EPS59674.1| hypothetical protein M569_15132, partial [Genlisea aurea]
Length=260

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 164/259 (63%), Gaps = 7/259 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G + G+R +G++ +K+YL+ FGY+     N   S+ D+F ++L SA+R+YQ  + LN 
Sbjct  9    LEGCRLGNRSEGIHGVKRYLERFGYLR-YEGNDPHSDDDFFDERLYSAVRVYQANYRLNV  67

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TG LDA TA  M   RCGV DI+NGT         P++ F+PD  +WP  K HL+Y +  
Sbjct  68   TGELDAATASVMSLQRCGVPDIVNGTNLMISWR--PYFSFFPDRQRWPPKKTHLSYLYLT  125

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGSYAH  540
              P ++I  +  A ++W +V   F+F R    ++D+    FSG+HGDGVPFDG GG  AH
Sbjct  126  NVPPEYIPAIDRAFESWASVTR-FTFHRVE-DSSDITVGYFSGDHGDGVPFDGPGGVLAH  183

Query  541  AFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYG  720
            +F P  G  HFDA E W + G  P+  D+ S+A+HEIGHLLGL HS  REA+MW  F  G
Sbjct  184  SFAPTDGRMHFDAAEPWFD-GVKPDRFDVHSIAMHEIGHLLGLGHSSVREAIMWAYFGLG  242

Query  721  EKKRDLTADDINGIRALYH  777
            E +R +  DDI+GI+ALY+
Sbjct  243  E-RRTIQPDDIDGIKALYN  260



>ref|XP_010037507.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49217.1| hypothetical protein EUGRSUZ_K02797 [Eucalyptus grandis]
Length=311

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 162/274 (59%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEA----DYFSDQLESAIRIYQTRH  168
            LQG  KGD+VKGL  LK+YL+ FGY+N   YN S+ +     D F + LESAI++YQ  +
Sbjct  42   LQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQTNANDDDFDELLESAIKLYQLNY  98

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEP  315
            HL  TG LD+ T   M  PRCG ADI+NGT R   G+            V H+ F+   P
Sbjct  99   HLKVTGNLDSQTVAMMTMPRCGAADIVNGTSRMRSGKRGTRHGSSNFHTVGHFTFFDGNP  158

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGE  492
            KWP++K HLTY F P T    + PV+ A   W +  + F+FS++  + +AD+K A    +
Sbjct  159  KWPSSKYHLTYAFYPETRDDVVGPVSRAFNTWASATQ-FTFSQSQNYESADIKIAFARRD  217

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG PFDG  G  AHAF P  G  H+DADE W   GP     ++++VALHEIGHLLGL 
Sbjct  218  HGDGAPFDGPNGVIAHAFQPTVGMFHYDADEPWSA-GPVSGSYNMETVALHEIGHLLGLG  276

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS    A+M+     G  K  L  DD+ GI+ALY
Sbjct  277  HSSVAGAIMYPTISPGVSK-GLHGDDVQGIKALY  309



>ref|XP_010037506.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49212.1| hypothetical protein EUGRSUZ_K02792 [Eucalyptus grandis]
Length=311

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 161/274 (59%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEA----DYFSDQLESAIRIYQTRH  168
            LQG  KGD+VKGL  LK+YL+ FGY+N   YN S+ +     + F + LESA++ YQ  +
Sbjct  42   LQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQGHANDEDFDELLESAVKTYQLNY  98

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEP  315
            H+  TG LD+ T   M  PRCGVADI+NGT R   G+            V H+ F+   P
Sbjct  99   HMKVTGNLDSQTVAMMTTPRCGVADIVNGTSRMRSGKRTTHHGSNKFHTVGHFTFFDGSP  158

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGE  492
            KWP++K HLTY   PGT    + PV+ A K W +   +F+FS++  + +AD+K A    +
Sbjct  159  KWPSSKYHLTYALDPGTQDDVLGPVSRAFKTWAS-ATHFTFSQSQNYESADIKIAFARRD  217

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG PFDG  G  AHAF P  G  H+D DE W   GP     D+++VALHEIGHLLGL 
Sbjct  218  HGDGAPFDGPSGVIAHAFQPTIGVFHYDGDEPW-SVGPVRGSYDLETVALHEIGHLLGLG  276

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS    A+M+     G  K  L  DD+ GI+ LY
Sbjct  277  HSSVAGAIMYPTISPGVSK-GLHGDDVQGIKTLY  309



>ref|XP_008230961.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=311

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 158/273 (58%), Gaps = 21/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G + GD+V G+ +LKKYL  FGY++    ++++   D F DQL SAI+ YQ  ++L +
Sbjct  45   LKGFQNGDKVPGIQDLKKYLGRFGYLS----SNNNQTTDEFDDQLASAIKTYQLNYNLKT  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRR-RPG------------GEVVPHYRFYPDEPKW  321
            TGILD  T   MM PRCGV DIINGT   R G            G  V HY F+P +PKW
Sbjct  101  TGILDTQTVSNMMMPRCGVPDIINGTSSMRSGKQSHPPPNHHHKGHTVAHYAFFPGKPKW  160

Query  322  PANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNA-DLKFALFSGEHG  498
            PA+K HLTY F  GTP+    PVA A   W      F FS+       DL  +     HG
Sbjct  161  PASKYHLTYAFLRGTPTAAKGPVARAFNTW-AAHTQFKFSQAPRNQKPDLTVSFHRRSHG  219

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG PFDG GG  AH+F P+ G  H+DADE W   G       +++VALHEIGHLLGL HS
Sbjct  220  DGHPFDGPGGILAHSFAPKDGRFHYDADEKW-SVGVVRGAFHLETVALHEIGHLLGLGHS  278

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
              R A+M+     GE K  L  DDI GI+ALYH
Sbjct  279  SVRRAIMYPTISSGETK-GLNRDDIQGIKALYH  310



>emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera]
Length=305

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 161/264 (61%), Gaps = 10/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----SEADYFSDQLESAIRIYQTRH  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S     +  D F D +ESAI+ YQT +
Sbjct  46   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  102

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTR-RRPGGEVVPHYRFYPDEPKWPANKRHLT  345
            HLN+TG LD++T  QM+KPRCG ADIINGT   R G +   H       P+WP +K +LT
Sbjct  103  HLNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRSPRWPPSKTYLT  162

Query  346  YGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRG  525
            Y F PGTPS  + PV+ A   W +   +         +AD+  +    +HGDG PFDG G
Sbjct  163  YAFLPGTPSWAMSPVSRAXXQWDSATHFTFGXIQDHTSADMTISFHRLDHGDGXPFDGPG  222

Query  526  GSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWE  705
            G+ AHAF P  G  H+D DE W   G  PN +D+++VA+HEIGHLLGL HS  + A+M+ 
Sbjct  223  GTIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVAVHEIGHLLGLGHSSVQNAIMFP  281

Query  706  EFEYGEKKRDLTADDINGIRALYH  777
                G  K  L  DDI GI ALY+
Sbjct  282  SISSGVTK-GLHEDDIQGIXALYN  304



>ref|XP_009341183.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=340

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 164/283 (58%), Gaps = 30/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSSEADYFSDQLESAIRIYQTRH  168
            L+G  KGD ++G+++LK YL+ FGY   LSY    N+  +  D F + LE A++ YQ  +
Sbjct  61   LKGGHKGDHIEGIHDLKLYLEKFGY---LSYAHAKNNPHANDDDFDNLLELAVKTYQLNY  117

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------------VVP  288
            HLN+TG LD +T  +MM PRCGVAD+INGT     G+                     V 
Sbjct  118  HLNTTGTLDGETVSKMMMPRCGVADVINGTSSMRSGKKKHHQHDPDHDHHNHGSSVHAVS  177

Query  289  HYRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNAD  465
            HY F+    +WP +K HLTYGF P TP++ + PV+ A + W +   +F FSR+  +  AD
Sbjct  178  HYSFFKGRLRWPTSKHHLTYGFLPSTPTEAMGPVSHAFRTWAS-NTHFRFSRSRNYKRAD  236

Query  466  LKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALH  645
            +K +    +HGDG PFDG+GG  AHA+ P  G  H+DADE W   G      D+++VALH
Sbjct  237  IKISFEYSDHGDGSPFDGKGGVLAHAYAPTNGRFHYDADEPW-SVGALEGYYDLETVALH  295

Query  646  EIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EIGHLLGL HS    A+M+     G  K  L  DDI GI+ LY
Sbjct  296  EIGHLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  338



>ref|XP_008355534.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 162/283 (57%), Gaps = 30/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSSEADYFSDQLESAIRIYQTRH  168
            L+G  KGD ++G+++LK YL+ FGY   LSY    N+  +  D F +  E A++ YQ  +
Sbjct  30   LRGGHKGDHIEGIHDLKLYLEKFGY---LSYAHAKNNPHANDDDFDNLXELAVKTYQLNY  86

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGG--------------------EVVP  288
            HLN+TG LD +T  +MM PRCGVADIINGT     G                      V 
Sbjct  87   HLNTTGTLDGETVSKMMMPRCGVADIINGTSSMRSGKKKHHHHDPDHDHHNHGSSVHAVS  146

Query  289  HYRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNAD  465
            HY F+    +WP +K HLTYGF P TP++ + PV+ A + W +   +F FSR+  +  AD
Sbjct  147  HYSFFKGRLRWPTSKHHLTYGFLPNTPTEAMGPVSYAFRTWAS-NTHFRFSRSRNYRRAD  205

Query  466  LKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALH  645
            +K +   G+HGDG PFDG GG  AHA+ P  G  H+DADE W   G      D+++VALH
Sbjct  206  IKISFEYGDHGDGSPFDGEGGVLAHAYAPTNGRFHYDADEPW-SVGALEGYYDLETVALH  264

Query  646  EIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EIGHLLGL HS    A+M+     G  K  L  DDI GI+ LY
Sbjct  265  EIGHLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  307



>ref|XP_010039144.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=315

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 132/283 (47%), Positives = 165/283 (58%), Gaps = 30/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-----SEADYFSDQLESAIRIYQTR  165
            LQG  KG+   G+  LK+YL+ FGY+N   YN S      ++ D F D LE A++ YQ  
Sbjct  40   LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  96

Query  166  HHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPD  309
            +HLN TG LD  T  +MM+PRCGVADIINGT R   G+             V HY F   
Sbjct  97   YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  156

Query  310  EPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFS  486
             P+WPA+  HLTYGF PGTP     PVA A   W +V   F+FS       A+++     
Sbjct  157  SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTR-FTFSYVEDHEIANIQIGFAR  215

Query  487  GEHGDGV--PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG---LDIQSVALHEI  651
            G+HGDG    FDG GG+ AHAFPP  G  H+DADE W     PP+G    ++++VALHEI
Sbjct  216  GDHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAV--DPPSGSAAFNVETVALHEI  273

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
            GHLLGL HS+   A+M+     G  K  L ADDI GI+ALY+F
Sbjct  274  GHLLGLGHSDVEGAIMYSSIAPGTTK-GLHADDIQGIKALYNF  315



>ref|XP_010273763.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=348

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 157/278 (56%), Gaps = 22/278 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEAD--YFSDQLESAIRIYQTRHHL  174
            L+G  KG  VKG++ LK+YL+ FGY+N    N S + AD   F + LESA++ YQ  +HL
Sbjct  69   LEGCHKGQDVKGVHQLKRYLEKFGYLNYPPGNKSLTHADDEEFDELLESAVKTYQLNYHL  128

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE-------------VVPHYRFYPDEP  315
              TG LD+ T +QMM PRCG+ DIINGT     G+              V HY F+P+ P
Sbjct  129  KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHAPSSLHTVSHYTFFPNNP  188

Query  316  KWPANKRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNA-DLKFAL  480
            +WP +K HLTY F          +     + A   W  V  +F+F       A D+    
Sbjct  189  RWPPSKTHLTYRFRSSASVVGLQELRSICSRAFSRWQQV-SHFTFEEVQNGAASDIVIGF  247

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHL  660
              G+HGDG  FDGRGG+ AHAF P  G  H+DADE W    P P   D++SVA+HEIGHL
Sbjct  248  HRGDHGDGYSFDGRGGTLAHAFAPTIGRFHYDADESW-STNPQPGVFDLESVAVHEIGHL  306

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EA+M+     G  KR+L  DD+ GIRALY
Sbjct  307  LGLGHSSVPEAIMYPSIPAGAVKRNLHGDDVQGIRALY  344



>ref|XP_009368959.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
 ref|XP_009342471.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=320

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 162/275 (59%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-SEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG  V GL  LKKYL  FGY+N   Y+ S  +  D F D LESAI+ YQ   HLN
Sbjct  48   LEGCHKGQNVSGLQELKKYLTKFGYLN---YDHSKHANDDEFDDLLESAIKSYQKSFHLN  104

Query  178  STGILDADTARQMMKPRCGVADIINGTRR------RPGGEV--VPHYR-FYPDEPKWPAN  330
             TG LD  T +QMM PRCGV D++NGTR+      R    +  V +Y  F+P   +WP  
Sbjct  105  VTGSLDTTTVKQMMVPRCGVPDVVNGTRKGTKNHNRKLKSIHGVSYYEFFFPGPLRWPPT  164

Query  331  KRHLTYGFA------PGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGE  492
            K HL Y FA      PGT +   +  A A + W  V  +         +AD+      G 
Sbjct  165  KTHLRYRFASSASQVPGTENVRSI-CAQAFQKWAQVTSFTFEEVPATSSADITIGFHRGA  223

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGD  PFDG  G+ AHA PP  G+ HFDADE W    P PN +D++SVA+HEIGHLLGLD
Sbjct  224  HGDMAPFDGFKGALAHANPPTGGNFHFDADEKW-SANPGPNEVDLESVAVHEIGHLLGLD  282

Query  673  HS-EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            H+ +  +A+M+ +F YG  KRDLT DDI+GIRALY
Sbjct  283  HNLDLPDAIMYPKFSYGIVKRDLTGDDIDGIRALY  317



>ref|XP_010278837.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=319

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 157/278 (56%), Gaps = 22/278 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEAD--YFSDQLESAIRIYQTRHHL  174
            L+G  KG  +KG++ LK+YL+ FGY+N    N S + AD   F + LESA++ YQ  +HL
Sbjct  40   LEGCHKGQDLKGVHQLKRYLEKFGYLNYPPGNKSLTHADDDEFDELLESAVKTYQLNYHL  99

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE-------------VVPHYRFYPDEP  315
              TG LD+ T +QMM PRCG+ DIINGT     G+              V HY F+P+ P
Sbjct  100  KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHGPSSLHTVSHYTFFPNNP  159

Query  316  KWPANKRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNA-DLKFAL  480
            +WP +K HLTY F          +     + A   W  V  +F+F       A D+    
Sbjct  160  RWPPSKTHLTYRFRSSVSVVGLQQLRSICSRAFSRWQQV-SHFTFEEVQNGAASDIVIGF  218

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHL  660
              G+HGDG  FDGRGG+ AHAF P  G  H+DADE W    P P   D++SVA+HEIGHL
Sbjct  219  HRGDHGDGYSFDGRGGTLAHAFAPTVGRFHYDADESW-STNPQPGMFDLESVAVHEIGHL  277

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EA+M+     G  KR+L  DD+ GIRALY
Sbjct  278  LGLGHSSVPEAIMYPSIPDGAVKRNLHGDDVQGIRALY  315



>ref|XP_009351242.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=317

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 162/275 (59%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-SEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG  V GL  LKKYL  FGY+N   Y+ S  +  D F D LESAI+ YQ   HLN
Sbjct  45   LEGCHKGQNVSGLQELKKYLTKFGYLN---YDHSKHANDDEFDDLLESAIKSYQKSFHLN  101

Query  178  STGILDADTARQMMKPRCGVADIINGTRR------RPGGEV--VPHYR-FYPDEPKWPAN  330
             TG LD  T +QMM PRCGV D++NGTR+      R    +  V +Y  F+P   +WP  
Sbjct  102  VTGSLDTTTVKQMMVPRCGVPDVVNGTRKGTKNHNRKLKSIHGVSYYEFFFPGPLRWPPT  161

Query  331  KRHLTYGFA------PGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGE  492
            K HL Y FA      PGT +   +  A A + W  V  +         +AD+      G 
Sbjct  162  KTHLRYRFASSASQVPGTENVRSI-CAQAFQRWAQVTSFTFEEVPATSSADITIGFHRGA  220

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGD  PFDG  G+ AHA PP  G+ HFDADE W    P PN +D++SVA+HEIGHLLGLD
Sbjct  221  HGDMAPFDGFKGALAHANPPTGGNFHFDADEKW-SANPGPNEVDLESVAVHEIGHLLGLD  279

Query  673  HS-EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            H+ +  +A+M+ +F YG  KRDLT DDI+GIRALY
Sbjct  280  HNLDLPDAIMYPKFSYGIVKRDLTGDDIDGIRALY  314



>ref|XP_006431003.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
 gb|ESR44243.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
Length=254

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 153/256 (60%), Gaps = 19/256 (7%)
 Frame = +1

Query  58   LKTFGYINDLSYNSSSSEADYFS--DQLESAIRIYQTRHHLNSTGILDADTARQMMKPRC  231
            ++ FGY+N  +Y + S+ AD     + LESAI+ YQ  +HL STG+LDA+T  +M  PRC
Sbjct  1    MEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHLKSTGVLDANTVAKMTIPRC  60

Query  232  GVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTYGFAPGTPSKFI  381
            GVADI+NGT R   G+           V HY F+P  PKWPA+K  LTY F PGT S  I
Sbjct  61   GVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWPASKFSLTYAFRPGTRSDAI  120

Query  382  VPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGRGGS---YAHAFP  549
             PVA A + W      F FS+   F NAD+K +  SG+HGDG PFDGRGG     AHAF 
Sbjct  121  TPVARAFQTW-AANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFA  179

Query  550  PEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGEKK  729
            P  G  H+DADE W   G      D+++VALHEIGHLLGL HS    A+M+     G  K
Sbjct  180  PTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLHHSSVEGAIMYPSISAGVTK  238

Query  730  RDLTADDINGIRALYH  777
              L  DDI GIR LY+
Sbjct  239  -GLHGDDIQGIRDLYN  253



>ref|XP_006482471.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=254

 Score =   216 bits (549),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 153/256 (60%), Gaps = 19/256 (7%)
 Frame = +1

Query  58   LKTFGYINDLSYNSSSSEA--DYFSDQLESAIRIYQTRHHLNSTGILDADTARQMMKPRC  231
            ++ FGY+N  +Y + S  A  D F + LESAI+ YQ  +HL STGILDA+T  +M  PRC
Sbjct  1    MEKFGYLNYDNYKNQSKHANDDDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRC  60

Query  232  GVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTYGFAPGTPSKFI  381
            GVADI+NGT +   G+           V HY F+   P+WPA+K  LTY F PGT S  I
Sbjct  61   GVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAI  120

Query  382  VPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGRGGS---YAHAFP  549
             PVA A + W      F FS+   F NAD+K +  SG+HGDG PFDGRGG     AHAF 
Sbjct  121  TPVARAFQTW-AANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFA  179

Query  550  PEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGEKK  729
            P  G  H+DADE W   G      D+++VALHEIGHLLGL HS    A+M+     G KK
Sbjct  180  PTNGRFHYDADEPWA-VGAVQGAFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAGVKK  238

Query  730  RDLTADDINGIRALYH  777
              L  DDI GIR LY+
Sbjct  239  -GLHGDDIQGIRDLYN  253



>ref|XP_007216020.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
 gb|EMJ17219.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
Length=296

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 152/271 (56%), Gaps = 35/271 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+     D F DQLESAI+ YQ  +HL +
Sbjct  48   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQINYHLKA  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKWP  324
            TG LDA T   MM PRCGVADIINGT     G+             V HY F+   PKWP
Sbjct  106  TGALDAKTVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            A+K HLTY F   TP++   P                       N DL  +   G HGDG
Sbjct  166  ASKYHLTYAFLQDTPAEATGPSNQ--------------------NPDLTVSFHRGNHGDG  205

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG GG+ AHAF P  G  H+DADE +   G      D+++VALHEIGHLLGL HS  
Sbjct  206  APFDGPGGTIAHAFAPTNGRFHYDADERF-SVGAVSGAYDLETVALHEIGHLLGLGHSSV  264

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            + A+M+     G  ++ L  DDI GI+ALY+
Sbjct  265  QGAIMYPTISPGVTQQSLHGDDIQGIKALYN  295



>ref|NP_001266203.1| matrix metalloproteinase precursor [Solanum lycopersicum]
 emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=367

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 157/278 (56%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G  V GL  +KKY   FGYIN    NSS++  D F D LESA++ YQ   +LN+
Sbjct  48   LLGCHSGQTVDGLAKIKKYFHYFGYIN----NSSTNFTDDFDDTLESALKTYQLNFNLNT  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG+LDA+T + ++KPRCG AD++NGT     G+          V HY F+P  P+WPANK
Sbjct  104  TGVLDANTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGSPRWPANK  163

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
            R LTY FAP  G      +    A   W  V          + +AD+K   FSG+H DG 
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTRAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPP---------NGLDIQSVALHEIGHL  660
            PFDG  G+ AHAF P  G  H D +E+WV  G P          + +D++SVA+HEIGHL
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGHL  283

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   +A+M+     G ++ +L  DDI G++ LY
Sbjct  284  LGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_006363533.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=370

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 156/278 (56%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G  V GL  +KKY   FGYIN    NSSS+  D F D LESA++ YQ   +LN+
Sbjct  48   LLGCHSGQTVDGLAKIKKYFHYFGYIN----NSSSNFTDDFDDTLESALKTYQLNFNLNT  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG+LDA T + ++KPRCG AD++NGT     G+          V HY F+P  P+WPANK
Sbjct  104  TGVLDASTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGRPRWPANK  163

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
            R LTY FAP  G      +    A   W  V          + +AD+K   FSG+H DG 
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTHAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPP---------NGLDIQSVALHEIGHL  660
            PFDG  G+ AHAF P  G  H D +E+WV  G P          + +D++SVA+HEIGHL
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVIDGAPIVDGNFFSILSAVDLESVAVHEIGHL  283

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   +A+M+     G ++ +L  DDI G++ LY
Sbjct  284  LGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_011071055.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=374

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 162/274 (59%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G KKG +  GL  LK+Y + FGY+N     S S  +D F D LE A++ YQ   +LN+
Sbjct  51   LVGCKKGQKADGLPKLKEYFQYFGYLN----TSYSDFSDEFDDSLEIAVKTYQLNFNLNA  106

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------VVPHYRFYPDEPKWPANKR  336
            TG +DA+T ++++ PRCG  DI+NGT     G+         V HY F+P+ P+WP +K 
Sbjct  107  TGQIDAETIKRIVVPRCGNPDIVNGTSAMHPGKPSANSTIHTVAHYSFFPNRPRWPPSKS  166

Query  337  HLTYGFAPGTPSKFIVPV--ATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGV  507
             LTY F P      +V    + A + W  V    +F+    FN AD++   FS EHGDG 
Sbjct  167  QLTYAFLPENQLSDVVKTVFSRAFERWSEVTT-LTFTEISSFNRADIRIGFFSREHGDGE  225

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWV---EF--GPPPNGLDIQSVALHEIGHLLGLD  672
            PFDG  G+ AHAF P  G CHFD +E+WV   +F  G P + +D++SVA+HEIGH+LGL 
Sbjct  226  PFDGVLGTLAHAFSPPTGRCHFDGEENWVIDGDFLNGAPLSAVDLESVAVHEIGHILGLG  285

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS   EA+M+     G +K +L  DDI GI+ LY
Sbjct  286  HSSVEEAIMYPSISSGTRKVELADDDIMGIQELY  319



>ref|XP_002275671.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=303

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 159/266 (60%), Gaps = 11/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS--EADYFSDQLESAIRIYQTRHHL  174
            LQGS+KGD+V+G++ +KKYL+ FGY+      + +     D+F D LESAI+ +QT +HL
Sbjct  39   LQGSQKGDKVEGIHKVKKYLQHFGYLGSTHSQTETQVDSEDHFDDALESAIKAFQTYYHL  98

Query  175  NSTGILDADTARQMMKPRCGVAD---IINGTRRRPGG--EVVPHYRFYPDEPKWPANKRH  339
              TGILDA TA QM + RCGV D   + N           +  HY F+P++P+WPA KRH
Sbjct  99   KPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRH  158

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFD  516
            L Y     +  +    VA A  AW  V   F+F RT     A+L  +    +HGDG PFD
Sbjct  159  LLYSLDSASHPEAANAVANAFGAWAGVTN-FTFERTSDPKIANLYISFKVRDHGDGRPFD  217

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            GRGG  AHAF P  G  HFD DE WV  G   N +D+Q+VA HEIGHLLGL H+  +EA+
Sbjct  218  GRGGILAHAFAPTDGRFHFDGDETWV-IGAVANSMDLQTVARHEIGHLLGLAHTPVQEAI  276

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            M+     G  K  L  DDI+GIRALY
Sbjct  277  MYAIISPGVTK-GLNQDDIDGIRALY  301



>emb|CBI34987.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 159/266 (60%), Gaps = 11/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS--EADYFSDQLESAIRIYQTRHHL  174
            LQGS+KGD+V+G++ +KKYL+ FGY+      + +     D+F D LESAI+ +QT +HL
Sbjct  32   LQGSQKGDKVEGIHKVKKYLQHFGYLGSTHSQTETQVDSEDHFDDALESAIKAFQTYYHL  91

Query  175  NSTGILDADTARQMMKPRCGVAD---IINGTRRRPGG--EVVPHYRFYPDEPKWPANKRH  339
              TGILDA TA QM + RCGV D   + N           +  HY F+P++P+WPA KRH
Sbjct  92   KPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRH  151

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFD  516
            L Y     +  +    VA A  AW  V   F+F RT     A+L  +    +HGDG PFD
Sbjct  152  LLYSLDSASHPEAANAVANAFGAWAGVTN-FTFERTSDPKIANLYISFKVRDHGDGRPFD  210

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            GRGG  AHAF P  G  HFD DE WV  G   N +D+Q+VA HEIGHLLGL H+  +EA+
Sbjct  211  GRGGILAHAFAPTDGRFHFDGDETWV-IGAVANSMDLQTVARHEIGHLLGLAHTPVQEAI  269

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            M+     G  K  L  DDI+GIRALY
Sbjct  270  MYAIISPGVTK-GLNQDDIDGIRALY  294



>ref|XP_010255281.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=378

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/271 (45%), Positives = 151/271 (56%), Gaps = 19/271 (7%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G   G+RV GL  LKKY + FGYI D    S S+  D F D  ESA++ YQ   +LN+TG
Sbjct  61   GCHSGERVDGLAGLKKYFQHFGYIPD----SPSNFTDDFDDAFESALKKYQQNFNLNATG  116

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANKRH  339
            +LD  T +QM++PRCGVADIINGT     G+          V HY F+P  P WP +KR 
Sbjct  117  VLDESTIQQMVRPRCGVADIINGTSTMNSGKSAKSTHSIHTVAHYSFFPYRPTWPPSKRD  176

Query  340  LTYGFAPGTPSKFIVPV--ATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPF  513
            LTY F P       V    A +   W  V        + +  AD+K A F G+H DG PF
Sbjct  177  LTYAFLPANQLSDTVKAVFAHSFARWSAVTPLSFTESSVYLTADIKIAFFRGDHNDGEPF  236

Query  514  DGRGGSYAHAFPPEYGDCHFDADEHWV----EFGPPPNGLDIQSVALHEIGHLLGLDHSE  681
            DG  G+ AHAF P  G  H D  E+WV         P+ +D++SVA+HEIGHLLGL HS 
Sbjct  237  DGVLGTLAHAFSPPDGRFHLDGAENWVVDDARKSSIPSAVDLESVAVHEIGHLLGLGHSS  296

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              EA+M+     G KK +L  DDI GI+ LY
Sbjct  297  QEEAIMFPTISSGMKKVELANDDIQGIQFLY  327



>ref|XP_006448956.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
 gb|ESR62196.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
Length=314

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 154/272 (57%), Gaps = 17/272 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN----------DLSYNSSSSEADYFSDQLESAIR  150
             QGS+KGD+VKG++ L+KYL++ GYIN          D S   S  E DYF + LESAI+
Sbjct  43   FQGSQKGDKVKGIHQLRKYLQSLGYINQNNISPSISLDNSDKESHIEDDYFGEDLESAIK  102

Query  151  IYQTRHHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP----HYRFYPDEPK  318
             YQ   +LN+TG LD  T   M +PRCG+ DIINGT R   G        HY F+ + P+
Sbjct  103  TYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSADKKYDIHYAFF-EGPR  161

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
            WP  K+ +T+ F PGT +    PV  AL  W N   +       + NAD+K +   G+HG
Sbjct  162  WPLTKKTVTFAFQPGTRADIHEPVRVALLLWSNWAPFAFEGSNDYENADIKISFQRGDHG  221

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG PFDG   + AHAF   Y   HF+ D +WV  G    G D+Q+VALHE+GH+LGL HS
Sbjct  222  DGTPFDGPWHTLAHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGHVLGLSHS  280

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              + A MW     G  K  L  DDI  ++ LY
Sbjct  281  SVKAASMWPSTRAGTTK-GLNDDDIRRMKMLY  311



>ref|XP_006856883.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
 gb|ERN18350.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
Length=357

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 153/267 (57%), Gaps = 15/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L G  KG+ V GL  +K+YL TFGYI  +L++       D F D LESAI+ YQ    LN
Sbjct  43   LSGCHKGEHVPGLTAIKQYLHTFGYIPQNLNF------TDDFDDSLESAIKTYQQNFRLN  96

Query  178  STGILDADTARQMMKPRCGVADIINGTR---RRPGGEVVPHYRFYPDEPKWPANKRHLTY  348
            +TG LD+ T RQMM PRCGV D++NGT    R  G   V  Y F+P  P+WP  KR+LTY
Sbjct  97   ATGSLDSGTVRQMMSPRCGVPDVVNGTTTMMRSRGLSSVMRYTFFPGNPRWPVWKRNLTY  156

Query  349  GFAPGTPSK----FIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPF  513
               PGT S         V     A        SF+  T +  AD++ A F G+HGDG PF
Sbjct  157  AIRPGTFSTSDDTAARAVFARAFARWAAATTLSFTESTSYSTADIRIAFFGGDHGDGEPF  216

Query  514  DGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREA  693
            DG  G+ AHAF P  G  H DA E WV  G    G+D++SVA+HEIGH+LGL HS    A
Sbjct  217  DGALGTLAHAFSPPDGRLHLDAAELWVVSGNSRLGIDLESVAVHEIGHVLGLGHSSDEAA  276

Query  694  VMWEEFEYGEKKRDLTADDINGIRALY  774
            +M+     G ++ +L  DDI GI+ LY
Sbjct  277  IMFPTITTGTRRVELATDDIMGIQELY  303



>ref|XP_010091950.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB47730.1| Metalloendoproteinase 1 [Morus notabilis]
Length=370

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 168/303 (55%), Gaps = 48/303 (16%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN---------------DLSYNSSSSEAD--YFSD  129
            L+GSKKGD+V+G+ +LKKYL+ FGY+N               D S N+  S A+   F D
Sbjct  67   LEGSKKGDKVQGIRDLKKYLQHFGYLNPTQITKTQITGHSLNDNSINNDISTANDSTFDD  126

Query  130  QLESAIRIYQTRHHLNSTGILDADTARQMMKPRCGVADIING-TRRRPGG----------  276
             LE+AI+ YQT ++L  TG LD+ T  +MM PRC VADIIN  TR R             
Sbjct  127  LLEAAIKTYQTNYNLKPTGTLDSQTLSKMMMPRCAVADIINNDTRMRSKKKSTTSSTKNH  186

Query  277  ----------------EVVPHYRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKA  408
                            + V HY F+  +PKWP++K  LTY FA G  S+ +  V  A + 
Sbjct  187  VHRKLLGQKYVSTDDLQTVSHYSFFSGKPKWPSSKYSLTYSFAEGMLSEDVEAVGRAFQT  246

Query  409  WHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADE  585
            W +   +FSFSR  G   AD++ +   G+HGDG  FDG GG  AHAF P  G  HFDADE
Sbjct  247  WAS-NTHFSFSRAQGNTKADIRVSFERGDHGDGDAFDGAGGVLAHAFSPTDGRLHFDADE  305

Query  586  HWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIR  765
             W   G   +  D+++VALHEIGH+LGL HS    A+M+ +   G  K  L ADDI GI 
Sbjct  306  TWA-IGEVADAFDVETVALHEIGHILGLLHSSVEGAIMYPQIGSGLTK-GLNADDIQGIN  363

Query  766  ALY  774
            ALY
Sbjct  364  ALY  366



>gb|KCW49215.1| hypothetical protein EUGRSUZ_K02795 [Eucalyptus grandis]
Length=405

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/283 (47%), Positives = 165/283 (58%), Gaps = 30/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-----SEADYFSDQLESAIRIYQTR  165
            LQG  KG+   G+  LK+YL+ FGY+N   YN S      ++ D F D LE A++ YQ  
Sbjct  130  LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  186

Query  166  HHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPD  309
            +HLN TG LD  T  +MM+PRCGVADIINGT R   G+             V HY F   
Sbjct  187  YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  246

