BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23382_g2_i1 len=881 path=[1537:0-58 1596:59-104 5367:105-110
3402:111-145 4333:146-737 1424:738-778 5084:779-846 5016:847-880]

Length=881
                                                                      Score     E

ref|XP_008458713.1|  PREDICTED: metalloendoproteinase 1-like            258   8e-81   
ref|XP_004142457.1|  PREDICTED: metalloendoproteinase 1-like            250   2e-77   
ref|XP_008230962.1|  PREDICTED: metalloendoproteinase 1-like            247   3e-76   
gb|KDP45996.1|  hypothetical protein JCGZ_11899                         244   2e-75   
ref|XP_008230959.1|  PREDICTED: metalloendoproteinase 1-like            244   3e-75   
ref|XP_008230963.1|  PREDICTED: metalloendoproteinase 1-like            244   3e-75   
ref|XP_007216922.1|  hypothetical protein PRUPE_ppa018385mg             243   5e-75   
ref|XP_007216839.1|  hypothetical protein PRUPE_ppa022514mg             242   1e-74   
ref|XP_002517411.1|  Metalloendoproteinase 1 precursor, putative        241   3e-74   Ricinus communis
ref|XP_007014936.1|  Matrixin family protein, putative                  241   4e-74   
ref|XP_008230957.1|  PREDICTED: metalloendoproteinase 1-like            241   7e-74   
ref|XP_008458907.1|  PREDICTED: metalloendoproteinase 1-like            241   7e-74   
ref|XP_004296560.1|  PREDICTED: metalloendoproteinase 1-like            239   1e-73   
gb|EYU29748.1|  hypothetical protein MIMGU_mgv1a025409mg                238   2e-73   
emb|CAN59960.1|  hypothetical protein VITISV_011608                     239   3e-73   Vitis vinifera
ref|XP_007010415.1|  Matrixin family protein                            239   3e-73   
ref|XP_007010413.1|  Matrixin family protein                            239   4e-73   
ref|XP_002275556.1|  PREDICTED: metalloendoproteinase 1-like            238   8e-73   Vitis vinifera
ref|XP_004288499.1|  PREDICTED: metalloendoproteinase 1-like            237   2e-72   
ref|XP_010037506.1|  PREDICTED: metalloendoproteinase 1-like            237   2e-72   
ref|XP_004142462.1|  PREDICTED: metalloendoproteinase 1-like            237   3e-72   
ref|XP_008458714.1|  PREDICTED: metalloendoproteinase 1-like            237   3e-72   
ref|XP_008352994.1|  PREDICTED: metalloendoproteinase 1-like            236   4e-72   
ref|XP_003633209.1|  PREDICTED: metalloendoproteinase 1-like            236   5e-72   
ref|XP_008230960.1|  PREDICTED: metalloendoproteinase 1-like            235   8e-72   
gb|EYU18042.1|  hypothetical protein MIMGU_mgv1a018853mg                234   8e-72   
ref|XP_008230675.1|  PREDICTED: metalloendoproteinase 1-like            234   2e-71   
ref|XP_007217804.1|  hypothetical protein PRUPE_ppa024325mg             237   3e-71   
ref|XP_008343421.1|  PREDICTED: metalloendoproteinase 1-like            232   2e-70   
ref|XP_010037507.1|  PREDICTED: metalloendoproteinase 1-like            232   2e-70   
ref|XP_008230676.1|  PREDICTED: metalloendoproteinase 1-like            231   3e-70   
ref|XP_008361888.1|  PREDICTED: metalloendoproteinase 1-like            231   3e-70   
emb|CBI34985.3|  unnamed protein product                                229   5e-70   
ref|XP_006482472.1|  PREDICTED: metalloendoproteinase 1-like            231   5e-70   
ref|XP_004296559.1|  PREDICTED: metalloendoproteinase 1-like            230   9e-70   
ref|XP_002280833.1|  PREDICTED: metalloendoproteinase 1                 230   9e-70   Vitis vinifera
gb|EYU34694.1|  hypothetical protein MIMGU_mgv1a023515mg                228   1e-69   
emb|CAN73128.1|  hypothetical protein VITISV_030256                     228   4e-69   Vitis vinifera
gb|EYU34696.1|  hypothetical protein MIMGU_mgv11b016964mg               227   2e-68   
ref|XP_007216923.1|  hypothetical protein PRUPE_ppa018181mg             225   2e-68   
ref|XP_007010134.1|  Matrixin family protein, putative                  225   3e-68   
ref|XP_010039144.1|  PREDICTED: metalloendoproteinase 1-like            226   4e-68   
gb|KDO37621.1|  hypothetical protein CISIN_1g035681mg                   226   5e-68   
ref|XP_010278837.1|  PREDICTED: metalloendoproteinase 1-like            226   7e-68   
ref|XP_008368314.1|  PREDICTED: LOW QUALITY PROTEIN: metalloendop...    225   9e-68   
ref|XP_010273763.1|  PREDICTED: metalloendoproteinase 1-like            226   1e-67   
ref|XP_004142461.1|  PREDICTED: metalloendoproteinase 1-like            225   1e-67   
ref|XP_002517412.1|  Matrix metalloproteinase, putative                 225   1e-67   Ricinus communis
ref|XP_008365496.1|  PREDICTED: metalloendoproteinase 1-like            224   3e-67   
ref|XP_008355534.1|  PREDICTED: metalloendoproteinase 1-like            223   6e-67   
ref|XP_009341183.1|  PREDICTED: metalloendoproteinase 1-like            224   7e-67   
ref|XP_006448956.1|  hypothetical protein CICLE_v10017926mg             221   2e-66   
gb|KCW49215.1|  hypothetical protein EUGRSUZ_K02795                     224   3e-66   
ref|XP_010255256.1|  PREDICTED: metalloendoproteinase 1-like            220   6e-66   
ref|XP_004159087.1|  PREDICTED: metalloendoproteinase 1-like            224   7e-66   
ref|XP_002280805.2|  PREDICTED: metalloendoproteinase 1-like            219   3e-65   Vitis vinifera
ref|XP_011085796.1|  PREDICTED: metalloendoproteinase 1-like            216   2e-64   
ref|XP_004297959.1|  PREDICTED: metalloendoproteinase 1-like            216   2e-64   
ref|XP_007216020.1|  hypothetical protein PRUPE_ppa014830mg             215   3e-64   
ref|XP_006448955.1|  hypothetical protein CICLE_v10017519mg             213   3e-64   
ref|XP_010091950.1|  Metalloendoproteinase 1                            217   6e-64   
gb|EYU29749.1|  hypothetical protein MIMGU_mgv1a023711mg                213   7e-64   
ref|XP_007226174.1|  hypothetical protein PRUPE_ppa015434mg             215   7e-64   
gb|KDO75344.1|  hypothetical protein CISIN_1g037265mg                   214   8e-64   
ref|XP_008222422.1|  PREDICTED: metalloendoproteinase 1-like            214   1e-63   
gb|EPS59674.1|  hypothetical protein M569_15132                         212   2e-63   
ref|XP_007216949.1|  hypothetical protein PRUPE_ppa016355mg             212   2e-63   
ref|XP_011073059.1|  PREDICTED: metalloendoproteinase 1-like            213   2e-63   
ref|XP_004139164.1|  PREDICTED: metalloendoproteinase 1-like            213   4e-63   
ref|XP_009368959.1|  PREDICTED: metalloendoproteinase 1-like            213   5e-63   
emb|CAN73130.1|  hypothetical protein VITISV_030258                     216   6e-63   Vitis vinifera
ref|XP_009351242.1|  PREDICTED: metalloendoproteinase 1-like            213   6e-63   
emb|CCH68443.1|  matrix metalloproteinase precursor                     213   1e-62   
ref|XP_006363533.1|  PREDICTED: metalloendoproteinase 1-like            213   2e-62   
ref|XP_004237082.2|  PREDICTED: metalloendoproteinase 1                 213   2e-62   
ref|NP_001266203.1|  matrix metalloproteinase precursor                 213   2e-62   
gb|EYU35921.1|  hypothetical protein MIMGU_mgv1a019701mg                211   3e-62   
ref|XP_008230961.1|  PREDICTED: metalloendoproteinase 1-like            211   3e-62   
gb|EYU38312.1|  hypothetical protein MIMGU_mgv11b017434mg               208   4e-62   
ref|XP_004139163.1|  PREDICTED: metalloendoproteinase 1-like            210   5e-62   
gb|KDP45419.1|  hypothetical protein JCGZ_09668                         209   6e-62   
ref|XP_006363534.1|  PREDICTED: metalloendoproteinase 1-like            211   8e-62   
ref|XP_011072962.1|  PREDICTED: metalloendoproteinase 1-like            209   1e-61   
ref|XP_008458911.1|  PREDICTED: metalloendoproteinase 1-like            209   1e-61   
ref|XP_010110202.1|  Metalloendoproteinase 1                            209   3e-61   
ref|XP_004297896.1|  PREDICTED: metalloendoproteinase 1-like            208   3e-61   
ref|XP_002311051.2|  hypothetical protein POPTR_0008s02790g             207   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011003818.1|  PREDICTED: metalloendoproteinase 1-like            207   4e-61   
gb|KDO37628.1|  hypothetical protein CISIN_1g039411mg                   203   2e-60   
ref|XP_006387200.1|  hypothetical protein POPTR_1544s00200g             206   2e-60   
gb|EYU31381.1|  hypothetical protein MIMGU_mgv1a023026mg                204   2e-60   
ref|XP_006482471.1|  PREDICTED: metalloendoproteinase 1-like            204   2e-60   
ref|XP_011071055.1|  PREDICTED: metalloendoproteinase 1-like            207   3e-60   
ref|XP_004167464.1|  PREDICTED: metalloendoproteinase 1-like            205   3e-60   
ref|XP_004142466.1|  PREDICTED: metalloendoproteinase 1-like            205   4e-60   
ref|XP_009624303.1|  PREDICTED: metalloendoproteinase 1-like            206   4e-60   
ref|XP_008443669.1|  PREDICTED: metalloendoproteinase 1-like            205   5e-60   
gb|KCW49214.1|  hypothetical protein EUGRSUZ_K02794                     202   7e-60   
ref|XP_011003815.1|  PREDICTED: metalloendoproteinase 1-like            204   7e-60   
gb|ABF58910.1|  matrix metalloprotease 1                                206   7e-60   Nicotiana tabacum [American tobacco]
ref|XP_006376166.1|  hypothetical protein POPTR_0013s10410g             204   8e-60   
gb|ABK95950.1|  unknown                                                 204   8e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009758591.1|  PREDICTED: metalloendoproteinase 1-like            206   9e-60   
ref|XP_011010763.1|  PREDICTED: metalloendoproteinase 1-like            204   9e-60   
ref|XP_006438497.1|  hypothetical protein CICLE_v10031870mg             206   1e-59   
ref|XP_010255281.1|  PREDICTED: metalloendoproteinase 1-like            206   2e-59   
ref|XP_002325947.1|  hypothetical protein POPTR_0019s10230g             203   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006856883.1|  hypothetical protein AMTR_s00055p00201730          204   4e-59   
ref|XP_011085865.1|  PREDICTED: metalloendoproteinase 1-like            202   4e-59   
ref|XP_008458910.1|  PREDICTED: metalloendoproteinase 1-like            202   4e-59   
ref|XP_006431003.1|  hypothetical protein CICLE_v10012543mg             201   4e-59   
ref|XP_008376281.1|  PREDICTED: metalloendoproteinase 1-like            203   8e-59   
ref|XP_010272073.1|  PREDICTED: metalloendoproteinase 1                 203   1e-58   
ref|XP_002319607.2|  hypothetical protein POPTR_0013s03350g             201   1e-58   Populus trichocarpa [western balsam poplar]
gb|KGN51345.1|  hypothetical protein Csa_5G522910                       201   1e-58   
gb|ADD21635.1|  matrix metalloprotease 1                                202   2e-58   Nicotiana benthamiana
gb|KCW56124.1|  hypothetical protein EUGRSUZ_I01878                     200   2e-58   
ref|XP_010030761.1|  PREDICTED: metalloendoproteinase 1-like            201   2e-58   
ref|XP_003517862.1|  PREDICTED: metalloendoproteinase 1-like            202   3e-58   
ref|XP_002275671.1|  PREDICTED: metalloendoproteinase 1-like            200   3e-58   Vitis vinifera
gb|KHN16358.1|  Metalloendoproteinase 1                                 199   3e-58   
ref|XP_008458715.1|  PREDICTED: metalloendoproteinase 1-like            200   3e-58   
emb|CBI34987.3|  unnamed protein product                                200   3e-58   
ref|XP_004159085.1|  PREDICTED: metalloendoproteinase 1-like            199   6e-58   
ref|XP_004142465.1|  PREDICTED: metalloendoproteinase 1-like            199   6e-58   
ref|XP_010255269.1|  PREDICTED: metalloendoproteinase 1-like            199   9e-58   
ref|XP_004509890.1|  PREDICTED: metalloendoproteinase 1-like            201   1e-57   
ref|XP_007153680.1|  hypothetical protein PHAVU_003G055800g             201   1e-57   
gb|KDO82628.1|  hypothetical protein CISIN_1g021444mg                   199   1e-57   
gb|EYU46220.1|  hypothetical protein MIMGU_mgv1a010241mg                199   1e-57   
ref|XP_006495379.1|  PREDICTED: metalloendoproteinase 1-like            196   1e-57   
gb|EPS61169.1|  matrixin family protein                                 198   2e-57   
ref|XP_006371427.1|  hypothetical protein POPTR_0019s10270g             198   2e-57   
ref|XP_011086481.1|  PREDICTED: metalloendoproteinase 1-like            200   2e-57   
ref|NP_001267680.1|  metalloendoproteinase 1-like precursor             198   2e-57   
ref|XP_008458917.1|  PREDICTED: metalloendoproteinase 1-like            196   5e-57   
ref|XP_004159086.1|  PREDICTED: matrix metalloproteinase-9-like         196   8e-57   
ref|XP_003530663.1|  PREDICTED: metalloendoproteinase 1-like            198   1e-56   
gb|EYU34695.1|  hypothetical protein MIMGU_mgv1a024051mg                193   1e-56   
emb|CDP00221.1|  unnamed protein product                                198   1e-56   
ref|XP_006602365.1|  PREDICTED: metalloendoproteinase 1-like            197   1e-56   
ref|XP_004142459.1|  PREDICTED: matrix metalloproteinase-9-like         195   1e-56   
ref|XP_002520211.1|  Metalloendoproteinase 1 precursor, putative        197   1e-56   Ricinus communis
ref|XP_007033356.1|  Matrixin family protein, putative                  197   2e-56   
ref|XP_010695886.1|  PREDICTED: metalloendoproteinase 1-like            196   2e-56   
gb|KDP21290.1|  hypothetical protein JCGZ_21761                         197   3e-56   
ref|XP_011080437.1|  PREDICTED: metalloendoproteinase 1-like            195   3e-56   
ref|XP_007220919.1|  hypothetical protein PRUPE_ppb025548mg             195   5e-56   
gb|KGN52417.1|  hypothetical protein Csa_5G633150                       194   5e-56   
ref|XP_004143787.1|  PREDICTED: metalloendoproteinase 1-like            196   5e-56   
ref|XP_008233236.1|  PREDICTED: metalloendoproteinase 1-like            196   6e-56   
gb|EYU28648.1|  hypothetical protein MIMGU_mgv1a008442mg                195   2e-55   
ref|XP_008465718.1|  PREDICTED: metalloendoproteinase 1                 194   2e-55   
ref|XP_008458915.1|  PREDICTED: metalloendoproteinase 1-like            192   3e-55   
ref|XP_003554856.1|  PREDICTED: metalloendoproteinase 1-like            192   3e-55   
ref|XP_004297678.1|  PREDICTED: metalloendoproteinase 1-like            194   3e-55   
ref|XP_010100525.1|  Metalloendoproteinase 1                            194   3e-55   
ref|XP_007044491.1|  Matrixin family protein, putative                  194   4e-55   
ref|XP_003519796.1|  PREDICTED: metalloendoproteinase 1-like            194   5e-55   
ref|XP_010414620.1|  PREDICTED: metalloendoproteinase 1-like            193   5e-55   
gb|KHN28682.1|  Metalloendoproteinase 1                                 194   6e-55   
ref|XP_006838196.1|  hypothetical protein AMTR_s00106p00141160          193   7e-55   
ref|XP_009626465.1|  PREDICTED: metalloendoproteinase 1-like            193   9e-55   
ref|XP_004142843.1|  PREDICTED: metalloendoproteinase 1-like            191   1e-54   
gb|KHN16355.1|  Metalloendoproteinase 1                                 190   1e-54   
emb|CAN76268.1|  hypothetical protein VITISV_004096                     192   1e-54   Vitis vinifera
ref|XP_010264870.1|  PREDICTED: metalloendoproteinase 1-like            191   1e-54   
ref|XP_002267298.2|  PREDICTED: metalloendoproteinase 1                 192   2e-54   Vitis vinifera
ref|XP_004142468.1|  PREDICTED: metalloendoproteinase 1-like            190   2e-54   
gb|KCW85819.1|  hypothetical protein EUGRSUZ_B02562                     191   4e-54   
gb|KCW49213.1|  hypothetical protein EUGRSUZ_K02793                     187   4e-54   
ref|NP_176205.1|  Matrixin family protein                               191   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235535.1|  metalloendoproteinase 1 precursor                  189   5e-54   
ref|XP_008244963.1|  PREDICTED: metalloendoproteinase 1                 192   5e-54   
ref|XP_009360449.1|  PREDICTED: metalloendoproteinase 1                 191   6e-54   
ref|XP_004142460.1|  PREDICTED: metalloendoproteinase 1-like            188   7e-54   
ref|XP_002533939.1|  Metalloendoproteinase 1 precursor, putative        186   1e-53   Ricinus communis
ref|XP_010913461.1|  PREDICTED: metalloendoproteinase 1-like            190   1e-53   
ref|XP_007219827.1|  hypothetical protein PRUPE_ppa026649mg             189   2e-53   
ref|XP_006300514.1|  hypothetical protein CARUB_v10020497mg             189   2e-53   
ref|XP_008353003.1|  PREDICTED: metalloendoproteinase 1-like            189   2e-53   
ref|XP_002888162.1|  predicted protein                                  189   2e-53   
ref|XP_006603838.1|  PREDICTED: metalloendoproteinase 1-like            188   3e-53   
ref|XP_010553642.1|  PREDICTED: metalloendoproteinase 1                 189   4e-53   
ref|XP_010552627.1|  PREDICTED: metalloendoproteinase 1                 189   5e-53   
dbj|BAE98757.1|  predicted GPI-anchored protein                         189   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20327.1|  unknown                                                 186   5e-53   Glycine max [soybeans]
emb|CDY45157.1|  BnaA09g14350D                                          188   5e-53   
ref|NP_177174.1|  matrix metalloproteinase                              188   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113266.1|  PREDICTED: metalloendoproteinase 1                 189   6e-53   
ref|XP_004504503.1|  PREDICTED: metalloendoproteinase 1-like            188   6e-53   
gb|ACJ24812.1|  matrix metalloproteinase                                187   8e-53   Pinus taeda
gb|KDO75343.1|  hypothetical protein CISIN_1g043086mg                   184   8e-53   
ref|XP_008458914.1|  PREDICTED: metalloendoproteinase 1-like            186   9e-53   
dbj|BAJ94792.1|  predicted protein                                      187   1e-52   
emb|CBI34986.3|  unnamed protein product                                186   1e-52   
gb|KFK40830.1|  hypothetical protein AALP_AA2G047000                    187   1e-52   
ref|XP_008458912.1|  PREDICTED: metalloendoproteinase 1-like            185   1e-52   
ref|XP_006304956.1|  hypothetical protein CARUB_v10011449mg             187   2e-52   
gb|EYU46223.1|  hypothetical protein MIMGU_mgv1a025538mg                185   2e-52   
ref|XP_008798076.1|  PREDICTED: metalloendoproteinase 1-like            188   2e-52   
gb|AES96374.2|  matrix metalloproteinase                                187   2e-52   
ref|XP_004965108.1|  PREDICTED: metalloendoproteinase 1-like            187   2e-52   
gb|AAC00572.1|  similar to zinc metalloproteinases                      187   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043822.1|  PREDICTED: metalloendoproteinase 1-like            189   3e-52   
ref|NP_173824.2|  putative metalloproteinase                            186   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613416.1|  Matrix metalloproteinase-9                         187   3e-52   
ref|XP_003628627.1|  Matrix metalloproteinase-9                         186   4e-52   
ref|XP_007157519.1|  hypothetical protein PHAVU_002G076600g             186   4e-52   
ref|XP_002887284.1|  hypothetical protein ARALYDRAFT_476141             186   4e-52   
gb|EYU46221.1|  hypothetical protein MIMGU_mgv1a010535mg                184   4e-52   
gb|EYU46222.1|  hypothetical protein MIMGU_mgv1a027058mg                184   4e-52   
ref|NP_001151749.1|  metalloendoproteinase 1 precursor                  186   4e-52   Zea mays [maize]
ref|XP_010415694.1|  PREDICTED: metalloendoproteinase 1-like            186   5e-52   
ref|XP_008458913.1|  PREDICTED: metalloendoproteinase 1-like            184   5e-52   
gb|KFK41437.1|  hypothetical protein AALP_AA2G130300                    186   6e-52   
ref|XP_004965107.1|  PREDICTED: metalloendoproteinase 1-like            184   6e-52   
ref|XP_007223246.1|  hypothetical protein PRUPE_ppa007227mg             186   6e-52   
emb|CDX68356.1|  BnaA07g23960D                                          186   6e-52   
emb|CDY23516.1|  BnaC06g24850D                                          186   6e-52   
ref|XP_002893327.1|  hypothetical protein ARALYDRAFT_889959             186   7e-52   
ref|XP_010510985.1|  PREDICTED: metalloendoproteinase 1-like            185   8e-52   
gb|KDP32993.1|  hypothetical protein JCGZ_13024                         183   8e-52   
ref|XP_006416025.1|  hypothetical protein EUTSA_v10007920mg             185   8e-52   
ref|XP_010320628.1|  PREDICTED: metalloendoproteinase 1                 184   1e-51   
emb|CDY30915.1|  BnaC09g14910D                                          184   1e-51   
ref|XP_006390919.1|  hypothetical protein EUTSA_v10018701mg             185   2e-51   
ref|XP_010512095.1|  PREDICTED: metalloendoproteinase 1                 184   2e-51   
ref|XP_009105693.1|  PREDICTED: metalloendoproteinase 1-like            184   2e-51   
ref|XP_004953898.1|  PREDICTED: metalloendoproteinase 1-like            184   3e-51   
dbj|BAJ93963.1|  predicted protein                                      183   3e-51   
emb|CDY11609.1|  BnaC06g31300D                                          183   4e-51   
gb|KFK44477.1|  hypothetical protein AALP_AA1G261400                    183   4e-51   
ref|XP_006357274.1|  PREDICTED: metalloendoproteinase 1-like            182   5e-51   
ref|XP_010470167.1|  PREDICTED: metalloendoproteinase 1-like            183   5e-51   
ref|XP_009410261.1|  PREDICTED: metalloendoproteinase 1                 182   6e-51   
ref|XP_008389591.1|  PREDICTED: metalloendoproteinase 1-like            183   6e-51   
ref|XP_010471013.1|  PREDICTED: metalloendoproteinase 1-like            183   7e-51   
emb|CDY38799.1|  BnaA07g28710D                                          182   8e-51   
ref|XP_009418044.1|  PREDICTED: metalloendoproteinase 1-like            182   1e-50   
ref|XP_009104967.1|  PREDICTED: metalloendoproteinase 1-like            182   1e-50   
ref|XP_006300509.1|  hypothetical protein CARUB_v10020468mg             182   1e-50   
gb|EAY79487.1|  hypothetical protein OsI_34615                          181   2e-50   Oryza sativa Indica Group [Indian rice]
gb|KHN16360.1|  Metalloendoproteinase 1                                 179   2e-50   
dbj|BAJ98922.1|  predicted protein                                      181   3e-50   
ref|XP_002274477.1|  PREDICTED: metalloendoproteinase 1                 181   3e-50   Vitis vinifera
ref|NP_001065361.2|  Os10g0557900                                       181   3e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87473.1|  hypothetical protein OsI_08881                          181   3e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_001048075.1|  Os02g0740700                                       181   4e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ24565.1|  hypothetical protein OsJ_08327                          181   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452573.1|  hypothetical protein SORBIDRAFT_04g028370          180   5e-50   Sorghum bicolor [broomcorn]
ref|XP_006367952.1|  PREDICTED: metalloendoproteinase 1-like            180   5e-50   
ref|XP_002318762.2|  MATRIX METALLOproteinASE                           180   6e-50   Populus trichocarpa [western balsam poplar]
ref|XP_007215990.1|  hypothetical protein PRUPE_ppa011783mg             175   7e-50   
gb|EYU22461.1|  hypothetical protein MIMGU_mgv1a008611mg                180   8e-50   
ref|XP_010460187.1|  PREDICTED: metalloendoproteinase 1-like            180   8e-50   
emb|CAN66084.1|  hypothetical protein VITISV_024635                     179   9e-50   Vitis vinifera
ref|XP_002322292.2|  hypothetical protein POPTR_0015s11510g             179   1e-49   Populus trichocarpa [western balsam poplar]
gb|EYU42526.1|  hypothetical protein MIMGU_mgv1a011887mg                176   1e-49   
ref|XP_008379873.1|  PREDICTED: metalloendoproteinase 1-like            177   1e-49   
ref|XP_007033352.1|  Matrixin family protein                            176   2e-49   
ref|XP_003560867.1|  PREDICTED: metalloendoproteinase 1-like            179   3e-49   
ref|XP_006647869.1|  PREDICTED: metalloendoproteinase 1-like            178   3e-49   
ref|NP_001142095.1|  hypothetical protein precursor                     178   3e-49   Zea mays [maize]
ref|XP_004142467.1|  PREDICTED: matrix metalloproteinase-9-like         176   4e-49   
ref|XP_011002109.1|  PREDICTED: metalloendoproteinase 1-like            178   4e-49   
ref|XP_002436777.1|  hypothetical protein SORBIDRAFT_10g008650          178   5e-49   Sorghum bicolor [broomcorn]
ref|XP_011042944.1|  PREDICTED: metalloendoproteinase 1-like            177   7e-49   
ref|XP_011080438.1|  PREDICTED: metalloendoproteinase 1-like            175   1e-48   
ref|XP_007052204.1|  Matrixin family protein                            176   1e-48   
ref|XP_010910625.1|  PREDICTED: metalloendoproteinase 1-like            176   2e-48   
ref|XP_004301194.1|  PREDICTED: metalloendoproteinase 1-like            176   2e-48   
ref|XP_010477738.1|  PREDICTED: metalloendoproteinase 1                 176   3e-48   
emb|CDY66521.1|  BnaCnng51190D                                          176   3e-48   
emb|CBI34984.3|  unnamed protein product                                181   3e-48   
ref|XP_011019812.1|  PREDICTED: metalloendoproteinase 1-like            173   4e-48   
ref|XP_008802827.1|  PREDICTED: metalloendoproteinase 1-like            175   5e-48   
ref|XP_010647716.1|  PREDICTED: metalloendoproteinase 1-like            173   5e-48   
ref|XP_010498935.1|  PREDICTED: metalloendoproteinase 1-like            176   1e-47   
emb|CAN65266.1|  hypothetical protein VITISV_040133                     172   1e-47   
ref|XP_004983677.1|  PREDICTED: metalloendoproteinase 1-like            174   2e-47   
gb|KDP39879.1|  hypothetical protein JCGZ_03410                         173   3e-47   
ref|XP_009136800.1|  PREDICTED: metalloendoproteinase 1-like            172   5e-47   
gb|ACB59207.1|  matrixin family protein                                 172   6e-47   
ref|XP_002511639.1|  Metalloendoproteinase 1 precursor, putative        172   9e-47   
ref|XP_006361512.1|  PREDICTED: metalloendoproteinase 1-like            171   9e-47   
ref|XP_003574325.2|  PREDICTED: metalloendoproteinase 1-like            174   1e-46   
ref|XP_004169198.1|  PREDICTED: metalloendoproteinase 1-like            170   1e-46   
dbj|BAJ94176.1|  predicted protein                                      172   1e-46   
ref|XP_004152428.1|  PREDICTED: metalloendoproteinase 1-like            170   1e-46   
gb|KDP28814.1|  hypothetical protein JCGZ_14585                         171   2e-46   
ref|XP_004511690.1|  PREDICTED: metalloendoproteinase 1-like            171   2e-46   
ref|XP_002870142.1|  hypothetical protein ARALYDRAFT_493212             171   2e-46   
ref|XP_009780227.1|  PREDICTED: metalloendoproteinase 1-like            170   3e-46   
ref|XP_002464938.1|  hypothetical protein SORBIDRAFT_01g029150          170   3e-46   
ref|XP_010089255.1|  Metalloendoproteinase 1                            169   4e-46   
ref|XP_006355432.1|  PREDICTED: metalloendoproteinase 1-like            169   5e-46   
emb|CDX90504.1|  BnaA03g42770D                                          169   5e-46   
ref|XP_010053954.1|  PREDICTED: metalloendoproteinase 1                 169   8e-46   
ref|XP_008658321.1|  PREDICTED: metalloendoproteinase 1-like            169   8e-46   
gb|KGN52411.1|  hypothetical protein Csa_5G632100                       168   9e-46   
ref|XP_008373793.1|  PREDICTED: metalloendoproteinase 1-like            169   9e-46   
emb|CDY16241.1|  BnaA09g29750D                                          169   1e-45   
ref|XP_010434790.1|  PREDICTED: metalloendoproteinase 1-like            168   2e-45   
ref|XP_009610496.1|  PREDICTED: metalloendoproteinase 1-like            168   2e-45   
gb|KGN50256.1|  hypothetical protein Csa_5G162050                       168   2e-45   
ref|XP_010325488.1|  PREDICTED: metalloendoproteinase 1                 167   3e-45   
ref|XP_009115471.1|  PREDICTED: metalloendoproteinase 1                 168   3e-45   
ref|XP_006283956.1|  hypothetical protein CARUB_v10005079mg             167   4e-45   
gb|AET01165.2|  matrix metalloproteinase                                167   5e-45   
ref|XP_010440122.1|  PREDICTED: metalloendoproteinase 1-like            167   6e-45   
ref|NP_193397.1|  Matrixin family protein                               167   7e-45   
gb|AAO42162.1|  putative proteinase                                     167   7e-45   
ref|XP_008437072.1|  PREDICTED: metalloendoproteinase 1                 166   8e-45   
ref|XP_010449738.1|  PREDICTED: metalloendoproteinase 1-like            166   9e-45   
ref|XP_007210794.1|  hypothetical protein PRUPE_ppa018176mg             166   1e-44   
ref|XP_004248606.1|  PREDICTED: metalloendoproteinase 1-like            166   1e-44   
gb|EYU29747.1|  hypothetical protein MIMGU_mgv1a025729mg                160   1e-44   
ref|XP_009629020.1|  PREDICTED: metalloendoproteinase 1-like            166   1e-44   
ref|XP_008369492.1|  PREDICTED: metalloendoproteinase 1                 166   2e-44   
ref|XP_006577655.1|  PREDICTED: metalloendoproteinase 1-like            166   2e-44   
ref|XP_006583548.1|  PREDICTED: metalloendoproteinase 1-like            166   2e-44   
ref|XP_003626689.1|  Matrix metalloproteinase-27                        166   2e-44   
ref|XP_003573113.1|  PREDICTED: metalloendoproteinase 1-like            166   3e-44   
ref|XP_008238512.1|  PREDICTED: metalloendoproteinase 1                 165   3e-44   
ref|XP_011020982.1|  PREDICTED: metalloendoproteinase 1-like            162   3e-44   
gb|EYU20655.1|  hypothetical protein MIMGU_mgv1a025968mg                159   3e-44   
ref|XP_010451026.1|  PREDICTED: metalloendoproteinase 1-like            165   3e-44   