Query  310  EPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFS  486
             P+WPA+  HLTYGF PGTP     PVA A   W +V   F+FS       A+++     
Sbjct  247  SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTR-FTFSYVEDHEIANIQIGFAR  305

Query  487  GEHGDGV--PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG---LDIQSVALHEI  651
            G+HGDG    FDG GG+ AHAFPP  G  H+DADE W     PP+G    ++++VALHEI
Sbjct  306  GDHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAV--DPPSGSAAFNVETVALHEI  363

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
            GHLLGL HS+   A+M+     G  K  L ADDI GI+ALY+F
Sbjct  364  GHLLGLGHSDVEGAIMYSSIAPGTTK-GLHADDIQGIKALYNF  405



>ref|XP_004297896.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 161/267 (60%), Gaps = 14/267 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSSEADYFSDQLESAIRIYQTRH  168
            L+GS KGD ++G+ +LK +L+ FGY   LSY    N   ++ D F D LESA++ YQ   
Sbjct  49   LKGSHKGDHIQGILDLKLFLEKFGY---LSYGNDKNHIHADDDDFDDVLESAVKDYQHYF  105

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTR----RRPGGEVVPHYRFYPDEPKWPANKR  336
            HL +TG LD  T  +M KPRCGV+D I   +    ++     V HY F+  + KWP +K 
Sbjct  106  HLRTTGTLDGKTVSKMTKPRCGVSDHIGVHKIDYSKKDHIHEVSHYSFFSSKQKWPPSKY  165

Query  337  HLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPF  513
            HLTY FAPGT S+ + P+A A + W     +F F R   +  AD+K +   G+HGDG  F
Sbjct  166  HLTYAFAPGTLSEAMTPIAQAFQTW-AASTHFKFRRHRDYKKADIKISFEQGDHGDGSSF  224

Query  514  DGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREA  693
            DG GG  AHA+ P YG  H+DADE W   G      D+++VALHEIGHLLGL HS   +A
Sbjct  225  DGTGGILAHAYAPTYGKLHYDADEPW-SIGALEGYYDLETVALHEIGHLLGLAHSSEEDA  283

Query  694  VMWEEFEYGEKKRDLTADDINGIRALY  774
            +M+     G  K DL  DDI+GIRALY
Sbjct  284  IMYPYISSGVTKLDLHHDDIHGIRALY  310



>gb|KDO75344.1| hypothetical protein CISIN_1g037265mg [Citrus sinensis]
Length=305

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 153/272 (56%), Gaps = 17/272 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN----------DLSYNSSSSEADYFSDQLESAIR  150
             +GS+KGD+VKG++ L+KYL++ GY+N          D S N S  E DYF + LESAI+
Sbjct  34   FRGSQKGDKVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIK  93

Query  151  IYQTRHHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP----HYRFYPDEPK  318
             YQ   +LN+TG LD  T   M +PRCG+ DIINGT R   G        HY F+ + P+
Sbjct  94   TYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSTDKKYDIHYAFF-EGPR  152

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
            WP  K+ +TY F PGT      PV  AL  W N   +       + NAD+K +   G+HG
Sbjct  153  WPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHG  212

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG PFDG   +  HAF   Y   HF+ D +WV  G    G D+Q+VALHE+GH+LGL HS
Sbjct  213  DGTPFDGPWHTLGHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGHVLGLSHS  271

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              + A MW     G  K  L  DDI  ++ LY
Sbjct  272  SVKAASMWPSTRAGTTK-GLNDDDIRRMKMLY  302



>ref|XP_004143787.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004157318.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN51182.1| hypothetical protein Csa_5G484630 [Cucumis sativus]
Length=366

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 156/274 (57%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G + GDR  GL NLK YL  FGYI      SS +  D F   L+SA++ YQT  +LN+
Sbjct  46   LKGCRPGDRFNGLSNLKTYLNRFGYIP-----SSPNFTDLFDPLLQSALKTYQTNFNLNA  100

Query  181  TGILDADTARQMMKPRCGVADIINGT----------RRRPGGEVVPHYRFYPDEPKWPAN  330
            TG+LD  T  Q+  PRCG+ DIIN +          R+ P    V HY F+P  P WPA+
Sbjct  101  TGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGQPTGRQSPHFHSVSHYSFFPGRPIWPAH  160

Query  331  KRHLTYGFAPGTP-SKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDG  504
            +R LTY FAP  P S  +  V     A        +FS    F +AD++   ++G+HGDG
Sbjct  161  RRDLTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRSADIRIGFYAGDHGDG  220

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG----PPPNGLDIQSVALHEIGHLLGLD  672
             PFDG  G+ AHAF P  G  H D DE WV  G     P   +D++SVA+HEIGHLLGL 
Sbjct  221  EPFDGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGLG  280

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS   E++M+       +K DL ADDINGI+ LY
Sbjct  281  HSSVEESIMFPTITSRTRKVDLAADDINGIQELY  314



>ref|XP_008458715.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=317

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 158/268 (59%), Gaps = 13/268 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            LQG   GD  +G+  +KKYL+ FGYI  ++  +S+    D F   LESA++ YQT H+L 
Sbjct  51   LQGCHLGDTKQGIQQIKKYLQRFGYITTNIQKHSNPIFDDTFDQVLESALKTYQTNHNLA  110

Query  178  STGILDADTARQMMKPRCGVADIINGTRR----RPGGEV----VPHYRFYPDEPKWPANK  333
             +GILD++T  Q+ KPRCGV D+I   +R    +  G +    V H+ F+    KWP++K
Sbjct  111  PSGILDSNTLAQIAKPRCGVQDVIKNKKRNQNYKNNGHIHFHKVSHFTFFEGNLKWPSSK  170

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVP  510
             HL+YGF P  P + I PV+ A   W ++  +F FS    +  AD+K +   GEHGD  P
Sbjct  171  FHLSYGFLPNYPIEAIKPVSRAFSKW-SLNTHFKFSHVVDYRKADIKISFERGEHGDNAP  229

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG  AHA+PP  G  HFD DE W   G      D+++VALHEIGH+LGL HS   E
Sbjct  230  FDGVGGVLAHAYPPTDGRLHFDGDEAW-SVGAISGYFDVETVALHEIGHILGLQHSTIEE  288

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            A+M+     G  K  L  DDI GI+ LY
Sbjct  289  AIMFPSIPEGVTK-GLHGDDIAGIKTLY  315



>ref|XP_008465718.1| PREDICTED: metalloendoproteinase 1 [Cucumis melo]
Length=362

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 154/270 (57%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G + GDR+ GL NLK YL  FGYI       S +  D F   L+SA++ YQT  +LN+
Sbjct  46   LKGCRPGDRLNGLSNLKTYLNHFGYIP-----PSPNFTDLFDPLLQSALKTYQTNFNLNA  100

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRRPGGEVVPHYRFYPDEPKWPANKRHL  342
            TG+LD  T  Q+  PRCG+ DIIN +      R  P    V HY F+P  P WPA++R L
Sbjct  101  TGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGRHSPHFHSVSHYTFFPGRPIWPAHRRDL  160

Query  343  TYGFAPGTP-SKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFD  516
            TY FAP  P S  +  V     A        +FS    F  AD++   ++G+HGDG PFD
Sbjct  161  TYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRTADIRIGFYAGDHGDGEPFD  220

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFG----PPPNGLDIQSVALHEIGHLLGLDHSEH  684
            G  G+ AHAF P  G  H D DE WV  G     P   +D++SVA+HEIGHLLGL HS  
Sbjct  221  GVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGLGHSSV  280

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALY  774
             E++M+       +K DL ADDINGI+ LY
Sbjct  281  EESIMFPTITSRTRKVDLAADDINGIQELY  310



>ref|XP_011073059.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 155/266 (58%), Gaps = 9/266 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEAD-YFSDQLESAIRIYQTRHHLN  177
            L G++KG   KG+  LKKYL  FGY+N  +    + + D +F D LE AI+ YQT   L 
Sbjct  49   LVGTRKGTTSKGISQLKKYLSHFGYMNHKNNIILAHQTDDFFDDNLELAIKSYQTFFKLE  108

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP----HYRFYPDEPKWPANKRHLT  345
              GI+DA+T  QM  PRCGV D  N  R       +P    HY F+P EPKWP  KR LT
Sbjct  109  VNGIMDANTITQMSPPRCGVPDSFNLNRSHELYLRIPTLASHYIFFPGEPKWPPTKRSLT  168

Query  346  YGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFDGR  522
            Y F  G P+     +  A + W +V   F+FS T  ++ AD+K +  + +HGDG PFDG 
Sbjct  169  YSFPSGAPTDVTNSILHATQIWASVSP-FTFSYTPDYDQADIKISFQNRDHGDGNPFDGP  227

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMW  702
            GG  AHA+ P  G  HFD DE WV+ G  P   D+Q+V LHE+GH+LGL HS    AVM+
Sbjct  228  GGILAHAYAPSDGRLHFDGDERWVD-GVTPGAFDLQTVGLHELGHVLGLGHSNDTGAVMY  286

Query  703  EEFEYGEKKRDLTADDINGIRALYHF  780
                 G +K  L  DDINGI+ALY F
Sbjct  287  PYIGDGLRKV-LGQDDINGIKALYQF  311



>ref|XP_004139164.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66657.1| hypothetical protein Csa_1G654860 [Cucumis sativus]
Length=314

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 152/279 (54%), Gaps = 23/279 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSSEADYFSDQLESAIRIYQTRH  168
            LQG KKGD VKG+  LK + + +GY    IN   +       D F D+LESAI+ YQ   
Sbjct  37   LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDIDANDIFDDRLESAIKTYQQYF  96

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFY  303
            HLN TG L+A+T  Q+  PRCG  DIIN T  R   E                V HY F+
Sbjct  97   HLNPTGSLNAETLSQLATPRCGNPDIINETTGRMLSEDIDNVSSHDHHHLPHAVSHYAFF  156

Query  304  PDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFAL  480
            P   +WP+ K  LTY F PGT +    PVA A   W     +F F+  T +  ADLK   
Sbjct  157  PGRLRWPSTKYRLTYAFLPGTRADAKAPVARAFATWAR-NTHFKFTLVTNYRRADLKIGF  215

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHL  660
            + G HGDG PFDG GG+ AHAF P  G  H+D+ E W   G      D+Q+VALHEIGHL
Sbjct  216  YRGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWA-VGAVRGRYDLQTVALHEIGHL  274

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            LGL HS  + A+M+   + G  K  L  DDI GI+ LY+
Sbjct  275  LGLGHSTVKNAIMYPYIKSGSTK-GLNVDDIKGIKVLYN  312



>ref|XP_007153680.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
 gb|ESW25674.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
Length=376

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 149/278 (54%), Gaps = 23/278 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G  +G+   GL NLK Y + FGY     +   S+ +D F D LESAI+ YQ   +LN 
Sbjct  53   LTGCHRGENYDGLANLKSYFERFGY---FPHAPPSNFSDEFDDALESAIKTYQKNFNLNV  109

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE-------------VVPHYRFYPDEPKW  321
            TG+LD  T +Q++ PRCGVADIINGT     G+              V H+  +P  P+W
Sbjct  110  TGVLDDATLQQIVLPRCGVADIINGTTTMNAGKQNETASFSKPRFHTVAHFALFPGNPRW  169

Query  322  PANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            P     LTY F PG      V    A+A   W  V          +FNAD++   FSG+H
Sbjct  170  PEGTEELTYAFNPGNDLSNTVKGVFASAFARWAEVTSLTFRETASYFNADIRIGFFSGDH  229

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHL  660
            GDG PFDG  G+ AHAF P  G  H DADE WV  G        + +D++SVA+HEIGHL
Sbjct  230  GDGEPFDGSLGTLAHAFSPTNGRFHLDADEDWVVSGDVTQSALSSAVDLESVAVHEIGHL  289

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EAVM+       KK  L  DDI GI+ LY
Sbjct  290  LGLGHSSVEEAVMFPTISSRRKKVVLAQDDIEGIQFLY  327



>ref|XP_006495379.1| PREDICTED: metalloendoproteinase 1-like, partial [Citrus sinensis]
Length=235

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/235 (50%), Positives = 141/235 (60%), Gaps = 17/235 (7%)
 Frame = +1

Query  115  DYFSDQLESAIRIYQTRHHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE-----  279
            D F + LESAI+ YQ  +HL STGILDA+T  +M  PRCGVADI+NGT +   G+     
Sbjct  3    DDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQH  62

Query  280  -----VVPHYRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR  444
                  V HY F+   P+WPA+K  LTY F PGT S  I PVA A + W      F FS+
Sbjct  63   NHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAITPVARAFQTW-AANTQFKFSK  121

Query  445  T-GFFNADLKFALFSGEHGDGVPFDGRGGS---YAHAFPPEYGDCHFDADEHWVEFGPPP  612
               F NAD+K +  SG+HGDG PFDGRGG     AHAF P  G  H+DADE W   G   
Sbjct  122  IEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWA-VGAVQ  180

Query  613  NGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
               D+++VALHEIGHLLGL HS    A+M+     G KK  L  DDI GIR LY+
Sbjct  181  GAFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAGVKK-GLHGDDIQGIRDLYN  234



>ref|XP_006363534.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=363

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 157/271 (58%), Gaps = 16/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G + G +V G+  +KKY + FGYIN  +   +S+  D F D LESA++ YQ   +LN+
Sbjct  48   LLGCQPGQKVDGIAKIKKYFQHFGYINTFT---TSNFTDEFDDTLESALKTYQRNFNLNA  104

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--VVPHYRFYPDEPKWPANKRHLTYGF  354
            TG+ D  T + ++KPRCG AD++NGT     G+   V HY F+P  PKWP +K  LTY F
Sbjct  105  TGLFDEPTIQNLIKPRCGNADVVNGTSTMNAGKPHTVAHYSFFPGRPKWPESKTDLTYSF  164

Query  355  APGTP-SKFIVPV-ATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGG  528
             P    ++ I  V + A   W  V          F +AD+K   F+G+H DG PFDG  G
Sbjct  165  LPANNLTEDIKSVFSRAFDRWSEVTPLSFTEIASFQSADIKIGFFTGDHNDGEPFDGPMG  224

Query  529  SYAHAFPPEYGDCHFDADEHWVEFGPPPN---------GLDIQSVALHEIGHLLGLDHSE  681
            + AHAF P  G  H D +E+WV  G P N          +D++SVA+HEIGHLLGL HS 
Sbjct  225  TLAHAFSPPAGHFHLDGEENWVVDGVPVNDGNFFSILSAVDLESVAVHEIGHLLGLGHSS  284

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              +++M+   E G ++ +L  DD+ G++ LY
Sbjct  285  VEDSIMYPSLEAGIRRVELVDDDVKGVQELY  315



>gb|KDP32993.1| hypothetical protein JCGZ_13024 [Jatropha curcas]
Length=306

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 153/261 (59%), Gaps = 5/261 (2%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQG  KGD++KG+  LK+YLK FGY+     N + +  DYF D LESAI++YQ  + L +
Sbjct  50   LQGCHKGDKIKGIQELKEYLKYFGYLR--YKNRAHANDDYFDDVLESAIKMYQQNYRLKT  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV-VPHYRFYPDEPKWPANKRHLTYGFA  357
            TG L ++T  +MM PRCGVAD+ NGT ++         Y F+P  PKWPA+K  LTY   
Sbjct  108  TGSLTSETVSKMMMPRCGVADLTNGTIKKSSNAYHTSGYTFFPGNPKWPASKYALTYELR  167

Query  358  PGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGSYA  537
              TP   I P+  A +AW NV  +      G  N D+   L+ G+HGDG PFD  G   A
Sbjct  168  YDTPPHLIPPLQNAFQAWANVTPFTFSPFHGRGNPDITIGLYKGDHGDGYPFDAFGAIAA  227

Query  538  HAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
            H++PP+ G  HF++   +   G  PN  D  +VA HEIGHLLGL HS   EA+M+    +
Sbjct  228  HSWPPQDGRLHFNSYGRFC-IGAFPNLYDFGTVASHEIGHLLGLGHSRDEEAIMYPVAPF  286

Query  718  GEKKRDLTADDINGIRALYHF  780
            G  K  +   DI G+RALY F
Sbjct  287  GRVK-GIHQYDIEGVRALYEF  306



>ref|XP_004139163.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66654.1| hypothetical protein Csa_1G654840 [Cucumis sativus]
Length=315

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 152/280 (54%), Gaps = 24/280 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSSEADYFSDQLESAIRIYQTRH  168
            LQGSKKGD VKG+  LK + + +GY    IN   +       D F D+ ESA++ YQ   
Sbjct  35   LQGSKKGDNVKGISKLKNFFRRYGYLNHQINVTGHLIDHDADDTFDDRFESAVKTYQQYF  94

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE----------------VVPHYRF  300
            HLNSTG L+A+T  Q+  PRCG  DI+N    R   E                 VPHY F
Sbjct  95   HLNSTGSLNAETLSQLATPRCGNPDILNEATGRMLLENNNNDSSHDHYHQLSHAVPHYSF  154

Query  301  YPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFS-RTGFFNADLKFA  477
            +P  P+WP  K HLTY F P T +    PV  A   W     +F FS  T    ADLK  
Sbjct  155  FPGRPRWPPTKYHLTYEFLPNTHADAKAPVTRAFATWAR-HTHFKFSLATNSRRADLKIG  213

Query  478  LFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGH  657
             + G HGDG PFDG GG+ AHAF P  G  HFD+ E WV  G      D+++VALHEIGH
Sbjct  214  FYRGNHGDGYPFDGSGGTLAHAFTPTDGRVHFDSTEKWV-VGAVRGRFDLETVALHEIGH  272

Query  658  LLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            LLGL HS  + A+M+   E G  K  L ADDI GI  LY+
Sbjct  273  LLGLGHSRVKNAIMYPTIESGSTK-GLNADDIEGIEVLYN  311



>ref|XP_009624303.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=365

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/279 (42%), Positives = 156/279 (56%), Gaps = 27/279 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI  LS     +  D F D LESA++ YQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLS-----NFTDDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDADTARQMMKPRCGVADIINGTRR---------RPGGEVVPHYRFYPDEPKWPANK  333
            TG+LDA T + +++PRCG AD++NGT            P    V HY F+P  P+WPA+K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSPSMHTVAHYSFFPGRPRWPASK  161

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEHGDG  504
              LTY F P  G         + A + W  V    +FS T  F +AD+K   F+G+H DG
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFERWSEVTP-LTFSETASFQSADIKIGFFAGDHNDG  220

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN---------GLDIQSVALHEIGH  657
             PFDG  G+ AHAF P  G  H D DE+WV  G P +          +D++SVA+HEIGH
Sbjct  221  EPFDGPMGTLAHAFSPPGGHFHLDGDENWVINGVPIDEGNFFSILSAVDLESVAVHEIGH  280

Query  658  LLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LLGL HS   +++M+     G ++ +L  DDI G++ LY
Sbjct  281  LLGLGHSSVEDSIMYPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=373

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 154/277 (56%), Gaps = 23/277 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G +KG +  GL  LKKY + FGY+N    NS  + +D F D LE AIR YQ   +L +
Sbjct  52   LDGCRKGVKADGLAKLKKYFQLFGYLN----NSYDNFSDDFDDYLEKAIRTYQLNFNLYA  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKWP  324
            TG LDA T + ++ PRCG  D++NGT     G+             V HY F+P+ P+WP
Sbjct  108  TGELDAPTLKHIVLPRCGNPDVVNGTSTMRSGKPSNRYSANSTIHTVAHYSFFPNRPRWP  167

Query  325  ANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
              +  LTY F P      +V    A A + W  V        + F+ ADL+   FSG+HG
Sbjct  168  PGRTRLTYAFLPENQLSDVVKGVFARAFERWSEVTPLTFTETSSFYGADLRIGFFSGDHG  227

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLL  663
            DG PFDG  G+ AHAF P  G  H D DE+WV  G      P + +D++SVA+HEIGHLL
Sbjct  228  DGEPFDGVLGTLAHAFSPPAGRFHLDGDENWVIDGDFLNSSPMSAVDLESVAVHEIGHLL  287

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS   +A+M+     G +K +L  DDI GI+ LY
Sbjct  288  GLGHSSVEDAIMYPTISSGTRKVELANDDIMGIQELY  324



>emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=363

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 153/271 (56%), Gaps = 16/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G + G +V G+  +KKY + FGYIN+L+   S +  D F D LESA++ YQ   +L +
Sbjct  49   LLGCQPGQKVDGIAKIKKYFQHFGYINNLT---SFNFTDEFDDTLESALKTYQRNFNLKA  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--VVPHYRFYPDEPKWPANKRHLTYGF  354
            TG+LDA T + ++KPRCG AD++NGT     G+   V HY F+P  PKWP  K  LTY F
Sbjct  106  TGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYAF  165

Query  355  APGT--PSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGG  528
             P            + A   W  V          F +AD+K    +G+H DG PFDG  G
Sbjct  166  LPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPMG  225

Query  529  SYAHAFPPEYGDCHFDADEHWVEFGPPPN---------GLDIQSVALHEIGHLLGLDHSE  681
            + AHAF P  G  H D +E+WV  G P N          +D++SVA+HEIGHLLGL HS 
Sbjct  226  TLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHSS  285

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              +++M+   E G ++ +L  DDI G++ LY
Sbjct  286  VEDSIMYPSLESGIRRVELVEDDIKGVQELY  316



>ref|XP_002325947.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
 gb|EEF00329.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
Length=308

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 159/272 (58%), Gaps = 22/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  SS      F D LE A++ YQ   HLN
Sbjct  43   LEGIQKGQTVEGLIELKQYLKKFGYYPSDITLTSSD-----FDDHLELALKTYQEYFHLN  97

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE--------VVPHYRFYPDEPKWPANK  333
             TG LD+ T +QMM PRCG+ DIIN    +P           VV HY F     KWP +K
Sbjct  98   VTGNLDSSTIQQMMIPRCGMPDIINTPSAKPNSTKSKHKKVHVVAHYAF--GAQKWPPSK  155

Query  334  RHLTYGFAPGTP---SKFIVPVAT-ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGD  501
              LTY F  G     S  +  V + A + W  V ++     TG  +AD+    FSG+HGD
Sbjct  156  YALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFREATGGASADIVIEFFSGDHGD  215

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS-  678
              PFDG G   AHAF P+ G  H+DADE+W    P  + +D+++V +HEIGHLLGL HS 
Sbjct  216  QSPFDGPGNQLAHAFYPQDGRLHYDADENW-STDPAMDQIDLETVTVHEIGHLLGLYHSK  274

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +H EA+M+   + G KKRDL  DDI+GI ALY
Sbjct  275  DHPEAIMYPTTQRGSKKRDLAQDDIDGIHALY  306



>ref|XP_011085796.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=314

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 156/273 (57%), Gaps = 20/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KG++ KG+++LK YL  FGY++    N   +  D F D LESA++ YQ  +H+  
Sbjct  45   LEGCHKGNKTKGIHHLKHYLHQFGYLD--YPNQIHANDDDFDDLLESALKTYQHNYHIKP  102

Query  181  TGILDADTARQMMKPRCGVADIINGTRRR-PGGE-------------VVPHYRFYPDEPK  318
            TG LD +T  +++ PRCG  DI+NGT    P  +              V HY F+   P+
Sbjct  103  TGTLDTETITKLVTPRCGNPDIVNGTNTMLPRSKKTQNSSSSPSSIHTVSHYSFFRGNPR  162

Query  319  WPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEH  495
            WP +K HLTYGF+  TP+  I PV  A + W +   +F+FSR       DL       +H
Sbjct  163  WPPSKTHLTYGFSANTPTNAIDPVVRAFEKW-DSATHFTFSRAQNNQRPDLVIGFHRRDH  221

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDG GG+ AHAF P  G  H+D++E W    P  N   +++VALHEIGHLLGL H
Sbjct  222  GDGAPFDGPGGTIAHAFAPTDGRFHYDSEETW-SIAPNANAFHLETVALHEIGHLLGLGH  280

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    A+M+   + G  K +L ADDI GIR LY
Sbjct  281  SSVEGAIMYARIQRGATK-NLHADDIQGIRVLY  312



>ref|XP_004237082.2| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=387

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 153/271 (56%), Gaps = 16/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G + G +V G+  +KKY + FGYIN+L+   S +  D F D LESA++ YQ   +L +
Sbjct  73   LLGCQPGQKVDGIAKIKKYFQHFGYINNLT---SFNFTDEFDDTLESALKTYQRNFNLKA  129

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--VVPHYRFYPDEPKWPANKRHLTYGF  354
            TG+LDA T + ++KPRCG AD++NGT     G+   V HY F+P  PKWP  K  LTY F
Sbjct  130  TGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYAF  189

Query  355  APGT--PSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGG  528
             P            + A   W  V          F +AD+K    +G+H DG PFDG  G
Sbjct  190  LPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPMG  249

Query  529  SYAHAFPPEYGDCHFDADEHWVEFGPPPN---------GLDIQSVALHEIGHLLGLDHSE  681
            + AHAF P  G  H D +E+WV  G P N          +D++SVA+HEIGHLLGL HS 
Sbjct  250  TLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHSS  309

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              +++M+   E G ++ +L  DDI G++ LY
Sbjct  310  VEDSIMYPSLESGIRRVELVEDDIKGVQELY  340



>ref|XP_006602365.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=368

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 149/278 (54%), Gaps = 22/278 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G  +GD+  GL NLK Y + FGYI      S+ S  D F D LESAI+ YQ   +LN 
Sbjct  43   FTGCHRGDKYDGLANLKSYFERFGYIPHAPPPSNFS--DEFDDALESAIKTYQKNFNLNV  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE-------------VVPHYRFYPDEPKW  321
            TG+LD  T ++++ PRCGVADIINGT     G+              V H+  +P  P+W
Sbjct  101  TGVLDDATLQKIVLPRCGVADIINGTTTMNAGKENETASFSKPKFHTVAHFSLFPGMPRW  160

Query  322  PANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            P   + LTY F PG      V    ATA   W  V          +F AD++   FSG+H
Sbjct  161  PEGTQELTYAFFPGNELSDTVKGVFATAFARWAEVTSLKFRESASYFGADIRIGFFSGDH  220

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHL  660
            GDG PFDG  G+ AHAF P  G  H DA E WV  G       P  +D++SVA+HEIGHL
Sbjct  221  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTLSALPTAVDLESVAVHEIGHL  280

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EAVM+      +KK  L  DDI GI+ LY
Sbjct  281  LGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  318



>ref|XP_008376281.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=362

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 159/274 (58%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KG  V GL  LKK+L  FGY N    +S  ++ D F D LESAI+ YQ  +HL  
Sbjct  90   LEGCHKGQNVSGLQELKKHLTKFGYFN--YDHSKHADNDEFDDLLESAIKSYQKSYHLKV  147

Query  181  TGILDADTARQMMKPRCGVADIINGTRR------RPGGEV--VPHYR-FYPDEPKWPANK  333
            TG LD  TA+QMM PRCGV D++NGTR+      R    +  V HY  F+P   +WP+ +
Sbjct  148  TGSLDTTTAKQMMVPRCGVPDVVNGTRKGSKKYNRKLKSLHGVSHYEFFFPGPLRWPSTQ  207

Query  334  RHLTYGFA------PGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
             HL Y FA      PGT +   +  A A + W  V  +          AD+      G H
Sbjct  208  THLRYRFASSARQVPGTENVRSI-CAQAFQRWAQVTTFTFEEVPSTSAADITIGFHRGNH  266

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GD  PFDG  G+YAHA PP  G+ HFDA E W    P PN +D++SV++HEIGHLLGL+H
Sbjct  267  GDRSPFDGFKGTYAHANPPGGGNFHFDAXETWSA-NPGPNEIDLESVSVHEIGHLLGLNH  325

Query  676  S-EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              +  + +M+  FEYG  KRDL  DDI+GIRALY
Sbjct  326  XPDLPDXIMYPYFEYGMVKRDLNRDDIDGIRALY  359



>ref|XP_010272073.1| PREDICTED: metalloendoproteinase 1 [Nelumbo nucifera]
Length=371

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 160/272 (59%), Gaps = 21/272 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G + G++V GL  LK+Y   FGYI D    S S+  D F D +ESA++ YQ   +LN+TG
Sbjct  56   GCRNGEQVDGLGKLKEYFHHFGYIPD----SPSNFTDDFDDTMESALKKYQQNFNLNATG  111

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANKRH  339
            +LD  T +Q+++PRCGVADIINGT     G+          V HY F+P +P WP+++  
Sbjct  112  VLDNSTIQQLIRPRCGVADIINGTNTMSSGKSAASTHSLHTVGHYTFFPHQPTWPSSRLD  171

Query  340  LTYGFAPGTPSKFIVPV--ATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVP  510
            LTYGF P       V    A A   W  V    +F+ T  ++ AD+K A ++G+H DG P
Sbjct  172  LTYGFLPDNQLSDTVKAVFAKAFARWAAVTP-LTFTMTDSYSMADIKIAFYTGDHSDGEP  230

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWV----EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            FDG  G+ AHAF P  G  H D  E+WV          + +D++SVA+HEIGHLLGL HS
Sbjct  231  FDGVLGTLAHAFSPTDGRFHLDGAENWVVDDASKSSISSAVDLESVAVHEIGHLLGLGHS  290

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             + +A+M+     G KK +L +DDI GI+ LY
Sbjct  291  SYGDAIMYPTISSGTKKVELWSDDIEGIQLLY  322



>ref|XP_006438497.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
 ref|XP_006483764.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
 gb|ESR51737.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
Length=371

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/281 (42%), Positives = 154/281 (55%), Gaps = 28/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   GD++ GL  LKKY   FGYI DL  N +    D F D LESA++ YQ   +L  
Sbjct  51   FTGCHPGDKMDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEP  106

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            TG LD+ T + +++PRCG  DI+NGT     G+                V HY F+P  P
Sbjct  107  TGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMP  166

Query  316  KWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFN-ADLKFALFS  486
            +WP+NKR LTY F P       V    ATA   W       +F+RT  +  AD++   F+
Sbjct  167  RWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATS-LTFTRTDVYTTADIRIGFFT  225

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV-----EFGPPPNGLDIQSVALHEI  651
            G+HGDG PFDG  G+ AHAF P  G  H D DE+WV           + +D++SVA+HEI
Sbjct  226  GDHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEI  285

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   +A+M+     G +K +L  DDI GI+ALY
Sbjct  286  GHLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALY  326



>ref|XP_007044491.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY00323.1| Matrixin family protein, putative [Theobroma cacao]
Length=369

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 163/275 (59%), Gaps = 24/275 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G + G++  GL  LK+Y   FGYI     NS ++ +D F+D+LE A++IYQ   +LN TG
Sbjct  53   GCQSGEKRDGLSKLKQYFNNFGYIP----NSPTNFSDDFNDELEKALKIYQQNFNLNVTG  108

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGG-----------EVVPHYRFYPDEPKWPANK  333
             LD  T +Q+++PRCG ADI+NGT     G               HY F+P  P WPAN+
Sbjct  109  QLDDQTLQQIVRPRCGNADIVNGTSSMNSGKSSSFHTTGHFRTTAHYAFFPGRPFWPANR  168

Query  334  RHLTYGFAPGTP-SKFIVPVAT-ALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDG  504
            R LTYGF P    S  +  V T A + W  V    +F++T  FF+AD+K A +SG+HGDG
Sbjct  169  RDLTYGFLPANELSDEVKAVFTRAFEKWSAVTP-LTFTQTDSFFSADIKIAFYSGDHGDG  227

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGL  669
             PFDG  G+ AHAF P  G  H D  E+WV  G        + +D++SVA+HEIGHLLGL
Sbjct  228  EPFDGVLGTLAHAFSPTNGRFHLDLAENWVVSGDVTTSSLSSAVDLESVAVHEIGHLLGL  287

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             HS   +A+M+       +K +L  DD++GI++LY
Sbjct  288  GHSSVEDAIMFPTISSRTRKVELANDDVDGIQSLY  322



>gb|EYU28648.1| hypothetical protein MIMGU_mgv1a008442mg [Erythranthe guttata]
Length=374

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 152/278 (55%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G  KG + +GL  LKKY + FGY+N    NS ++ +D F + LESA++ YQ   +LN 
Sbjct  56   LTGCHKGVKSQGLPKLKKYFQFFGYLN----NSYTNFSDDFDEYLESAVKSYQLNFNLNV  111

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKWP  324
            TG LDA T   ++ PRCG ADI+NGT     G+             V HY F+PD P+WP
Sbjct  112  TGQLDAPTLNHIVLPRCGNADIVNGTSIMRSGKSPNTYSANSTIHTVAHYSFFPDRPRWP  171

Query  325  ANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
                 LTY F P       V    + A + W  V  +       F++ADLK A F G+HG
Sbjct  172  PGTTQLTYAFLPENQLSDAVKGVFSRAFERWSEVTAFTFVETASFYDADLKIAFFGGDHG  231

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG------PPPNGLDIQSVALHEIGHL  660
            DG PFDG  G+ AHAF P  G  H D DE+WV  G           +D++SVA+HEIGHL
Sbjct  232  DGEPFDGVMGTLAHAFAPPAGRFHLDGDENWVIDGNFLGAAASVAAVDLESVAVHEIGHL  291