ref|XP_010264331.1|  PREDICTED: metalloendoproteinase 1-like            164   4e-44   
ref|NP_001057259.1|  Os06g0239100                                       165   4e-44   
ref|XP_006375259.1|  hypothetical protein POPTR_0014s05720g             164   4e-44   
ref|XP_009334548.1|  PREDICTED: metalloendoproteinase 1                 164   4e-44   
emb|CDY40518.1|  BnaC01g19940D                                          164   5e-44   
gb|EYU29520.1|  hypothetical protein MIMGU_mgv1a018504mg                162   5e-44   
gb|EAZ00310.1|  hypothetical protein OsI_22327                          164   5e-44   
ref|XP_007157295.1|  hypothetical protein PHAVU_002G058000g             164   6e-44   
ref|XP_006387815.1|  hypothetical protein POPTR_0547s00200g             164   6e-44   
gb|KHN25070.1|  Metalloendoproteinase 1                                 164   7e-44   
ref|XP_007134548.1|  hypothetical protein PHAVU_010G056300g             164   8e-44   
ref|XP_007010972.1|  Matrixin family protein                            162   8e-44   
gb|AAM62476.1|  proteinase like protein                                 164   9e-44   
gb|EYU29746.1|  hypothetical protein MIMGU_mgv1a022148mg                158   1e-43   
ref|XP_011001486.1|  PREDICTED: metalloendoproteinase 1-like            163   1e-43   
ref|XP_006369019.1|  senescence-specific family protein                 163   2e-43   
gb|EYU34693.1|  hypothetical protein MIMGU_mgv1a025583mg                157   2e-43   
gb|KCW77797.1|  hypothetical protein EUGRSUZ_D02088                     163   2e-43   
ref|XP_009145660.1|  PREDICTED: metalloendoproteinase 1-like            162   2e-43   
ref|XP_003538740.1|  PREDICTED: metalloendoproteinase 1-like            162   2e-43   
ref|XP_007041108.1|  Matrix metalloproteinase, putative                 160   3e-43   
ref|XP_007216495.1|  hypothetical protein PRUPE_ppa023859mg             157   3e-43   
ref|XP_007151139.1|  hypothetical protein PHAVU_004G021000g             160   3e-43   
ref|XP_002534615.1|  Metalloendoproteinase 1 precursor, putative        161   3e-43   
emb|CDP09976.1|  unnamed protein product                                160   4e-43   
gb|EYU31934.1|  hypothetical protein MIMGU_mgv1a021000mg                162   4e-43   
ref|XP_010053486.1|  PREDICTED: metalloendoproteinase 1-like            162   4e-43   
ref|XP_002969781.1|  hypothetical protein SELMODRAFT_13930              160   6e-43   
gb|AGT16050.1|  metalloendoproteinase                                   161   7e-43   
ref|XP_010444942.1|  PREDICTED: metalloendoproteinase 1-like            161   8e-43   
gb|KHN34932.1|  Metalloendoproteinase 1                                 160   1e-42   
ref|XP_003618349.1|  Interstitial collagenase                           160   1e-42   
ref|XP_003516663.2|  PREDICTED: metalloendoproteinase 1-like            160   1e-42   
ref|XP_006477577.1|  PREDICTED: metalloendoproteinase 1-like            160   1e-42   
ref|XP_006414320.1|  hypothetical protein EUTSA_v10025551mg             160   2e-42   
ref|XP_007039816.1|  Matrixin family protein                            160   2e-42   
ref|XP_007219228.1|  hypothetical protein PRUPE_ppa017777mg             160   3e-42   
ref|XP_006440301.1|  hypothetical protein CICLE_v10024210mg             159   3e-42   
ref|XP_007157294.1|  hypothetical protein PHAVU_002G058000g             157   4e-42   
ref|XP_003611315.1|  Matrix metalloproteinase-28                        159   4e-42   
ref|XP_009397655.1|  PREDICTED: metalloendoproteinase 1-like            159   6e-42   
ref|XP_004963649.1|  PREDICTED: metalloendoproteinase 1-like            159   6e-42   
ref|XP_011033214.1|  PREDICTED: metalloendoproteinase 1                 159   7e-42   
ref|XP_010055492.1|  PREDICTED: metalloendoproteinase 1                 158   1e-41   
gb|EYU19330.1|  hypothetical protein MIMGU_mgv1a010192mg                156   3e-41   
ref|XP_009398117.1|  PREDICTED: metalloendoproteinase 1                 156   6e-41   
ref|XP_008458908.1|  PREDICTED: metalloendoproteinase 1-like            155   6e-41   
ref|XP_002979138.1|  hypothetical protein SELMODRAFT_110370             155   9e-41   
ref|XP_011032037.1|  PREDICTED: metalloendoproteinase 1                 157   9e-41   
ref|XP_011094514.1|  PREDICTED: metalloendoproteinase 1                 155   2e-40   
ref|XP_001774956.1|  predicted protein                                  153   2e-40   
emb|CAN66781.1|  hypothetical protein VITISV_013507                     154   4e-40   
ref|XP_011010768.1|  PREDICTED: metalloendoproteinase 1-like            150   4e-40   
gb|EPS70970.1|  hypothetical protein M569_03790                         153   5e-40   
ref|XP_011081262.1|  PREDICTED: metalloendoproteinase 1-like            154   6e-40   
ref|XP_002988587.1|  hypothetical protein SELMODRAFT_128150             153   8e-40   
emb|CDP09487.1|  unnamed protein product                                152   1e-39   
ref|XP_010524412.1|  PREDICTED: metalloendoproteinase 1                 152   1e-39   
ref|XP_003635123.1|  PREDICTED: metalloendoproteinase 1                 151   1e-39   
ref|XP_004510108.1|  PREDICTED: metalloendoproteinase 1-like            152   2e-39   
ref|XP_004142464.1|  PREDICTED: metalloendoproteinase 1-like            151   2e-39   
gb|EYU34692.1|  hypothetical protein MIMGU_mgv1a022100mg                146   2e-39   
ref|XP_007099566.1|  Matrix metalloproteinase, putative                 149   2e-39   
ref|XP_006371425.1|  hypothetical protein POPTR_0019s10250g             147   2e-39   
ref|XP_010647721.1|  PREDICTED: metalloendoproteinase 1-like            150   3e-39   
ref|XP_010538414.1|  PREDICTED: metalloendoproteinase 1                 152   3e-39   
ref|WP_001265815.1|  hypothetical protein                               148   8e-39   
ref|XP_003562240.2|  PREDICTED: metalloendoproteinase 1                 150   9e-39   
ref|XP_002304280.1|  hypothetical protein POPTR_0003s07510g             147   4e-38   
ref|XP_004167465.1|  PREDICTED: metalloendoproteinase 1-like            144   6e-38   
ref|XP_010676950.1|  PREDICTED: metalloendoproteinase 1-like            147   3e-37   
ref|XP_010692448.1|  PREDICTED: metalloendoproteinase 1                 146   4e-37   
ref|XP_009554452.1|  PREDICTED: matrilysin                              143   5e-37   
ref|XP_001779172.1|  predicted protein                                  143   5e-37   
ref|XP_010647717.1|  PREDICTED: metalloendoproteinase 1-like            144   6e-37   
gb|KFO69571.1|  Stromelysin-1                                           143   6e-37   
ref|XP_007217818.1|  hypothetical protein PRUPE_ppb019632mg             142   7e-37   
ref|XP_006397684.1|  hypothetical protein EUTSA_v10001525mg             144   1e-36   
emb|CDY18956.1|  BnaC04g03940D                                          144   2e-36   
gb|AAC31167.1|  metalloproteinase                                       144   2e-36   
ref|WP_014642607.1|  M10 family peptidase                               144   2e-36   
ref|XP_002309553.2|  hypothetical protein POPTR_0006s25750g             142   4e-36   
gb|KFK37298.1|  hypothetical protein AALP_AA4G239100                    142   5e-36   
ref|NP_182030.1|  matrixin family protein                               142   6e-36   
emb|CDX74706.1|  BnaA05g04520D                                          142   6e-36   
ref|XP_010508218.1|  PREDICTED: metalloendoproteinase 1-like            142   9e-36   
ref|XP_005346839.1|  PREDICTED: matrilysin                              140   1e-35   
ref|XP_009143096.1|  PREDICTED: metalloendoproteinase 1                 142   1e-35   
ref|XP_006431002.1|  hypothetical protein CICLE_v10013597mg             138   2e-35   
ref|XP_005149869.1|  PREDICTED: matrilysin                              139   2e-35   
ref|XP_009685061.1|  PREDICTED: matrilysin                              139   2e-35   
ref|XP_009640064.1|  PREDICTED: matrilysin                              139   3e-35   
gb|KGL80216.1|  Matrilysin                                              138   3e-35   
gb|KFP18449.1|  Stromelysin-1                                           138   3e-35   
gb|KFV87419.1|  Matrilysin                                              138   3e-35   
gb|KHN01125.1|  Metalloendoproteinase 1                                 138   4e-35   
gb|EFB17312.1|  hypothetical protein PANDA_010999                       137   4e-35   
ref|XP_004626205.1|  PREDICTED: neutrophil collagenase                  142   5e-35   
ref|XP_010129608.1|  PREDICTED: matrilysin                              137   6e-35   
ref|XP_002922067.1|  PREDICTED: matrilysin-like                         137   7e-35   
ref|XP_002198049.2|  PREDICTED: 72 kDa type IV collagenase-like         137   7e-35   
ref|XP_010217214.1|  PREDICTED: matrilysin                              139   7e-35   
gb|KFO84409.1|  Matrix metalloproteinase-18                             137   8e-35   
gb|KFP91609.1|  Matrilysin                                              137   1e-34   
ref|XP_009873395.1|  PREDICTED: matrilysin                              137   1e-34   
gb|KFR13852.1|  Matrilysin                                              136   2e-34   
ref|XP_009936824.1|  PREDICTED: matrilysin                              136   2e-34   
ref|XP_004052079.1|  PREDICTED: matrix metalloproteinase-20             140   3e-34   
ref|XP_010518113.1|  PREDICTED: metalloendoproteinase 1-like            138   3e-34   
ref|XP_005230633.1|  PREDICTED: stromelysin-2                           137   5e-34   
ref|XP_007495036.1|  PREDICTED: matrilysin                              136   5e-34   
gb|KFQ16528.1|  Stromelysin-1                                           135   6e-34   
ref|XP_009958192.1|  PREDICTED: matrilysin                              135   7e-34   
ref|XP_002440092.1|  hypothetical protein SORBIDRAFT_09g025870          137   7e-34   
ref|XP_004661963.1|  PREDICTED: matrix metalloproteinase-20             138   9e-34   
ref|XP_003496183.1|  PREDICTED: matrix metalloproteinase-20             138   9e-34   
ref|XP_004870849.1|  PREDICTED: neutrophil collagenase isoform X1       138   1e-33   
prf||1905425A  metalloprotease                                          132   1e-33
ref|XP_004900298.1|  PREDICTED: neutrophil collagenase isoform X1       138   1e-33   
ref|XP_002880153.1|  matrix metalloproteinase                           136   1e-33   
gb|KDO61427.1|  hypothetical protein CISIN_1g037540mg                   135   2e-33   
ref|XP_010129795.1|  PREDICTED: interstitial collagenase-like           137   2e-33   
ref|XP_007637744.1|  PREDICTED: matrix metalloproteinase-20             137   2e-33   
ref|XP_004604868.1|  PREDICTED: matrix metalloproteinase-20             137   2e-33   
gb|KFO86870.1|  Interstitial collagenase                                137   2e-33   
gb|KFV43873.1|  Stromelysin-2                                           134   2e-33   
gb|KFP52111.1|  Matrilysin                                              134   2e-33   
ref|XP_009973912.1|  PREDICTED: matrilysin                              134   2e-33   
ref|XP_010156415.1|  PREDICTED: matrilysin                              133   2e-33   
gb|ERE75957.1|  matrix metalloproteinase-20                             138   2e-33   
ref|XP_005077401.1|  PREDICTED: matrix metalloproteinase-20             136   2e-33   
gb|KFW11249.1|  Matrilysin                                              133   2e-33   
ref|XP_006907576.1|  PREDICTED: neutrophil collagenase                  137   3e-33   
ref|XP_006983832.1|  PREDICTED: matrix metalloproteinase-20             137   3e-33   
gb|EYU20657.1|  hypothetical protein MIMGU_mgv1a0176451mg               130   3e-33   
ref|WP_035319307.1|  hypothetical protein                               133   3e-33   
gb|AAT70722.1|  matrix metalloproteinase 20 (enamelysin)                137   4e-33   
ref|XP_008828119.1|  PREDICTED: matrix metalloproteinase-20             136   4e-33   
ref|NP_004762.2|  matrix metalloproteinase-20 preproprotein             136   4e-33   
emb|CAA73317.1|  enamelysin                                             136   5e-33   
gb|ABK51704.1|  matrix metalloproteinase 20                             136   5e-33   
ref|XP_003764326.1|  PREDICTED: matrilysin                              132   5e-33   
ref|XP_005010554.1|  PREDICTED: matrilysin isoform X2                   133   5e-33   
ref|XP_003613392.1|  Matrix metalloprotease                             134   5e-33   
ref|XP_010891574.1|  PREDICTED: matrix metalloproteinase-20-like ...    136   5e-33   
gb|EOB07965.1|  Matrilysin                                              132   5e-33   
ref|XP_001153208.1|  PREDICTED: matrix metalloproteinase-20             136   5e-33   
ref|XP_008577849.1|  PREDICTED: matrilysin                              132   6e-33   
ref|XP_007890011.1|  PREDICTED: neutrophil collagenase-like             136   6e-33   
ref|XP_006206761.1|  PREDICTED: matrix metalloproteinase-20             136   6e-33   
ref|XP_009070762.1|  PREDICTED: matrilysin                              132   6e-33   
ref|XP_005474674.1|  PREDICTED: matrix metalloproteinase-20-like ...    136   7e-33   
ref|XP_003828430.1|  PREDICTED: matrix metalloproteinase-20             136   7e-33   
gb|ELT91654.1|  hypothetical protein CAPTEDRAFT_219025                  136   7e-33   
gb|KFV96739.1|  Stromelysin-1                                           132   7e-33   
ref|XP_005010553.1|  PREDICTED: matrilysin isoform X1                   132   7e-33   
ref|XP_005432126.1|  PREDICTED: 72 kDa type IV collagenase-like         134   7e-33   
ref|XP_009571839.1|  PREDICTED: matrilysin                              132   7e-33   
ref|XP_006293383.1|  hypothetical protein CARUB_v10023542mg             134   7e-33   
gb|KFP78211.1|  Matrilysin                                              132   7e-33   
ref|XP_009083841.1|  PREDICTED: matrilysin                              133   7e-33   
ref|XP_007434824.1|  PREDICTED: macrophage metalloelastase-like         132   8e-33   
ref|XP_008688374.1|  PREDICTED: matrilysin                              133   8e-33   
ref|XP_005378041.1|  PREDICTED: neutrophil collagenase isoform X1       135   8e-33   
ref|XP_003253094.1|  PREDICTED: matrix metalloproteinase-20             135   8e-33   
ref|XP_007215299.1|  hypothetical protein PRUPE_ppa005073mg             135   8e-33   
ref|XP_005346838.1|  PREDICTED: matrix metalloproteinase-20             135   8e-33   
ref|XP_008348251.1|  PREDICTED: metalloendoproteinase 1-like            130   8e-33   
gb|KDO37620.1|  hypothetical protein CISIN_1g039712mg                   130   8e-33   
ref|XP_004385917.1|  PREDICTED: matrix metalloproteinase-20             135   8e-33   
ref|XP_002708614.1|  PREDICTED: matrix metalloproteinase-20             135   9e-33   
ref|XP_003764327.1|  PREDICTED: matrix metalloproteinase-20             135   9e-33   



>ref|XP_008458713.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=282

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 170/272 (63%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G KKGD+V+G++ +KKYL+ FGY+N+  +  S    D F + LE A++TYQ   +L +
Sbjct  10   LNGCKKGDKVEGIHQMKKYLQHFGYMNNDVHIHSKSSDDEFDEILEFAVKTYQINYNLKA  69

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LD  T+ QM+KPRCGVADIINGR G  S                 V ++ F+ G  K
Sbjct  70   TGTLDNSTISQMSKPRCGVADIINGRTGMKSGKRLVNRHRKIIGHFHEVSHFAFFEGNLK  129

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHG  492
            WPN KS LT+GF PGTP++   PV  A   W    HFSF Q + YE+AD+K +  RGDHG
Sbjct  130  WPNSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESNYENADIKVTFERGDHG  189

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFD  GG  AHAF+PT G  HFDA E+W D    P+S D+ +VA+HEIGHLLGL HS
Sbjct  190  DGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWAD-GAVPNSYDMETVALHEIGHLLGLHHS  248

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V GA+MW     G   + L  DDI GI+ LY
Sbjct  249  SVEGAIMWPSI-MGGTTKGLHADDIEGIKVLY  279



>ref|XP_004142457.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004170680.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52418.1| hypothetical protein Csa_5G633160 [Cucumis sativus]
Length=313

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 169/272 (62%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G KKGD+V+G++ +KKYL+ FGY+N+  +  S    D F + LE A++TYQ   +L  
Sbjct  41   LKGCKKGDKVEGIHQMKKYLQHFGYLNNDVHIRSESSDDEFDEILEFAVKTYQINYNLKV  100

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LD  T+ QM+KPRCGVADIING+    S                 V ++ F+ G  +
Sbjct  101  TGTLDNSTLMQMSKPRCGVADIINGKTSMKSGKRFVNQHRKISGHFHEVSHFAFFEGNLR  160

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHG  492
            WP+ KS LT+GF PGTP++   PV  A   W    HFSF Q ++YE+AD+K S  +GDHG
Sbjct  161  WPDSKSHLTYGFLPGTPSEAISPVNRAFTTWAANTHFSFSQESKYENADIKISFEKGDHG  220

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFD  GG  AHAF+PT G  HFDA E+W D    P S D+ +VA+HEIGHLLGL HS
Sbjct  221  DGFPFDSVGGVLAHAFAPTDGRLHFDAVEHWAD-GAVPKSYDMETVALHEIGHLLGLHHS  279