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EA+M+       +K +L  DDI GI+ LY
Sbjct  292  LGLGHSSVEEAIMYPTISSSTRKVELANDDIMGIQELY  329



>ref|XP_003530663.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=370

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 148/278 (53%), Gaps = 22/278 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G  +GD+  GL NLK Y + FGY        SS+ +D F D LESAI+ YQ   +LN 
Sbjct  50   FTGCHRGDKYDGLANLKSYFERFGYFPHAP--PSSNFSDEFDDALESAIKTYQKNFNLNV  107

Query  181  TGILDADTARQMMKPRCGVADIINGTR-------------RRPGGEVVPHYRFYPDEPKW  321
            TG+LD  T +Q++ PRCGVADIINGT               +P    V H+  +P  P+W
Sbjct  108  TGVLDDATVQQIVLPRCGVADIINGTTTMNAAKENETASFSKPKFHTVAHFTLFPGMPRW  167

Query  322  PANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            P   + LTY F PG      V    A A   W  V          +F AD++   FSG+H
Sbjct  168  PEGTQELTYAFFPGNGLSDAVKGVFAAAFARWAEVTSLKFRETASYFGADIRIGFFSGDH  227

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHL  660
            GDG PFDG  G+ AHAF P  G  H DA E WV  G       P  +D++SVA+HEIGHL
Sbjct  228  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTRSALPTAVDLESVAVHEIGHL  287

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EAVM+      +KK  L  DDI GI+ LY
Sbjct  288  LGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  325



>ref|XP_010110202.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXC25440.1| Metalloendoproteinase 1 [Morus notabilis]
Length=332

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/293 (42%), Positives = 152/293 (52%), Gaps = 36/293 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS--------SEADYFSDQLESAIRIY  156
            L G  KG+ V GL  LK+YL+ FGY++  +  + +        +  DYF D LESAI+ Y
Sbjct  43   LTGGHKGEIVPGLSELKQYLQRFGYLDSEAVENVAEAQNYDDVNSIDYFDDVLESAIKAY  102

Query  157  QTRHHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEV------------------  282
            Q  ++LN TG LD  T RQMM PRCG  D +NGT   P                      
Sbjct  103  QRNYNLNVTGTLDPPTVRQMMLPRCGFPDTVNGTTSFPISHDHDHDHDHNHDHDHVHKQL  162

Query  283  ---VPHYRFYPDEPKWPANKRHLTYGFAPGT----PSKFIVPVATALKAWHNVGEYFSFS  441
               V HY F+   P+W  NK  LTY F  G      S     V  A + W  V  +    
Sbjct  163  IHGVRHYSFFRGSPRW--NKYQLTYRFVAGVQVPGTSNIRSIVYRAFQRWARVTRFTFTE  220

Query  442  RTGFFNADLKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGL  621
                  +D+    F G HGD  PFDG GG+ AHA+ P  G  H+DADE+W E  P    +
Sbjct  221  VASNVQSDISIGFFRGYHGDNAPFDGTGGTIAHAYAPSVGWFHYDADEYWSE-NPNYYQM  279

Query  622  DIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
            D++SVA+HEIGHLLGLDHS    A+M+     G  KR+L ADDINGIRALY F
Sbjct  280  DLESVAVHEIGHLLGLDHSTVAAAIMYPSINSGAIKRELNADDINGIRALYAF  332



>ref|XP_008458911.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 148/269 (55%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L GS+K D  +G++ +K YL+ +GY++D   N+ S +A  F D LESAI+ YQ    LN 
Sbjct  40   LIGSRKNDNFEGIHKVKAYLQRYGYLSDEKENNLSIDA--FDDDLESAIKSYQKVFKLNV  97

Query  181  TGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPAN  330
            +G+LD +T +QM +PRCGV D            N T  + GG    HY FYP++ KWP  
Sbjct  98   SGVLDRETLQQMARPRCGVTDDFILVAQQDHENNNTNIQIGGS---HYMFYPNKLKWPVE  154

Query  331  KRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGV  507
            KRHLTYGF    P +    V  A   W      F+FS       AD+  +   G+HGDG 
Sbjct  155  KRHLTYGFIHNYPPEHAAAVIRAFDTW-EANTKFTFSHAARVQTADILLSFERGDHGDGK  213

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
            PFDG GG+  HAF    G  HFD DE W          D++SVALHEIGH LGL HS   
Sbjct  214  PFDGPGGALGHAFGAIDGRVHFDGDEQWETGSFWQEYFDVESVALHEIGHALGLGHSREP  273

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             AVMW   + G  K  LT DDI GI ALY
Sbjct  274  SAVMWANMDSGVTKTHLTIDDIEGIHALY  302



>ref|XP_008222422.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=319

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 160/278 (58%), Gaps = 25/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSSEADYFSDQLESAIRIYQTRH  168
            L+G  KGD + G+++LK YL+ FGY   LSY    ++  ++ D F D LE A++ YQ  +
Sbjct  45   LKGVHKGDHIPGIHDLKLYLEKFGY---LSYAHAKHNPHADDDDFDDFLELAVKTYQLNY  101

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEV---------------VPHYRFY  303
            HL +TGILD  T  +MM PRCGVADIING      G+                V HY F+
Sbjct  102  HLKTTGILDTKTVSKMMMPRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFF  161

Query  304  PDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFAL  480
              + KWP +K HLTY F P TP++ + P++ A + W     +F FSR+  +  AD+K + 
Sbjct  162  KGKLKWPRSKHHLTYAFLPTTPTEAMGPISRAFRTW-ATNTHFRFSRSQNYKRADIKISF  220

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHL  660
              G+HGDG  FDG GG  AHA+ P YG  H+DA+E W   G      D+++VALHEIGHL
Sbjct  221  EYGDHGDGNSFDGPGGVLAHAYAPTYGKFHYDAEEPW-SVGALEGYYDLETVALHEIGHL  279

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS    AVM+     G     L  DDI GI+ LY
Sbjct  280  LGLGHSSVEGAVMYPYIASGATNLYLHDDDIQGIKVLY  317



>ref|XP_006376166.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
 gb|ERP53963.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
Length=304

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 157/268 (59%), Gaps = 18/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  +S      F D LESA++ YQ   HLN
Sbjct  43   LEGVRKGQTVEGLVELKQYLKRFGYYPSDVNLMTSD-----FDDLLESALKTYQNYFHLN  97

Query  178  STGILDADTARQMMKPRCGVADII-NGTRRR-PGGEVVPHYRFYPDEPKWPANKRHLTYG  351
             TGILD  T +QMM PRCG+ DI  N T+       +V HY F+   PKW  +K HLTY 
Sbjct  98   VTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYT  157

Query  352  FAPGTPSKFIVPVAT-------ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            F  G+    +V + T       A K W +V        +   +A++  A + G+HGDG P
Sbjct  158  F--GSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYP  215

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG G   AHAF PE G  H+DADE W    P  + +D++SVA+HEIGHLLGL HS    
Sbjct  216  FDGPGKILAHAFSPENGRFHYDADEKW-STNPAMDQIDLESVAVHEIGHLLGLAHSSDSN  274

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVM+     G KKR+L  DDI+GI ALY
Sbjct  275  AVMYPSIAAGTKKRNLAQDDIDGIHALY  302



>gb|KDO37628.1| hypothetical protein CISIN_1g039411mg [Citrus sinensis]
Length=222

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 135/222 (61%), Gaps = 15/222 (7%)
 Frame = +1

Query  145  IRIYQTRHHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGG-----------EVVPH  291
            ++ YQ  +HLNSTG+LD +T   M +PRCGVADI+NGT R   G             V H
Sbjct  1    MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSH  60

Query  292  YRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADL  468
            Y F+P  P+WP +  HLTY F PGTP++ I  V  A + W  +  +F FS+T  + NA+L
Sbjct  61   YEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAI-SHFKFSQTQDYTNANL  119

Query  469  KFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHE  648
            K +   G HGD  PFDGRGG+ AHA PP  G   +DADE W   G  P   D+++VALHE
Sbjct  120  KISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWA-VGARPGAFDLETVALHE  178

Query  649  IGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            IGHLLGLDHS    A+M+   + G  K  L  DD+ GIRALY
Sbjct  179  IGHLLGLDHSLVEGAIMYAYIDPGATK-GLHTDDVQGIRALY  219



>emb|CDP00221.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/275 (44%), Positives = 156/275 (57%), Gaps = 24/275 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G   G +V GL  LK+Y + FGYI+    N +    D F D L SA++ YQ   +LN TG
Sbjct  61   GCHTGQKVDGLAKLKQYFQRFGYIDTSLLNFT----DDFDDYLGSALKTYQRNFNLNETG  116

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGEV----------VPHYRFYPDEPKWPANKR  336
             LDA T + + +PRCG  DI+NGT     G+V          V HY F+P  P+WPA K 
Sbjct  117  ELDAPTLQHITRPRCGNPDIVNGTTSMNSGKVANANSLRPHTVAHYSFFPGMPRWPAGKT  176

Query  337  HLTYGFAPGTPSKFIV--PVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGV  507
             LTY F P    + +V    A A   W  V    +F+ T  F+ AD+K  +FSG+HGDG 
Sbjct  177  DLTYAFLPENQVEDVVRRVFANAFDRWSEV-TTLNFTETASFSLADIKIGIFSGDHGDGE  235

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWV---EFGPPP---NGLDIQSVALHEIGHLLGL  669
            PFDG  G+ AHAF P  G  H D DE+WV   +F   P   + +D++SVA+HEIGHLLGL
Sbjct  236  PFDGVLGTLAHAFSPPSGRLHLDGDENWVIDGDFFSAPSLASAVDLESVAVHEIGHLLGL  295

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             HS   EA+M+       +K +LT DDI GI+ LY
Sbjct  296  GHSSVEEAIMYPSIGSATRKVELTKDDIQGIQMLY  330



>gb|ABK95950.1| unknown [Populus trichocarpa]
Length=304

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 157/268 (59%), Gaps = 18/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  +S      F D LESA++ YQ   HLN
Sbjct  43   LEGVRKGQTVEGLVELKQYLKRFGYYPSDVNLMTSD-----FDDLLESALKTYQNYFHLN  97

Query  178  STGILDADTARQMMKPRCGVADII-NGTRRR-PGGEVVPHYRFYPDEPKWPANKRHLTYG  351
             TGILD  T +QMM PRCG+ DI  N T+       +V HY F+   PKW  +K HLTY 
Sbjct  98   VTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYT  157

Query  352  FAPGTPSKFIVPVAT-------ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            F  G+    +V + T       A K W +V        +   +A++  A + G+HGDG P
Sbjct  158  F--GSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYP  215

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG G   AHAF PE G  H+DADE W    P  + +D++SVA+HEIGHLLGL HS    
Sbjct  216  FDGPGKILAHAFSPENGRFHYDADEKWST-NPAMDQIDLESVAVHEIGHLLGLAHSSDSN  274

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVM+     G KKR+L  DDI+GI ALY
Sbjct  275  AVMYPSIAAGTKKRNLAQDDIDGIHALY  302



>gb|EYU38312.1| hypothetical protein MIMGU_mgv11b017434mg [Erythranthe guttata]
Length=251

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 141/234 (60%), Gaps = 16/234 (7%)
 Frame = +1

Query  115  DYFSDQLESAIRIYQTRHHLNSTGILDADTARQMMKPRCGVADIING--TRRRPGGE---  279
            D+ +   ESAI+ YQ  +H+  TGILDA T  +M  PRCG ADI+NG  T +   G+   
Sbjct  15   DFINQLEESAIKTYQRNYHIAPTGILDATTVSKMTTPRCGYADIVNGINTMQLNKGKKYL  74

Query  280  -------VVPHYRF-YPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFS  435
                    V HYRF  P   +WP +K +LTY F P TP   + PV+ A + WH++   FS
Sbjct  75   NSNNDIHTVSHYRFTVPRNRRWPRSKANLTYRFLPNTPEIAVGPVSRAFQKWHSISG-FS  133

Query  436  FSRT-GFFNADLKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPP  612
            FSR     + DL    F   HGDG PFDG GG  AHAF P  G  H+DADE W + GP P
Sbjct  134  FSRVQDSSSTDLVIGFFKRSHGDGAPFDGPGGVTAHAFRPTDGRLHYDADEKWSD-GPAP  192

Query  613  NGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            + +D++S+A+HEIGHLLGL HS+ + A+M+    YG  K    ADDINGI+ALY
Sbjct  193  DAMDLESIAVHEIGHLLGLGHSDVKAAIMYSYLNYGMNKTKFDADDINGIKALY  246



>ref|XP_010255256.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=309

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 151/271 (56%), Gaps = 20/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G +KG+ VKGL  LK+YL+ FGY+N+   +    +       LE AI+ YQ  ++LN 
Sbjct  45   LEGCRKGETVKGLNELKRYLERFGYLNNHKDDDDFDDL------LELAIKTYQLNYNLNV  98

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE------------VVPHYRFYPDEPKWP  324
            TG LD +T +QM  PRCG  DI NGT     G+             V  Y F+   P+WP
Sbjct  99   TGSLDPETLKQMSLPRCGAPDITNGTTSMRSGKEKKHPHERKTLHTVSRYSFFSGIPRWP  158

Query  325  ANKRHLTYGFAPGTPSKFIVPVA-TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGD  501
             +K  LTY F PGTP   + PV   A + W  V  +       +  AD+K +   G+HGD
Sbjct  159  PSKTLLTYAFLPGTPVSSMRPVCDRAFQRWAAVSRFRFQETQDYLTADIKISFERGDHGD  218

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSE  681
              PFDG GG  AHA+ P  G  H+DADE W   G   +G D++SVA+HEIGHLLGL HS 
Sbjct  219  KYPFDGPGGVLAHAYAPTDGRFHYDADEKWY-IGASLDGYDVESVAMHEIGHLLGLGHSS  277

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               ++M+     G +K  L  DDI+GIR+LY
Sbjct  278  VGNSIMYPSLLMGTQKLKLDQDDIDGIRSLY  308



>ref|XP_011072962.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/265 (44%), Positives = 149/265 (56%), Gaps = 7/265 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEAD-YFSDQLESAIRIYQTRHHLN  177
            L G++KG   KG+  LKKYL  FGY+N  +    + + D +F D LE AI+ YQT   L 
Sbjct  49   LIGTQKGTTSKGISQLKKYLSHFGYMNHKNNTILTHQTDDFFDDNLELAIKSYQTFFKLK  108

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP----HYRFYPDEPKWPANKRHLT  345
              GI+DA+   +M  PRCGV D  N  R       +P    HY F+P EPKWP  KR LT
Sbjct  109  VNGIMDANIVAKMSHPRCGVPDSFNLNRSHKLYLRIPTLASHYTFFPGEPKWPPTKRSLT  168

Query  346  YGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRG  525
            Y F  G P+     +  A + W +V  +    RT +  AD+K +    +HGDG PFDG G
Sbjct  169  YSFPLGGPTNVNSSILHATQIWASVTPFRFSYRTNYDQADIKISFQYRDHGDGYPFDGPG  228

Query  526  GSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWE  705
            G  AHAF P  G  HFD DE WV+ G      D+Q+V LHE+GH+LGL H+    A+M+ 
Sbjct  229  GILAHAFAPSDGRLHFDGDERWVD-GVTLGAFDMQTVGLHELGHVLGLGHTNDTGAIMYP  287

Query  706  EFEYGEKKRDLTADDINGIRALYHF  780
                G +K  L  DDINGI+ALY F
Sbjct  288  YIGDGLRKV-LGQDDINGIKALYQF  311



>ref|XP_008233236.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=381

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 160/277 (58%), Gaps = 26/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-SEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG  V GL  LKKYL  FGY+N   Y+ S  +  D F D LESAI+ YQ  +HL 
Sbjct  110  LEGCHKGQNVSGLQELKKYLTKFGYLN---YDHSKHANDDEFDDILESAIKSYQKSYHLK  166

Query  178  STGILDADTARQMMKPRCGVADIINGTR--------RRPGGEVVPHYRFY-PDEPKWPAN  330
             TG LDA T +QMM PRCGV D++NGTR        +      V HY F+ P   +W  +
Sbjct  167  VTGTLDASTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHEVAHYEFFLPGPLRW--S  224

Query  331  KRHLTYGF------APGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGE  492
            K HLTY F       PGT +   +  A A + W  V  +          AD+      G 
Sbjct  225  KTHLTYRFRSSVNQVPGTQNVRSI-CAQAFQRWAQVTSFTFEEVPATSAADITIGFHRGN  283

Query  493  HGDG--VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLG  666
            HGDG    FDG  G++AHA PP  G+ H+DADE W    P PN +D++SVA+HEIGHLLG
Sbjct  284  HGDGPHNAFDGPRGTFAHANPPSGGNFHYDADERWSS-NPGPNEVDLESVAVHEIGHLLG  342

Query  667  LDHS-EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LDH+ + R+A+M+  F+YG  KRDL  DDI+GIR LY
Sbjct  343  LDHNPDLRDAIMYPYFDYGIIKRDLHRDDIDGIRVLY  379



>ref|XP_008458910.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=296

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 152/265 (57%), Gaps = 11/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+GS+ G+ ++G+Y++K YLK +GY+     N+ S+  D F   LESAI+ +Q  H LN 
Sbjct  34   LKGSRIGNNIEGIYSVKLYLKRYGYLITNVPNTDSN--DTFDVLLESAIKTFQKYHSLNV  91

Query  181  TGILDADTARQMMKPRCGVADIINGTR------RRPGGEVVPHYRFYPDEPKWPANKRHL  342
            +G+LD +T   M  PRCG++DI++         +        HY F P  PKWP +K +L
Sbjct  92   SGVLDKETLTLMSLPRCGISDIVHNNNVMDNNIQMNSSSFHSHYTFLPGNPKWPISKYNL  151

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDG  519
             Y F  G P+ F  PV  A+  W  +   F FS T G    D+ F    G HGDG PFDG
Sbjct  152  KYTFLEGFPNDFKEPVMNAMDQW-ALFSLFRFSETIGGEEVDITFNFVRGNHGDGHPFDG  210

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
            +GG  AHAF P  G  HFD DE W + G     +++  VALHE+GH+LGL HS  R+A+M
Sbjct  211  KGGVLAHAFGPLDGRVHFDWDEDWAD-GSVGGFINVGMVALHELGHVLGLAHSTIRDAIM  269

Query  700  WEEFEYGEKKRDLTADDINGIRALY  774
            W     GE+ R L  DDI GI+ LY
Sbjct  270  WPYMHVGEQTRGLQFDDIEGIQTLY  294



>ref|NP_001267680.1| metalloendoproteinase 1-like precursor [Cucumis sativus]
 emb|CAB76364.1| matrix metalloproteinase [Cucumis sativus]
 gb|KGN52412.1| hypothetical protein Csa_5G632110 [Cucumis sativus]
Length=320

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 155/271 (57%), Gaps = 16/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            LQG   GD  +G++ +KKYL+ FGYI  ++  +S+    D F   LESA++ YQT H+L 
Sbjct  51   LQGCHLGDTKQGIHQIKKYLQRFGYITTNIQKHSNPIFDDTFDHILESALKTYQTNHNLA  110

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEPKWP  324
             +GILD++T  Q+  PRCGV D+I   + +   +            V H+ F+    KWP
Sbjct  111  PSGILDSNTIAQIAMPRCGVQDVIKNKKTKKRNQNFTNNGHTHFHKVSHFTFFEGNLKWP  170

Query  325  ANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTG-FFNADLKFALFSGEHGD  501
            ++K HL+YGF P  P   I PV+ A   W ++  +F FS    +  AD+K +   GEHGD
Sbjct  171  SSKLHLSYGFLPNYPIDAIKPVSRAFSKW-SLNTHFKFSHVADYRKADIKISFERGEHGD  229

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSE  681
              PFDG GG  AHA+ P  G  HFD D+ W   G      D+++VALHEIGH+LGL HS 
Sbjct  230  NAPFDGVGGVLAHAYAPTDGRLHFDGDDAW-SVGAISGYFDVETVALHEIGHILGLQHST  288

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              EA+M+     G  K  L  DDI GI+ALY
Sbjct  289  IEEAIMFPSIPEGVTK-GLHGDDIAGIKALY  318



>ref|XP_006387200.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
 gb|ABK94796.1| unknown [Populus trichocarpa]
 gb|ERP46114.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
Length=309

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 158/273 (58%), Gaps = 23/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI--NDLSYNSSSSEADYFSDQLESAIRIYQTRHHL  174
            L+G KKG  V+GL  LK+YLK  GY   +D++  SS      F D LE A++ YQ   HL
Sbjct  43   LEGVKKGQTVQGLIELKQYLKKLGYYPSDDITLTSSD-----FDDHLELALKTYQEYFHL  97

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE--------VVPHYRFYPDEPKWPAN  330
            N TG LD+ T +QM+ PRCG  DIIN    +P           +V HY F  +  KWP +
Sbjct  98   NVTGNLDSSTIQQMVIPRCGTPDIINTPSTKPNSTKSKHKKVHMVAHYAFGAE--KWPPS  155

Query  331  KRHLTYGFAPGTP---SKFIVPVAT-ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
            K  LTY F  G     S  +  V + A + W  V ++     T   +AD+    +SG+HG
Sbjct  156  KYALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFQEATAGASADIVIEFYSGDHG  215

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            D  PFDG G + AHAF P+ G  H+DADE+W    P  +  D++SV +HEIGHLLGL HS
Sbjct  216  DRYPFDGPGKTLAHAFYPQDGRLHYDADENW-STDPAMDQTDLESVTVHEIGHLLGLHHS  274

Query  679  -EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             +H EA+M+   E G+KKRDL  DDI+GI ALY
Sbjct  275  TDHPEAIMYPTIEAGKKKRDLAQDDIDGIHALY  307



>gb|EYU35921.1| hypothetical protein MIMGU_mgv1a019701mg [Erythranthe guttata]
Length=304

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/263 (43%), Positives = 149/263 (57%), Gaps = 6/263 (2%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G +KG + KGL  LK +L   GY+ + + N + +  D F D LE AI+ YQ   HLN 
Sbjct  45   LVGVRKGQKAKGLVELKTHLSNLGYMKN-NNNEAKANNDLFDDDLELAIKKYQVFFHLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV---VPHYRFYPDEPKWPANKRHLTYG  351
             GILDA T   ++ PRCGVAD +N    +   E+     HY F+P EPKWP  K +LTY 
Sbjct  104  NGILDAKTVEHLLLPRCGVADFVNLNASQFKNEIPTIASHYTFFPGEPKWPPGKTNLTYS  163

Query  352  FAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGS  531
            F PG  ++ +  +  A + W  V  +     T + +AD+K +    +H DG  FDGRGG 
Sbjct  164  FPPGASNEVMQAIKDATQLWAGVTHFKFTYITDYDHADIKISFQVWDHKDGAAFDGRGGI  223

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEF  711
             AHAF P  G  HFD DE WV+ G  P   D+Q V LHE+GH+LGL H+    A+M    
Sbjct  224  LAHAFAPSDGRLHFDGDEVWVD-GVVPGKFDLQMVGLHELGHVLGLGHTTDGGAIMTPTL  282

Query  712  EYGEKKRDLTADDINGIRALYHF  780
              G +K  L  DDINGI+ALYH 
Sbjct  283  GSGFRK-GLGQDDINGIKALYHL  304



>gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana]
Length=364

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/278 (40%), Positives = 151/278 (54%), Gaps = 25/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI+ LS     +  D F D LESA++ YQ   +LN+
Sbjct  46   LLGCHAGQKVDGLAKIKKYFYNFGYISSLS-----NFTDDFDDALESALKTYQQNFNLNT  100

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG+LDA T   +++PRCG AD++NGT     G+          V H+ F+P  P+WP + 
Sbjct  101  TGVLDAPTIEHLIRPRCGNADVVNGTSTMNSGKPSAGSQNIHTVAHFSFFPGRPRWPESN  160

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
            R LTY F P  G         + A   W  V          F +AD+K   F+G+H DG 
Sbjct  161  RDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLTFTEIASFQSADIKIGFFAGDHNDGE  220

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPP---------NGLDIQSVALHEIGHL  660
            PFDG  G+ AHAF P  G  H D DE+WV  G P          + +D++SVA+HEIGHL
Sbjct  221  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGAPIVEGNFFSILSAVDLESVAVHEIGHL  280

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   +++M+     G ++ +L  DDI G++ LY
Sbjct  281  LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  318



>ref|XP_007226174.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
 gb|EMJ27373.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
Length=321

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 159/278 (57%), Gaps = 25/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----SEADYFSDQLESAIRIYQTRH  168
            L+G  KGD ++G+++LK YL+ FGY   LSY  +     ++ D F D LE A++ YQ  +
Sbjct  47   LKGVHKGDHIQGIHDLKLYLEKFGY---LSYAHAKHNPHADDDDFDDFLELAVKTYQLNY  103

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEV---------------VPHYRFY  303
            HL +TG LDA T  +MM  RCGVADIING      G+                V HY F+
Sbjct  104  HLKTTGTLDAKTVSKMMMSRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFF  163

Query  304  PDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFAL  480
              + KWP +K HLT+ F P TP++ + P++ A + W     +F FSR+  +  AD+K + 
Sbjct  164  KGKLKWPRSKHHLTFAFLPTTPTEAMGPISRAFRTW-ATNTHFRFSRSQNYKRADIKISF  222

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHL  660
              G+HGDG  FDG GG  AHA+ P YG  H+DA+E W   G      D+++VALHEIGHL
Sbjct  223  EYGDHGDGSSFDGPGGVLAHAYAPTYGKFHYDAEEPW-SVGALEGYYDLETVALHEIGHL  281

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS    AVM+     G     L  DDI GI+ LY
Sbjct  282  LGLGHSSVEGAVMYPYIASGATNLYLHDDDIRGIKVLY  319



>ref|XP_004167464.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52408.1| hypothetical protein Csa_5G632070 [Cucumis sativus]
Length=306

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 151/270 (56%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S++A  F D LESAI+ YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYFSNENENNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPA  327
             +G+LD +T +QM +PRCGVAD            N T  + GG    H+ F+P + KWP 
Sbjct  98   VSGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGS---HFMFFPGKGKWPY  154

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDG  504
             K HLTYGF    P K    V  A   W      F+FS       AD+  +   G+HGDG
Sbjct  155  RKWHLTYGFVHNYPMKHAAAVVRAFDKW-AANSKFTFSLAWRIQTADILLSFERGDHGDG  213

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN-GLDIQSVALHEIGHLLGLDHSE  681
             PFDG GG   HAF P  G  HFDADE W E G   N   D +SVALHEIGH LGL HS 
Sbjct  214  KPFDGEGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGHALGLGHSI  273

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRAL  771
               AVMW   E G  K +LT DDI G+ AL
Sbjct  274  FPSAVMWANMETGVNKTELTIDDIEGVHAL  303



>ref|XP_004142466.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=306

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 151/270 (56%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S++A  F D LESAI+ YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYFSNENENNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPA  327
             +G+LD +T +QM +PRCGVAD            N T  + GG    H+ F+P + KWP 
Sbjct  98   VSGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGS---HFMFFPGKGKWPY  154

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDG  504
             K HLTYGF    P K    V  A   W      F+FS       AD+  +   G+HGDG
Sbjct  155  RKWHLTYGFVHNYPMKHAAAVVRAFDKW-AANSKFTFSLAWRIQTADILLSFERGDHGDG  213

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN-GLDIQSVALHEIGHLLGLDHSE  681
             PFDG GG   HAF P  G  HFDADE W E G   N   D +SVALHEIGH LGL HS 
Sbjct  214  KPFDGEGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGHALGLGHSI  273

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRAL  771
               AVMW   E G  K +LT DDI G+ AL
Sbjct  274  FPSAVMWANMETGVNKTELTIDDIEGVHAL  303



>gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum]
Length=365

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/279 (41%), Positives = 155/279 (56%), Gaps = 27/279 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI  LS     +  D F D LESA++ YQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLS-----NFTDDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG+LDA T + +++PRCG AD++NGT     G+          V H+ F+P  P+WP +K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEHGDG  504
              LTY F P  G         + A   W  V    SF+ T  F +AD+K   F+G+H DG
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTP-LSFTETASFQSADIKIGFFAGDHNDG  220

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPP---------NGLDIQSVALHEIGH  657
             PFDG  G+ AHAF P  G  H D DE+WV  G P          + +D++SVA+HEIGH
Sbjct  221  EPFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGH  280

Query  658  LLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LLGL HS   +++M+     G ++ +L  DDI G++ LY
Sbjct  281  LLGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_009758591.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana sylvestris]
Length=365

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/279 (41%), Positives = 155/279 (56%), Gaps = 27/279 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G +V GL  +KKY   FGYI  LS     +  D F D LESA++ YQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLS-----NFTDDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG+LDA T + +++PRCG AD++NGT     G+          V H+ F+P  P+WP +K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEHGDG  504
              LTY F P  G         + A   W  V    SF+ T  F +AD+K   F+G+H DG
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTP-LSFTETASFQSADIKIGFFAGDHNDG  220

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPP---------NGLDIQSVALHEIGH  657
             PFDG  G+ AHAF P  G  H D DE+WV  G P          + +D++SVA+HEIGH
Sbjct  221  EPFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGH  280

Query  658  LLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LLGL HS   +++M+     G ++ +L  DDI G++ LY
Sbjct  281  LLGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_004142465.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52409.1| hypothetical protein Csa_5G632080 [Cucumis sativus]
Length=295

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 153/265 (58%), Gaps = 12/265 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQGS+ G+ ++G++N+K YLK +GY+ ++   +S++  D     LESAI+ +Q  H LN 
Sbjct  34   LQGSRIGNNIEGIHNVKLYLKRYGYLTNVESTNSNNTFDVL---LESAIKTFQKYHSLNV  90

Query  181  TGILDADTARQMMKPRCGVADIINGTR------RRPGGEVVPHYRFYPDEPKWPANKRHL  342
            +G++D +T   M  PRCG+ DI++         +        H+ F+PD  KWP +K +L
Sbjct  91   SGVIDEETLTLMSLPRCGIPDIMHNINVMDNNVQMNSSSFHSHFTFFPDNLKWPVSKYNL  150

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFDG  519
             Y F    P+ F  PV  A++ W  +   F FS       AD+ F    G HGDG PFDG
Sbjct  151  RYTFLDDFPNDFKEPVMNAMEQW-ALFSLFRFSEAVEAQEADITFNFVRGNHGDGYPFDG  209

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
            +GG  AHAF P  G  HFD DE W + G     +++  VALHE+GH+LGL HS  R+A+M
Sbjct  210  KGGVLAHAFGPLDGRVHFDWDEDWAD-GSVGGFINVGMVALHELGHVLGLAHSTIRDAIM  268

Query  700  WEEFEYGEKKRDLTADDINGIRALY  774
            W   E GE+ R L  DDI GI+ LY
Sbjct  269  WPYMEAGEQTRGLQFDDIEGIQTLY  293



>ref|XP_004297959.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 147/268 (55%), Gaps = 14/268 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+   KGD+VKG+++LKKYL  FG ++ +  N   S  D+F   LE A+R YQ   +LN 
Sbjct  48   LKCCHKGDKVKGIHDLKKYLHKFGCLDYM--NHIHSNDDHFDQFLEEAVRTYQLNFNLNP  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV---------VPHYRFYPDEPKWPANK  333
            TG LD  T   MMKP CGV DIINGT      ++           HY     + KWP +K
Sbjct  106  TGTLDEKTISMMMKPHCGVPDIINGTTSMRSAKIKHQHRAIHTTVHYTLPDGDYKWPPSK  165

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGF-FNADLKFALFSGEHGDGVP  510
              LT+GF PGTPS     +  A   W     +F FS++    NADLK +    +HGDG P
Sbjct  166  YQLTFGFLPGTPSAATGSIVQAFAIWQK-STHFKFSQSNNPQNADLKISFHKRDHGDGDP  224

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG  AHA  P  G  H+DA+E W   G  P  +D  SV LHEIGHLLGL HS    
Sbjct  225  FDGPGGQLAHAAYPTGGTLHYDAEETW-SAGAKPGAMDYGSVGLHEIGHLLGLGHSSVEG  283

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVM+     G   + L  DDI GI+ALY
Sbjct  284  AVMFPTVTEGVAYKGLHQDDIQGIKALY  311



>gb|KDO82628.1| hypothetical protein CISIN_1g021444mg [Citrus sinensis]
Length=312

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 150/272 (55%), Gaps = 28/272 (10%)
 Frame = +1

Query  28   VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDADTA  207
            + GL  LKKY   FGYI DL  N +    D F D LESA++ YQ   +L  TG LD+ T 
Sbjct  1    MDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEPTGQLDSQTM  56

Query  208  RQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEPKWPANKRHL  342
            + +++PRCG  DI+NGT     G+                V HY F+P  P+WP+NKR L
Sbjct  57   QHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDL  116

Query  343  TYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPF  513
            TY F P       V    ATA   W       +F+RT  +  AD++   F+G+HGDG PF
Sbjct  117  TYAFLPDNQLTDEVKNVFATAFDRWSEATS-LTFTRTDVYTTADIRIGFFTGDHGDGEPF  175

Query  514  DGRGGSYAHAFPPEYGDCHFDADEHWV-----EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
            DG  G+ AHAF P  G  H D DE+WV           + +D++SVA+HEIGHLLGL HS
Sbjct  176  DGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHS  235

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G +K +L  DDI GI+ALY
Sbjct  236  SVEDAIMYPSISSGSRKVELANDDIQGIQALY  267



>gb|KDP21290.1| hypothetical protein JCGZ_21761 [Jatropha curcas]
Length=371

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 157/280 (56%), Gaps = 29/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G + G ++ GL  LK+Y   FGYI     N+ ++  D F D LESA++ YQ   +LN 
Sbjct  53   LSGCRAGQKLDGLNKLKQYFHDFGYIP----NTFANFTDDFDDALESALKTYQQNFNLNV  108

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVP------------HYRFYPDEPKWP  324
            TG LD  T  Q++KPRCG ADI+NGT     G+  P            HY F+P  P+WP
Sbjct  109  TGELDEQTLSQLIKPRCGNADIVNGTTAMNSGKWTPPFNTTSHFHTVGHYTFFPGSPRWP  168

Query  325  ANKRHLTYGFAPG----TPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSG  489
             +KR LTY F PG    T +K +     A   W  V    +F+ T  F  AD++   FSG
Sbjct  169  DSKRDLTYAFWPGNNLTTEAKSVF--TRAFDRWSTVIP-MTFAETDSFTIADIRIGFFSG  225

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN-----GLDIQSVALHEIG  654
            +HGDG PFDG  G+ AHAF P  G  H D DE+WV  G   +      +D++SVA+HEIG
Sbjct  226  DHGDGEPFDGVLGTLAHAFSPPSGRFHLDGDENWVVSGDISDSSIISAVDLESVAVHEIG  285

Query  655  HLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HLLGL HS   +A+M+       +K +L  DDI+G++ LY
Sbjct  286  HLLGLGHSSVEDAIMYPTIPSRTRKVELAQDDIDGVQQLY  325



>gb|EYU29749.1| hypothetical protein MIMGU_mgv1a023711mg, partial [Erythranthe 
guttata]
Length=265

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 150/263 (57%), Gaps = 15/263 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQGS KGDR+ G+  LK YL+ FGY+++L+    ++E   F D LESAI+ YQ   ++N 
Sbjct  15   LQGSVKGDRILGISVLKNYLQKFGYLDNLNNTQINNE---FDDALESAIKTYQQNFNINP  71

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV--VPHYRFYPDEPKWPANKRHLTYGF  354
            TG+LDA T         G  +  + +     G +  V HY F+   PKWP +K +LTYGF
Sbjct  72   TGVLDAATP-------AGTENHESSSSNNQLGHIHTVSHYTFFSGNPKWPPSKYNLTYGF  124

Query  355  APGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFDGRGGS  531
                P+  + P   A + W N   +F+F R +    ADL      G+HGDG  FDG GG 
Sbjct  125  LSNVPANAVAPAERAFQNWDN-ATHFTFKRASSGQTADLIIGFQRGDHGDGSSFDGPGGI  183

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEF  711
             AHAF P  G  H+DADE W    P  N + +++VALHEIGHLLGL HS  + A+M+   
Sbjct  184  LAHAFAPTNGRLHYDADERW-SVDPVANTIHLETVALHEIGHLLGLGHSSIQAAIMYPSV  242

Query  712  EYGEKKRDLTADDINGIRALYHF  780
              G  K  L ADDI GI+ALY+ 
Sbjct  243  SAGTAKIKLNADDIQGIKALYNM  265



>ref|XP_003517862.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 151/276 (55%), Gaps = 20/276 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G + G    GL NLK Y   FGYI+++S + SS+ +D F D LE+A+R YQ   +LN 
Sbjct  59   FTGCRPGKTYNGLSNLKNYFHYFGYISNVS-SKSSNFSDDFDDALEAAVRAYQKNFNLNI  117

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPAN  330
            TG LD  T  Q++KPRCGVADIINGT     G+           V HY F+  +P+WP  
Sbjct  118  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKTNTTDSPTFHTVAHYSFFDGQPRWPVG  177

Query  331  KRHLTYGFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTG-FFNADLKFALFSGEHGD  501
             + LTY F P      ++      A   W  V    SF  T  +  AD++   + G+HGD
Sbjct  178  TQELTYAFDPDNALDDVIKTVFGNAFSRWSEV-TTISFRETASYVAADIRIGFYGGDHGD  236

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLG  666
            G PFDG  G+ AHAF P  G  H D+ E WV  G        N +D++SVA+HEIGHLLG
Sbjct  237  GEPFDGVLGTLAHAFSPTNGMFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLLG  296

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   +A+M+       +K +L  DDI GI+ LY
Sbjct  297  LGHSSVEDAIMYPTITARTRKVELNEDDIQGIQVLY  332



>ref|XP_008443669.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=313

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 151/279 (54%), Gaps = 23/279 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSSEADYFSDQLESAIRIYQTRH  168
            LQG KKGD VKG+  LK + + +GY    IN   +   +   D F D+LE AI+ YQ   
Sbjct  36   LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDTDADDTFDDRLEFAIKTYQQYF  95

Query  169  HLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFY  303
            HLN TG L+A+T  Q+  PRCG  DIIN +  R   E                V HY F+
Sbjct  96   HLNPTGSLNAETISQLATPRCGNPDIINESTGRMLSEHNNNDSSHDHHHLPHAVSHYAFF  155

Query  304  PDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFAL  480
            P   +WP+ K  LTY F PGT +    PV  A   W     +F FS  T +  ADLK   
Sbjct  156  PGRRRWPSTKYRLTYAFLPGTRADAKAPVTRAFATWAR-NTHFKFSLITNYRRADLKIGF  214

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHL  660
            + G HGDG PFDG GG+ AHAF P  G  H+D+ E W   G      D+Q+VALHEIGHL
Sbjct  215  YRGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWA-VGAVKGRYDLQTVALHEIGHL  273

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYH  777
            LGL HS  R A+M+     G  K  L ADDI GI+ LY+
Sbjct  274  LGLGHSTVRNAIMYPYIRSGSTK-GLNADDIKGIKVLYN  311



>ref|XP_011003818.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 152/273 (56%), Gaps = 17/273 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G +KG  VKGL  LK +LK  GY     +      +D F +  ESA++ YQ  + LN 
Sbjct  39   LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLNV  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV-----------VPHYRFYPDEPKWPA  327
            TG LD+DT +++M PRCGV D IN    +  G             V HY F+   P+WP+
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  328  NKRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            +K HLTY F+         +     + A + W +V ++     +    AD+     SG+H
Sbjct  158  SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDG G   AHAF P  G  H+DADE W    P  + +D++SVA+HEIGHLLGLDH
Sbjct  218  GDGDPFDGPGRILAHAFAPTDGRLHYDADEKW-STNPSTDEVDLESVAVHEIGHLLGLDH  276

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S  + ++M+ E   G  KR+L  DDI+GIRALY
Sbjct  277  SMDQNSIMFAEIPQGTIKRELGQDDIDGIRALY  309



>ref|XP_004509890.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=377

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 155/281 (55%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G +  GL NLK Y + FGYI   S+    + +D F D LE+AI+ YQ   +LN 
Sbjct  53   FTGCHHGVKYDGLSNLKNYFQHFGYI---SHAPQLNFSDNFDDALENAIKTYQKNFNLNI  109

Query  181  TGILDADTARQMMKPRCGVADIINGTR---------------RRPGGEVVPHYRFYPDEP  315
            TG LD +T RQ++ PRCGVADIINGT                 +P    + H+  +P +P
Sbjct  110  TGELDDNTLRQIVLPRCGVADIINGTTAMNAGKEKETTSYGHSKPKFHTLSHFTVFPGQP  169

Query  316  KWPANKRHLTYGFAPGTP-SKFIVPV-ATALKAWHNVGEYFSFSRT-GFFNADLKFALFS  486
            +WP  K+ LTY F PG   SK +  V ATA   W  V    +F+ T  + +AD+K   F 
Sbjct  170  RWPEGKQELTYAFFPGNDLSKTVKSVFATAFARWSEVTT-LTFTETESYSSADMKIGFFE  228

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEI  651
            G+HGDG PFDG  G+ AHAF P  G  H DA E WV  G       P  +D++SVA+HEI
Sbjct  229  GDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDISKSSLPTAVDLESVAVHEI  288

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   +A+M+       KK  L  DD+ GI+ LY
Sbjct  289  GHLLGLGHSSVEDAIMFPTISSRMKKVVLAEDDVRGIQYLY  329



>ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=364

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/275 (43%), Positives = 154/275 (56%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G + GD+++GL  LK Y   FGYI     N+ S+  D F D LESAI+ YQ   +LN 
Sbjct  50   LAGCRAGDKLEGLSKLKNYFHYFGYIP----NTLSNFTDDFDDALESAIKTYQQNFNLNV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG LD  T  Q+++PRCG ADIING+     G+          V HY F+P  P+WP +K
Sbjct  106  TGELDEQTLDQLVRPRCGNADIINGSTTMNSGKWQTTTTSFHAVGHYSFFPGTPRWPDSK  165

Query  334  RHLTYGFAPGTPSKFI--VPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDG  504
            R LTY F P      +       A   W  V    +F+ T  +N AD++   FSG+HGDG
Sbjct  166  RDLTYAFWPSNQLTEVEKSVFTRAFDRWSTVIP-MNFTETESYNVADIRIGFFSGDHGDG  224

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGL  669
             PFDG  G+ AHAF P  G  H D +E+WV  G        + +D++SVA+HEIGHLLGL
Sbjct  225  EPFDGVLGTLAHAFSPPSGRFHLDGEENWVVSGDISSSTISSAVDLESVAVHEIGHLLGL  284

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             HS   EA+M+       +K +L  DDI GI+ LY
Sbjct  285  GHSSVEEAIMYPTIPSRTRKIELANDDIQGIQYLY  319



>gb|EPS61169.1| matrixin family protein, partial [Genlisea aurea]
Length=313

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 151/274 (55%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G KKG +  G+  +KKYL+ FGY+ND SY   S E   F + L++A+R YQ   +L  
Sbjct  7    LVGCKKGIKAAGIGLMKKYLQYFGYLND-SYRDFSDE---FDENLDAAVRDYQLNFNLGV  62

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYR---------FYPDEPKWPANK  333
            TG LD  T   M +PRCG  D+INGT     G+    +R         F+P+ P+WP  +
Sbjct  63   TGELDESTVDLMAQPRCGNLDVINGTSTMASGKSSDTFRGIRNVGRHSFFPNRPRWPPGR  122

Query  334  RHLTYGFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
              LTY F P    P+      A A + W  V          F  AD++ A F G+HGDG 
Sbjct  123  DRLTYAFLPENRLPAPTRSAFARAFRRWSAVTPLSFVETEAFEGADIRIAFFRGDHGDGE  182

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLD  672
            PFDG  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLLGL 
Sbjct  183  PFDGLLGTLAHAFSPPSGRFHLDGDENWVVDGDFLDATRTSAVDLESVAVHEIGHLLGLG  242

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS  REA+M+    +G +K DL  DDI GI+ LY
Sbjct  243  HSSVREAIMYPTIAFGTRKVDLVDDDIAGIQELY  276



>ref|XP_007220919.1| hypothetical protein PRUPE_ppb025548mg [Prunus persica]
 gb|EMJ22118.1| hypothetical protein PRUPE_ppb025548mg [Prunus persica]
Length=315

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 159/276 (58%), Gaps = 25/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG  V GL  LKKYL  FGY+N D S +++  E   F D LESAI+ YQ  +HL 
Sbjct  44   LEGCHKGQNVSGLQELKKYLTKFGYLNYDHSKHANDEE---FDDILESAIKSYQKSYHLK  100

Query  178  STGILDADTARQMMKPRCGVADIINGTR--------RRPGGEVVPHYRFYPDEPKWPANK  333
             TG LD  T +QMM PRCGV D++NGTR        +      V HY F+P   +W  +K
Sbjct  101  VTGTLDTTTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHGVAHYEFFPGPRRW--SK  158

Query  334  RHLTYGFA------PGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
             HLTY F+      PGT +   +  A A + W  V  +          AD+      G H
Sbjct  159  THLTYRFSSSVNQVPGTQNVRSI-CAQAFQRWAQVTSFTFEEVPATSAADITIGFHRGNH  217

Query  496  GDGV--PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGL  669
            GDG    FDG  G+ AHA PP  G+ H+DADE W    P PN +D++SV +HEIGHLLGL
Sbjct  218  GDGPGNAFDGPRGTLAHANPPRGGNFHYDADERWSS-NPGPNEVDLESVTVHEIGHLLGL  276

Query  670  DHS-EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +H+ +  +A+M+  F++G  KRDL  DDI+GIRALY
Sbjct  277  NHNPDLPDAIMYPYFDHGIIKRDLHRDDIDGIRALY  312



>ref|XP_006371427.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
 gb|ERP49224.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
Length=308

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 154/270 (57%), Gaps = 18/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  SS      F D LE A++ YQ   HLN
Sbjct  43   LEGVQKGQTVQGLVELKQYLKKFGYYPSDITLTSSD-----FDDHLELALKTYQEYFHLN  97

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYP------DEPKWPANKRH  339
             TG LD+ T +QMM PRCG+ DIIN    +P      H +F+          KWP +K  
Sbjct  98   VTGNLDSSTIQQMMIPRCGMPDIINTPSTKPNSTTSKHNKFHMVVHYDFGTRKWPPSKYA  157

Query  340  LTYGFAPGTP---SKFIVPVAT-ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
            LTY F  G     S  +  V + A + W  V  +     T   +AD+    FSG+HGD  
Sbjct  158  LTYRFGSGVQVVGSDTLRSVCSNAFQTWAKVSPFTFQEATDGASADIVIEFFSGDHGDQD  217

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS-EH  684
            PFDG G   AH F P+ G  H+DADE+W    P  +  D++SV +HEIGHLLGL HS +H
Sbjct  218  PFDGPGKQLAHGFFPQDGRLHYDADENW-STDPAMDQTDLESVTVHEIGHLLGLYHSKDH  276

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALY  774
             EA+M+     G+KKRDL  DDI+GI ALY
Sbjct  277  PEAIMYPTIAPGKKKRDLAQDDIDGIHALY  306



>ref|XP_004504503.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=374

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/285 (42%), Positives = 144/285 (51%), Gaps = 34/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G    GL  LK Y + FGYI +      S+  D F D LESA+R YQ   +LN 
Sbjct  54   FTGCSPGKTYDGLSKLKNYFQRFGYITNAP---PSNFTDDFDDALESAVRAYQQNFNLNV  110

Query  181  TGILDADTARQMMKPRCGVADIINGT----------------RRRPGGEVVPHYRFYPDE  312
            TG LD  T   ++KPRCGVADIINGT                +  P    V HY F+P E
Sbjct  111  TGELDNATMNYIVKPRCGVADIINGTTSMNSGKFNFNNTSENKENPKFHTVAHYSFFPGE  170

Query  313  PKWPANKRHLTYGFAPG------TPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKF  474
            P+WPA  + LTY F P       T   F    A A   W  V        T F  AD+K 
Sbjct  171  PRWPAGTKSLTYAFDPNENLDETTKQVF----ANAFNQWSKVTTITFSETTSFSTADIKI  226

Query  475  ALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVA  639
              +SG+HGDG  FDG  G+ AHAF P  G  H D  E WV  G        N +D++SVA
Sbjct  227  GFYSGDHGDGEAFDGVLGTLAHAFSPTDGRFHLDKAEDWVVSGDVTESTLSNAVDLESVA  286

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS   EA+M+       +K +L  DDI+GI+ LY
Sbjct  287  VHEIGHLLGLGHSSVEEAIMYPTISSKTRKVELVNDDIDGIQQLY  331



>ref|XP_011003815.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 152/273 (56%), Gaps = 17/273 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G +KG  VKGL  LK +L+  GY     +      +D F +  ESA++ YQ  + LN 
Sbjct  39   LEGCQKGQNVKGLKELKHHLRNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLNV  97

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV-----------VPHYRFYPDEPKWPA  327
            TG LD+DT +++M PRCGV D IN    +  G             V HY F+   P+WP+
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWPS  157

Query  328  NKRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            +K HLTY F+         +     + A + W +V ++     +    AD+     SG+H
Sbjct  158  SKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGDH  217

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
            GDG PFDG G   AHAF P  G  H+DADE W    P  + +D++SVA+HEIGHLLGLDH
Sbjct  218  GDGDPFDGPGRILAHAFAPTDGRLHYDADEKW-STNPRTDEVDLESVAVHEIGHLLGLDH  276

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S  + ++M+ E   G  KR+L  DDI+GIRALY
Sbjct  277  SMDQNSIMFAEIPQGTIKRELGQDDIDGIRALY  309



>gb|EYU31381.1| hypothetical protein MIMGU_mgv1a023026mg, partial [Erythranthe 
guttata]
Length=267

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 152/263 (58%), Gaps = 8/263 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G++KG + K +  LKK+L   GY+   + N +  + D F D LE AI+ YQ   HL+ 
Sbjct  10   LIGARKGHKAKSVLELKKHLSNIGYMKH-NNNEAKEKTDLFDDDLELAIKKYQVFFHLDV  68

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV---VPHYRFYPDEPKWPANKRHLTYG  351
            TGILDA T + ++ PRCGVAD +N    +   ++     HY F+P EPKWP  K +LTY 
Sbjct  69   TGILDAKTVKNLLLPRCGVADFVNLNASQFKNKIPTLASHYTFFPGEPKWP--KTNLTYS  126

Query  352  FAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGS  531
            F PGT +  +  +  A + W +V  +       + +AD+K +    EHGDG PFDGRGG+
Sbjct  127  FPPGTRADALQAIKDATQMWASVSNFKFTYIADYDHADIKISFQVWEHGDGTPFDGRGGA  186

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEF  711
             AH+  P     HFD DE W + G  P   D+Q++ LHE+GH LGL H+    A+M+   
Sbjct  187  LAHSSGPYDSLLHFDGDELWAD-GVVPGKYDLQTIGLHELGHKLGLGHTNDGGAIMYPTI  245

Query  712  EYGEKKRDLTADDINGIRALYHF  780
              G +K  L  DDI+GI+ALYH 
Sbjct  246  GSGFRK-GLGKDDIDGIKALYHL  267



>emb|CDY11609.1| BnaC06g31300D [Brassica napus]
Length=373

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 153/276 (55%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYSGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR----PGGEVVPHYRFYPDEPKWPAN  330
            TG LDA T + ++ PRCG  D++NGT      RR+    P    V HY  +P EP+WP +
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  331  KRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            +R LTY F P  P    V    A A   W +V      +   F  +D+    ++G+HGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEIGHLLG  666
             PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   E++M+     G++K DLT+DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>emb|CDX68356.1| BnaA07g23960D [Brassica napus]
Length=373

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/276 (41%), Positives = 152/276 (55%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     + +  D F D L++A+ +YQ    L+ 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYTGNFTDDFDDILKAAVELYQKNFRLDV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRR-----RPGGEV-----VPHYRFYPDEPKWPAN  330
            TG LDA T + ++ PRCG  D++NGT        PGG +     V HY  +P EP+WP +
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  331  KRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            +R LTY F P  P    V    A A   W  V E    +   F  +D+    ++G+HGDG
Sbjct  164  RRDLTYAFDPRNPLTNEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEIGHLLG  666
             PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   E++M+     G++K DLT DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>emb|CDY23516.1| BnaC06g24850D [Brassica napus]
Length=373

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 151/276 (55%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI       + +  D F D L++A+ +YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYI---PQTYTGNFTDDFDDILKAAVELYQKNFGLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRR-----RPGGEV-----VPHYRFYPDEPKWPAN  330
            TG LDA T + ++ PRCG  D++NGT        PGG +     V HY  +P EP+WP +
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  331  KRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            +R LTY F P  P    V    A A   W  V E    +   F  +D+    ++G+HGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEIGHLLG  666
             PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   E++M+     G++K DLT DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>ref|XP_008244963.1| PREDICTED: metalloendoproteinase 1 [Prunus mume]
Length=425

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 155/271 (57%), Gaps = 25/271 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            GD+V+GL  LKKY   FGYI +L  N +    D F D L+SA++ YQ   +LN TG LD 
Sbjct  110  GDKVEGLAKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  165

Query  199  DTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTY  348
             T + ++KPRCG  DI+NGT     G+           V HY  +P  P WP N+R LTY
Sbjct  166  PTIQHLVKPRCGNPDIVNGTTTMNSGKPSSSNTSNLHTVAHYSTFPGTPVWPLNRRDLTY  225

Query  349  GFAPGTPSKFIVPV-ATALKAWH--NVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFD  516
             F P   +K    V A  L+A+   +     +FS T  F+ AD+K   F G+HGDG PFD
Sbjct  226  AFLP--ENKLADDVKAVFLRAFERWSAATPLNFSETTSFYTADIKIGFFRGDHGDGEPFD  283

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSE  681
            G  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLLGL HS 
Sbjct  284  GVLGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGHSS  343

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              EA+M+       KK +L +DD+ GI++LY
Sbjct  344  VEEAIMFPTISSRTKKVELASDDVLGIQSLY  374



>dbj|BAE98757.1| predicted GPI-anchored protein [Arabidopsis thaliana]
Length=378

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 154/281 (55%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S +  D F D L++A+ +YQT  +LN 
Sbjct  47   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT    GG                V  Y  +P EP+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEY-FSFSRTGFFNADLKFALFSG  489
            WP N+R LTY F P  P    V    + A   W +V    F+ S + F  +D+    ++G
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSES-FSTSDITIGFYTG  222

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEI  651
            +HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEI
Sbjct  223  DHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEI  282

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   E++M+     G++K DLT DD+ GI+ LY
Sbjct  283  GHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|NP_177174.1| matrix metalloproteinase [Arabidopsis thaliana]
 gb|AAB61099.1| Similar to Glycine metalloendoproteinase (gb|U63725) [Arabidopsis 
thaliana]
 gb|AEE35027.1| matrix metalloproteinase [Arabidopsis thaliana]
Length=378

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 154/281 (55%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S +  D F D L++A+ +YQT  +LN 
Sbjct  47   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT    GG                V  Y  +P EP+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEY-FSFSRTGFFNADLKFALFSG  489
            WP N+R LTY F P  P    V    + A   W +V    F+ S + F  +D+    ++G
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSES-FSTSDITIGFYTG  222

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEI  651
            +HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEI
Sbjct  223  DHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEI  282

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   E++M+     G++K DLT DD+ GI+ LY
Sbjct  283  GHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>emb|CDY38799.1| BnaA07g28710D [Brassica napus]
Length=370

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 152/276 (55%), Gaps = 21/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYSGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR----PGGEVVPHYRFYPDEPKWPAN  330
            TG LDA T + ++ PRCG  D++NGT      RR+    P    V HY  +P EP+WP +
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  331  KRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            +R LTY F P  P    V    A A   W  V      +   F  +D+    ++G+HGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEIGHLLG  666
             PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   E++M+     G++K DLT+DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>ref|XP_009360449.1| PREDICTED: metalloendoproteinase 1 [Pyrus x bretschneideri]
Length=375

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 148/271 (55%), Gaps = 24/271 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L    +++  D F D LE+A++ YQT  +LN TG LD 
Sbjct  60   GEKVDGLGKLKKYFNRFGYIPNLP---TANLTDDFDDDLEAALKTYQTNFNLNVTGELDG  116

Query  199  DTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTY  348
             T   ++KPRCG  DI+NGT     G+           V HY F+P  P WP N+R LTY
Sbjct  117  PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYTFFPGTPVWPQNRRDLTY  176

Query  349  GFAP----GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFD  516
             F P      P K +     A + W           T F +AD+K   F G+HGDG PFD
Sbjct  177  AFVPENELSDPVKAVF--VGAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEPFD  234

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSE  681
            G  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLLGL HS 
Sbjct  235  GVLGTLAHAFSPPSGRFHLDGDENWVIAGDISKSSVTSAVDLESVAVHEIGHLLGLGHSS  294

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               A+M+       KK +L  DD+ GI++LY
Sbjct  295  VEGAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_009105693.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=378

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 156/284 (55%), Gaps = 29/284 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     + +  D F D L++A+ +YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYTGNFTDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR-------PGGEV-----VPHYRFYP  306
            TG LDA T + ++ PRCG  D++NGT      RR+       PGG+V     V HY  +P
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVNFSPGGKVPRLHTVKHYTLFP  163

Query  307  DEPKWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFAL  480
             EP+WP ++R LTY F P  P    V    A A   W  V      +   F  +D+    
Sbjct  164  GEPRWPRDRRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGF  223

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVAL  642
            ++G+HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  643  HEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HEIGHLLGL HS   E++M+     G++K DLT+DD+ GI+ LY
Sbjct  284  HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  327



>ref|XP_008458917.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=295

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/265 (42%), Positives = 150/265 (57%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE--ADYFSDQLESAIRIYQTRHHL  174
            L G +KGD V+G++++KKYL  +GY++  +  SS  E  ++ F D LESA+++YQ    L
Sbjct  33   LYGCRKGDNVEGIHSIKKYLHRYGYLSHNTNTSSHIELNSNTFDDTLESAVKLYQKWSKL  92

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE----VVPHYRFYPDEPKWPANKRHL  342
            N +GILD  T  Q+ KPRCG+ D+I  +      E    +  HY  +P   KWP  KRHL
Sbjct  93   NVSGILDQQTLDQIFKPRCGLPDVIMKSNSNKNTEDDLEISSHYALFPGNQKWPDYKRHL  152

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNA-DLKFALFSGEHGDGVPFDG  519
            TY F    P  F+  V  A+K W      F+FS+       D+  +   G+HGDGVPFDG
Sbjct  153  TYTFTNNFPIDFVPSVTEAMKEW-AAHSLFTFSQAADDQVPDINISFQVGDHGDGVPFDG  211

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
             GG   HAF P  G  H D D+ W   G     +++ + ALHE+GH+LGL HS  ++AVM
Sbjct  212  PGGVVGHAFAPTDGRLHLDGDDKW-SAGLETQKVNVMNAALHELGHVLGLAHSTVQQAVM  270

Query  700  WEEFEYGEKKRDLTADDINGIRALY  774
            W   +    K  LT DDI G+ ALY
Sbjct  271  WPYIDVYALKA-LTDDDIAGLTALY  294



>gb|KCW49214.1| hypothetical protein EUGRSUZ_K02794, partial [Eucalyptus grandis]
Length=227

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 146/266 (55%), Gaps = 46/266 (17%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQG  KG+   G+  LK+YL+ F                      E A++ YQ  +HLN 
Sbjct  2    LQGCHKGNHTGGIRELKRYLEKF----------------------EFAVKTYQLNYHLNV  39

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TG LD  T  +MM+PRCGVADIINGT R                P+WPA+  HLTYGF P
Sbjct  40   TGTLDPQTTSKMMRPRCGVADIINGTTRM--------------GPRWPASNYHLTYGFLP  85

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGV--PFDGRGGS  531
            GTP     PVA A   W +V   F+FS       A+++     G+HGDG    FDG GG+
Sbjct  86   GTPEAATAPVARAFATWTSVTR-FTFSYVEDHEIANIQIGFARGDHGDGAHNSFDGPGGT  144

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNG---LDIQSVALHEIGHLLGLDHSEHREAVMW  702
             AHAFPP  G  H+DADE W     PP+G    ++++VALHEIGHLLGL HS+   A+M+
Sbjct  145  LAHAFPPTVGLFHYDADEKWAV--DPPSGSAAFNVETVALHEIGHLLGLGHSDVEGAIMY  202

Query  703  EEFEYGEKKRDLTADDINGIRALYHF  780
                 G  K  L ADDI GI+ALY+F
Sbjct  203  SSIAPGTTK-GLHADDIQGIKALYNF  227



>emb|CAN76268.1| hypothetical protein VITISV_004096 [Vitis vinifera]
Length=364

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 149/273 (55%), Gaps = 23/273 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G   GD+  GL  LK+Y   FGYI++ +Y       D F D  E A++ YQ   +LN+TG
Sbjct  51   GCHAGDKADGLAKLKEYFHYFGYIHNSNYT------DDFDDAFEQALKTYQLNFNLNTTG  104

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGEVVP----------HYRFYPDEPKWPANKR  336
             LD  T  Q++ PRCG ADI NG+     G+  P          HY F+  +P WP +KR
Sbjct  105  QLDXATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPESKR  164

Query  337  HLTYGFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            +LTYGF P       V     +A + W  V          +++ADL+ A ++G+HGDG  
Sbjct  165  NLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDGEA  224

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDH  675
            FDG  G+ AHAF P  G  H D +E+WV  G        + +D++SVA+HEIGHLLGL H
Sbjct  225  FDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHLLGLGH  284

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S   EA+M+       KK +L +DDI GI+ LY
Sbjct  285  SSVEEAIMYPTITSRTKKVELASDDIQGIQELY  317



>ref|XP_008353003.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=377

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/269 (41%), Positives = 147/269 (55%), Gaps = 20/269 (7%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L    +++  D F   LE+A++ YQ   +LN TG LD 
Sbjct  60   GEKVDGLSKLKKYFNRFGYIPNLP---TTNLTDDFDGDLEAALKTYQKNFNLNVTGELDG  116

Query  199  DTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTY  348
             T   ++KPRCG ADI+NGT     G+           V HY F+P  P WP N+R LTY
Sbjct  117  PTLEHLVKPRCGNADIVNGTTTMNSGKPASYNSTKFHSVSHYSFFPGTPVWPQNRRDLTY  176

Query  349  GFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGR  522
             F P      +       A + W           T F++AD+K   F G+HGDG PFDG 
Sbjct  177  AFLPENELSDEVKTVFVGAFQRWSAATPLTFQETTSFYSADIKIGFFVGDHGDGEPFDGV  236

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSEHR  687
             G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLLGL HS   
Sbjct  237  LGTLAHAFSPPSGRFHLDGDENWVITGDISKFSVESAVDLESVAVHEIGHLLGLGHSSVE  296

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +A+M+       KK +L +DD+ GI+ LY
Sbjct  297  DAIMYPTISSRTKKVELASDDVLGIQTLY  325



>ref|XP_002267298.2| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
Length=373

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 149/273 (55%), Gaps = 23/273 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G   GD+  GL  LK+Y   FGYI++ +Y       D F D  E A++ YQ   +LN+TG
Sbjct  60   GCHAGDKADGLAKLKEYFHYFGYIHNSNY------TDDFDDAFEQALKTYQLNFNLNTTG  113

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGEVVP----------HYRFYPDEPKWPANKR  336
             LD  T  Q++ PRCG ADI NG+     G+  P          HY F+  +P WP +KR
Sbjct  114  QLDEATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPESKR  173

Query  337  HLTYGFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            +LTYGF P       V     +A + W  V          +++ADL+ A ++G+HGDG  
Sbjct  174  NLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDGEA  233

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDH  675
            FDG  G+ AHAF P  G  H D +E+WV  G        + +D++SVA+HEIGHLLGL H
Sbjct  234  FDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHLLGLGH  293

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S   EA+M+       KK +L +DDI GI+ LY
Sbjct  294  SSVEEAIMYPTITSRTKKVELASDDIQGIQELY  326



>ref|XP_009104967.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=381

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 155/284 (55%), Gaps = 29/284 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL+ +KKY + FGYI +     + +  D F D L++A+ +YQ    L+ 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE---TYTGNFTDDFDDILKAAVELYQKNFRLDV  103

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR-------PGGEV-----VPHYRFYP  306
            TG LDA T + ++ PRCG  D++NGT      RR+       PGG +     V HY  +P
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSVMHNGRRKTFEVNFSPGGRIPRLHTVKHYTLFP  163

Query  307  DEPKWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFAL  480
             EP+WP ++R LTY F P  P    V    A A   W  V E    +   F  +D+    
Sbjct  164  GEPRWPKDRRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGF  223

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVAL  642
            ++G+HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  643  HEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HEIGHLLGL HS   E++M+     G++K DLT DD+ GI+ LY
Sbjct  284  HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_003628627.1| Matrix metalloproteinase-9 [Medicago truncatula]
 gb|AET03103.1| matrix metalloproteinase [Medicago truncatula]
Length=373

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 152/279 (54%), Gaps = 27/279 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G ++G+   GL NLK Y + FGYI     +  S+ +D F D L+ AI+ YQ   +LN TG
Sbjct  51   GCRQGENYNGLSNLKNYFQHFGYI---PRSPKSNFSDDFDDDLQEAIKTYQKNFNLNVTG  107

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEPKW  321
             LD  T RQ+M PRCGVADIINGT     G+                V H+  +P +P+W
Sbjct  108  ELDDMTLRQVMLPRCGVADIINGTTTMNAGKDTETTSNSDSKLRFHTVSHFTVFPGQPRW  167

Query  322  PANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGE  492
            P  K+ LTY F PG      V    ATA   W  V     F+ T  ++ AD+K   F+G+
Sbjct  168  PEGKQELTYAFFPGNELTETVKSVFATAFARWSEV-TTLKFTETTLYSGADIKIGFFNGD  226