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V GA+MW     G   + L  DDI GI+ LY
Sbjct  280  SVEGAIMWPSI-MGGATKGLHADDIEGIKVLY  310



>ref|XP_008230962.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=314

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 165/269 (61%), Gaps = 16/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+  ++ D F DQLESAI+TYQ   HL +
Sbjct  47   LKGCHKGDKVQGIKDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQINYHLKA  104

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS------------EVVPNYRFYPGEPKWPN  324
            TG LDA TV  M  PRCGVADIING     S              V +Y F+ G PKWP 
Sbjct  105  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGKKRHPHHHHGGHTVAHYSFFQGNPKWPA  164

Query  325  QKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHGDGV  501
             K  LT+ F  GTPA+   PV +A + W    HF+F   Q  ++ DL  S  RG+HGDG 
Sbjct  165  SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEVQSNQNPDLTVSFHRGNHGDGA  224

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGPGG  AHAF+PT G  H+DA E W     S  + D++SVA+HEIGHLLGL HS V 
Sbjct  225  PFDGPGGTIAHAFAPTNGRFHYDAAEAWAVGAVSG-AFDLQSVALHEIGHLLGLGHSSVQ  283

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GA+M+     G   + L  DDI GI+ALY
Sbjct  284  GAIMFPSIGTGVTEQSLHGDDIQGIKALY  312



>gb|KDP45996.1| hypothetical protein JCGZ_11899 [Jatropha curcas]
 gb|KDP45997.1| hypothetical protein JCGZ_11900 [Jatropha curcas]
Length=309

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/271 (49%), Positives = 167/271 (62%), Gaps = 17/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQGSKKGD++KG++ LKKYLK FGY++    N S  D D F D LESA++ YQ   HLN+
Sbjct  43   LQGSKKGDKIKGIHELKKYLKHFGYLS--CENQSFADDDEFDDVLESALKVYQLNYHLNT  100

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS------------EVVPNYRFYPGEPKWPN  324
            TG LD +T+  M  PRCG+ DIING     S             +V +Y F+ G+PKWP 
Sbjct  101  TGFLDYETMSIMMMPRCGIPDIINGSTRMLSGKNNHRHSSSSFHMVSHYTFFRGKPKWPV  160

Query  325  QKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV  501
             K  LT+GF P TP +    V  A   W  V  F F   Q Y+ ADLK    RG+HGDG+
Sbjct  161  SKYNLTYGFEPSTPTEARGAVANAFETWATVTKFKFTSVQDYKTADLKIGFYRGEHGDGL  220

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGPGG  AHAF+P  G  H+DADE +        + D+++VA+HEIGHLLGL HS + 
Sbjct  221  PFDGPGGITAHAFAPQDGRFHYDADEKYAV-GAVQGAFDLKTVALHEIGHLLGLQHSSLQ  279

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
             AVM++    G   +DLT DD+ GIRALY+F
Sbjct  280  AAVMYAYTSRGVT-KDLTADDVQGIRALYNF  309



>ref|XP_008230959.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 164/269 (61%), Gaps = 20/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ NLK YL+ FGY+N  + N      DYF D+LE AI+TYQ   HL  
Sbjct  50   LKGCHKGDKVQGIQNLKIYLEKFGYLNGNTNND-----DYFDDELELAIKTYQINYHLKV  104

Query  181  TGILDADTVRQMTKPRCGVADIING----RPG------GPSEVVPNYRFYPGEPKWPNQK  330
            TG LDA TV++M  PRCGV DIING    R G      G +  V +Y F+ G PKWP  K
Sbjct  105  TGTLDAKTVKKMEIPRCGVPDIINGTTSMRSGNKRGGHGSTHTVGHYAFFQGNPKWPANK  164

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV--  501
              LT+GF  GTP++    V  A   W    HF+F + Q +E ADLK    RGDHGDG   
Sbjct  165  YHLTYGFLQGTPSEAVGAVARAFATWQGNTHFTFSQAQSFESADLKIGFGRGDHGDGANN  224

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
             FDGPG   AHAF P+ G  H+DADE WV     P   D+ +VA+HEIGHLLGLDHS V 
Sbjct  225  AFDGPGKTIAHAFPPSDGRFHYDADETWVV-GAVPGGFDLETVALHEIGHLLGLDHSSVS  283

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GAVM S+   G   + L  DD+ GIRALY
Sbjct  284  GAVMQSQIPSGY-TQSLHADDVQGIRALY  311



>ref|XP_008230963.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 163/270 (60%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY   LS N+   + D F DQLESAI+TYQ   HL +
Sbjct  47   LKGCHKGDKVQGIQDLKKYLGKFGY---LSSNNGHLNDDDFDDQLESAIKTYQINYHLKA  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS------------EVVPNYRFYPGEPKWPN  324
            TG LDA TV  M  PRCGVADIING     S              V NY F+ G P WP 
Sbjct  104  TGTLDAKTVSNMMMPRCGVADIINGTSSMRSGQKRHPHHHHRGHTVANYSFFQGNPTWPA  163

Query  325  QKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV  501
             K  LT+ F  GTPA+   PV +A + W    HF+F   Q  ++ DL  S  RGDHGDG 
Sbjct  164  SKYHLTYAFLQGTPAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGT  223

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGPGG  AHAF+PT G  H+DADE +     S  + D  ++A+HEIGHLLGL HS V 
Sbjct  224  PFDGPGGTIAHAFAPTNGRLHYDADERFSVGAVSG-AYDFETIALHEIGHLLGLGHSSVQ  282

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
             A+M+     G+ ++ L  DDI GI+ALY+
Sbjct  283  EAIMFPSVRSGETQQSLHGDDIQGIKALYN  312



>ref|XP_007216922.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
 gb|EMJ18121.1| hypothetical protein PRUPE_ppa018385mg, partial [Prunus persica]
Length=297

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/257 (51%), Positives = 159/257 (62%), Gaps = 14/257 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY   LS N+   + D F DQLESAI+TYQ   HL +
Sbjct  52   LKGCHKGDKVQGIQDLKKYLGKFGY---LSSNNGHLNDDDFDDQLESAIKTYQINYHLKA  108

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG LDA TV  M  PRCGVADIIN         V NY F+   P WP  K  LT+ F  G
Sbjct  109  TGTLDAKTVSNMMMPRCGVADIIN---------VANYSFFEENPTWPASKYHLTYAFLQG  159

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
            TPA+   PV +A + W    HF+F   Q  ++ DL  S  RGDHGDG PFDGPGG  AHA
Sbjct  160  TPAEAMGPVSSAFQTWAANTHFTFSEAQNNQNPDLTVSFNRGDHGDGTPFDGPGGTIAHA  219

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F+PT G  H+DADE +     S  + D  +VA+HEIGHLLGL HS V GA+M+     G 
Sbjct  220  FAPTNGRLHYDADERFSVGAVSG-AYDFETVALHEIGHLLGLRHSSVQGAIMFPSVRAGV  278

Query  718  KRRDLTPDDINGIRALY  768
             ++ L  DDI GI+ALY
Sbjct  279  TQQSLHGDDIQGIKALY  295



>ref|XP_007216839.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
 gb|EMJ18038.1| hypothetical protein PRUPE_ppa022514mg, partial [Prunus persica]
Length=296

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 162/257 (63%), Gaps = 13/257 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++    N+  ++ D F DQLESAI+TYQ   HL +
Sbjct  50   LKGCHKGDKVQGIKDLKKYLGKFGYLS--RNNNGHFNDDDFDDQLESAIKTYQINYHLKA  107

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG LDA TV  M  PRCGVADIIN         V +Y F+ G PKWP  K  LT+ F  G
Sbjct  108  TGTLDAKTVSNMMMPRCGVADIIN---------VAHYSFFQGNPKWPASKYHLTYAFLQG  158

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
            TPA+   PV +A + W    HF+F   Q  ++ DL  S  RG+HGDG PFDGPGG  AHA
Sbjct  159  TPAEAMGPVSSAFQTWAANKHFTFSEVQSNQNPDLTVSFHRGNHGDGAPFDGPGGTIAHA  218

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F+PT G  H+DA E W        + D++SVA+HEIGHLLGL HS V GA+M+     G 
Sbjct  219  FAPTNGRFHYDAAEAWAV-GAVTGAFDLQSVALHEIGHLLGLGHSSVQGAIMFPSIGTGV  277

Query  718  KRRDLTPDDINGIRALY  768
             ++ L  DDI GI+ALY
Sbjct  278  TQQSLHGDDIQGIKALY  294



>ref|XP_002517411.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF44953.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=311

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 163/271 (60%), Gaps = 20/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSWDADYFSDQLESAIRTYQTRRHLN  177
            LQG  KGD +KG+++LKKYL+ FGY   LSY N S  + D F D LE A++TYQ   HLN
Sbjct  44   LQGCHKGDNLKGIHDLKKYLENFGY---LSYKNQSHSNDDDFDDLLEYALKTYQFNYHLN  100

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSE-------------VVPNYRFYPGEPKW  318
             TG LD++TV +M  PRCGVADIING     S               V +Y F+PG P+W
Sbjct  101  VTGFLDSETVTKMMMPRCGVADIINGTTRMQSSNKNPHHHSSTSFHTVSHYEFFPGNPRW  160

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGD  495
            P  K  LT+GF PGTP +   PV  A + W    HF F R Q Y  AD+     RGDHGD
Sbjct  161  PASKYHLTYGFLPGTPNQAMEPVAKAFQTWAANTHFRFTRVQDYRAADITIGFHRGDHGD  220

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G PFDG GG  AHAF+P  G  H+D DE+W     +  + D+ +VA+HEIGHLLGL HS 
Sbjct  221  GSPFDGRGGTLAHAFAPQDGRFHYDGDEHWAV-GATQGAFDVETVALHEIGHLLGLGHSS  279

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V GA+M    + G   + L  DDI GIRALY
Sbjct  280  VEGAIMHPSIQSGAT-KGLHSDDIQGIRALY  309



>ref|XP_007014936.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY32555.1| Matrixin family protein, putative [Theobroma cacao]
Length=310

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 165/270 (61%), Gaps = 17/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQG  KG++VK ++ LKKYL++FGY++  S N +  + D F D LESAIRTYQ   +L +
Sbjct  42   LQGCHKGEKVKDIHKLKKYLESFGYLS-YSKNETHANDDDFDDFLESAIRTYQLNYNLKT  100

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-------------EVVPNYRFYPGEPKWP  321
            TG LD+ TV +M   RC VADI NG  G  S               V +Y F+PG PKWP
Sbjct  101  TGTLDSKTVSKMMTSRCAVADITNGTTGMRSGKKRQHPAGSKSFHTVAHYAFFPGNPKWP  160

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            + KS LT+ F PGT A    PV  A + W    HFSF RTQ Y +AD+  S    DH DG
Sbjct  161  DSKSHLTYAFLPGTRADAINPVVRAFQTWAANTHFSFSRTQDYTNADITISFESRDHADG  220

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEV  678
             PFDGP G  AHAF+PT G  H+DADE W     +P +  + ++A+HEIGHLLGL HS V
Sbjct  221  NPFDGPDGTLAHAFAPTNGRFHYDADEQW-SVSVTPGAYHLETIALHEIGHLLGLHHSSV  279

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             GA+M+  F  G+  + L  DDI GIRALY
Sbjct  280  EGAIMYPTFMAGES-KGLHGDDIQGIRALY  308



>ref|XP_008230957.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=310

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 161/268 (60%), Gaps = 20/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N         + D F DQLE+AI+TYQ   HL +
Sbjct  49   LKGCHKGDKVQGIQDLKKYLERFGYLN------GDINNDDFDDQLEAAIKTYQINYHLKA  102

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-----------EVVPNYRFYPGEPKWPNQ  327
            TG LD  T+ +M  PRCGV DIING     S             V +Y F+ G PKWP  
Sbjct  103  TGTLDTKTISKMMMPRCGVPDIINGTTAMRSGKKRHPHHHGGHTVAHYAFFQGSPKWPAN  162

Query  328  KSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVP  504
            K  LT+GFA GTPA     V  A   W    HFSF R +  + ADLK S   G+HGDG P
Sbjct  163  KYHLTYGFARGTPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGRP  222

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPG  684
            FDGPGG  AHA++PT G  H+DADE WV     P  +D+ +VA+HEIGHLLGL+HS V G
Sbjct  223  FDGPGGVLAHAYAPTNGRFHYDADETWVV-GAVPGGMDLETVALHEIGHLLGLEHSSVEG  281