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGH  657
            HGDG PFDG  G+ AHAF P  G  H DA E WV  G       P  +D++SVA+HEIGH
Sbjct  227  HGDGEPFDGSLGTLAHAFSPRNGRFHLDAAEDWVVSGDVSKSSLPTAVDLESVAVHEIGH  286

Query  658  LLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LLGL HS   EA+M+       KK  L  DD+ GI+ LY
Sbjct  287  LLGLGHSSEEEAIMFPTISSRMKKVVLADDDVRGIQYLY  325



>ref|XP_006838196.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
 gb|ERN00765.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
Length=355

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 153/269 (57%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
             Q +  G  + G+  LKKY + FGY+ +   NSS +  D F ++ ESA+R YQ R  L+ 
Sbjct  50   FQDAPLGSNITGMVELKKYFQRFGYLLN-PPNSSETLTDCFDEEFESAVRTYQARLSLSV  108

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV--VPHYRFYPDEPKWPANKRHLTYGF  354
            TG LD DT  Q+M PRCG+ D      +  GG    V HY F+P  PKWP  K+ LTYG 
Sbjct  109  TGRLDPDTLAQVMTPRCGMPD------KGLGGPFHEVGHYAFFPGVPKWPRGKKALTYGI  162

Query  355  APGTPSKFI------VPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFD  516
            +P     ++      + ++ A   W NV          ++ AD+K   FSG+HGDG PFD
Sbjct  163  SPTNMVNYLDMEDVRMALSRAFDRWSNVIPLNFTETQDYYGADIKIGFFSGDHGDGQPFD  222

Query  517  GRGGSYAHAFPPEYGDCHFDADEHW-VEFGPPPN--GLDIQSVALHEIGHLLGLDHSEHR  687
            G  G  AHAF P  G+ H DA E W  +FG   +   +D++SVA HEIGHLLGL HS+ +
Sbjct  223  GVLGILAHAFSPSNGNFHLDASETWSTDFGVQKSRVAIDLESVATHEIGHLLGLGHSKEK  282

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EA+M+       KK +L +DDI G+++LY
Sbjct  283  EAIMYPSLSPRTKKMELRSDDIIGVQSLY  311



>ref|XP_009626465.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 157/288 (55%), Gaps = 30/288 (10%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G   G +V+GL  +K+Y + FGYIN LS N S    D F D L SA++ YQ   +LN+TG
Sbjct  52   GCHVGQKVEGLAKIKQYFQHFGYINSLSKNFS----DEFDDVLFSAVKTYQLNFNLNTTG  107

Query  187  ILDADTARQMMKPRCGVADIINGTR---------RRPGGEVVPHYRFYPDEPKWPANKRH  339
              DA T + M+KPRCG  DI+NGT            P    + H+ F+   P+WP +K +
Sbjct  108  EFDAVTLQHMIKPRCGNPDIVNGTTSMNSGNSPANSPAMHTMAHFSFFEGRPRWPPSKTN  167

Query  340  LTYGFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEHGDGVP  510
            L Y F P       V  A   A   W  V    SF+ TG +  AD++     G+HGDG P
Sbjct  168  LNYAFLPENQLTDSVKAAFGRAFDKWSEVTP-LSFTETGSYRTADIRIGFLVGDHGDGNP  226

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVE---FGPPP----NGLDIQSVALHEIGHLLGL  669
            FDG     AHAF P  G  H D +E+WV    F   P    +G+D++SVA+HEIGHLLGL
Sbjct  227  FDGPMKILAHAFSPPTGFFHLDGEENWVVDGGFLKEPVLEISGVDLESVAVHEIGHLLGL  286

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF*HLSGQQCNNN  813
            DHS  +EA+M+     G +K +L++DDI G+  LY      G   NNN
Sbjct  287  DHSSKKEAIMFPTLGAGVRKVELSSDDIKGVHMLY------GSNPNNN  328



>emb|CBI34986.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/266 (45%), Positives = 155/266 (58%), Gaps = 11/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS--EADYFSDQLESAIRIYQTRHHL  174
            LQGSKKGD+V+G++ ++ YL+ FGY++     + S     D+F D LESAI+ +QT +HL
Sbjct  39   LQGSKKGDKVEGIHKVRNYLQRFGYLSSTHSKTESQVDGDDHFDDDLESAIQAFQTYYHL  98

Query  175  NSTGILDADTARQMMKPRCGVAD---IINGTRRRPGG--EVVPHYRFYPDEPKWPANKRH  339
              TGILDA TA  M +PRCGV D   + N T         +  H+ F+P+ P+WP  + H
Sbjct  99   KPTGILDAPTAALMSRPRCGVPDNPSVTNNTNSHGHSHLNIGTHFAFFPNNPRWPPGQTH  158

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFD  516
            L Y    G+ S+    V  A  AW  + + F+F +T     A+L  +    EHGDG PFD
Sbjct  159  LLYVLDSGSHSEAADAVGKAFGAWAAISK-FTFEQTSDPTVANLNISFQIREHGDGSPFD  217

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            G GG+ AHA PP  G  HFD DE WV  G   N +D+Q+VA HEIGHLLGL HS    A+
Sbjct  218  GPGGTIAHAAPPTDGRFHFDGDETWV-VGAVANSIDLQTVATHEIGHLLGLAHSSVEAAI  276

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            M+     G  K  L  DDI GI ALY
Sbjct  277  MFAYIAPGATK-GLNQDDIAGITALY  301



>ref|NP_176205.1| Matrixin family protein [Arabidopsis thaliana]
 gb|AAD14473.1| Strong similarity to gi|2829864 F3I6.6 zinc metalloproteinase 
homolog from Arabidopsis thaliana BAC gb|AC002396. EST gb|Z26412 
comes from this gene [Arabidopsis thaliana]
 dbj|BAD44472.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ABF19013.1| At1g59970 [Arabidopsis thaliana]
 gb|AEE33645.1| Matrixin family protein [Arabidopsis thaliana]
Length=360

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 150/272 (55%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+ + GL  LK+Y + FGYI      ++ +  D F D L+SAI  YQ   +L  
Sbjct  48   LAGCHIGENINGLSKLKQYFRRFGYIT-----TTGNCTDDFDDVLQSAINTYQKNFNLKV  102

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVV---PHYRFYPDEPKWPANKRHLTYG  351
            TG LD+ T RQ++KPRCG  D+I+G     GG+++     Y F+P +P+WP  KR LTY 
Sbjct  103  TGKLDSSTLRQIVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYA  162

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            FAP      +     + A   W  V    +F+R+     AD+    FSGEHGDG PFDG 
Sbjct  163  FAPQNNLTDEVKRVFSRAFTRWAEVTP-LNFTRSESILRADIVIGFFSGEHGDGEPFDGA  221

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D DE W+           P    +D++SVA+HEIGHLLGL HS
Sbjct  222  MGTLAHASSPPTGMLHLDGDEDWLISNGEISRRILPVTTVVDLESVAVHEIGHLLGLGHS  281

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G++K +L  DDI GI+ LY
Sbjct  282  SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  313



>ref|XP_011080437.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=308

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 155/264 (59%), Gaps = 10/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEA-DYFSDQLESAIRIYQTRHHLN  177
            L G++KG   KG+  LKKYL   GY+ND ++ + +++  D+F D+LE AI+ YQT   L 
Sbjct  47   LIGARKGTTSKGIPQLKKYLSRLGYMNDNNHTTPANQTNDFFDDKLELAIKRYQTFFKLT  106

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGEV---VPHYRFYPDEPKWPANKRHLTY  348
               I+D +T  QM +PRCGV D    T      ++     HY F P++P WP  KR+LTY
Sbjct  107  VNRIMDDNTVTQMSRPRCGVPDFNLNTSNELFLQIPTSASHYTFLPNKPTWPRTKRNLTY  166

Query  349  GFAPGTPSKFIVP-VATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFDGR  522
             F P    + + P +  A + W      F FS T  ++ AD+K +   G HGDG PFDGR
Sbjct  167  SF-PVIARRDVYPAIEHATELWAFFSS-FKFSYTQNYDRADIKISFQYGNHGDGYPFDGR  224

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMW  702
            GG   HA PP  G  H+DADE+WV  G  P   D+Q++ LHE+GH+LGL H+    A+M+
Sbjct  225  GGILGHALPPTIGILHYDADENWVN-GETPGAFDLQTIGLHELGHILGLGHTNDVRAIMY  283

Query  703  EEFEYGEKKRDLTADDINGIRALY  774
               + G +K  L  DD++GI+ALY
Sbjct  284  PNMDPGVRKV-LGQDDMDGIKALY  306



>gb|KFK41437.1| hypothetical protein AALP_AA2G130300 [Arabis alpina]
Length=380

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/284 (41%), Positives = 153/284 (54%), Gaps = 29/284 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY LKKY + FGYI +     S +  D F D L++A+ +YQ    L+ 
Sbjct  47   FTGCHHGQTVDGLYRLKKYFQRFGYIPE---TFSGNFTDDFDDVLKTAVELYQKNFQLDV  103

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR-------PGGE-----VVPHYRFYP  306
            TG LDA T + M+ PRCG  D++NGT      RR+       PGG         HY  +P
Sbjct  104  TGELDALTIKHMVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSPGGRGPRLHTFKHYTLFP  163

Query  307  DEPKWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFAL  480
             EP+WP N+R LTY F P  P    V    + A + W +V          F  +D+    
Sbjct  164  GEPRWPRNRRDLTYAFDPRNPLTEEVKGVFSRAFQRWSDVTALNFTLIDSFTRSDITIGF  223

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVAL  642
            +SG+HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+
Sbjct  224  YSGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  643  HEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HEIGHLLGL HS   +++M+     G++K DLT DD+ GI+ LY
Sbjct  284  HEIGHLLGLGHSSVEDSIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_011010763.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=308

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 153/271 (56%), Gaps = 16/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLE--SAIRIYQTRHH  171
            L  S+KG  V  L+ +K+YLK FGY++ DLS N + ++ D         SAIR YQ   H
Sbjct  39   LVESQKGQSVSKLHLVKQYLKKFGYLDYDLSSNKNRNQVDDDEFDDLLESAIRTYQQNFH  98

Query  172  LNSTGILDADTARQMMKPRCGVADIINGTRRRPG-----GEVVPHYRFYPDEPKWPANKR  336
            L  TG LD  T  QMMKPRCGVADI N T+ R       G     Y F+P  P+W  +K+
Sbjct  99   LEVTGRLDKRTVNQMMKPRCGVADIFNSTKHRNSSKSSDGVANADYSFFPGAPRW--SKK  156

Query  337  HLTYGFAPGTPSKFIVPVATALKA----WHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            HL Y F           + +  K     W  V ++         +AD+K A +  +HGD 
Sbjct  157  HLKYTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDD  216

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS-E  681
             PFDG GG +AH F P  G  HFDADE W    P    LD++SVA+HEIGHLLGL HS +
Sbjct  217  EPFDGPGGIFAHGFRPTIGMLHFDADETWSS-NPGRLELDLESVAVHEIGHLLGLGHSGD  275

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            H +A+M+  F+YG+ KR+L  DDI+GIR LY
Sbjct  276  HPDAIMYPYFDYGKTKRNLQEDDIDGIRDLY  306



>ref|XP_002887284.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63543.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/281 (41%), Positives = 153/281 (54%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V+GLY +KKY + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  47   FTGCHHGQNVEGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKTAVELYQRNFKLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE--------------VVPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT    GG                V  Y  +P EP+
Sbjct  104  TGELDAMTIKHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEY-FSFSRTGFFNADLKFALFSG  489
            WP N+R LTY F P  P    V    + A   W +V    F+ S + F  +D+    ++G
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSDS-FSTSDITIGFYTG  222

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEI  651
            +HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEI
Sbjct  223  DHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEI  282

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   E++M+     G++K DLT DD+ GI+ LY
Sbjct  283  GHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|XP_010255269.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=316

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 157/276 (57%), Gaps = 26/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+GS+KGDRVKGL   K+YL  FGY++  + +            LESAI+ YQ  ++LN 
Sbjct  46   LEGSRKGDRVKGLNEAKRYLHRFGYLDHHNDDDDFDHH------LESAIKTYQLYYNLNE  99

Query  181  TGILDADTARQMMKPRCGVADIING---------TRRRPGGEVVP-----HYRFYPDEPK  318
            TG LD +T +QMM PRCG  DIING           RR GG         HY F+ +  K
Sbjct  100  TGSLDFETVKQMMLPRCGFPDIINGETWMRSGKEKNRRLGGRKTAVGFSSHYAFFNNSLK  159

Query  319  WPANKRHLTYGFAPGTPSKFIV--PVA-TALKAWHNVGEYFSFSRT-GFFNADLKFALFS  486
            WP +K HL Y      P   +V  P+   A   W  + + F+F RT    +AD+  + F 
Sbjct  160  WPPSKMHLKYALDTNVPFDDVVMNPLCYVAFDKWAAISD-FTFERTYDLSSADILISFFK  218

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLG  666
            G+HGDG  FDG GG  AH+F P  G  H+D +E+WV  G      D++SVA+HEIGHLLG
Sbjct  219  GDHGDGHLFDGPGGVLAHSFAPTGGRLHYDLEENWVA-GIRAGSFDLESVAVHEIGHLLG  277

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L H+   EAVM+   + G +K +L  DDI+G+RALY
Sbjct  278  LWHTPVTEAVMFAYLKDGTQKVNLHQDDIDGLRALY  313



>gb|KGN52417.1| hypothetical protein Csa_5G633150 [Cucumis sativus]
Length=294

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 152/268 (57%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            L G +KGD V+G++N+KKYL+ +GY   LS+N+S+        ++ F D LESAIR+YQ 
Sbjct  32   LNGCRKGDNVEGIHNIKKYLQRYGY---LSHNTSTDSNIIELNSNKFDDSLESAIRLYQK  88

Query  163  RHHLNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANK  333
              HLN +GILD +T  QM + RCG+ D+   N ++      E+  HY  +P+  KWP  K
Sbjct  89   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYK  148

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVP  510
            RHLTY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG  
Sbjct  149  RHLTYMFTNNFPVDFVPSVTEAMARWA-AQSLFTFSEASDAQSADINISFQVKDHADGSA  207

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG   HAF P  G  H D D+ W   G   N  ++ +VALHE+GH+LGL HS   +
Sbjct  208  FDGPGGVVGHAFAPTDGRLHLDGDDSW-SAGLEENKFNVMNVALHELGHVLGLAHSTLPQ  266

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVMW   +    K +L  DDI G+ ALY
Sbjct  267  AVMWPYIDSNALK-NLNDDDIAGLHALY  293



>ref|XP_007223246.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
 gb|EMJ24445.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
Length=377

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 155/271 (57%), Gaps = 25/271 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            GD+V+GL  LKKY   FGYI +L  N +    D F D L+SA++ YQ   +LN TG LD 
Sbjct  62   GDKVEGLSKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  117

Query  199  DTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTY  348
             T + ++K RCG  DI+NGT     G+           V HY  +P  P WP ++R LTY
Sbjct  118  RTIQHLVKRRCGNPDIVNGTTTMNSGKPTSSNTSNLHTVAHYSTFPGTPVWPPSRRDLTY  177

Query  349  GFAPGTPSKFIVPV-ATALKAWH--NVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFD  516
             F P   +K    V A  L+A+   +     +FS T  F+ AD+K   FSG+HGDG PFD
Sbjct  178  AFLP--ENKLADDVKAVFLRAFQRWSAATPLNFSETTSFYTADIKIGFFSGDHGDGEPFD  235

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSE  681
            G  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLLGL HS 
Sbjct  236  GVLGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGHSS  295

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              EA+M+       KK +L +DD+ GI++LY
Sbjct  296  VEEAIMFPTISSRTKKVELASDDVLGIQSLY  326



>ref|XP_010100525.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB82659.1| Metalloendoproteinase 1 [Morus notabilis]
Length=374

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 149/277 (54%), Gaps = 24/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G + G +  GL  LK Y K FGYI D  +N +    D F D+LESAI+ YQ   +LN 
Sbjct  53   FTGCRPGQKSDGLSKLKDYFKNFGYIPDSQHNFT----DDFDDELESAIKTYQKNFNLNV  108

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE-----------VVPHYRFYPDEPKWPA  327
            TG LD  T   +MK RCG ADI+NGT     G+            V HY F+   P WP 
Sbjct  109  TGELDDKTIENLMKSRCGNADIVNGTSTMNSGKPASSNSSLNFHAVRHYSFFEGRPTWPE  168

Query  328  NKRHLTYGFAPGTP-SKFIVPVAT-ALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHG  498
              R LTY F P    S     V T A + W  V    +F+ T  ++ ADLK A ++G+HG
Sbjct  169  YHRDLTYAFLPDNELSNTTKEVFTRAFERWAAVTT-LTFTETDSYYEADLKVAFYTGDHG  227

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLL  663
            DG PFDG  G+ AHAF P  G  H D  E WV  G        + +D++SVA+HEIGHLL
Sbjct  228  DGEPFDGVLGTLAHAFSPTSGRFHLDGAETWVAEGDVTKSSTSSAIDLESVAVHEIGHLL  287

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS   EA+M+       +K +L +DDI GI+ LY
Sbjct  288  GLGHSSVEEAIMYPTISAKTRKVELASDDIQGIQELY  324



>ref|XP_006448955.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
 gb|ESR62195.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
Length=241

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 141/236 (60%), Gaps = 6/236 (3%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G++KGD VKG+  LKKYL T GY+++ ++N ++ + DYF + LESA++ YQ   +LN TG
Sbjct  1    GTQKGDTVKGINALKKYLHTLGYLSNHNHNHAA-DGDYFDENLESAVKTYQRNFNLNPTG  59

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGEV--VPHYRFYPDEPKWPANKRHLTYGFAP  360
             +D  T   M KPRCGV D+IN T R  GG      HY FYP  PKWPA K+ ++Y F P
Sbjct  60   HMDLKTVSMMGKPRCGVPDVINRTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISYAFLP  119

Query  361  GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRG--GSY  534
            GT +    PV  A   W     +       +  AD+K +   G+HGDG PF G G     
Sbjct  120  GTRTDVQEPVRQAFLTWSKYTPFSYEFVQDYDAADIKISFQRGDHGDGYPFGGPGPYNLL  179

Query  535  AHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMW  702
            AH+F P  G  H+D DE+W      P  +D+Q+VALHE+GH+LGL HS  + A+M+
Sbjct  180  AHSFSPTDGRAHYDGDENWTVVA-VPGAVDMQTVALHELGHVLGLAHSPVQAAIMY  234



>ref|XP_011085865.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=283

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/274 (43%), Positives = 157/274 (57%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG++ K +++LK YL  FGY   L Y N   +  + F D LESA++ YQ  +++N
Sbjct  16   LEGCHKGNKTKDIHHLKHYLHQFGY---LDYPNQIHANNNDFDDLLESALKEYQRYYNIN  72

Query  178  STGILDADTARQMMKPRCGVADIINGTRR---RPGGE-----------VVPHYRFYPDEP  315
             TG +DA+T  +M+ PRCG  DI++GT     RP  +            V  Y F+P   
Sbjct  73   PTGAVDAETIAKMVIPRCGNRDIVHGTNTMLPRPNKKENSNSSTNSIHTVSQYSFFPGNL  132

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGE  492
            +W  +K HLTYGF+P TP+  I PV  A   W +   +F+FSR       DL       +
Sbjct  133  RW--SKTHLTYGFSPNTPTATIDPVIRAFAKW-DSATHFTFSRAQNNQRPDLIIGFHRRD  189

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGDG PFDG GG+ AHAF P  G  H+D+DE W    P  N   +++VALHEIGHLLGL 
Sbjct  190  HGDGSPFDGPGGTIAHAFAPSDGRFHYDSDEAW-SMSPVGNAFHLETVALHEIGHLLGLG  248

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS   +A+M+     G  K +L ADDI GI+ALY
Sbjct  249  HSSVADAIMYPSISRGATK-NLHADDIQGIKALY  281



>ref|XP_006300509.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
 gb|EOA33407.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
Length=380

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 150/280 (54%), Gaps = 25/280 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  49   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDVLKTAVELYQRNFRLNV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRPGGEV---------VPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT      RR   EV         V  Y  +P EP+
Sbjct  106  TGELDALTIKHIVIPRCGNPDVVNGTSLMHNGRRKTFEVNFSRSHLHAVKRYTLFPGEPR  165

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFALFSGE  492
            WP N+R LTY F P  P    V    A A   W +V          F ++D+    ++G+
Sbjct  166  WPRNRRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTPSEDFTSSDITIGFYTGD  225

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEIG  654
            HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEIG
Sbjct  226  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  285

Query  655  HLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HLLGL HS   E++M+     G +K DLT DD+ GI+ LY
Sbjct  286  HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  325



>ref|XP_008389591.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=387

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 146/269 (54%), Gaps = 20/269 (7%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L    +++  D F D LE+A++ YQ   +LN TG LD 
Sbjct  60   GEKVDGLGKLKKYFNRFGYIPNLP---TANLTDEFDDDLEAALKTYQKNFNLNVTGELDG  116

Query  199  DTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRHLTY  348
             T   ++KPRCG  DI+NGT     G+           V HY F+P  P WP N+R LTY
Sbjct  117  PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYSFFPGTPVWPENRRDLTY  176

Query  349  GFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGR  522
             F         V      A + W           T F +AD+K   F G+HGDG PFDG 
Sbjct  177  AFVSENELSDTVKAVFVGAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEPFDGV  236

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSEHR  687
             G+ AHAF P  G  H DA+E+WV  G        + +D++SVA+HEIGHLLGL HS   
Sbjct  237  LGTLAHAFSPPSGRFHLDAEENWVITGDISKTSVTSAVDLESVAVHEIGHLLGLGHSSVE  296

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EA+M+       KK +L  DD+ GI++LY
Sbjct  297  EAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_010415694.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 154/281 (55%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRPGGEV---------VPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT      RR   EV         V  Y  +P EP+
Sbjct  105  TGELDAFTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRSRLHAVKRYTLFPGEPR  164

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRT-GFFNADLKFALFSG  489
            WP ++R LTY F P  P    V    A A   W +V    +F+R+  F  +D+    ++G
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTA-LNFTRSESFSTSDITIGFYTG  223

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEI  651
            +HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEI
Sbjct  224  DHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEI  283

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   E++M+     G +K DLT DD+ GI+ LY
Sbjct  284  GHLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_010414620.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=369

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 150/272 (55%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  + ++ +   D F D L+SAI  YQ   +L  
Sbjct  54   LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVDNCT---DDFDDVLQSAIDTYQKNFNLKV  110

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LD+ T RQ++KPRCG  D+I+G     GG        Y F+P +P+WP  KR LTY 
Sbjct  111  TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  170

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            F P      +     A A   W  V   F+F+R+     AD+    FSGEHGDG PFDG 
Sbjct  171  FVPQNNLTDEVKRVFARAFTRWSEVTP-FNFTRSESLVGADIVIGFFSGEHGDGEPFDGA  229

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D+DE W+           P  + +D++SV +HEIGHLLGL HS
Sbjct  230  MGTLAHASSPPTGMLHLDSDEDWLISDGGISRRILPVTSVVDLESVVVHEIGHLLGLGHS  289

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G++K +L  DDI GI+ LY
Sbjct  290  SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  321



>ref|XP_004159085.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/265 (42%), Positives = 154/265 (58%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSE--ADYFSDQLESAIRIYQTRHH  171
            L G +KGD V+G+ N+KKYL+ +GY++ ++S +S   E  ++ F D LESAI++YQ   H
Sbjct  33   LYGCRKGDNVEGIRNIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKWTH  92

Query  172  LNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANKRHL  342
            LN +G+LD +T  QM KPRCGV D+   N ++      E+  HY  +P  P+WP  KRHL
Sbjct  93   LNVSGVLDQETLDQMFKPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNPQWPDYKRHL  152

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFDG  519
            TY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG+PFDG
Sbjct  153  TYVFTNNFPIDFVPSVTEAMARWAG-QSLFTFSEASDAQSADINISFQIKDHADGLPFDG  211

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
             GG   HAF P  G  H D D+ W   G     +++ + ALHE+GH+LGL HS   +AVM
Sbjct  212  PGGIVGHAFAPTDGRLHLDGDDSW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVM  270

Query  700  WEEFEYGEKKRDLTADDINGIRALY  774
            W   E    K +L  DDI G+ ALY
Sbjct  271  WPYIESNALK-NLNDDDIAGLHALY  294



>gb|EYU34695.1| hypothetical protein MIMGU_mgv1a024051mg, partial [Erythranthe 
guttata]
Length=224

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 135/228 (59%), Gaps = 18/228 (8%)
 Frame = +1

Query  139  SAIRIYQTRHHLNSTGILDADTARQMMKPRCGVADIING--TRRRPGGE-----------  279
            SA++ YQ  +H+N TG LDA T  +M  PRCGV DII+G  T ++ G +           
Sbjct  1    SAVKTYQRNYHINPTGTLDATTVSKMTTPRCGVPDIIDGKNTMQKHGTKEHESNSSSKHI  60

Query  280  -VVPHYRFYPDEPKWPANKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFF  456
              V HY F+   P+WP +K HLTY F P TP   + PV+ A + W +   +F+FS     
Sbjct  61   HTVSHYSFFQGNPRWPPSKTHLTYRFLPNTPGAAVGPVSRAFQKWAS-STHFTFSLAQS-  118

Query  457  NADLKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSV  636
            +ADL      G+HGDG PFDGRGG+ AHAF P  G  H+DADE W   GP  +  D+++V
Sbjct  119  SADLVIGFHRGDHGDGNPFDGRGGTLAHAFAPTNGRFHYDADEQW-SVGPVQDAFDLETV  177

Query  637  ALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
            ALHEIGHLLGL HS    A+M+     G  K  L ADDI GIRALY+ 
Sbjct  178  ALHEIGHLLGLGHSSVEAAIMYSGIGAGVTK-GLHADDIQGIRALYNI  224



>ref|XP_006390919.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
 gb|ESQ28205.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
Length=383

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 151/285 (53%), Gaps = 30/285 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GL  +KKY + FGYI +     S +  D F D L+SA+ +YQ    LN 
Sbjct  47   FTGCHHGQNVDGLNRIKKYFQRFGYIPE---TFSGNFTDDFDDILKSAVELYQKNFRLNV  103

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR--------PGGE-----VVPHYRFY  303
            TG LDA T + ++ PRCG  D++NGT      RRR        PGG       V  Y  +
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSLMHGERRRKTFEVNFSPGGRRPRFHSVKRYTLF  163

Query  304  PDEPKWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFFNADLKFA  477
            P EP+WP+++R LTY F P  P    V    + A   W  V E        F  AD+   
Sbjct  164  PGEPRWPSDRRDLTYAFDPRNPLTEEVKSVFSRAFGRWSEVTELNFTKIESFSTADITIG  223

Query  478  LFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVA  639
             ++G+HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA
Sbjct  224  FYTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVA  283

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS   E++M+     G +K DLT DD+ GI+ LY
Sbjct  284  VHEIGHLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  328



>ref|XP_010553642.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=375

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 152/285 (53%), Gaps = 31/285 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GDRV GL  LK+Y + FGYI   +  ++ +  D F D LESAIRIYQ    L  
Sbjct  47   LAGCHAGDRVSGLSKLKQYFRRFGYI---TTAATGNFTDDFDDVLESAIRIYQKNFDLKV  103

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            TG LDA T RQ++ PRCG +D+I+G+     G+                   Y F+P +P
Sbjct  104  TGELDAATLRQIVLPRCGNSDVIDGSSDMNAGKGFQKTAMTAGAARIRTTKRYSFFPGKP  163

Query  316  KWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTG-FFNADLKFALFS  486
            +WPA KR L Y F P       V    + A   W NV     F+R+G    AD+    FS
Sbjct  164  RWPARKRDLIYAFVPQNNLTEDVKRVFSRAFDRWANVTP-LRFTRSGSLLRADIVIGFFS  222

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV---------EFGPPPNGLDIQSVA  639
            G+HGDG PFDG  G+ AHA  P  G  H D DE W+               + +D++SVA
Sbjct  223  GDHGDGEPFDGAMGTLAHASSPPTGMFHLDGDEDWLISDGGGENRRILSVTSLVDLESVA  282

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS  ++A+M+     G++K +L  DDI GI+ LY
Sbjct  283  VHEIGHLLGLGHSSVKDAIMYPTIAGGDRKVELAKDDIEGIQHLY  327



>gb|KGN51345.1| hypothetical protein Csa_5G522910 [Cucumis sativus]
Length=295

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 151/268 (56%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N+S         ++ F D LESAI++YQ 
Sbjct  33   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNTSIDSHIIELNSNKFDDSLESAIKLYQK  89

Query  163  RHHLNSTGILDADTARQMMKPRCGVADIINGTRRR---PGGEVVPHYRFYPDEPKWPANK  333
              HLN +GILD +T  QM KPRCGV D+      +      E+  HY  +P   KWP  K
Sbjct  90   WSHLNVSGILDQETLDQMFKPRCGVRDVFKFNSNKNLEDDLEMSSHYTLFPGNLKWPDYK  149

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVP  510
            RHLTY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG+P
Sbjct  150  RHLTYVFTNNFPVDFVPSVTEAMARW-AAQSLFTFSEASDAQSADINISFQIKDHADGLP  208

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG   HAF P  G  H D D+ W   G     +++ +VALHE+GH+LGL HS   +
Sbjct  209  FDGPGGVVGHAFAPTDGRLHLDGDDTW-SAGMEVQKVNVMNVALHELGHVLGLAHSTLPQ  267

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVMW   +    K +L  DDI G+ ALY
Sbjct  268  AVMWPYIDSNALK-NLNDDDIAGLHALY  294



>ref|XP_003519796.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 146/275 (53%), Gaps = 18/275 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G + G    GL NLK Y + FGYI+  + + SS+  D F D LE+AI+ YQ   +LN 
Sbjct  58   FTGCRPGKTYNGLSNLKNYFQYFGYISK-ALSKSSNFTDDFDDALEAAIKAYQKNFNLNI  116

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPAN  330
            TG LD  T  Q++KPRCGVADIINGT     G+           V HY F+  +P+WP  
Sbjct  117  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKSNTTDSPKFHSVAHYSFFDGQPRWPEG  176

Query  331  KRHLTYGFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
             + LTY F P      +       A   W  V        + +  AD++   + G+HGDG
Sbjct  177  TQELTYAFDPDNALDDVSKTVFGNAFSRWSEVTTISFRETSSYAAADIRIGFYGGDHGDG  236

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGL  669
             PFDG  G+ AHAF P  G  H D+ E WV  G        N +D++SVA+HEIGHLLGL
Sbjct  237  EPFDGVLGTLAHAFSPTNGRFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLLGL  296

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             HS   +A+M+       +K +L  DDI GI+ LY
Sbjct  297  GHSSVEDAIMYPTITARTRKVELNEDDILGIQVLY  331



>ref|XP_002319607.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
 gb|EEE95530.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
Length=312

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 151/274 (55%), Gaps = 18/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G +KG  VKGL  LK +LK  GY     +      +D F +  ESA++ YQ  + L  
Sbjct  39   LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLKV  97

Query  181  TGILDADTARQMMKPRCGVADIIN--GTRRRPGG----------EVVPHYRFYPDEPKWP  324
            TG LD+DT +++M PRCGV D IN   T ++ G             V HY F+   P+WP
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHVDTSKQAGRTEHDSKSSKFHTVSHYSFFGGTPRWP  157

Query  325  ANKRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGE  492
            ++K HLTY F+         +     + A + W +V ++     +    AD+     SG+
Sbjct  158  SSKFHLTYTFSSSVQVIDMQELRSACSRAFQKWADVTQFTFQEASEGSQADIVIGFQSGD  217

Query  493  HGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLD  672
            HGD  PFDG G   AHAF P  G  H+DADE W    P  + +D++SVA+HEIGHLLGLD
Sbjct  218  HGDRYPFDGPGRILAHAFAPTDGRFHYDADEKWST-NPSADEVDLESVAVHEIGHLLGLD  276

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS  + ++M+ E   G  KRDL  DDI GIRALY
Sbjct  277  HSMDQNSIMFAEIPQGTIKRDLGQDDIAGIRALY  310



>gb|EYU22461.1| hypothetical protein MIMGU_mgv1a008611mg [Erythranthe guttata]
Length=368

 Score =   196 bits (497),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 154/271 (57%), Gaps = 17/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G +KG +  GL  LKKY + FGY+N    NS S  +D F + LESA+R YQ   +LN+
Sbjct  51   LAGCQKGRKADGLAKLKKYFQYFGYLN----NSYSDYSDDFDELLESAVRNYQLNFNLNA  106

Query  181  TGILDADTARQMMKPRCGVADIINGT---RRR---PGGEVVPHYRFYPDEPKWPANKRHL  342
            TG LDA T   +++PRCG  D +NGT   RRR        V HY F+PD P+WPA K  L
Sbjct  107  TGKLDAPTLDHIVRPRCGNPDFVNGTSTMRRRDDHATIHTVAHYSFFPDRPRWPARKTQL  166

Query  343  TYGFAPGTPSKFIV--PVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFD  516
            TY FAP      +V    A A + W             +  AD++   F G+HGDG PFD
Sbjct  167  TYAFAPENQLSAVVRGVFARAFERWSEATTLTFVETASYGRADIRIGFFGGDHGDGEPFD  226