Query  685  AVMWSEFEYGQKRRDLTPDDINGIRALY  768
            AVM      G   + L  DDI GI+ALY
Sbjct  282  AVMLPGIRAGFT-QSLHADDIQGIKALY  308



>ref|XP_008458907.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=316

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 166/273 (61%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSWDADYFSDQLESAIRTYQTRRHLN  177
            L G +KGD+V G++ +K+YL+ FGY+N+   N S S+D D F   LESAI+TYQ   +L 
Sbjct  43   LNGCRKGDKVAGIHQIKEYLQHFGYLNNYLQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  102

Query  178  STGILDADTVRQMTKPRCGVADIINGRP---------------GGPSEVVPNYRFYPGEP  312
            +TG LDA T+  M+KPRCGVADII+G+                 G    V +Y F+ G P
Sbjct  103  ATGTLDAKTLDLMSKPRCGVADIIDGKTRMKSGKKMVNQHRKINGHFHTVSHYAFFDGNP  162

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDH  489
            KWP  K  LT+GF PGTP+K   PV  A + W    HF+F R ++Y+ AD+K S   GDH
Sbjct  163  KWPASKFHLTYGFLPGTPSKAVAPVGRAFKTWGAHTHFNFSRASKYKKADIKISFRSGDH  222

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG  FDG GG  AH F+PT G  HFDA E+W        S D+ +VA+HEIGHLLGL H
Sbjct  223  GDGHSFDGVGGVIAHGFAPTDGRLHFDAIESWAV-GAVADSFDLETVALHEIGHLLGLHH  281

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V GA+MW     G   + L  DDI GI ALY
Sbjct  282  SSVEGAIMWPSIMEGT-TKGLDADDIAGINALY  313



>ref|XP_004296560.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 165/267 (62%), Gaps = 15/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+VKG+ +LKKYL+ +GY+N    N S  D D F D LE A++TYQ   HL S
Sbjct  44   LKGCHKGDKVKGINDLKKYLEKYGYLN--YKNHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG----------GPSEVVPNYRFYPGEPKWPNQK  330
            TG LD+ TV +MT PRCGVADIING             G      +Y F+ G PKWP+ K
Sbjct  102  TGTLDSKTVSKMTTPRCGVADIINGTSSMRSAKKRHHHGSLHTTAHYSFFQGNPKWPSSK  161

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPF  507
              LT+GF P TP++    V  A   W    HF+F + Q YE+ADLK    RG+HGDG  F
Sbjct  162  YHLTYGFLPNTPSEATGAVARAFATWEGNTHFTFSQAQSYENADLKIGFQRGNHGDGAAF  221

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG  AHAFSPT GI H+DADE W      P + D+ +VA+HEIGHLLGL HS V GA
Sbjct  222  DGPGGTLAHAFSPTHGIFHYDADETWSV-GAVPGATDLETVALHEIGHLLGLGHSSVKGA  280

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            +M      G+  R L  DD+ GI+ALY
Sbjct  281  IMEPTLPTGE-TRGLHGDDVQGIKALY  306



>gb|EYU29748.1| hypothetical protein MIMGU_mgv1a025409mg, partial [Erythranthe 
guttata]
Length=262

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 157/259 (61%), Gaps = 14/259 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQGS KG+R  G+  +K YL+ FGY+++L+    +   + F D LESAI+TYQ   ++N 
Sbjct  17   LQGSVKGNRALGISGIKNYLQKFGYLDNLNNTQVN---NLFDDALESAIKTYQQNFNINP  73

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TGILDA TV  M  PRCGV DIIN         V +Y F+ G PKWP  K  LT+GF   
Sbjct  74   TGILDASTVSTMIIPRCGVPDIIN---------VSHYTFFSGNPKWPPSKYNLTYGFLSN  124

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
             PA    P   A ++W N  HF+F+R    +  DL     RG+HGDG  FDGPGG  AHA
Sbjct  125  VPANAVAPAERAFQNWDNATHFTFKRASSGQTPDLTIGFLRGNHGDGASFDGPGGTLAHA  184

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F+PT G  H+DADE W   DP  ++  + +VA+HEIGHLLGL HS +  A+M+     GQ
Sbjct  185  FAPTNGRLHYDADERW-SVDPVANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGQ  243

Query  718  KRRDLTPDDINGIRALYHF  774
             +  L  DDI GI+ALY+ 
Sbjct  244  AKIKLNSDDIQGIKALYNM  262



>emb|CAN59960.1| hypothetical protein VITISV_011608 [Vitis vinifera]
Length=319

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 168/272 (62%), Gaps = 16/272 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG +VK ++ LKKYL+ FGY++   S + +  D D F D LE AI+TYQT  +L 
Sbjct  38   LEGCQKGHKVKDIHKLKKYLQQFGYLSYSHSEHQTHADNDDFDDLLEFAIKTYQTNYYLK  97

Query  178  STGILDADTVRQMTKPRCGVADIING----RPG--------GPSEVVPNYRFYPGEPKWP  321
            ++G LD++TV  M KPRCGVADIING    R G        G    V +Y F  G P+WP
Sbjct  98   ASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSFHTVAHYSFLAGSPRWP  157

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
              K+ LT+ F  GTP+     V  A   W +  +FSF  TQ Y +AD+K    RGDHGDG
Sbjct  158  PSKTHLTYAFLSGTPSTTMSAVTRAFGQWASATNFSFAETQDYTNADMKIGFQRGDHGDG  217

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEV  678
             PFDGPGG  AH+F PT G  HFD DE+WV       + D+ +VA+HEIGHLLGL HS V
Sbjct  218  HPFDGPGGTIAHSFPPTDGRLHFDGDESWVV-GAVAGAFDVETVALHEIGHLLGLGHSSV  276

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
             GA+M+    YG   + L  DDI GI+ALY+F
Sbjct  277  EGAIMFPTIAYGVT-KGLNEDDIQGIQALYNF  307



>ref|XP_007010415.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19225.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 162/272 (60%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQG  KGD+VK +  LKKYL+ FGY++  S N +  + + F D LESAI+TYQ   HLNS
Sbjct  42   LQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDNDFDDLLESAIKTYQLNFHLNS  100

Query  181  TGILDADTVRQMTKPRCGVADIING------------RPGGPSEV--VPNYRFYPGEPKW  318
             G LD +TV +M  PRCGVADIING            R  G   +  V +Y F+P  P+W
Sbjct  101  NGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRW  160

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGD  495
            P  KS LT+ F PGT A    PV  A + W    HF F R   Y  AD+     R DHGD
Sbjct  161  PPSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDHGD  220

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G PFDGPGG  AHAF+PTIG  H+DADE W      P ++ + +VA+HEIGHLLGL HS 
Sbjct  221  GNPFDGPGGTLAHAFAPTIGRFHYDADETW-SVSARPGTMHLETVALHEIGHLLGLSHSS  279

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            +  A+M+     G   + L  DDI GI+ALY+
Sbjct  280  IENAIMYPSITAGTS-KGLARDDIEGIKALYN  310



>ref|XP_007010413.1| Matrixin family protein [Theobroma cacao]
 ref|XP_007099564.1| Matrixin family protein [Theobroma cacao]
 gb|EOY19223.1| Matrixin family protein [Theobroma cacao]
 gb|EOY20464.1| Matrixin family protein [Theobroma cacao]
Length=311

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 162/272 (60%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQG  KGD+VK +  LKKYL+ FGY++  S N +  + D F D LESAI+TYQ   HLNS
Sbjct  42   LQGCHKGDKVKDIRKLKKYLEQFGYLS-YSKNKTHANDDDFDDLLESAIKTYQLNFHLNS  100

Query  181  TGILDADTVRQMTKPRCGVADIING------------RPGGPSEV--VPNYRFYPGEPKW  318
             G LD +TV +M  PRCGVADIING            R  G   +  V +Y F+P  P+W
Sbjct  101  NGALDTETVSKMMMPRCGVADIINGTSGMRSGKKKPHRAAGSKSIHEVSHYAFFPRSPRW  160

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGD  495
            P  KS LT+ F PGT A    PV  A + W    HF F R   Y  AD+     R DHGD
Sbjct  161  PPSKSHLTYAFLPGTRADAVNPVAGAFQTWAANTHFRFSRIDNYRDADITIGFQRRDHGD  220

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G PFDGPGG  AHAF+PT+G  H+DADE W      P ++ + +VA+HEIGHLLGL HS 
Sbjct  221  GNPFDGPGGTLAHAFAPTLGRFHYDADETW-SVSARPGTMHLETVALHEIGHLLGLGHSS  279

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            +  A+M+     G   + L  DDI GI+ALY+
Sbjct  280  IENAIMYPSITAGTS-KGLARDDIEGIKALYN  310



>ref|XP_002275556.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=315

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 166/273 (61%), Gaps = 22/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSW----DADYFSDQLESAIRTYQTRR  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S +    + D F D +ESAI+TYQT  
Sbjct  46   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  102

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGPS------------EVVPNYRFYPGEP  312
            HLN+TG LD++TV QM KPRCG ADIING     S              V +Y F+ G P
Sbjct  103  HLNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRTVAHYSFFSGSP  162

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDH  489
            +WP  K+ LT+ F PGTP+    PV  A   W +  HF+F   Q +  AD+  S  R DH
Sbjct  163  RWPPSKTYLTYAFLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDH  222

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG PFDGPGG  AHAF+PT G  H+D DE W      P+++D+ +VA+HEIGHLLGL H
Sbjct  223  GDGYPFDGPGGTIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVALHEIGHLLGLGH  281

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V  A+M+     G   + L  DDI GI ALY
Sbjct  282  SSVQNAIMFPSISSGVT-KGLHEDDIQGISALY  313



>ref|XP_004288499.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 160/269 (59%), Gaps = 15/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G +KGD+ KGL +LK YL+ FGY+N   Y + S   D F D LE AI+TYQ    L  
Sbjct  46   LKGRQKGDKFKGLNDLKNYLEKFGYLN---YKNRSLFNDDFDDLLEEAIKTYQINYRLEV  102

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----------GGPSEVVPNYRFYPGEPKWPNQK  330
            TG LD  TV +M  PRCGV DIING             G       Y F+PG PKWP+ K
Sbjct  103  TGKLDNKTVSKMMMPRCGVPDIINGTSFMRSANKGHHHGSIHTTALYSFFPGSPKWPSSK  162

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPF  507
              LT+GF PGT ++    V  A   W     F+F   Q Y +ADLK S  RGDHGDGVPF
Sbjct  163  YHLTYGFLPGTRSEATAAVARAFATWAKSSRFTFSPAQSYYNADLKISFQRGDHGDGVPF  222

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG  AH+F P+ G  H+DAD+ W      P + D+ SVA+HEIGHLLGL HS +PGA
Sbjct  223  DGPGGILAHSFCPSDGRFHYDADDTWTV-GAKPGAFDLESVALHEIGHLLGLQHSSLPGA  281

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            VM      G  +  LT DD+ GI+ALY+F
Sbjct  282  VMAPGIPPGVTKTSLTEDDVQGIKALYNF  310



>ref|XP_010037506.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49212.1| hypothetical protein EUGRSUZ_K02792 [Eucalyptus grandis]
Length=311

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 165/273 (60%), Gaps = 22/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDA----DYFSDQLESAIRTYQTRR  168
            LQG  KGD+VKGL  LK+YL+ FGY+N   YN S+       + F + LESA++TYQ   
Sbjct  42   LQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQGHANDEDFDELLESAVKTYQLNY  98

Query  169  HLNSTGILDADTVRQMTKPRCGVADIING----RPGGPS--------EVVPNYRFYPGEP  312
            H+  TG LD+ TV  MT PRCGVADI+NG    R G  +          V ++ F+ G P
Sbjct  99   HMKVTGNLDSQTVAMMTTPRCGVADIVNGTSRMRSGKRTTHHGSNKFHTVGHFTFFDGSP  158

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDH  489
            KWP+ K  LT+   PGT      PV  A + W +  HF+F ++Q YE AD+K + AR DH
Sbjct  159  KWPSSKYHLTYALDPGTQDDVLGPVSRAFKTWASATHFTFSQSQNYESADIKIAFARRDH  218

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG PFDGP G  AHAF PTIG+ H+D DE W    P   S D+ +VA+HEIGHLLGL H
Sbjct  219  GDGAPFDGPSGVIAHAFQPTIGVFHYDGDEPW-SVGPVRGSYDLETVALHEIGHLLGLGH  277

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V GA+M+     G   + L  DD+ GI+ LY
Sbjct  278  SSVAGAIMYPTISPGVS-KGLHGDDVQGIKTLY  309



>ref|XP_004142462.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159088.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52413.1| hypothetical protein Csa_5G632120 [Cucumis sativus]
Length=319