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWV---EF--GPPPNGLDIQSVALHEIGHLLGLDHSE  681
            G  G+ AHAF P  G  H D DE+WV    F  G P   +D++SVA+HEIGH+LGL HS 
Sbjct  227  GVLGTLAHAFAPPNGRFHLDGDENWVIDGNFLNGAPRTAVDLESVAVHEIGHVLGLGHST  286

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
              EA+M+     G +K +L  DD+ GI+ LY
Sbjct  287  VEEAIMYPTISSGTRKVELANDDVLGIQELY  317



>ref|XP_004297678.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=373

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 149/276 (54%), Gaps = 29/276 (11%)
 Frame = +1

Query  10   SKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGI  189
             + G++V GL  LKKY   FGYI +L  N +    D F D+L+SA++ YQ   +LN TG 
Sbjct  57   CRPGEKVDGLAKLKKYFNYFGYIPNLPTNCT----DEFDDELQSALKTYQKNFNLNVTGE  112

Query  190  LDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPANKRH  339
            LD  T   +++PRCG  DI+NGT     G+           V HY F+P  P WP  +R 
Sbjct  113  LDDQTINHLVRPRCGNPDIVNGTTTMHSGKPVTFNNSKLHTVGHYSFFPGTPVWPTGRRD  172

Query  340  LTYGFAPGT------PSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGD  501
            LT+ F P         S F+     A + W  V        T +++AD+K   + G+HGD
Sbjct  173  LTFAFLPDNELSDEAKSVFV----GAFQKWSTVIPMTFTETTSYYSADIKIGFYVGDHGD  228

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLG  666
            G  FDG  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLLG
Sbjct  229  GEAFDGVLGTLAHAFSPPSGLFHLDGDENWVIGGDISTSTVTSAIDLESVAVHEIGHLLG  288

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   E++M+       KK DL  DD+ GI++LY
Sbjct  289  LGHSSVEESIMYPTITSKTKKVDLANDDVEGIQSLY  324



>gb|EYU46220.1| hypothetical protein MIMGU_mgv1a010241mg [Erythranthe guttata]
Length=318

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/266 (43%), Positives = 148/266 (56%), Gaps = 11/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND---LSYNSSSSEADYFSDQLESAIRIYQTRHH  171
            L G++KG+  KGL +LK YL   GY+N    ++  S     D F + LE A+R YQ+   
Sbjct  54   LVGTRKGNTAKGLSHLKGYLSNLGYMNIDSIIAKPSPEQNNDSFDENLELAVRAYQSFFK  113

Query  172  LNSTGILDADTARQMMKPRCGVAD---IINGTRRRPGGEVVP-HYRFYPDEPKWPANKRH  339
            L  TG+LDA T  QMM+PRCGVAD   ++N T       V+  HY F+P +P W   K  
Sbjct  114  LKVTGVLDAATVNQMMQPRCGVADNFSVLNQTHLMTESPVIAKHYTFFPGKPVWWPGKTD  173

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFD  516
            LTY F  G        +  A   W+N    F F+    ++ AD+K +    +HGD  PFD
Sbjct  174  LTYSFPAGASYDLDEGIFEATGLWNN-NSIFKFAYIKDYDKADVKISFQVWDHGDRAPFD  232

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            G GG  AHAF P  G  HFD  E WV+ G      D+QSV LHE+GH+LGL HS    AV
Sbjct  233  GPGGVLAHAFAPTDGRLHFDGSEKWVD-GVKDGAFDVQSVGLHELGHILGLGHSADANAV  291

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            MW  F+  ++K  L  DDI+GI+ALY
Sbjct  292  MWPTFQTKQRK-GLGQDDIDGIKALY  316



>ref|XP_011002109.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=372

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 151/277 (55%), Gaps = 26/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G +  GL  LK Y + FGYI     NS S+  D F D LESA+R YQ   +LN 
Sbjct  55   LAGCHAGKKYDGLAKLKNYFQYFGYIP----NSLSNFTDDFDDNLESALRTYQQNFNLNV  110

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV-----------VPHYRFYPDEPKWPA  327
            TG LD  T   +++PRCG  DIING+     G+            V HY F+  +P+W  
Sbjct  111  TGQLDDQTVNHIVRPRCGNPDIINGSTSMNSGKTNNTSSSHHFHTVSHYSFFTGQPRW--  168

Query  328  NKRHLTYGFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHG  498
             K+ LTY F P      +     + A   W  V    +FS+T   + AD++ A FSG+HG
Sbjct  169  RKQALTYVFLPENQLSDEVKAVFSRAFDRWSTVIP-LNFSQTDSIYTADIRIAFFSGDHG  227

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLL  663
            DG PFDG  G+ AHAF P+ G  H D DEHWV  G        + +D++SVA+HEIGHLL
Sbjct  228  DGEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTGDVRTSALTSAVDLESVAVHEIGHLL  287

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS   E++M+       +K +L +DDI GI+ LY
Sbjct  288  GLGHSSVEESIMYPSISSRTRKVELASDDIEGIQTLY  324



>ref|XP_004159086.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 152/266 (57%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS----EADYFSDQLESAIRIYQTRH  168
            L G +KGD V+G++N+KKYL+ +GY   LS+N+ S      ++ F D LESAI++YQ   
Sbjct  33   LYGCRKGDNVEGIHNIKKYLQRYGY---LSHNTDSHIIELNSNKFDDSLESAIKLYQKWS  89

Query  169  HLNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANKRH  339
            HLN +GILD +T  QM +PRCGV D+   N ++      E+  HY  +P   KWP  KRH
Sbjct  90   HLNVSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRH  149

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFD  516
            LTY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG+PFD
Sbjct  150  LTYVFTNNFPINFVPSVTEAMARW-AAHSLFTFSEASDAQSADINISFQIKDHADGMPFD  208

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            G GG   HAF P  G  H D D+ W   G     +++ + ALHE+GH+LGL HS   +AV
Sbjct  209  GPGGVVGHAFAPIDGRLHLDGDDSW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQAV  267

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            MW   E    K ++  DDI G+ ALY
Sbjct  268  MWPYIESNALK-NMNDDDIAGLHALY  292



>ref|NP_001235535.1| metalloendoproteinase 1 precursor [Glycine max]
 sp|P29136.2|MEP1_SOYBN RecName: Full=Metalloendoproteinase 1; AltName: Full=SMEP1; Flags: 
Precursor [Glycine max]
 gb|AAB26959.1| metalloproteinase [Glycine max]
Length=305

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 137/259 (53%), Gaps = 12/259 (5%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            G   KGL N+K Y    GYI +  +       D F D L SAI+ YQ  ++LN TG  D 
Sbjct  48   GQNYKGLSNVKNYFHHLGYIPNAPHFD-----DNFDDTLVSAIKTYQKNYNLNVTGKFDI  102

Query  199  DTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAPG--TPS  372
            +T +Q+M PRCGV DII  T +     ++  Y F+ D P+W A    LTY F+P      
Sbjct  103  NTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEPRLDD  162

Query  373  KFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGSYAHAFPP  552
             F   +A A   W  V        T +  A++K    S  HGD  PFDG GG   HAF P
Sbjct  163  TFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGHAFAP  222

Query  553  EYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
              G CHFDADE+WV  G     P  +  D++SVA+HEIGHLLGL HS    A+M+     
Sbjct  223  TDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPP  282

Query  718  GEKKRDLTADDINGIRALY  774
              +K +L  DDI+GIR LY
Sbjct  283  RTRKVNLAQDDIDGIRKLY  301



>ref|XP_002888162.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 148/272 (54%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+ + GL  LK+Y + FGYI       +++  D F D L+SAI  YQ   +L  
Sbjct  37   LAGCHIGENINGLSKLKQYFRRFGYIT-----GTNNCTDDFDDVLQSAINTYQKNFNLKV  91

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LD+ T RQ++KPRCG  D+I+G     GG+       Y F+P +P+WP  KR LTY 
Sbjct  92   TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGKKLRATERYSFFPGKPRWPKRKRDLTYA  151

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            + P      +     A A   W  V    +F+R+     AD+    FSGEHGDG PFDG 
Sbjct  152  YVPQNNLTDEVKRVFARAFTRWAEVTP-LNFTRSESLLGADIVIGFFSGEHGDGEPFDGA  210

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D DE W+           P  + +D++SVA+HEIGHLLGL HS
Sbjct  211  MGTLAHASSPPTGMLHLDGDEDWLISDGEISRRVLPVTSVVDLESVAVHEIGHLLGLGHS  270

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G++K +L  DDI GI+ LY
Sbjct  271  SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  302



>ref|XP_004142459.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 152/266 (57%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS----EADYFSDQLESAIRIYQTRH  168
            L G +KGD V+G++N+KKYL+ +GY   LS+N+ S      ++ F D LESAI++YQ   
Sbjct  33   LYGCRKGDNVEGIHNIKKYLQRYGY---LSHNTDSHIIELNSNKFDDSLESAIKLYQKWS  89

Query  169  HLNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANKRH  339
            HLN +GILD +T  QM +PRCGV D+   N ++      E+  HY  +P   KWP  KRH
Sbjct  90   HLNVSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRH  149

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFD  516
            LTY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG+PFD
Sbjct  150  LTYVFTNNFPINFVPSVTEAMARW-AAHSLFTFSEASDAQSADINISFQIKDHADGMPFD  208

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            G GG   HAF P  G  H D D+ W   G     +++ + ALHE+GH+LGL HS   +AV
Sbjct  209  GPGGVVGHAFAPIDGRLHLDGDDSW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQAV  267

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            MW   +    K +L  DDI G+ ALY
Sbjct  268  MWPYIDSNALK-NLNDDDIAGLHALY  292



>gb|AES96374.2| matrix metalloproteinase [Medicago truncatula]
Length=368

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 143/278 (51%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G  +G    GL  LK Y   FGYI +      S+  D F + LESA+R YQ   +LN 
Sbjct  55   FTGCSRGKTYDGLSKLKNYFNHFGYIPN---GPPSNFTDDFDEALESAVRTYQKNFNLNI  111

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG LD  T   ++KPRCGVADIINGT     G+          V HY F+P +P+WP   
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  334  RHLTYGFAP------GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            + LTY F P       T   F    A A   W  V        T + ++D+K   +SG+H
Sbjct  172  QTLTYAFDPSENLDDATKQVF----ANAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDH  227

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHL  660
            GDG  FDG  G+ AHAF P  G  H D  E WV  G        N +D++SV +HEIGHL
Sbjct  228  GDGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGHL  287

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EA+M+       KK +L +DDI GI+ LY
Sbjct  288  LGLGHSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_002311051.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
 gb|EEE88418.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
Length=295

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 148/269 (55%), Gaps = 25/269 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L  S+KG  V  L+ +K+YLK FGY++ DLS           +D+LESAIR YQ   HL 
Sbjct  39   LVESQKGQSVSKLHLVKQYLKKFGYLDYDLS-----------NDRLESAIRTYQQNFHLE  87

Query  178  STGILDADTARQMMKPRCGVADIINGTR-----RRPGGEVVPHYRFYPDEPKWPANKRHL  342
             TG LD  T  QMMKPRCGVADI N T+     +   G     Y F+P  P+W +  +HL
Sbjct  88   VTGRLDKRTVNQMMKPRCGVADIFNSTKHHNSSKSSDGVANADYSFFPGAPRWSS--KHL  145

Query  343  TYGFAPGTPSKFIVPVATALKA----WHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
             Y F           + +  K     W  V ++         +AD+K A +  +HGD  P
Sbjct  146  KYTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEP  205

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSE-HR  687
            FDG GG +AH F P  G  HFDADE W    P    LD++SVA+HEIGHL  L HSE H 
Sbjct  206  FDGPGGIFAHGFRPTIGMLHFDADETWSS-NPGSLELDLESVAVHEIGHLPELGHSEDHP  264

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +A+M+  F+YG+ KR L  DDI GIR LY
Sbjct  265  DAIMYPYFDYGKTKRSLQEDDIEGIRDLY  293



>ref|XP_007219827.1| hypothetical protein PRUPE_ppa026649mg, partial [Prunus persica]
 gb|EMJ21026.1| hypothetical protein PRUPE_ppa026649mg, partial [Prunus persica]
Length=344

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 150/267 (56%), Gaps = 22/267 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG  V GL  LKKYL  FGY+N D S +++  E   F D LESAI+ YQ  +HL 
Sbjct  89   LEGCHKGQNVSGLQELKKYLTKFGYLNYDHSKHANDEE---FDDILESAIKSYQKSYHLK  145

Query  178  STGILDADTARQMMKPRCGVADIINGTR--------RRPGGEVVPHYRFYPDEPKWPANK  333
             TG LD  T +QMM PRCGV D++NGTR        +      V HY F+P   +W  +K
Sbjct  146  VTGTLDTTTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHGVAHYEFFPGPRRW--SK  203

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPF  513
             HLTY F     S  +  V      W  V  +          AD+      G HGDG  F
Sbjct  204  THLTYRF-----SSSVNQVPGTQNRWAQVTSFTFEEVPATSAADITIGFHRGNHGDGSAF  258

Query  514  DGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHS-EHRE  690
            DG  G++AHA PP  G+ H+DADE W    P PN +D++SVA+HEIGHLLGL+H+ +  +
Sbjct  259  DGPRGTFAHANPPRGGNFHYDADERWSS-NPGPNEVDLESVAVHEIGHLLGLNHNPDLPD  317

Query  691  AVMWEEFEYGEKKRDLTADDINGIRAL  771
            A+M+  F YG  KR+L  DD NG+  L
Sbjct  318  AIMYPYFNYGSIKRNLHRDD-NGMLTL  343



>ref|XP_010471013.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 153/281 (54%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRPGGEV---------VPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT      RR   EV         V  Y  +P EP+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRT-GFFNADLKFALFSG  489
            W  ++R LTY F P  P    V    A A   W +V    +F+R+  F  +D+    ++G
Sbjct  165  WRKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTA-LNFTRSESFSTSDITIGFYTG  223

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEI  651
            +HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEI
Sbjct  224  DHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEI  283

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   E++M+     G +K DLT DD+ GI+ LY
Sbjct  284  GHLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_010512095.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=378

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 114/281 (41%), Positives = 153/281 (54%), Gaps = 27/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G  V GLY +KKY + FGYI +     S +  D F D L++A+ +YQ    L  
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLKV  104

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRPGGEV---------VPHYRFYPDEPK  318
            TG LDA T + ++ PRCG  D++NGT      RR   EV         V  Y  +P EP+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  319  WPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRT-GFFNADLKFALFSG  489
            WP ++R LTY F P  P    V    A A   W +V    +F+R+  F  +D+    ++G
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTA-LNFTRSESFSTSDITIGFYTG  223

Query  490  EHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV------EFGPPPNGLDIQSVALHEI  651
            +HGDG PFDG  G+ AHAF P  G  H DADE+WV       F      +D++SVA+HEI
Sbjct  224  DHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEI  283

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS   +++M+     G +K DLT DD+ GI+ LY
Sbjct  284  GHLLGLGHSSVEDSIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_003613416.1| Matrix metalloproteinase-9 [Medicago truncatula]
Length=393

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 143/278 (51%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G  +G    GL  LK Y   FGYI +      S+  D F + LESA+R YQ   +LN 
Sbjct  55   FTGCSRGKTYDGLSKLKNYFNHFGYIPN---GPPSNFTDDFDEALESAVRTYQKNFNLNI  111

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG LD  T   ++KPRCGVADIINGT     G+          V HY F+P +P+WP   
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  334  RHLTYGFAP------GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEH  495
            + LTY F P       T   F    A A   W  V        T + ++D+K   +SG+H
Sbjct  172  QTLTYAFDPSENLDDATKQVF----ANAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDH  227

Query  496  GDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHL  660
            GDG  FDG  G+ AHAF P  G  H D  E WV  G        N +D++SV +HEIGHL
Sbjct  228  GDGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGHL  287

Query  661  LGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            LGL HS   EA+M+       KK +L +DDI GI+ LY
Sbjct  288  LGLGHSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_008458912.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 149/269 (55%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ + N+ S++A  F D LESAI+ YQ    + 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENENNLSTDA--FDDDLESAIKSYQKFSKIK  97

Query  178  STGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPA  327
             +G+LD +T +QM  PRCGV D              T    GG    HY FY +  KWPA
Sbjct  98   VSGVLDRETLQQMSTPRCGVRDTFVSVAQQEHENKSTNIEIGGS---HYTFYYNNVKWPA  154

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
             K+HL+YGF    P + +  V  A + W +  ++  F       AD+  +   GEHGD  
Sbjct  155  EKKHLSYGFIHNFPPQHVPTVLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGEHGDDE  214

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
            PFDG GG  AH+     G  HFDADE W E GP     D++++ALHE+GH LGL HS   
Sbjct  215  PFDGPGGILAHSLGAVDGRVHFDADEQW-EGGPVEKRYDLETLALHELGHALGLGHSSSS  273

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             AVMW     G  K  LT DDI GIRALY
Sbjct  274  LAVMWAYMYAGFPKTRLTIDDIEGIRALY  302



>gb|KCW56124.1| hypothetical protein EUGRSUZ_I01878 [Eucalyptus grandis]
Length=294

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 146/269 (54%), Gaps = 12/269 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG   +G+  +K+YL+ FGY   +   N  +   D F + LESA++ YQ  +HL 
Sbjct  25   LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  84

Query  178  STGILDADTARQMMKPRCGVADIIN------GTRRRPGGEVVPHYRFYPDEPKWPANKRH  339
             TG LDADT  QM  PRCGV D ++         +     +V  Y F+P++P+WP  K H
Sbjct  85   VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  144

Query  340  LTYGFAP---GTPSKFIVPVAT-ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
            L Y F P     P + +  V + A + W +V  +     +     DL    + G+HGDG 
Sbjct  145  LNYAFGPVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGDGY  204

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
            PFDG G   AH+F P  G  H+D +E W    P     D++SV LHEIGHLLGL H+  +
Sbjct  205  PFDGPGKILAHSFSPTDGRFHYDVEEQW-STNPSSTQFDLESVTLHEIGHLLGLAHTPDQ  263

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             AVM+     G +KRDL  DDI+GI ALY
Sbjct  264  NAVMFATISPGAQKRDLRQDDIDGIHALY  292



>gb|KHN28682.1| Metalloendoproteinase 1 [Glycine soja]
Length=400

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 148/266 (56%), Gaps = 16/266 (6%)
 Frame = +1

Query  16   KGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILD  195
            +G   KGL N+K Y    GYI +    ++    D F D L SAI+ +Q  ++L+ TG LD
Sbjct  47   RGHNYKGLSNVKNYFHHLGYIPN---PNAPPLDDKFDDTLVSAIKTFQKNYNLDITGKLD  103

Query  196  ADTARQMMKPRCGVADIINGTRRRPGGEV----VPHYRFYPDEPKWPANKRHLTYGFAP-  360
             +T RQ+  PRCGV DIIN        ++    V HY F+   P+WPA  R LTY F+P 
Sbjct  104  NNTLRQLTTPRCGVPDIINTNTTTQHTQLHIHTVSHYSFFNGAPRWPAGTRQLTYAFSPE  163

Query  361  -GTPSKFIVPVATALKAWHNVGE--YFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGS  531
                S      A A   W  V    ++  + + +  A++K A  SG+H DG+PFDG  G 
Sbjct  164  LNLNSAAKSLFARAFNRWTQVVNIAFYEIASSSYQTANIKIAFLSGDHNDGLPFDGPLGE  223

Query  532  YAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            + HAF P  G CHFDADE+WV  G     P    +D++S+A+HEIGHLLGL HS  + A+
Sbjct  224  WTHAFAPTNGWCHFDADEYWVASGDVTQSPVARAVDLESIAVHEIGHLLGLHHSSDQRAI  283

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            M+       +K +L  DDINGIR LY
Sbjct  284  MYAYLPPRTRKVNLAQDDINGIRHLY  309



>ref|XP_002322292.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
 gb|EEF06419.2| hypothetical protein POPTR_0015s11510g [Populus trichocarpa]
Length=375

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 150/277 (54%), Gaps = 26/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G +  GL  LK Y + FGYI     NS S+  D F D LESA+R YQ   +LN 
Sbjct  58   LAGCHAGKKYDGLAKLKHYFQYFGYIP----NSLSNFTDDFDDYLESALRTYQQNFNLNV  113

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV-----------VPHYRFYPDEPKWPA  327
            TG LD  T   +++PRCG  DIING+     G+            V HY F+  +P+W  
Sbjct  114  TGELDDQTVNHVVRPRCGNPDIINGSTSMNSGKTNNTSSSHHLHTVSHYSFFTGQPRW--  171

Query  328  NKRHLTYGFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHG  498
             K+ LTY F+P      +     + A   W  V    +FS+T   + AD++ A FSG+HG
Sbjct  172  RKQALTYVFSPENQLSDEVKAVFSRAFDRWSTVIP-LNFSQTDSIYTADIRIAFFSGDHG  230

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHW-----VEFGPPPNGLDIQSVALHEIGHLL  663
            DG PFDG  G+ AHAF P+ G  H D DEHW     V      + +D++SVA+HEIGHLL
Sbjct  231  DGEPFDGVLGTLAHAFSPQNGRLHLDDDEHWVVTDDVRTSTLTSAVDLESVAVHEIGHLL  290

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS   E++M+       +K +L  DDI GI+ LY
Sbjct  291  GLGHSSVEESIMYPSISSRTRKVELATDDIEGIQTLY  327



>ref|NP_173824.2| putative metalloproteinase [Arabidopsis thaliana]
 gb|AAU90055.1| At1g24140 [Arabidopsis thaliana]
 gb|AEE30482.1| putative metalloproteinase [Arabidopsis thaliana]
Length=384

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 150/283 (53%), Gaps = 28/283 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G +  GLY LK+Y + FGYI +   N S +  D F D L++A+ +YQ    LN 
Sbjct  49   FTGCHAGKKYDGLYMLKQYFQHFGYITET--NLSGNFTDDFDDILKNAVEMYQRNFQLNV  106

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            TG+LD  T + ++ PRCG  D++NGT     G                 V HY F+P EP
Sbjct  107  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  166

Query  316  KWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTG-FFNADLKFALFS  486
            +WP N+R LTY F P      +     + A   W  V    +F+R   F  +D+    +S
Sbjct  167  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTP-LTFTRVERFSTSDISIGFYS  225

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSVALH  645
            GEHGDG PFDG   + AHAF P  G  H D +E+W+  G   +G       +D++SVA+H
Sbjct  226  GEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVH  285

Query  646  EIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EIGHLLGL HS    ++M+     G +K DLT DD+ G++ LY
Sbjct  286  EIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>ref|XP_008458915.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=303

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 151/268 (56%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ + N+ S++A  F D LESAI+ YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENDNNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTARQMMKPRCGVADII---------NGTRRRPGGEVVPHYRFYPDEPKWPAN  330
             +G+LD  T   M K RCGV D             T    GG    HY FY +   WPA 
Sbjct  98   VSGVLDRKTLEHMYKFRCGVKDTFVSAAQEHENKNTNIEIGGS---HYTFYFNNVSWPAE  154

Query  331  KRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            ++HL+YGF    P +FI P+  A + W +  ++  F  +    AD+  +   GEHGD  P
Sbjct  155  RKHLSYGFIHNYPPQFIDPLVRAFQTWEDNTKFSFFLASRVQTADILVSFERGEHGDIDP  214

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG+ AH+     G  HFDADE W E  P    +D++SVALHE+GH LGL HS    
Sbjct  215  FDGPGGTLAHSLGAIDGRVHFDADEQW-EGEPSEERIDLESVALHELGHTLGLGHSSDPS  273

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVM+   E    K  LT+DDI GIRALY
Sbjct  274  AVMFAYMEPDTYKTTLTSDDIEGIRALY  301



>ref|XP_004142460.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=294

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 153/265 (58%), Gaps = 10/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSE--ADYFSDQLESAIRIYQTRHH  171
            L G +KGD V+G++++KKYL+ +GY++ ++S +S   E  ++ F D LESAI++YQ   H
Sbjct  32   LYGCRKGDNVEGIHSIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKWSH  91

Query  172  LNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANKRHL  342
            LN +GILD +T  QM + RCG+ D+   N ++      E+  HY  +P+  KWP  KRHL
Sbjct  92   LNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNEKWPDYKRHL  151

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVPFDG  519
            TY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG  FDG
Sbjct  152  TYMFTNNFPVDFVPSVTEAMARW-AAQSLFTFSEASDAQSADINISFQVKDHADGSAFDG  210

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
             GG   HAF P  G  H D D+ W   G   N  ++ +VALHE+GH+LGL HS   +AVM
Sbjct  211  PGGVVGHAFAPTDGRLHLDGDDSW-SAGLEENKFNVMNVALHELGHVLGLAHSTLPQAVM  269

Query  700  WEEFEYGEKKRDLTADDINGIRALY  774
            W   +    K +L  DDI G+ ALY
Sbjct  270  WPYIDSNALK-NLNDDDIAGLHALY  293



>ref|XP_010552627.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=376

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 154/282 (55%), Gaps = 28/282 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G + GD+V GLY LK+Y + FGYI +   N S +  D F D L  AI +YQ    LN 
Sbjct  49   FTGCRSGDKVDGLYKLKQYFQRFGYIPE---NFSGNFTDDFDDILRHAIEMYQRNFRLNV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            +G LD  T R ++ PRCG  DI+NG+    GG+                +  Y  +P EP
Sbjct  106  SGELDELTVRHLVIPRCGNPDIVNGSSAMHGGKKYEVNFAGRRGQRFHALKRYSLFPGEP  165

Query  316  KWPANKRHLTYGFAPGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFF-NADLKFALFS  486
            +WP ++R LTY F P       V      A   W  V +  +F+R   F ++D+    ++
Sbjct  166  RWPEDRRQLTYAFDPRNALTEEVKGVFGRAFARWAAVTK-LTFTRVETFPDSDITIGFYT  224

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG------PPPNGLDIQSVALHE  648
            G+HGDG PFDG  G+ AHAF P  G  H D+DE+WV  G         + +D++SVA+HE
Sbjct  225  GDHGDGEPFDGVLGTLAHAFSPPSGRFHLDSDENWVVSGDVGGILSMTSAVDLESVAVHE  284

Query  649  IGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            IGHLLGL HS   +++M+     G +K +LT DDI+GI+ LY
Sbjct  285  IGHLLGLGHSTIEDSIMYPTISTGRRKVELTRDDIDGIQYLY  326



>ref|XP_010030761.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=311

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 147/270 (54%), Gaps = 14/270 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+G  KG   +G+  +K+YL+ FGY   +   N  +   D F + LESA++ YQ  +HL 
Sbjct  42   LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  101

Query  178  STGILDADTARQMMKPRCGVADII-------NGTRRRPGGEVVPHYRFYPDEPKWPANKR  336
             TG LDADT  QM  PRCGV D +       N T+      +V  Y F+P++P+WP  K 
Sbjct  102  VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPS-KLRIVARYNFFPNKPRWPPTKT  160

Query  337  HLTYGFAP---GTPSKFIVPVAT-ALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDG  504
            HL Y F P     P + +  V + A + W +V  +     +     DL    + G+HGDG
Sbjct  161  HLNYAFGPVPAAIPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHGDG  220

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEH  684
             PFDG G   AH+F P  G  H+D +E W    P     D++SV LHEIGHLLGL H+  
Sbjct  221  YPFDGPGKILAHSFSPTDGRFHYDVEEQW-STNPSSTQFDLESVTLHEIGHLLGLAHTPD  279

Query  685  REAVMWEEFEYGEKKRDLTADDINGIRALY  774
            + AVM+     G +KRDL  DDI+GI ALY
Sbjct  280  QNAVMFATISPGAQKRDLRQDDIDGIHALY  309



>gb|AAC00572.1| similar to zinc metalloproteinases [Arabidopsis thaliana]
Length=377

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 150/283 (53%), Gaps = 28/283 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G +  GLY LK+Y + FGYI +   N S +  D F D L++A+ +YQ    LN 
Sbjct  42   FTGCHAGKKYDGLYMLKQYFQHFGYITET--NLSGNFTDDFDDILKNAVEMYQRNFQLNV  99

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            TG+LD  T + ++ PRCG  D++NGT     G                 V HY F+P EP
Sbjct  100  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  159

Query  316  KWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTG-FFNADLKFALFS  486
            +WP N+R LTY F P      +     + A   W  V    +F+R   F  +D+    +S
Sbjct  160  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTP-LTFTRVERFSTSDISIGFYS  218

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSVALH  645
            GEHGDG PFDG   + AHAF P  G  H D +E+W+  G   +G       +D++SVA+H
Sbjct  219  GEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVH  278

Query  646  EIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EIGHLLGL HS    ++M+     G +K DLT DD+ G++ LY
Sbjct  279  EIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  321



>gb|ACU20327.1| unknown [Glycine max]
Length=305

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 136/259 (53%), Gaps = 12/259 (5%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTGILDA  198
            G   KGL N+K Y    GYI +  +       D F D L SAI+ YQ  ++LN TG  D 
Sbjct  48   GQNYKGLSNVKNYFHHLGYIPNAPHFD-----DNFDDTLVSAIKTYQKNYNLNVTGKFDI  102

Query  199  DTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAPG--TPS  372
            +T +Q+M PRCGV DII  T +     ++  Y F+ D P+W A    LTY F+P      
Sbjct  103  NTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEPRLDD  162

Query  373  KFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGSYAHAFPP  552
             F   +A A   W  V        T +  A++K    S  HGD  PFDG GG   HAF P
Sbjct  163  TFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGHAFAP  222

Query  553  EYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFEY  717
              G CHFDADE+WV  G     P  +  D++SVA+HEIGHLLGL HS    A+M+     
Sbjct  223  TDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPP  282

Query  718  GEKKRDLTADDINGIRALY  774
              +K +L  D I+GIR LY
Sbjct  283  RTRKVNLAQDGIDGIRKLY  301



>gb|KCW85819.1| hypothetical protein EUGRSUZ_B02562 [Eucalyptus grandis]
Length=374

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 145/277 (52%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G+R  GL NLKKY + FGYI +   N +    D F D L SAI+ YQ   +L  
Sbjct  55   FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  110

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV----------VPHYRFYPDEPKWPAN  330
            TG LD  T  Q+++PRCG  DI+NG+     G+           V HY F+P  P+WP  
Sbjct  111  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  170

Query  331  KRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
            K  LTY F P        K +   + A + W  V      +   +  AD+K   FSG+HG
Sbjct  171  KSDLTYAFLPANQLSDDEKAVF--SRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHG  228

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLL  663
            DG  FDG  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLL
Sbjct  229  DGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHLL  288

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS   E++M+       KK DL  DD+ GI+ LY
Sbjct  289  GLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  325



>ref|XP_007157519.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
 gb|ESW29513.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
Length=377

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 143/275 (52%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G + G    GL NLK Y   FGYI        S+  D F D LE+A++ YQ   +LN 
Sbjct  60   FTGCRHGKAYDGLSNLKNYFHYFGYI---PTAPPSNFTDDFDDALEAAVKAYQKNFNLNI  116

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------VVPHYRFYPDEPKWPANK  333
            TG LD  T +Q+++PRCGVAD+INGT    G            V HY F+   P+WP   
Sbjct  117  TGELDDATMQQIVRPRCGVADVINGTTTMNGKSNTTTTPKFHTVAHYSFFDGMPRWPQGT  176

Query  334  RHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDG  504
              LTY F P  G         + A K W  V    SFS  + +  AD+    +SG+HGDG
Sbjct  177  EELTYAFEPDNGLDDTVKGVFSNAFKRWAEVTT-ISFSEASSYAVADITIGFYSGDHGDG  235

Query  505  VPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGL  669
             PFDG  G+ AHAF P  G  H D  E WV  G        N +D++SVA+HEIGHLLGL
Sbjct  236  EPFDGVLGTLAHAFSPTNGMFHLDEAEDWVATGDVTEASMSNAVDLESVAVHEIGHLLGL  295

Query  670  DHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             HS   EA+M+       +K +L  DDI GI+ LY
Sbjct  296  GHSSIEEAIMYPTISAKTRKVELAEDDIEGIQVLY  330



>ref|XP_008458914.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 151/269 (56%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY N+ + N+ S++A  F D+LESAI++YQ   +L 
Sbjct  40   LIGSSKNDNIVEGIHKVKAYLQRYGYFNNENDNNLSTDA--FDDRLESAIKLYQKFSNLK  97

Query  178  STGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPA  327
             +G+LD +T +QM KPRCGV D              T    GG     Y F+ +   WPA
Sbjct  98   VSGVLDRETLQQMSKPRCGVRDTFASIAQQEHENKNTNIEIGG---SRYTFFFNNVSWPA  154

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
             ++HL+YGF    P +F+ P+  A + W +  ++  F       AD+  +   G HGD  
Sbjct  155  ERKHLSYGFIHNYPPQFVDPLLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGAHGDYQ  214

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
             FDG GG  AH+     G  HFDADE W E  P    +D++SVALHE+GH LGL HS   
Sbjct  215  AFDGEGGILAHSLGAIDGRVHFDADEAW-ERIPIEQRVDLESVALHELGHTLGLGHSSEI  273