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 165/272 (61%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L GS+KGD+V+G++ LKKYL  FGY+N+ +   S  + D F + LE+AI+TYQ   +L  
Sbjct  46   LYGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENNDDEFDELLETAIKTYQKNYNLKV  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---------------GGPSEVVPNYRFYPGEPK  315
            TG LDA T+ QM+KPRCGVADII+G                  G    V ++ F+ G PK
Sbjct  106  TGTLDAMTIAQMSKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHSVSHFAFFDGNPK  165

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHG  492
            WP  KS LT+GF PGTP++   PV  A   W    HF+F Q    + +D+      GDHG
Sbjct  166  WPATKSHLTYGFLPGTPSETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFETGDHG  225

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDG GG  AHAFSP+ G  H DADE+W +   S  S D+ +VA+HEIGHLLGL HS
Sbjct  226  DGYPFDGVGGVVAHAFSPSDGRFHLDADESWANGVVSD-SFDLETVALHEIGHLLGLQHS  284

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
               GA+MW +   G   + L  DDI GI+ALY
Sbjct  285  STEGAIMWPQVPVG-ASKGLHVDDIAGIKALY  315



>ref|XP_008458714.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=319

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 163/272 (60%), Gaps = 18/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L GS+KGD+V+G++ LKKYL  FGY+N+ +   S    D F + LESAI+TYQ   +L  
Sbjct  46   LHGSQKGDKVEGIHQLKKYLHQFGYLNEDAQIHSENKDDEFDELLESAIKTYQKNYNLKV  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---------------GGPSEVVPNYRFYPGEPK  315
            TG LDA T+ QM KPRCGVADII+G                  G    V ++ F+ G PK
Sbjct  106  TGTLDAMTIAQMLKPRCGVADIIHGNTWMRSSKKRKQLEHGIVGHFHRVSHFAFFDGNPK  165

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHG  492
            WP  KS LT+GF PGTP +   PV  A   W    HF+F Q    + +D+      GDHG
Sbjct  166  WPATKSHLTYGFLPGTPPETVSPVARAFATWAANSHFTFSQALDNQTSDITIGFESGDHG  225

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDG GG  AHAFSP+ G  H DADE+W +   S  S D+ +VA+HEIGHLLGL HS
Sbjct  226  DGYPFDGVGGVVAHAFSPSDGRFHLDADESWANGVVSG-SFDLETVALHEIGHLLGLQHS  284

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             + GA+MW +   G   + L  DDI GI+ALY
Sbjct  285  SIEGAIMWPQVPEG-ASKGLHADDIAGIKALY  315



>ref|XP_008352994.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 161/272 (59%), Gaps = 24/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D D F D LESAI+TYQ   HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DNDDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LDA TV +M  PRCGV DIING     S                 V +Y F+PG PK
Sbjct  98   TGTLDAKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP+ K  LT+ F   TP +    V  A   W    HFSF ++Q YE+ADL  S A GDHG
Sbjct  158  WPSSKYHLTYAFDQTTPTEARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDG GG  AHAF+PT G  H+DADE W        + D+ +VA+HEIGHLLGL HS
Sbjct  218  DGNPFDGRGGTLAHAFAPTNGRFHYDADEPWAV-GAVEGAYDLETVALHEIGHLLGLRHS  276

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V GAVM S    G   + L  DDI GI+ALY
Sbjct  277  SVEGAVMSSTVRTGFA-QSLHADDIQGIKALY  307



>ref|XP_003633209.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=319

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 168/275 (61%), Gaps = 22/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSW----DADYFSDQLESAIRTYQTRR  168
            L+G +KG +VK ++ LKKYL+ FGY   LSY+ S +    D D F D LE AI+TYQT  
Sbjct  38   LEGCQKGHKVKDIHKLKKYLQQFGY---LSYSHSEYQTHADNDDFDDLLEFAIKTYQTNY  94

Query  169  HLNSTGILDADTVRQMTKPRCGVADIING----RPG--------GPSEVVPNYRFYPGEP  312
            +L ++G LD++TV  M KPRCGVADIING    R G        G    V +Y F+ G P
Sbjct  95   YLKASGNLDSETVSVMVKPRCGVADIINGTSRMRSGSRSYPHGYGSLHTVAHYSFFAGSP  154

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDH  489
            +WP   + LT+ F  GT +     V  A   W +   F+F  TQ Y +AD+K    RGDH
Sbjct  155  RWPPSNTHLTYAFLSGTSSTTMSAVTRAFGQWASATDFTFAETQDYTNADMKIGFQRGDH  214

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG PFDGPGG  AH+FSPT G  HFD DE+WV       + D+ +VA+HEIGHLLGL H
Sbjct  215  GDGFPFDGPGGTIAHSFSPTDGRLHFDGDESWVV-GAVAGAFDVETVALHEIGHLLGLGH  273

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            S V GA+++    +G   + L  DDI GI+ALY+F
Sbjct  274  SSVEGAIIFPTIAFGVT-KGLNEDDIQGIQALYNF  307



>ref|XP_008230960.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=313

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 166/269 (62%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+  ++ D F DQLESAI+TYQ   HL +
Sbjct  48   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQLNYHLKA  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-------------EVVPNYRFYPGEPKWP  321
            TG LDA+TV  M  PRCGVADIING     S               V +Y F+ G PKWP
Sbjct  106  TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGV  501
              K  LT+ F  GTPA+   PV  A + W    HF+F ++  ++ DL  S  RG+HGDG 
Sbjct  166  ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN-QNPDLTVSFHRGNHGDGS  224

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGPGG  AHAF+PT G  H+DADE +     S  + D+ +VA+HEIGHLLGL HS V 
Sbjct  225  PFDGPGGTIAHAFAPTNGRFHYDADERFSVGAVSG-AYDLETVALHEIGHLLGLGHSSVL  283

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GA+M+     G   + L  DDI GI+ALY
Sbjct  284  GAIMYPTISPG-ATKGLHGDDIQGIKALY  311



>gb|EYU18042.1| hypothetical protein MIMGU_mgv1a018853mg [Erythranthe guttata]
Length=287

 Score =   234 bits (598),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 155/257 (60%), Gaps = 14/257 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQGS KGDR  G+  LK YL+ FGY+ +L+    +   + F D LESAI+TYQ   ++N 
Sbjct  42   LQGSVKGDRTLGISGLKSYLQKFGYLENLNNTQVN---NVFDDALESAIKTYQQNFNINP  98

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TGILDA TV  M  PRCGV DIIN         V +Y F+ G PKWP  K  LT+ F   
Sbjct  99   TGILDAATVSTMIIPRCGVPDIIN---------VSHYTFFLGNPKWPASKYNLTYEFLSN  149

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQYEH-ADLKFSLARGDHGDGVPFDGPGGNYAHA  537
             P+    PV  A ++W N  HF+F+R+  +  ADL     RG HGDG  FDGPGG  AHA
Sbjct  150  VPSNAVAPVERAFQNWDNATHFTFRRSSSDQTADLIIEFQRGYHGDGASFDGPGGTLAHA  209

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F+PT G  H+DADE W   DP  ++  + +VA+HEIGHLLGL HS +  A+M+     G 
Sbjct  210  FAPTNGRFHYDADERW-SVDPVANTFHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGT  268

Query  718  KRRDLTPDDINGIRALY  768
             +  L  DDI GI+ALY
Sbjct  269  AKIKLNTDDIQGIKALY  285



>ref|XP_008230675.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=305

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 166/269 (62%), Gaps = 18/269 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+  ++ D F DQLESAI+TYQ   HL +
Sbjct  40   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQLNYHLKA  97

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-------------EVVPNYRFYPGEPKWP  321
            TG LDA+TV  M  PRCGVADIING     S               V +Y F+ G PKWP
Sbjct  98   TGTLDAETVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  157

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGV  501
              K  LT+ F  GTPA+   PV  A + W    HF+F ++  ++ DL  S  RG+HGDG 
Sbjct  158  ASKYHLTYAFLQGTPAEATGPVARAFQTWAANTHFTFSQSN-QNPDLTVSFHRGNHGDGS  216

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGPGG  AHAF+PT G  H+DADE +     S  + D+ +VA+HEIGHLLGL HS V 
Sbjct  217  PFDGPGGTIAHAFAPTNGRFHYDADERFSVGAVSG-AYDLETVALHEIGHLLGLGHSSVL  275

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GA+M+     G   + L  DDI GI+ALY
Sbjct  276  GAIMYPTISPG-ATKGLHGDDIQGIKALY  303



>ref|XP_007217804.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
 gb|EMJ19003.1| hypothetical protein PRUPE_ppa024325mg, partial [Prunus persica]
Length=406

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 161/260 (62%), Gaps = 16/260 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  + N      D+F D+LESAI+TYQ   HL  
Sbjct  157  LKGCHKGDKVQGIQDLKKYLEKFGYLNGNTNND-----DHFDDELESAIKTYQINYHLKV  211

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG-GPSEVVPNYRFYPGEPKWPNQKSQLTFGFAP  357
            TG LDA TV++M  PRCG       R G G +  V +Y F+ G PKWP  K  LT+GF  
Sbjct  212  TGTLDAKTVKKMEMPRCG-----KKRGGHGSTHTVGHYAFFQGNPKWPANKYHLTYGFLQ  266

Query  358  GTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV--PFDGPGGNY  528
            GT ++    V  A   W +  HF+F + Q +E ADLK    RGDHGDG    FDGPG   
Sbjct  267  GTQSEAVGAVARAFATWQSNTHFTFSQAQSFESADLKIGFGRGDHGDGANNAFDGPGKTI  326

Query  529  AHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFE  708
            AHAF PT G  H+DADE WV     P   D+ +VA+HEIGHLLGLDHS VPGAVM S+  
Sbjct  327  AHAFRPTNGRFHYDADETWVV-GAVPGGFDLETVALHEIGHLLGLDHSSVPGAVMQSQIP  385

Query  709  YGQKRRDLTPDDINGIRALY  768
             G   + L  DD+ GIRALY
Sbjct  386  PGYT-QSLHADDVQGIRALY  404



>ref|XP_008343421.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/272 (49%), Positives = 158/272 (58%), Gaps = 24/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D D F D LESAI+TYQ   HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DNDDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LD  TV +M  PRCGV DIING     S                 V +Y F+PG PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP+ K  LT+ F   TP      V  A   W    HFSF ++Q YE+ADL  S A GDHG
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PF G GG  AHAF+PT G  H+DADE W        + D+ +VA+HEIGHLLGL HS
Sbjct  218  DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWAV-GAVEGAYDLETVALHEIGHLLGLRHS  276

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V GAVM S    G   + L  DDI GI+ALY
Sbjct  277  SVEGAVMSSTVRTGFA-QSLHADDIQGIKALY  307



>ref|XP_010037507.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
 gb|KCW49217.1| hypothetical protein EUGRSUZ_K02797 [Eucalyptus grandis]
Length=311

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 164/273 (60%), Gaps = 22/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDA----DYFSDQLESAIRTYQTRR  168
            LQG  KGD+VKGL  LK+YL+ FGY+N   YN S+       D F + LESAI+ YQ   
Sbjct  42   LQGCHKGDKVKGLQELKQYLEKFGYLN---YNQSNLQTNANDDDFDELLESAIKLYQLNY  98

Query  169  HLNSTGILDADTVRQMTKPRCGVADIING----RPG------GPSE--VVPNYRFYPGEP  312
            HL  TG LD+ TV  MT PRCG ADI+NG    R G      G S    V ++ F+ G P
Sbjct  99   HLKVTGNLDSQTVAMMTMPRCGAADIVNGTSRMRSGKRGTRHGSSNFHTVGHFTFFDGNP  158

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDH  489
            KWP+ K  LT+ F P T      PV  A   W +   F+F ++Q YE AD+K + AR DH
Sbjct  159  KWPSSKYHLTYAFYPETRDDVVGPVSRAFNTWASATQFTFSQSQNYESADIKIAFARRDH  218

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG PFDGP G  AHAF PT+G+ H+DADE W    P   S ++ +VA+HEIGHLLGL H
Sbjct  219  GDGAPFDGPNGVIAHAFQPTVGMFHYDADEPW-SAGPVSGSYNMETVALHEIGHLLGLGH  277

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V GA+M+     G   + L  DD+ GI+ALY
Sbjct  278  SSVAGAIMYPTISPGVS-KGLHGDDVQGIKALY  309



>ref|XP_008230676.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=299

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 162/267 (61%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            ++G +KGD V+G+ ++KK+L+ FGY++  S N      D F DQLE AI+TYQ   +L +
Sbjct  39   VKGCRKGDNVQGILDVKKHLEKFGYLSGHSQN------DDFDDQLELAIKTYQLNYNLEA  92