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             AVM+   E G  K  LT DDI GIRALY
Sbjct  274  SAVMFAYMEPGLYKTRLTIDDIEGIRALY  302



>ref|XP_004142468.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159089.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52406.1| hypothetical protein Csa_5G631560 [Cucumis sativus]
Length=295

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 109/268 (41%), Positives = 151/268 (56%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            L G +K D V+G++++KKYL+ +GY   LS+N+S+        ++ F D LESAIR+YQ 
Sbjct  33   LYGCRKDDNVEGIHSIKKYLQRYGY---LSHNTSTDSNIIELNSNKFDDSLESAIRLYQK  89

Query  163  RHHLNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANK  333
              HLN +GI+D +T  QM +PRCGV D+   N ++      E+  HY  +P+  KWP  K
Sbjct  90   WSHLNVSGIIDQETLDQMFQPRCGVPDVFKFNSSKNLEDDLEMSSHYALFPNNEKWPDYK  149

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVP  510
            RHLTY F    P  F+  +  A+  W      F+FS  +   +AD+  +    +H DG  
Sbjct  150  RHLTYMFTNNFPIDFVPSMTEAMARW-AAQSLFTFSEASDAQSADINISFQVKDHADGFA  208

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG   HAF P  G  H D D+ W   G     +++ + ALHE+GH+LGL HS   +
Sbjct  209  FDGPGGVVGHAFAPTDGRLHLDGDDTW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQ  267

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVMW   E    K +L  DDI GI ALY
Sbjct  268  AVMWPYIESNALK-NLNDDDIAGIHALY  294



>ref|XP_006416025.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
 gb|ESQ34378.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
Length=382

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 152/285 (53%), Gaps = 31/285 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G +V GLY LK+Y + FGYI         +  D F D L++A+  YQ   HLN 
Sbjct  49   FTGCHAGMKVNGLYKLKQYFQHFGYIRQ---TLPKNFTDDFDDILKNAVETYQRNFHLNI  105

Query  181  TGILDADTARQMMKPRCGVADIINGT------RRR----------PGGEVVPHYRFYPDE  312
            TG LD  T + ++ PRCGV DI+NGT      RRR          P    V  Y F+P E
Sbjct  106  TGELDELTLKHVVMPRCGVPDIVNGTSTMHNGRRRTYEVSFSGKGPRFHAVKRYSFFPGE  165

Query  313  PKWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALF  483
            P+WP   R LTY F P      +     + A   W  V    +F+R   F+ +D++   +
Sbjct  166  PRWPERNRDLTYAFDPRNSLTEEVKSVFSRAFVRWAEVIP-VTFTRVEVFSISDIRIGFY  224

Query  484  SGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG--------PPPNGLDIQSVA  639
            SG+HGDG PFDG  G+ AHAF P  G  H D DE+W+  G             +D++SVA
Sbjct  225  SGDHGDGEPFDGVMGTLAHAFSPPNGHFHLDGDENWIVSGDVGGDRLLSVTAAVDLESVA  284

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS  ++++M+     G +K DLT+DD+ G++ LY
Sbjct  285  VHEIGHLLGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  329



>ref|XP_008458913.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 150/269 (56%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S+  D F + LESAI+ YQ    L 
Sbjct  40   LIGSSKNDNIVEGIHKVKAYLQRYGYFSNENANTLST--DVFDNDLESAIKSYQKFSKLK  97

Query  178  STGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPA  327
             +G+LD +T +QM KPRCGV D              T    GG    HY FY +   WPA
Sbjct  98   VSGVLDRETLQQMSKPRCGVRDTFVSVAQQEHENKNTNIEIGGS---HYTFYFNNVTWPA  154

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
             K+HL+YGF    P +F+ P+  A + W +  ++  F       AD+  +   G+HGD  
Sbjct  155  EKKHLSYGFIHNYPPQFVDPLVRAFETWEDNTKFSFFLAPRVQTADILVSFERGDHGDYQ  214

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
             FDG GG  AH+     G  HFDADE W E GP  + +D++SVALHE+GH LGL HS   
Sbjct  215  AFDGEGGILAHSLGAVDGRVHFDADEPW-ESGPIEDRVDLESVALHELGHTLGLGHSREP  273

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             AVM+   + G  K  LT DDI GI ALY
Sbjct  274  SAVMYAFMDPGVYKTHLTIDDIEGICALY  302



>ref|XP_004142843.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/268 (40%), Positives = 152/268 (57%), Gaps = 16/268 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N+S         ++ F D LESAI++YQ 
Sbjct  33   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNTSIDSHIIELNSNKFDDSLESAIKLYQK  89

Query  163  RHHLNSTGILDADTARQMMKPRCGVADI--INGTRRRPGG-EVVPHYRFYPDEPKWPANK  333
              HLN +GILD +T  QM + RCG+ D+   N ++      E+  HY  +P+  KWP  K
Sbjct  90   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYK  149

Query  334  RHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSR-TGFFNADLKFALFSGEHGDGVP  510
            RHLTY F    P  F+  V  A+  W      F+FS  +   +AD+  +    +H DG+P
Sbjct  150  RHLTYMFTNNFPIDFMPSVTEAMARW-AAQSLFTFSEASDAQSADINISFQIKDHADGLP  208

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
            FDG GG   HAF P  G  H D D+ W   G     +++ + ALHE+GH+LGL HS   +
Sbjct  209  FDGPGGVVGHAFAPTDGRLHLDGDDTW-SAGMEVQKVNVMNAALHELGHVLGLAHSTLPQ  267

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVMW   +    K +L  DDI G+ ALY
Sbjct  268  AVMWPYIDSNALK-NLNDDDIAGLHALY  294



>ref|XP_006300514.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
 gb|EOA33412.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
Length=370

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/272 (40%), Positives = 145/272 (53%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G + G+++ GL  LK+Y   FGYI  +      +  D F D L+SAI  YQ   +L  
Sbjct  53   LAGCQIGEKIDGLSKLKQYFHRFGYITTIK-----NCTDDFDDALQSAINTYQKNFNLKV  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LD+ T RQ++KPRCG  D+I+G     GG        Y F+P +P+WP  KR LTY 
Sbjct  108  TGKLDSFTLRQIVKPRCGNPDMIDGFSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  167

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            F P      +     A A   W  V    +F+R+     AD+    FSGEHGDG PFDG 
Sbjct  168  FLPQNNLTDEVKRVFARAFTRWAEVTP-LNFARSESLRGADIFIGFFSGEHGDGEPFDGA  226

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D DE W+           P    +D++SV +HEIGHLLGL HS
Sbjct  227  MGTLAHASSPPTGMLHLDGDEDWLISDGAISRRILPVTTVVDLESVVVHEIGHLLGLGHS  286

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G++K +L  DDI GI+ LY
Sbjct  287  SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  318



>gb|EYU46223.1| hypothetical protein MIMGU_mgv1a025538mg [Erythranthe guttata]
Length=293

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 154/261 (59%), Gaps = 16/261 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G+ KGD+ KGL  LK+YLK  GYIN  S   ++   D+F D LE AI+ YQ  +++  
Sbjct  44   LSGTHKGDKSKGLNKLKEYLKNLGYIN--SKIPTNKYDDFFDDTLELAIKKYQEFYNIKI  101

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEP--KWPANKRHLTYGF  354
            TG LD +T   M+KPRCGVAD++  T R P       +R Y +     WP NKR+LTY  
Sbjct  102  TGFLDPETVTLMLKPRCGVADLLT-TNRTP-------FRSYYNLSGYSWPPNKRNLTYSL  153

Query  355  APGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGRGGS  531
               T      P+  AL  W +V   F+F+ T  F N+D+K +  + +HGDG PFDG  G 
Sbjct  154  PKDTRKDAYTPIVKALIKWVSVSP-FNFTFTDDFENSDVKISFETRDHGDGYPFDGPYGV  212

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEF  711
              H+F P  G  HFDA+E+W  F        + +VALHE+GH+LGL HS+  +++M+   
Sbjct  213  LGHSFYPTDGRLHFDAEENWKPFA-EAGSFYLGTVALHELGHILGLAHSQDEKSIMYAYI  271

Query  712  EYGEKKRDLTADDINGIRALY  774
              GE K DLT DDI+GI+++Y
Sbjct  272  GEGENK-DLTQDDIHGIKSIY  291



>ref|XP_008798076.1| PREDICTED: metalloendoproteinase 1-like, partial [Phoenix dactylifera]
Length=410

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 149/274 (54%), Gaps = 26/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+   GL +LK YL  FGY+       +S+  D F D LE A+R YQ    LN+
Sbjct  48   LSGCHPGENRAGLADLKDYLSRFGYL------PTSNFTDAFDDALEEALRTYQQNFGLNA  101

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRPGGEVVPHYRFYPDEPKWPANKRHLT  345
            TG LD  T  Q++ PRCGVADI+NGT      + PG  +   Y ++P  P WP+ KR LT
Sbjct  102  TGSLDDSTVNQLIIPRCGVADIVNGTSSMRSAKLPGRNL---YAYFPGNPTWPSWKRDLT  158

Query  346  YGFAPGTP-----SKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGV  507
            Y     +      S      A A   W +     +F+ T    +AD+K   +SG+HGDG 
Sbjct  159  YALVSTSAVSIDTSAISTVFARAFGRW-SAATTLTFTETDSASDADIKIGFYSGDHGDGE  217

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLD  672
            PFDG  G+ AHAF P  G  H DA E WV  G          +D++SVA+HEIGHLLGL 
Sbjct  218  PFDGVLGTLAHAFSPTDGRFHLDAAEQWVADGDVTEASSSVAVDLESVAVHEIGHLLGLG  277

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS   EA+M+   +   KK +L +DD++GI+ LY
Sbjct  278  HSSEAEAIMYPTIKTRTKKVELASDDVDGIQNLY  311



>ref|XP_010510985.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=367

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 146/272 (54%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  +  + +   D F D L+SAI  YQ   +L  
Sbjct  51   LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVENCT---DDFDDVLQSAIDTYQKNFNLKV  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LD+ T RQ++KPRCG  D+I+G     GG        Y F+P +P+WP  KR+LTY 
Sbjct  108  TGKLDSSTLRQIVKPRCGNPDMIDGFSEMNGGRKLRATERYSFFPGKPRWPKRKRYLTYA  167

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            F        +     A A   W  V    +F+R+     AD+    FSGEHGDG PFDG 
Sbjct  168  FVTQNNLTEEIKRVFARAFTRWSEVTP-LNFTRSESLLGADIVIGFFSGEHGDGEPFDGA  226

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D+DE W+              + +D++SV +HEIGHLLGL HS
Sbjct  227  MGTLAHASSPPTGMLHLDSDEDWLISDGGISRRISSVTSVVDLESVVVHEIGHLLGLGHS  286

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G +K +L  DDI GI+ LY
Sbjct  287  SVEDAIMFPAISGGHRKVELAKDDIEGIQHLY  318



>ref|XP_002893327.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69586.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/285 (39%), Positives = 151/285 (53%), Gaps = 32/285 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI--NDLSYNSSSSEADYFSDQLESAIRIYQTRHHL  174
              G   G +  GLY LK+Y + FGYI   DLS N +    D F D L++A+ +YQ    L
Sbjct  49   FTGCHAGKKYDGLYKLKQYFQHFGYIPETDLSGNFT----DDFDDILKNAVEMYQRNFQL  104

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPD  309
            N TG+LD  T + ++ PRCG  D++NGT     G                 V HY F+P 
Sbjct  105  NVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRRTFEVSFAGRGQRFHTVKHYSFFPG  164

Query  310  EPKWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRTG-FFNADLKFAL  480
            EP+WP N+R LTY F P      +     + A   W  V    +F+R   F  +D+    
Sbjct  165  EPRWPRNRRDLTYAFDPRNSLTEEVKSVFSRAFARWAEVTP-LTFTRVERFSTSDISIGF  223

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSVA  639
            +SGEHGDG PFDG   + AHAF P  G  H D +E+W+  G   +G       +D++SVA
Sbjct  224  YSGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVDEAVDLESVA  283

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS    ++M+     G +K DLT DD+ G++ LY
Sbjct  284  VHEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>ref|XP_010913461.1| PREDICTED: metalloendoproteinase 1-like [Elaeis guineensis]
Length=366

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/273 (40%), Positives = 143/273 (52%), Gaps = 24/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G  +GD   GL +LK YL  FGY+   ++       D F + LE A++ YQ    LN+
Sbjct  53   LSGCHRGDNRTGLADLKDYLSRFGYLPTANFT------DAFDEALEEALKTYQQNFGLNA  106

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRPGGEVVPHYRFYPDEPKWPANKRHLT  345
            TG LD  T  Q++ PRCGVADIINGT      + PG  +   Y ++P  P WP+ KR LT
Sbjct  107  TGSLDDSTVSQLIIPRCGVADIINGTSSMRSAKLPGRNL---YAYFPGSPTWPSWKRDLT  163

Query  346  YGFAPGTP-----SKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            Y     +      S      A A   W               +AD++   +SG+HGDG P
Sbjct  164  YALVSTSAVSIDTSALRTVFARAFGRWAAATTLTFTESDSVSDADIQIGFYSGDHGDGEP  223

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN-----GLDIQSVALHEIGHLLGLDH  675
            FDG  G+ AHAF P  G  H DA E WV  G          +D++SVA+HEIGHLLGL H
Sbjct  224  FDGVLGTLAHAFSPTDGRFHLDAAEQWVADGDVTQASSNVAVDLESVAVHEIGHLLGLGH  283

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S   EA+M+   +   KK +L +DD+ GI+ LY
Sbjct  284  SSVEEAIMYPTIKTKTKKVELASDDVEGIQNLY  316



>ref|XP_006304956.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
 gb|EOA37854.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
Length=381

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 155/283 (55%), Gaps = 29/283 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G++  GLY LK+Y + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  49   FTGCHAGNKYDGLYKLKQYFQHFGYIPE---TFSGNFTDDFDDILKNAVEMYQRNFRLNV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTR-----RRP-------GGE---VVPHYRFYPDEP  315
            TG+LD  T +Q++ PRCG  D++NGT      RR        GG+    V  Y F+P EP
Sbjct  106  TGVLDELTLKQVVIPRCGNPDVVNGTSTMHSGRRTYEVSFSGGGQRFHAVKRYSFFPGEP  165

Query  316  KWPANKRHLTYGFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFS  486
            +WP ++R LTY F P      +     + A   W  V    +F+R   F N+D+    +S
Sbjct  166  RWPRHRRDLTYAFNPRNMLTEEVKTVFSRAFARWAEVTP-LTFTRVESFSNSDIFIGFYS  224

Query  487  GEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-------PPPNGLDIQSVALH  645
            GEHGDG PFDG   + AHAF P  G  H D +E+W+  G         P  +D++SVA+H
Sbjct  225  GEHGDGEPFDGPMRTLAHAFSPPTGHFHLDREENWIISGEGGDGVISVPEAVDLESVAVH  284

Query  646  EIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            EIGHLLGL HS    ++M+     G++K DLT DD+ G++ LY
Sbjct  285  EIGHLLGLGHSSVEGSIMYPTIMTGKRKVDLTTDDVEGVQYLY  327



>ref|XP_009418044.1| PREDICTED: metalloendoproteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 145/269 (54%), Gaps = 19/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GD   GL  LK YLK FGY+   S NS+    D F D LE AI+ YQ    LN+
Sbjct  47   LSGCHHGDDKPGLAGLKHYLKHFGYLPTSSMNST----DSFDDALEIAIQSYQRFFGLNA  102

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGF--  354
            TG +D  T  Q+M PRCGVAD +NG+   PG  +   Y ++PD P WP  +R+L Y    
Sbjct  103  TGEIDEPTVDQLMAPRCGVADFVNGSSALPGRNL---YAYFPDAPTWPFWRRNLKYAITA  159

Query  355  ---APGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
                P   +      A A   W +     +F  T    +AD+    + GEHGDG PFDG 
Sbjct  160  TSDVPIDRAVLKAVFARAFGRWSS-ATTLTFEETDSAADADITIGFYRGEHGDGEPFDGV  218

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-----LDIQSVALHEIGHLLGLDHSEHR  687
             G+  HAF P  G  H DA E WV  G    G     +D++SVA+HEIGHLLGL HS   
Sbjct  219  LGTLGHAFSPTDGRLHLDAAEAWVAEGDMTKGSSDVAVDLESVAVHEIGHLLGLGHSAAA  278

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +A+M+   +   +K +LT DD+ GI++LY
Sbjct  279  DAIMYPAIKTRTRKVELTTDDVEGIQSLY  307



>gb|ACJ24812.1| matrix metalloproteinase [Pinus taeda]
Length=364

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 152/268 (57%), Gaps = 18/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L  + KGDR++GL +LK+Y + FGY++     + ++  + F + +ESA+R YQ    LN 
Sbjct  59   LTNACKGDRMQGLPDLKRYFRRFGYLS-----AQNNVTEDFDEAVESAVRTYQKNFGLNV  113

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TG+LD  T  Q+M PRCG  DIING+    G  + P   F+P  P+W  +KR L+Y F+P
Sbjct  114  TGVLDEATISQLMVPRCGREDIINGSSAMRGRGLFP---FFPGSPRWGPDKRVLSYAFSP  170

Query  361  G-------TPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDG  519
                    + ++    V  A K W +V        + + +AD+K   +SG+HGDG PFDG
Sbjct  171  DHEVLSEISLAELSTVVGRAFKRWADVIPITFTESSDYSSADIKVGFYSGDHGDGHPFDG  230

Query  520  RGGSYAHAFPPEYGDCHFDADEHW---VEFGPPPNGLDIQSVALHEIGHLLGLDHSEHRE  690
              G+ AH+F P  G  H DA E W   +        +D++S+A HEIGHLLGL H+  + 
Sbjct  231  PLGTLAHSFSPPDGRFHLDAAESWTVDLSSDSAATAIDLESIATHEIGHLLGLGHTTEKA  290

Query  691  AVMWEEFEYGEKKRDLTADDINGIRALY  774
            AVM+       +K DL  DD++G++ +Y
Sbjct  291  AVMYPSIAPRTRKVDLVLDDVDGVQYVY  318



>ref|XP_010264870.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=318

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/281 (42%), Positives = 153/281 (54%), Gaps = 31/281 (11%)
 Frame = +1

Query  4    QGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNST  183
            +G  KGDRVKGL  +K+YL+ FGY++  + +    +       LESAI+ YQ  ++L  T
Sbjct  42   EGCHKGDRVKGLNQVKRYLQRFGYLDHHNDDDDDFDH-----HLESAIKTYQLNYNLKET  96

Query  184  GILDADTARQMMKPRCGVADIING-TRRRPGGE-----------------VVPHYRFYPD  309
            G LD  T +QMM PRCGV DII G T  R G E                    HY F+ +
Sbjct  97   GSLDVATVKQMMLPRCGVPDIIKGETWMRSGKEKKEKRLLGVSGRKTTLGFSSHYTFFNN  156

Query  310  EP--KWPANKRHLTYGFAPGTPSKFIV--PVA-TALKAWHNVGEYFSFSRTG-FFNADLK  471
             P  KWP  K HL Y      P   ++  P+   A   W  V   F+F  T    +AD++
Sbjct  157  TPTPKWPPYKMHLKYVLDSTVPVDDLLMHPLCYVAFARWAAVSN-FTFEETQDLSSADIR  215

Query  472  FALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEI  651
            F+ F G+HGDG PFDG GG  AHA+ P  G  HFD++E W   G   + +D  SVA+HEI
Sbjct  216  FSFFKGDHGDGNPFDGPGGVLAHAYAPIDGRVHFDSEERWTT-GIRADWIDTASVAMHEI  274

Query  652  GHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GHLLGL HS    AVM+   + G +K +L  DDI GI++LY
Sbjct  275  GHLLGLGHSSEHGAVMFPYIDVGSQKVNLHPDDIQGIQSLY  315



>gb|KFK40830.1| hypothetical protein AALP_AA2G047000 [Arabis alpina]
Length=364

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 146/272 (54%), Gaps = 16/272 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GD++ GL  LK+Y   FGY+   +   ++   D F D L+SAI  YQ   +L  
Sbjct  46   LAGCHVGDKIDGLSKLKQYFHRFGYLTTTTTAGTNFTDD-FDDILQSAINTYQKNFNLKV  104

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LDA T RQ++KPRCG  D+I+G      G        Y F+P +P+WP  KR LTY 
Sbjct  105  TGNLDASTLRQIVKPRCGNPDMIDGVSEMNAGRKLRTTERYSFFPGKPRWPKRKRDLTYA  164

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            F P      +     A A   W  V    +F+R+     AD+    F+GEHGDG PFDG 
Sbjct  165  FVPQNNLTDEVKRVFARAFTRWSEVTP-LNFTRSESILRADIVIGFFAGEHGDGEPFDGA  223

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D DE W+           P  + +D++SVA+HEIGHLLGL HS
Sbjct  224  MGTLAHASSPPTGMFHLDGDEDWLISEDEISRGILPVTSVVDLESVAVHEIGHLLGLGHS  283

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +++M+     G++K +L  DDI GI+ LY
Sbjct  284  SVEDSIMYPAIAGGDRKVELGKDDIEGIQHLY  315



>gb|KFK44477.1| hypothetical protein AALP_AA1G261400 [Arabis alpina]
Length=378

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 151/284 (53%), Gaps = 30/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G +V GLY +K+Y + FGYI +       +  D F D L++A+ +YQ    LN 
Sbjct  45   FTGCHTGMKVDGLYKIKQYFQHFGYIPE---TLPGNFTDDFDDILKNAVEMYQRNFQLNV  101

Query  181  TGILDADTARQMMKPRCGVADIINGTR----------------RRPGGEVVPHYRFYPDE  312
            TG LD  T   ++ PRCGV D++NGT                 R P    V  Y F+P E
Sbjct  102  TGELDELTLIHVVIPRCGVPDVVNGTSTMHGHGRRTYEVSFTGRGPRFHAVRRYSFFPGE  161

Query  313  PKWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALF  483
            P+WP ++R LTY F P      +     + A   W  V    +F+R   F  AD++   +
Sbjct  162  PRWPNHRRDLTYAFDPRNALTEEVKNVFSRAFVRWAEVTP-LTFTRAESFLTADIRVGFY  220

Query  484  SGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVE-------FGPPPNGLDIQSVAL  642
            SG+HGDG PFDG  G+ AHAF P  G  H D DE+WV        F      +D++SVA+
Sbjct  221  SGDHGDGEPFDGVMGTLAHAFSPPSGHFHLDGDENWVVSDSGGDGFLSVTAAVDLESVAV  280

Query  643  HEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HEIGH+LGL HS  ++++M+     G +K DLT+DD+ G++ LY
Sbjct  281  HEIGHILGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  324



>ref|XP_010043822.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=499

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 145/277 (52%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G+R  GL NLKKY + FGYI +   N +    D F D L SAI+ YQ   +L  
Sbjct  180  FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  235

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEV----------VPHYRFYPDEPKWPAN  330
            TG LD  T  Q+++PRCG  DI+NG+     G+           V HY F+P  P+WP  
Sbjct  236  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  295

Query  331  KRHLTYGFAPGTP----SKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHG  498
            K  LTY F P        K +   + A + W  V      +   +  AD+K   FSG+HG
Sbjct  296  KSDLTYAFLPANQLSDDEKAVF--SRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHG  353

Query  499  DGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLL  663
            DG  FDG  G+ AHAF P  G  H D DE+WV  G        + +D++SVA+HEIGHLL
Sbjct  354  DGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHLL  413

Query  664  GLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            GL HS   E++M+       KK DL  DD+ GI+ LY
Sbjct  414  GLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  450



>ref|XP_002533939.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28446.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=226

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 133/225 (59%), Gaps = 17/225 (8%)
 Frame = +1

Query  142  AIRIYQTRHHLNSTGILDADTARQMMKPRCGVADII--NGT------RRRPGGEVVPHYR  297
            AIR YQ  +HL  TGILD  T  QMMKPRCG+ D++  NGT      R+      + HY+
Sbjct  2    AIRNYQHNYHLKDTGILDNYTVSQMMKPRCGMPDVVTNNGTKHQSHNRKLMSIHSLVHYK  61

Query  298  FYPDEPKWPANKRHLTYGF-----APGTPSKFIVPVATALKAWHNVGEYFSFSRTGF-FN  459
            F+  EP+WPA + HL Y F      PGT +   +  A A + W  V  +F+F        
Sbjct  62   FFHGEPRWPAERTHLRYRFRSSTQVPGTQNIGSI-CARAFQKWAEV-THFTFEEVASNAQ  119

Query  460  ADLKFALFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVA  639
            A+++       HGDG PFDGR G+ AHA  P  G  HFD DE+W E  P  N +D++SVA
Sbjct  120  AEIEIGFHRRSHGDGHPFDGRSGTLAHATAPTGGMFHFDGDENWSE-NPEANEVDLESVA  178

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS+   AVM+  F YG  KRDL +DD+ GIRALY
Sbjct  179  VHEIGHLLGLHHSDDPNAVMYATFRYGITKRDLDSDDVQGIRALY  223



>ref|XP_004142467.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
 gb|KGN52407.1| hypothetical protein Csa_5G632060 [Cucumis sativus]
Length=303

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/269 (41%), Positives = 144/269 (54%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L GS K D  V+G++ +K YL+ +GY+++   N      D F D LESAI+ YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSN--ENEKKLSTDAFDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTARQMMKPRCGVADII----------NGTRRRPGGEVVPHYRFYPDEPKWPA  327
             +G+LD +T +QM +PRCGV D              T    GG    HY FY +   WPA
Sbjct  98   VSGVLDRETLQQMSRPRCGVRDTYVSVGQQEHENKNTNIEIGGS---HYTFYYNHVTWPA  154

Query  328  NKRHLTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGV  507
             +RHL+YGF    P + +  V  A + W +  ++  F       AD+  +   GEHGD  
Sbjct  155  ERRHLSYGFIHDFPPQHVDTVRRAFQTWEDNTKFSFFLSPRVQTADILVSFERGEHGDHE  214

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHR  687
            PFDG GG  AH+     G  HFDAD+ W   G P    D++++ALHEIGH LGL HS   
Sbjct  215  PFDGEGGILAHSLGAVDGRVHFDADDRWE--GDPMERYDLETLALHEIGHALGLGHSSSS  272

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALY  774
             A+MW     G  K  LT DDI GIRALY
Sbjct  273  LAIMWAYMYKGFPKTRLTIDDIEGIRALY  301



>ref|XP_007033356.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY04282.1| Matrixin family protein, putative [Theobroma cacao]
Length=384

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 150/263 (57%), Gaps = 12/263 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQG++KG +VKGL ++K+Y K FGY     Y +  +  D + D LESA++ YQ  + L  
Sbjct  128  LQGAQKGYKVKGLNHVKQYFKAFGY-----YPNHINLTDDYDDSLESALKKYQENYRLKV  182

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGG-EVVPHYRFYPDEPKWPANKRHLTYGFA  357
            TG +D DT ++M+ PRCGVADI N +       ++V +Y F+   PKW  +KR LTY F 
Sbjct  183  TGRIDPDTIKEMLIPRCGVADIFNESNSEYDKLDMVANYTFFDGMPKW--SKRQLTYTFR  240

Query  358  PG----TPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRG  525
                  +  +    +A A + W  V ++       F  AD+        H D  PFDG G
Sbjct  241  SSAIVISVQQLRPIIARAFEKWAAVSQFTFRQAPTFTQADIVIGFHRRFHWDNYPFDGPG  300

Query  526  GSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWE  705
               AHAF P+ G  H+DADE+W       N +D++SVA+HEIGHLLGL HS    A+M+ 
Sbjct  301  NVLAHAFAPQDGRFHYDADENWSTNPTTVNQIDVESVAVHEIGHLLGLGHSRDPNAIMFA  360

Query  706  EFEYGEKKRDLTADDINGIRALY  774
             +  G  KR+L  DDI+G+RALY
Sbjct  361  LYMPGTIKRNLGQDDIDGMRALY  383



>ref|XP_002318762.2| MATRIX METALLOproteinASE [Populus trichocarpa]
 gb|EEE96982.2| MATRIX METALLOproteinASE [Populus trichocarpa]
Length=373

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 146/276 (53%), Gaps = 25/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G++  GL  LK Y + FGYI     NS S+  D F D LESA+R YQ   +LN 
Sbjct  58   LSGCHAGEKYDGLAKLKSYFQYFGYIP----NSLSNFTDDFDDSLESALRTYQQNFNLNI  113

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPAN  330
            TG LD  T   +++PRCG  DI+NG+     G+           V HY F+   P+W   
Sbjct  114  TGQLDDQTVNHIVRPRCGNPDIVNGSSSMNSGKTHNTSSSHVHTVSHYSFFTGMPRW--R  171

Query  331  KRHLTYGFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGD  501
            K+ LTY F PG     +     + A   W  V    +F++    N AD+    +SG+HGD
Sbjct  172  KQALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIP-LTFTQADSINAADIGIGFYSGDHGD  230

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLG  666
            G PFDG  G+ AH+F P  G  H D DE+WV  G          +D++SVA+HEIGHLLG
Sbjct  231  GEPFDGVLGTLAHSFSPPSGQFHLDGDENWVVTGDVRTSSLTTAVDLESVAVHEIGHLLG  290

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS   E++M+       KK +L  DDI GI+ LY
Sbjct  291  LGHSSVEESIMYPTISSRTKKVELADDDIQGIQVLY  326



>ref|XP_010470167.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=364

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 146/272 (54%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  + ++ +   D F D L+SAI  YQ   +L  
Sbjct  49   LAGCHIGEKIDGLSKLKQYFHRFGYISAAAVDNCT---DDFDDVLQSAIDTYQKNFNLKV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LD+ T RQ++KPRCG  D+I+G     G         Y F+  +P+WP  KR LTY 
Sbjct  106  TGKLDSSTLRQIVKPRCGNLDMIDGVSEMNGRRKLRTTERYSFFHGKPRWPKRKRDLTYA  165

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            F P      +       A   W  V    +F+R+     AD+    FSGEHGDG PFDG 
Sbjct  166  FVPQNNLTEEVKRVFERAFTRWSEVTP-LNFTRSESLLGADIVIGFFSGEHGDGEPFDGA  224

Query  523  GGSYAHAFPPEYGDCHFDADEHWV--------EFGPPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D+DE W+           P  + +D++SV +HEIGHLLGL HS
Sbjct  225  MGTLAHASSPPTGMLHLDSDEDWLISNGEISRRILPVTSVVDLESVVVHEIGHLLGLGHS  284

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
               +A+M+     G++K +L  DDI GI+ LY
Sbjct  285  SVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  316



>gb|EYU46221.1| hypothetical protein MIMGU_mgv1a010535mg [Erythranthe guttata]
Length=309

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 147/267 (55%), Gaps = 10/267 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSSEADYFSDQLESAIRIYQTRHHL  174
            L G +KG+  KGL +LK YL   GY+N   +      +  D F + LE AIR YQ+   L
Sbjct  46   LVGIRKGNSAKGLSHLKNYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFFKL  105

Query  175  NSTGILDADTARQMMKPRCGVAD---IINGTRRRPGGEVVP-HYRFYPDEPKWPANKRHL  342
              TG+LD DT +Q+M+PRCGVAD   ++N T  +    ++   Y F+P +P WPA KR L
Sbjct  106  KVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKRSL  165

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDG  519
            TY F PGT       +  A   W      F F+    + NAD+K +    +HGDG PFDG
Sbjct  166  TYSFPPGTRPDINRCLLAATDIW-GANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDG  224

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
              G  AHAF P  G  H D DE W + G      D+Q+V LHE+GH+LGL H+    AVM
Sbjct  225  PLGILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGHILGLMHTGDVGAVM  283

Query  700  WEEFEYGEKKRDLTADDINGIRALYHF  780
            +       +K  L  DD++GI+ALY F
Sbjct  284  YPYIGPNSRK-GLGQDDVDGIKALYPF  309



>gb|EYU46222.1| hypothetical protein MIMGU_mgv1a027058mg, partial [Erythranthe 
guttata]
Length=284

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/267 (42%), Positives = 146/267 (55%), Gaps = 10/267 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSSEADYFSDQLESAIRIYQTRHHL  174
            L G +KG   KGL +LK YL   GY+N   +      +  D F + LE AIR YQ+   L
Sbjct  21   LVGIRKGTTAKGLSHLKSYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFFKL  80

Query  175  NSTGILDADTARQMMKPRCGVAD---IINGTRRRPGGEVVP-HYRFYPDEPKWPANKRHL  342
              TG+LD DT +Q+M+PRCGVAD   ++N T  +    ++   Y F+P +P WPA KR L
Sbjct  81   KVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKRSL  140

Query  343  TYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDG  519
            TY F PGT       +  A   W      F F+    + NAD+K +    +HGDG PFDG
Sbjct  141  TYSFPPGTRPDINRCLLAATDIW-GANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDG  199

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
              G  AHAF P  G  H D DE W + G      D+Q+V LHE+GH+LGL H+    AVM
Sbjct  200  PLGILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGHILGLMHTGDVGAVM  258

Query  700  WEEFEYGEKKRDLTADDINGIRALYHF  780
            +       +K  L  DD++GI+ALY F
Sbjct  259  YPYIGPNSRK-GLGQDDVDGIKALYPF  284



>gb|KCW49213.1| hypothetical protein EUGRSUZ_K02793, partial [Eucalyptus grandis]
Length=236

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 149/271 (55%), Gaps = 47/271 (17%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS-----SEADYFSDQLESAIRIYQTR  165
            LQG  KGD   G+  LK+YL+ FGY+N   YN S      ++ D F D LE A++ YQ  
Sbjct  2    LQGCHKGDHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  58

Query  166  HHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLT  345
            +HLN TG LD  T  +MM+P                             P+WPA+  HLT
Sbjct  59   YHLNVTGTLDPQTTSKMMRP-----------------------------PRWPASNYHLT  89

Query  346  YGFAPGTPSKFIVPVATALKAWHNVGEY-FSFSRTGFFNADLKFALFSGEHGDGV--PFD  516
            YGF PGTP     PVA A   W +V  + FS+ +   F A+++     G+HGDG    FD
Sbjct  90   YGFLPGTPEAATAPVARAFAKWTSVTRFTFSYVQDHQF-ANIQIGFARGDHGDGAHNSFD  148

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG---LDIQSVALHEIGHLLGLDHSEHR  687
            G GG+ AHAFPP  G  H+DADE W     PP+G    ++++VALHEIGHLLGL HS+  
Sbjct  149  GPGGTLAHAFPPTSGLFHYDADEKWAV--DPPSGSAAFNVETVALHEIGHLLGLGHSDVE  206

Query  688  EAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
             A+M+     G  K  L ADDI GI+ALY+F
Sbjct  207  AAIMYSSIAPGTTK-GLHADDIQGIKALYNF  236



>ref|XP_011042944.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=373

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/276 (41%), Positives = 144/276 (52%), Gaps = 25/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G++  GL  LK Y + FGYI     NS S+  D F D +ESAIR YQ   +LN 
Sbjct  58   LSGCHAGEKYDGLAKLKSYFQYFGYIP----NSLSNFTDDFDDSIESAIRTYQQNFNLNI  113

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE----------VVPHYRFYPDEPKWPAN  330
            TG LD  T   ++ PRCG  DI+NGT     G+           V HY F+   P+W   
Sbjct  114  TGQLDDQTVNHIVLPRCGNPDIVNGTTSMNSGKTHNTSSRHVHTVSHYSFFTGMPRW--R  171

Query  331  KRHLTYGFAPGT--PSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGD  501
            K+ LTY F PG     +     + A   W  V    +F++T   N AD+    +SG+HGD
Sbjct  172  KKALTYAFLPGNQLTDEVKTVFSRAFDRWSTVIP-LTFTQTDSINTADIGIGFYSGDHGD  230

Query  502  GVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLG  666
            G PFDG  G+ AH+F P  G  H D DE WV  G          +D++SVA+HEIGHLLG
Sbjct  231  GEPFDGVLGTLAHSFSPPSGQFHLDGDESWVVTGDVRTSSLTTAVDLESVAVHEIGHLLG  290

Query  667  LDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            L HS    ++M+       KK +L  DDI GI+ LY
Sbjct  291  LGHSSVEVSIMYPTISSRTKKVELADDDIQGIQVLY  326



>ref|XP_006357274.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=338

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/266 (40%), Positives = 145/266 (55%), Gaps = 14/266 (5%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE-ADYFSDQLESAIRIYQTRHHLNST  183
            G + G ++KGL  +K+Y K FGYI+    NS S++  D F   L SA++ YQ   +LN T
Sbjct  60   GCRVGQKIKGLAKIKQYFKHFGYID----NSLSNDFTDEFDQLLFSALKTYQLNFNLNIT  115

Query  184  GILDADTARQMMKPRCGVADIINGTR-----RRPGGEVVPHYRFYPDEPKWPANKRHLTY  348
            G  D  T + M+KPRCG  DI+NGT      + P    V H+ F+  +P+WP++K  L Y
Sbjct  116  GEFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKY  175

Query  349  GFAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGR  522
             F P       V VA   A   W  V          +   D++   F  +HGDG PFDG 
Sbjct  176  AFLPENQLTDSVKVAFRRAFDKWSKVTPLTFKEMDSYRLVDIRIRFFVRDHGDGNPFDGP  235

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFGP--PPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
                AHAF P     H D +E+WV  G       +D++SVA+HEIGHLLGLDH   +EA+
Sbjct  236  MKILAHAFAPPTRFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIGHLLGLDHLSEKEAI  295

Query  697  MWEEFEYGEKKRDLTADDINGIRALY  774
            M+   E G +K +L+ DDI G++ LY
Sbjct  296  MFPTIEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_009113266.1| PREDICTED: metalloendoproteinase 1 [Brassica rapa]
Length=394

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 144/273 (53%), Gaps = 20/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI  YQ   +L  
Sbjct  90   LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAISTYQKNFNLKV  145

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGG----EVVPHYRFYPDEPKWPANKRHLTY  348
            TG LDA T  Q++KPRCG  D+I+GT            V  Y F+P +P+WP   R L+Y
Sbjct  146  TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSY  205

Query  349  GFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDG  519
             F P      +     A A   W +V    +F+R+     AD+    F+G+HGDG PFDG
Sbjct  206  AFVPLNNLTEEVKQVFARAFTRWADVTP-LNFTRSESILRADIVIGFFAGDHGDGEPFDG  264

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFG--------PPPNGLDIQSVALHEIGHLLGLDH  675
              G+ AHA  P  G  H D DE W+  G        P  + +D++SVA+HEIGHLLGL H
Sbjct  265  PMGTLAHASSPPTGMFHLDGDEDWLISGEDMSRQILPVTSVVDLESVAVHEIGHLLGLGH  324

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S   +A+M+     G +K +L  DDI GI+ LY
Sbjct  325  SSVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  357



>emb|CDY45157.1| BnaA09g14350D [Brassica napus]
Length=354

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 144/273 (53%), Gaps = 20/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI  YQ   +L  
Sbjct  50   LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAITTYQKNFNLKV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGG----EVVPHYRFYPDEPKWPANKRHLTY  348
            TG LDA T  Q++KPRCG  D+I+GT            V  Y F+P +P+WP   R L+Y
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKLRTVARYSFFPGKPQWPKRNRDLSY  165

Query  349  GFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDG  519
             F P      +     A A   W +V    +F+R+     AD+    F+G+HGDG PFDG
Sbjct  166  AFFPLNNLTEEVKQVFARAFTRWADVTP-LNFTRSESILRADIVIGFFAGDHGDGEPFDG  224

Query  520  RGGSYAHAFPPEYGDCHFDADEHWVEFG--------PPPNGLDIQSVALHEIGHLLGLDH  675
              G+ AHA  P  G  H D DE W+  G        P  + +D++SVA+HEIGHLLGL H
Sbjct  225  PMGTLAHASSPPTGMFHLDGDEDWLISGEDVSRQILPVTSVVDLESVAVHEIGHLLGLGH  284

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S   +A+M+     G +K +L  DDI GI+ LY
Sbjct  285  SSVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  317



>dbj|BAJ94792.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92632.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 141/271 (52%), Gaps = 15/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GD   GL  LK YL  FGY+++    +SS  +D F  +LE+A+  YQ    LN+
Sbjct  51   LSGCHMGDERDGLARLKDYLSHFGYLSEAP--TSSPFSDAFDAELEAAVATYQRNFGLNA  108

Query  181  TGILDADTARQMMKPRCGVADIINGTRR-----RPGGEVVPHYRFYPDEPKWPANKRHLT  345
            TG+LD  T  QM+ PRCGVAD+INGT          G     Y ++P  P WP  +R L 
Sbjct  109  TGVLDPPTVSQMVAPRCGVADVINGTSTMDRNASAAGHGRHLYTYFPGGPMWPPFRRELR  168

Query  346  YGFAPGTPSK-----FIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVP  510
            Y       +           A A   W +             +AD+    ++G HGDG  
Sbjct  169  YAITATAATSIDRATLGAVFARAFARWSDATTLRFAEAASESDADITIGFYAGSHGDGEA  228

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWV---EFGPPPNGLDIQSVALHEIGHLLGLDHSE  681
            FDG  G+ AHAF P  G  H DA E WV   + G  P  +D++SVA+HEIGHLLGL HS 
Sbjct  229  FDGPLGTLAHAFSPTDGRFHLDAAEAWVADGQGGDAPGAVDLESVAVHEIGHLLGLGHSS  288

Query  682  HREAVMWEEFEYGEKKRDLTADDINGIRALY  774
             + A+M+     G +K DL +DD+ GI++LY
Sbjct  289  VQGAIMYPTIRTGTRKVDLESDDVQGIQSLY  319



>ref|XP_011019812.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=298

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/261 (41%), Positives = 141/261 (54%), Gaps = 10/261 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            LQGSKKGD+V+G+  LKK+L  FGY+N    N+   E DYF + +E A++ YQ   +L  
Sbjct  42   LQGSKKGDKVEGVDQLKKFLHHFGYLNHGGLNNDEIEDDYFDETIERALKTYQINFNLKP  101

Query  181  TGILDADTARQMMKPRCGVADIING-TRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFA  357
            TG+LDA+T   MMKPRCGV DI++G TR    G     Y  +P  P+WP   + L +G+ 
Sbjct  102  TGLLDAETVSLMMKPRCGVPDIVDGKTRMNSAGSYNIDYALFPGSPRWPKTTKVLNWGYR  161

Query  358  PGTPSKFIVPVAT-ALKAWHNVGEY-FSFSRTGFFNADLKFALFSGEHGDGVPFDGRGGS  531
            PGT    + P+A    K W +   + F+F       AD+         G         G 
Sbjct  162  PGTRKDVLNPLAKYCFKPWGDHLPFTFNFVERNLGVADITIGFLKNGQG-----GMDKGK  216

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEF  711
             A A+PP  G   F+AD +W  FG  P   D  +V LHE+GH+LGL HS  + AVMW   
Sbjct  217  EAFAYPPTDGRVFFNADLNW-SFGAAPGAYDFLTVGLHELGHVLGLAHSSVKGAVMWPYN  275

Query  712  EYGEKKRDLTADDINGIRALY  774
               E K  L  DDI+GI ALY
Sbjct  276  GMNETKV-LQDDDIHGIEALY  295



>emb|CDY30915.1| BnaC09g14910D [Brassica napus]
Length=353

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 147/274 (54%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI  YQ   +L  
Sbjct  50   LTGYHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLKSAISTYQKNFNLKV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---VVPHYRFYPDEPKWPANKRHLTYG  351
            TG LDA T  Q++KPRCG  D+I+GT     G+    V  Y F+P +P+WP   R L+Y 
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSYA  165

Query  352  FAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFDGR  522
            F P      +     A A   W +V    +F+R+     AD+    F+G+HGDG PFDG 
Sbjct  166  FFPLNNLTEEVKQVFARAFTRWADVTP-LNFTRSESILRADIVIGFFAGDHGDGEPFDGP  224

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFG--------PPPNGLDIQSVALHEIGHLLGLDHS  678
             G+ AHA  P  G  H D +E W+  G        P  + +D++SVA+HEIGHLLGL HS
Sbjct  225  MGTLAHASSPPTGMFHLDNEEDWLISGEDMSRQILPVTSVVDLESVAVHEIGHLLGLGHS  284

Query  679  EHREAVMWEEFEYGEKKRDLTADDINGIRALYHF  780
               +A+M+     G +K +L  DDI GI+ LY +
Sbjct  285  SVEDAIMYPAISGGHRKVELAKDDIEGIQHLYGY  318



>gb|EYU42526.1| hypothetical protein MIMGU_mgv1a011887mg [Erythranthe guttata]
Length=267

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/262 (41%), Positives = 145/262 (55%), Gaps = 11/262 (4%)
 Frame = +1

Query  13   KKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            +KGD++KG+  LKKYL   GY+N  + S N      + F   L+ A++ YQ  ++LN TG
Sbjct  10   QKGDKIKGVVELKKYLTYLGYLNRNNCSNNQKIKSNNIFDKPLQLALKKYQKFYNLNVTG  69

Query  187  ILDADTARQMMKPRCGVADIINGTRRRPGGEVVPH-YRFYPDEPKWPANKRHLTYGFAPG  363
            ILD+ T  +M KPRC + D  N + +          Y F P +P+W   KR L Y F+  
Sbjct  70   ILDSKTVAKMHKPRCAMPDFYNHSCKNVKFLTTDSLYAFLPGQPRW--KKRILKYAFSAS  127

Query  364  TPSKFIVPVATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFDGRG--GSY  534
            TP + I+ +  A K W +V   F F  T  F+ A ++     GEHGD +PF G    G  
Sbjct  128  TPKEAILAIELAFKEWASVTN-FKFEPTRKFDGAHVRILFLHGEHGDDLPFGGPEPIGGV  186

Query  535  AHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEFE  714
            AH++PP  G+ HFDA   W   G   N  DI++V LHE+GH+LGL HS    AVM+    
Sbjct  187  AHSYPPPIGEVHFDAGLKWSNKG-ERNAFDIKTVGLHELGHILGLGHSSDANAVMYPLVH  245

Query  715  YGEKKRDLTADDINGIRALYHF  780
             GE K+ L ADDI GI+ALY  
Sbjct  246  LGETKK-LDADDIKGIKALYKL  266



>ref|XP_010477738.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=380

 Score =   183 bits (465),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 113/285 (40%), Positives = 153/285 (54%), Gaps = 33/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G+   GLY LK+Y + FGYI +     S +  D F D L++A+ IYQ    LN 
Sbjct  49   FTGCHVGETYDGLYKLKQYFQHFGYIPE---TLSGNFTDDFDDILKNAVEIYQRNFRLNV  105

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGG----EV-----------VPHYRFYPDEP  315
            TG+LD  T + +M PRCG  D++NGT     G    EV           V  Y  +P EP
Sbjct  106  TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHSVKRYSLFPAEP  165

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVAT----ALKAWHNVGEYFSFSRT-GFFNADLKFAL  480
            +WP+N+R LTY F P   +K    V T    A   W  V    +F+R   F  +D+    
Sbjct  166  RWPSNRRDLTYAFDP--RNKLTEEVKTVFSRAFARWAEVTP-LTFTRVESFRTSDIFIGF  222

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWV---EFGPPPN----GLDIQSVA  639
            +SGEHGDG PFDG   + AHAF P  G  H DA+E+W+   E G   N     +D++SVA
Sbjct  223  YSGEHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISREGGDGVNSVTEAIDLESVA  282

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS    ++M+     G +K +LT +D+ G++ LY
Sbjct  283  VHEIGHLLGLGHSSVEGSIMYPTITTGMRKVELTTNDVEGVQYLY  327



>gb|KHN16358.1| Metalloendoproteinase 1 [Glycine soja]
Length=292

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 146/266 (55%), Gaps = 20/266 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L+G  KG +  G+  L+ YL+ FGY+ +       S  D F + +ESA++ YQ  +HL S
Sbjct  41   LRGVHKGQKANGVGELRSYLQHFGYLTN-----GDSSNDNFDNNVESALKHYQEFNHLRS  95

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFAP  360
            TG++D +T ++M  PRCG+ DI+             +Y F+P +PKW   K  LTYG   
Sbjct  96   TGVVDDETIKRMSLPRCGMPDIVTQPNANQLLVAPNNYSFFPGQPKW--RKFALTYGHMS  153

Query  361  GT--PSKFIVPVATA----LKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGR  522
                 + F   V  A    L+ W  V  +    R     AD+ +    G+HGDG PFDG 
Sbjct  154  SVVLSNNFFSSVRAAKLRALQTWARVTNFTFTERAP--PADIVYGFHRGDHGDGYPFDGP  211

Query  523  GGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMW  702
             G  AHAF P+ G CH+DADE W   G     +D ++VALHE GHLLGL HS  R +VM 
Sbjct  212  YGVLAHAFAPQNGRCHYDADEPWNFNG---QNIDFETVALHECGHLLGLGHSNTRGSVM-  267

Query  703  EEFEYGEKKRDLTADDINGIRALYHF  780
             E  Y  ++R LT DDI+GIRALY F
Sbjct  268  -EATYAGQRRSLTQDDIDGIRALYQF  292



>ref|XP_006367952.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=369

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/265 (39%), Positives = 145/265 (55%), Gaps = 12/265 (5%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNSTG  186
            G + G ++KGL  +K+Y + FGYI++   + S+   D F   L SA++ YQ   +LN TG
Sbjct  60   GCRVGQKIKGLAKIKQYFQHFGYIDN---SLSNDFTDEFDQLLFSALKTYQLNFNLNITG  116

Query  187  ILDADTARQMMKPRCGVADIINGTR-----RRPGGEVVPHYRFYPDEPKWPANKRHLTYG  351
              D  T + M+KPRCG  DI+NGT      + P    V H+ F+  +P+WP++K  L Y 
Sbjct  117  EFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKYA  176

Query  352  FAPGTPSKFIVPVA--TALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRG  525
            F P       V VA   A   W  V          +  AD++   F  +HG+G PFDG  
Sbjct  177  FLPENQLTDSVKVAFRRAFDKWSKVTPLTFKEMDSYRLADIRIGFFVRDHGNGNPFDGPM  236

Query  526  GSYAHAFPPEYGDCHFDADEHWVEFGP--PPNGLDIQSVALHEIGHLLGLDHSEHREAVM  699
               AH F P  G  H D +E+WV  G       +D++SVA+HEI HLLGLDHS  +EA+M
Sbjct  237  KILAHTFAPPTGFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIRHLLGLDHSFEKEAIM  296

Query  700  WEEFEYGEKKRDLTADDINGIRALY  774
            +   E G +K +L+ DDI G++ LY
Sbjct  297  FPTLEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_004953898.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=372

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 145/274 (53%), Gaps = 18/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S  ++A  F + LE+AI  YQ    LN+
Sbjct  53   LSGCHMGEERQGLAGLKDYLSHFGYLPPPPSSSPFTDA--FDEDLEAAIATYQRNFGLNA  110

Query  181  TGILDADTARQMMKPRCGVADIINGTRR--RPGGEVVPH----YRFYPDEPKWPANKRHL  342
            TG LDA T  QM+ PRCGVAD+INGT    R       H    Y ++P  P+WP  +R L
Sbjct  111  TGALDASTVAQMVSPRCGVADVINGTSTMARNSSAAGAHGRHLYAYFPGGPRWPPFRRDL  170

Query  343  TYGFAPGTPSKF----IVPVATALKAWHNVGEYFSFSRTGF-FNADLKFALFSGEHGDGV  507
             Y     + +      +  V     A         F+ T    +AD+    ++G HGDG 
Sbjct  171  KYAITATSATSIDRSTLSDVFARAFAQWAAATNLRFAETASESDADITIGFYTGSHGDGE  230

Query  508  PFDGRGGSYAHAFPPEYGDCHFDADEHWVEFG-----PPPNGLDIQSVALHEIGHLLGLD  672
            PFDG  G+ AHAF P  G  H DA E WV  G       P  +D++SVA+HEIGHLLGL 
Sbjct  231  PFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGGDVSRASSPGVVDLESVAVHEIGHLLGLG  290

Query  673  HSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HS   EA+M+     G +K +L ADD+ GI++LY
Sbjct  291  HSSVPEAIMYPTIRTGTRKVELEADDVQGIQSLY  324



>ref|XP_010460187.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=381

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 150/285 (53%), Gaps = 33/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G+   GLY LK+Y + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  51   FTGCHVGETYDGLYKLKQYFQHFGYIPE---TLSGNFTDDFDDILKNAVEMYQRNFRLNV  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            TG+LD  T + +M PRCG  D++NGT     G                 V  Y  +P EP
Sbjct  108  TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHAVKRYSLFPGEP  167

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVAT----ALKAWHNVGEYFSFSRT-GFFNADLKFAL  480
            +WP+N+R LTY F P   +K    V T    A   W  V    +F+R   F  +D+    
Sbjct  168  RWPSNRRDLTYAFDP--RNKLTEEVKTVFSRAFARWAQVTP-LTFTRVQSFRTSDIFIGF  224

Query  481  FSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSVA  639
            ++GEHGDG PFDG   + AHAF P  G  H DA+E+W+      +G       +D++SVA
Sbjct  225  YAGEHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISSEGGDGVLSVTEAIDLESVA  284

Query  640  LHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            +HEIGHLLGL HS    ++M+     G +K +LT +D+ G++ LY
Sbjct  285  VHEIGHLLGLGHSSVEGSIMYPTITTGMRKVELTTNDVEGVQYLY  329



>ref|XP_004965108.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=368

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 145/273 (53%), Gaps = 22/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+  +G+  LK YL  FGY+ +     SS   D F   LE AI++YQ    LN 
Sbjct  53   LTGCHFGEEQQGVAKLKDYLAHFGYLPE-----SSGFTDIFDADLEEAIKVYQRNFGLNI  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPH----YRFYPDEPKWPANKRHLTY  348
            TG++DA T  QMM PRCGVAD+INGT    G     H    Y ++P  P WP +K+ LTY
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTM-GASSHAHGRNLYSYFPGSPSWPRSKKRLTY  166

Query  349  GF---APGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEHGDGVP  510
                 A  T  +  +    A A   W +     +F+ T    +AD+     +G+HGDG  
Sbjct  167  AITDTAATTIDRATLSRVFARAFARW-SAATTLNFTETASARDADITIGFHAGDHGDGEA  225

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN-----GLDIQSVALHEIGHLLGLDH  675
            FDG  G+ AHAF P  G  H DA E WV  G          +D++SVA+HEIGHLLGL H
Sbjct  226  FDGPLGTLAHAFSPTDGRFHLDAAEAWVAAGDVSRASSDVAVDLESVAVHEIGHLLGLGH  285

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    A+M+       +K DL +DD+ GI++LY
Sbjct  286  SSEPGAIMYPTITSRTRKVDLASDDVVGIQSLY  318



>ref|XP_010498935.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=425

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/284 (38%), Positives = 146/284 (51%), Gaps = 31/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G+   GLY LK+Y + FGYI +     S +  D F D L++A+ +YQ    LN 
Sbjct  95   FTGCHVGETYDGLYKLKQYFQHFGYIPE---TLSGNFTDDFDDILKNAVEMYQRNFRLNV  151

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGE---------------VVPHYRFYPDEP  315
            TG+LD  T + +M PRCG  D++NGT     G                 V  Y  +P EP
Sbjct  152  TGVLDELTLKHVMIPRCGNPDVVNGTSTMHSGRRTYEVSFSGRSQRFHAVKRYSLFPGEP  211

Query  316  KWPANKRHLTYGFAPGTPSKFIVPVAT----ALKAWHNVGEYFSFSRTGFFNADLKFALF  483
            +WP N+R LTY F P   +K    V T    A   W  V          F  +D+    +
Sbjct  212  RWPRNRRDLTYAFDP--RNKLTEEVKTVFSRAFARWAEVTPLTFTHVESFRTSDIFIGFY  269

Query  484  SGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSVAL  642
            SGEHGDG PFDG   + AHAF P  G  H DA+E+W+  G   +G       +D++SVA+
Sbjct  270  SGEHGDGEPFDGPLRTLAHAFSPPTGHFHLDAEENWIISGEGGDGVLSVTEAIDLESVAV  329

Query  643  HEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            HEIGHLLGL HS    ++M+     G +K +LT +D+ G++ LY
Sbjct  330  HEIGHLLGLGHSSVEGSIMYPTITTGMRKVELTTNDVEGVQYLY  373



>emb|CBI34984.3| unnamed protein product [Vitis vinifera]
Length=682

 Score =   186 bits (472),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 154/258 (60%), Gaps = 31/258 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSE------ADYFSDQLESAIRIYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S         DYF D LESAI+ YQT
Sbjct  435  LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  491

Query  163  RHHLNSTGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWP-ANKRH  339
             +HL +TG LD++T R          D  +G+        V HY+F+P  P+WP +N  H
Sbjct  492  NYHLKATGKLDSETKRH---------DQGHGSL-----HTVSHYQFFPGSPRWPTSNNAH  537

Query  340  LTYGFAPGTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFALFSGEHGDGVPFD  516
            LTY F PGTP +  +PV+ A   W +    F+F++T    NA+L  +  S  HGD  PFD
Sbjct  538  LTYAFLPGTPDEAKIPVSRAFGKWASATS-FTFAQTEDHRNANLTISFHSLLHGDWNPFD  596

Query  517  GRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAV  696
            G GG+ AHA+ P  G  H+DADE W   G  P  LD+++VALHEIGHLLGL HS  REA+
Sbjct  597  GPGGTIAHAYAPTDGRFHYDADEEW-SVGAVPGALDVETVALHEIGHLLGLGHSSVREAI  655

Query  697  MWEEFEYG----EKKRDL  738
            M+     G    +K+R++
Sbjct  656  MFPSISTGGGVKKKQRNM  673



>ref|XP_004965107.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=321

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 144/273 (53%), Gaps = 22/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
            L G   G+  +G+  LK YL  FGY+ +     SS   D F   LE AI++YQ    LN 
Sbjct  53   LTGCHFGEEQQGVAKLKDYLAHFGYLPE-----SSGFTDIFDADLEEAIKVYQRNFGLNI  107

Query  181  TGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPH----YRFYPDEPKWPANKRHLTY  348
            TG++DA T  QMM PRCGVAD+INGT    G     H    Y ++P  P WP +K+ LTY
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTM-GASSHAHGRNLYSYFPGSPSWPRSKKRLTY  166

Query  349  GF---APGTPSKFIVP--VATALKAWHNVGEYFSFSRTGFF-NADLKFALFSGEHGDGVP  510
                 A  T  +  +    A A   W +     +F+ T    +AD+     +G+HGDG  
Sbjct  167  AITDTAATTIDRATLSRVFARAFARW-SAATTLNFTETASARDADITIGFHAGDHGDGEA  225

Query  511  FDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPN-----GLDIQSVALHEIGHLLGLDH  675
            FDG  G+ AHAF P  G  H DA E WV  G           D++SVA+HEIGHLLGL H
Sbjct  226  FDGPLGTLAHAFAPTDGRFHLDAAEAWVAAGDVSRASSDVAYDLESVAVHEIGHLLGLGH  285

Query  676  SEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            S    A+M+       +K DL +DD+ GI++LY
Sbjct  286  SSEPGAIMYPSITPRTRKVDLASDDVVGIQSLY  318



>emb|CDY16241.1| BnaA09g29750D [Brassica napus]
Length=384

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 151/286 (53%), Gaps = 32/286 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSSEADYFSDQLESAIRIYQTRHHLNS  180
              G   G +V GLY +K+Y + FGYI         +  D F D L+SA+ +YQ    LN 
Sbjct  49   FTGCHAGMKVDGLYKIKQYFQHFGYI---PLTLPGNFTDDFDDILKSAVEMYQRNFKLNI  105

Query  181  TGILDADTARQMMKPRCGVADIINGTR-------RRPGGEV-----------VPHYRFYP  306
            TG LD  T + ++ PRCGV D++NGT        RR   EV           V  Y F+P
Sbjct  106  TGELDELTLQHVVIPRCGVPDVVNGTSTMLSGGGRRRTYEVSFSGRSQRFHAVKRYSFFP  165

Query  307  DEPKWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFA  477
             EP+WP  +R+LTY F P      +     + A   W  V    +F R   F  +D+   
Sbjct  166  GEPRWPERRRNLTYAFEPQNALTEEVKSVFSRAFVRWAEVIP-LTFRRVESFSTSDISIG  224

Query  478  LFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSV  636
             ++GEHGD  PFDG  G+ AHAF P  G  H D+ E+W+  G   +G       +D++SV
Sbjct  225  FYTGEHGDREPFDGFMGTLAHAFSPPNGHFHLDSAENWIVSGEGGDGFLTERAAVDLESV  284

Query  637  ALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            A+HEIGHLLGL HS  ++++M+     G +K DL +DD+ G++ LY
Sbjct  285  AVHEIGHLLGLGHSSVQDSIMFPTITTGRRKVDLHSDDVEGVQYLY  330



>gb|KDO75343.1| hypothetical protein CISIN_1g043086mg [Citrus sinensis]
Length=257

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 135/231 (58%), Gaps = 27/231 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSS--EADYFSDQLESAIRIYQTRHHL  174
             QG++KGD VKG+  LKKYL T GY+++ ++N +++  + DYF + LESA++ YQ   +L
Sbjct  46   FQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNL  105

Query  175  NSTGILDADTARQMMKPRCGVADIINGTRRRPGGEV--VPHYRFYPDEPKWPANKRHLTY  348
            N TG +D  T   M KPRCGV D+INGT R  GG      HY FYP  PKWPA K+ ++ 
Sbjct  106  NPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISC  165

Query  349  GFAPGTPSKFIVPVATALKAWHNVGEYFSFSRTGFFNADLKFALFSGEHGDGVPFDGRG-  525
             F PGT +    P   A                    AD+K +   G+HGDG PFDG G 
Sbjct  166  AFLPGTRTDVQEPDYDA--------------------ADVKISFQRGDHGDGYPFDGPGP  205

Query  526  -GSYAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDH  675
                AH+FPP  G  H+D DE+W   G  P  +D+Q+VALHE+ H+LGL H
Sbjct  206  YNLLAHSFPPTDGRFHYDGDENWT-VGAVPGAVDMQTVALHELRHVLGLAH  255



>ref|XP_007033352.1| Matrixin family protein [Theobroma cacao]
 gb|EOY04278.1| Matrixin family protein [Theobroma cacao]
Length=275

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/261 (41%), Positives = 146/261 (56%), Gaps = 27/261 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
            L+ ++KGD + GL ++KKYL+ FGY  ND +        D+F D LESA++ +Q  ++L 
Sbjct  37   LERAQKGDTLNGLSHVKKYLRAFGYYPNDFNLID-----DHFDDSLESALKAHQQNYYLK  91

Query  178  STGILDADTARQMMKPRCGVADIINGTRRRPGGEVVPHYRFYPDEPKWPANKRHLTYGFA  357
             TG +D DT + MM PRCGV DII+       GE  PH   +           HL     
Sbjct  92   VTGKIDPDTIKAMMTPRCGVPDIISNRTSNDTGET-PHGVIF-----------HLVIS--  137

Query  358  PGTPSKFIVPV-ATALKAWHNVGEYFSFSRTGFFN-ADLKFALFSGEHGDGVPFDGRGGS  531
                S+ + P+ A A + W  V   F F      N AD++   +  EHGDG PFDG G  
Sbjct  138  ----SQVLRPIIARAFQTWAAVSP-FRFQEVAQGNRADIRIGFYRYEHGDGYPFDGPGNI  192

Query  532  YAHAFPPEYGDCHFDADEHWVEFGPPPNGLDIQSVALHEIGHLLGLDHSEHREAVMWEEF  711
             AHAF P+ G  H+DADE+W      PN +D+++VA+HEIGH LGL HS+ + A+M+   
Sbjct  193  LAHAFAPQDGRFHYDADENWSPNPTAPNQIDLETVAVHEIGHNLGLGHSQDQAAIMFPSL  252

Query  712  EYGEKKRDLTADDINGIRALY  774
              G  KR+L  DDI G++ALY
Sbjct  253  PAGATKRNLGQDDIVGLQALY  273



>gb|ACB59207.1| matrixin family protein [Brassica oleracea]
 emb|CDY14666.1| BnaC05g19230D [Brassica napus]
Length=383

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 152/286 (53%), Gaps = 33/286 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSSEADYFSDQLESAIRIYQTRHHLN  177
              G   G +V GLY +K+Y + FGYI   L  N S    D F D L++A+ +YQ    LN
Sbjct  49   FTGCHAGMKVDGLYKIKQYFQHFGYIPQTLPGNFS----DDFDDILKNAVEMYQRNFKLN  104

Query  178  STGILDADTARQMMKPRCGVADIINGTR------RRPGGEV-----------VPHYRFYP  306
             TG LD  T + ++ PRCGV D++NGT       RR   EV           V  Y F+P
Sbjct  105  ITGELDELTLQHVVIPRCGVPDVVNGTSTMLNGGRRRTYEVSFSGRSQRFHAVKRYSFFP  164

Query  307  DEPKWPANKRHLTYGFAP--GTPSKFIVPVATALKAWHNVGEYFSFSRT-GFFNADLKFA  477
             EP+WP  +R+LTY F P      +     + A   W  V    +F R   F  +D+   
Sbjct  165  GEPRWPERRRNLTYAFEPQNNLAEEVKSVFSRAFVRWAEVIP-LTFRRVESFSTSDISIG  223

Query  478  LFSGEHGDGVPFDGRGGSYAHAFPPEYGDCHFDADEHWVEFGPPPNG-------LDIQSV  636
             ++GEHGD  PFDG  G+ AHAF P  G  H D  E+W+  G   +G       +D++SV
Sbjct  224  FYTGEHGDREPFDGFMGTLAHAFSPPTGHFHLDGAENWIVSGEGGDGFLTERAAVDLESV  283

Query  637  ALHEIGHLLGLDHSEHREAVMWEEFEYGEKKRDLTADDINGIRALY  774
            A+HEIGHLLGL HS  ++++M+     G +K DL +DD+ G++ LY
Sbjct  284  AVHEIGHLLGLGHSSVQDSIMFPTISTGRRKVDLHSDDVEGVQYLY  329



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1919675704716