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSE--------VVPNYRFYPGEPKWPNQKSQ  336
            TG LD  TV  M  PRCGV DIING     S          V  Y F+ G PKWP+ K +
Sbjct  93   TGRLDVKTVSNMMIPRCGVPDIINGTTSMISRKIQHHEGLTVSKYSFFSGNPKWPSAKYR  152

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDG  513
            LT+ F  GTP +   PV  A + W N   F+F + + YE  DL  S  R DHGDG PFDG
Sbjct  153  LTYAFLQGTPNQAKDPVKRAFQSWANNTQFTFSQVEAYETPDLTISFQRLDHGDGYPFDG  212

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
             GG  AHAFSPT G  H+DADE WV    +   +D++S+A+HEIGHLLGL+HS V  A+M
Sbjct  213  RGGVTAHAFSPTDGRFHYDADEMWVVGSVNG-GMDLQSIAVHEIGHLLGLNHSSVEEAIM  271

Query  694  WSEFEYGQKRRDLTPDDINGIRALYHF  774
            +        +R+L PDDI GI+ LY+ 
Sbjct  272  YPFLNTATVKRNLKPDDIQGIKNLYNI  298



>ref|XP_008361888.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 133/272 (49%), Positives = 157/272 (58%), Gaps = 24/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D D F D LESAI+TYQ   HL +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DNDDFDDILESAIKTYQLNYHLKA  97

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LD  TV +M  PRCGV DIING     S                 V +Y F+PG PK
Sbjct  98   TGTLDXKTVSKMMMPRCGVPDIINGTTSMRSGKKRHPHHHSGHGSPHTVAHYSFFPGNPK  157

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP+ K  LT+ F   TP      V  A   W    HFSF ++Q YE+ADL  S A GDHG
Sbjct  158  WPSSKYHLTYAFDQXTPTXARDAVARAFATWAGNTHFSFSQSQTYENADLTISFASGDHG  217

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PF G GG  AHAF+PT G  H+DADE W          D+ +VA+HEIGHLLGL HS
Sbjct  218  DGXPFXGRGGTLAHAFAPTNGRFHYDADEPWAV-GAVEGXYDLETVALHEIGHLLGLRHS  276

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V GAVM S    G   + L  DDI GI+ALY
Sbjct  277  SVEGAVMSSTVRTGFA-QSLHADDIQGIKALY  307



>emb|CBI34985.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/261 (49%), Positives = 160/261 (61%), Gaps = 22/261 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSW----DADYFSDQLESAIRTYQTRR  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S +    + D F D +ESAI+TYQT  
Sbjct  17   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  73

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            HLN+TG LD++TV QM KPRCG ADIING              +   P+WP  K+ LT+ 
Sbjct  74   HLNATGSLDSETVSQMVKPRCGAADIINGTN------------WMRSPRWPPSKTYLTYA  121

Query  349  FAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPGGN  525
            F PGTP+    PV  A   W +  HF+F   Q +  AD+  S  R DHGDG PFDGPGG 
Sbjct  122  FLPGTPSWAMSPVSRAFGQWDSATHFTFGSIQDHTSADMTISFHRLDHGDGYPFDGPGGT  181

Query  526  YAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEF  705
             AHAF+PT G  H+D DE W      P+++D+ +VA+HEIGHLLGL HS V  A+M+   
Sbjct  182  IAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVALHEIGHLLGLGHSSVQNAIMFPSI  240

Query  706  EYGQKRRDLTPDDINGIRALY  768
              G   + L  DDI GI ALY
Sbjct  241  SSGVT-KGLHEDDIQGISALY  260



>ref|XP_006482472.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=320

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 166/273 (61%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDA--DYFSDQLESAIRTYQTRRHL  174
            L+G  KGD++KG++ LKKY++ FGY+N  +Y + S  A  D F + LESAI+TYQ   HL
Sbjct  48   LKGCHKGDKIKGIHELKKYMEKFGYLNYDNYKNQSTHANDDDFDELLESAIKTYQLNYHL  107

Query  175  NSTGILDADTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWP  321
             STGILDA+TV +M  PRCGVADI+NG    R G   +        V +Y F+ G P+WP
Sbjct  108  KSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWP  167

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
              K  LT+ F PGT +    PV  A + W     F F + + + +AD+K S   GDHGDG
Sbjct  168  ASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDG  227

Query  499  VPFD---GPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
             PFD   GP G  AHAF+PT G  H+DADE W        + D+ +VA+HEIGHLLGL H
Sbjct  228  NPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWAV-GAVQGAFDLETVALHEIGHLLGLHH  286

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V GA+M+     G K + L  DDI GIR LY
Sbjct  287  SSVEGAIMYPSIAAGVK-KGLHGDDIQGIRDLY  318



>ref|XP_004296559.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=308

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 162/267 (61%), Gaps = 15/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+VKG+ +LKKYL+ FGY+N    N S  D D F D LE A++TYQ   HL S
Sbjct  44   LKGCHKGDKVKGINDLKKYLEKFGYLN--YKNHSHSDDDEFDDLLEEAVKTYQINYHLKS  101

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG----------GPSEVVPNYRFYPGEPKWPNQK  330
            TG LD  TV +M  PRCG+ DIING             G      +Y F  G PKWP+ K
Sbjct  102  TGTLDGKTVAKMMMPRCGLPDIINGTSSMRSAKKRHHHGSIHTTAHYAFPAGNPKWPSSK  161

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPF  507
              LT+GF PGTP++    V  A   W    HF+F + Q YE+ADLK    +GDHGDG  F
Sbjct  162  YHLTYGFLPGTPSEATGAVARAFATWAGNTHFTFSQAQNYENADLKIGFEKGDHGDGSAF  221

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG  AHAF PT G  H+DADENW      P + D+ ++A+HEIGHLLGLDHS V GA
Sbjct  222  DGPGGVLAHAFYPTDGRFHYDADENWSV-GAKPGAFDLETLALHEIGHLLGLDHSSVEGA  280

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            +M S    G   R L  DD+ GI+ALY
Sbjct  281  IMSSGIPAGV-TRGLHGDDVQGIKALY  306



>ref|XP_002280833.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
 emb|CAN73129.1| hypothetical protein VITISV_030257 [Vitis vinifera]
Length=319

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 134/275 (49%), Positives = 164/275 (60%), Gaps = 20/275 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            LQG  KGD V G+  LKKYL+ FGY++   S N +  D D F D LESAI+TYQ   HL 
Sbjct  46   LQGCHKGDEVNGIQKLKKYLEQFGYLSYSRSKNQTHADDDDFDDLLESAIKTYQANYHLE  105

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPS----------------EVVPNYRFYPGE  309
            +TG LD++TV +M KPRCGVADIING     S                  V +Y F+PG 
Sbjct  106  ATGDLDSETVSEMVKPRCGVADIINGTNWMLSGKKRQYHGHGHGHGSLRTVAHYSFFPGS  165

Query  310  PKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            P+WP  K+ LT+ F PGTP     PV  A   W +  HF+F   Q Y  AD+  S  R D
Sbjct  166  PRWPPSKTYLTYAFLPGTPNWAMSPVSRAYGRWDSATHFTFGWIQDYTSADMTISFHRLD  225

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLD  666
            HGDG PFDGPGG  AHAF+PT G  H+D DE W      P+++D+ +VA+HEIGHLLGL 
Sbjct  226  HGDGSPFDGPGGTIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVALHEIGHLLGLG  284

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            HS V  A+M+     G   + L  DDI GIRALY+
Sbjct  285  HSSVQNAIMFPSISTGVT-KGLHEDDIQGIRALYN  318



>gb|EYU34694.1| hypothetical protein MIMGU_mgv1a023515mg, partial [Erythranthe 
guttata]
Length=261

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 158/257 (61%), Gaps = 16/257 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSWDADYFSDQLESAIRTYQTRRHLN  177
            LQG  KG++ K +++LK YL  FGY   L Y N +  + D F + LESA++TYQ   H+N
Sbjct  18   LQGCHKGNKSKDIHHLKNYLHQFGY---LQYPNETHANNDDFDETLESAVKTYQRNYHIN  74

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAP  357
             TG LDA TV +MT PRCGV DII+         V +Y F+ G P+WP  K+ LT+ F P
Sbjct  75   PTGTLDATTVSKMTTPRCGVPDIID---------VSHYSFFQGNPRWPPSKTHLTYRFLP  125

Query  358  GTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
             TPA    PV  A + W +  HF+F R Q   ADL     RGDHGDG PFDG GG  AHA
Sbjct  126  NTPAPAVGPVSRAFQKWASSTHFTFSRAQ-NSADLVIGFHRGDHGDGFPFDGRGGTLAHA  184

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F+PT G  H+DADE W    P   + D+ +VA+HEIGHLLGL HS V  A+M+S    G 
Sbjct  185  FAPTNGRFHYDADERW-SVGPVQDAFDLETVALHEIGHLLGLGHSSVEAAIMYSGIGAGV  243

Query  718  KRRDLTPDDINGIRALY  768
              ++L  DDI GIRALY
Sbjct  244  T-KNLHADDIQGIRALY  259



>emb|CAN73128.1| hypothetical protein VITISV_030256 [Vitis vinifera]
Length=305

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 163/263 (62%), Gaps = 12/263 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSW----DADYFSDQLESAIRTYQTRR  168
            LQG  KGD+V+G++ LKKYL  FGY   LSY+ S +    + D F D +ESAI+TYQT  
Sbjct  46   LQGCHKGDKVEGIHKLKKYLGQFGY---LSYSHSKYHTHANDDDFDDLVESAIKTYQTNY  102

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPG--EPKWPNQKSQLT  342
            HLN+TG LD++TV QM KPRCG ADIING     S    ++  +     P+WP  K+ LT
Sbjct  103  HLNATGSLDSETVSQMVKPRCGAADIINGTNWMRSGKKGHHHGHGSLRSPRWPPSKTYLT  162

Query  343  FGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG  519
            + F PGTP+    PV  A   W +  HF+F   Q +  AD+  S  R DHGDG PFDGPG
Sbjct  163  YAFLPGTPSWAMSPVSRAXXQWDSATHFTFGXIQDHTSADMTISFHRLDHGDGXPFDGPG  222

Query  520  GNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWS  699
            G  AHAF+PT G  H+D DE W      P+++D+ +VA+HEIGHLLGL HS V  A+M+ 
Sbjct  223  GTIAHAFAPTNGRFHYDGDETW-SIGAVPNAMDLETVAVHEIGHLLGLGHSSVQNAIMFP  281

Query  700  EFEYGQKRRDLTPDDINGIRALY  768
                G   + L  DDI GI ALY
Sbjct  282  SISSGVT-KGLHEDDIQGIXALY  303



>gb|EYU34696.1| hypothetical protein MIMGU_mgv11b016964mg [Erythranthe guttata]
Length=312

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 162/272 (60%), Gaps = 22/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY-NSSSWDADYFSDQLESAIRTYQTRRHLN  177
            +QG  KG++ K ++NLKKYL  FGY   L Y N +  + D F + LESA++TYQ   ++N
Sbjct  45   VQGCHKGNKTKEIHNLKKYLHKFGY---LQYPNQTHANNDDFDEALESAVKTYQRNYNIN  101

Query  178  STGILDADTVRQMTKPRCGVADIINGR----PGGPSE-----------VVPNYRFYPGEP  312
             TG LDA TV +MT PRCGV DIING+      G  E            V +Y F PG P
Sbjct  102  PTGTLDATTVSKMTTPRCGVPDIINGKNTMQKHGTKEHESNSSSKHIHTVSHYSFLPGNP  161

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHG  492
            +WP  K+ LT+ F+  TPA    PV  A + W +  HF+F   Q   ADL      GDHG
Sbjct  162  RWPRSKTHLTYMFSANTPAAAVGPVSRAFQKWASSTHFTFSLAQ-SSADLVIGFHSGDHG  220

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDG GG  AHAF+PT G  H+DADE W    P   + D+ +VA+HEIGHLLGL HS
Sbjct  221  DGNPFDGRGGTLAHAFAPTNGRFHYDADELW-SVGPVQDAFDLETVALHEIGHLLGLGHS  279

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  A+M+S    G   ++L PDDI GI++LY
Sbjct  280  AVEAAIMYSGIGAGVT-KNLHPDDIQGIKSLY  310



>ref|XP_007216923.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
 gb|EMJ18122.1| hypothetical protein PRUPE_ppa018181mg, partial [Prunus persica]
Length=264

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 154/257 (60%), Gaps = 12/257 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N         + D F DQLE+AI+TYQ   HL +
Sbjct  17   LKGCHKGDKVQGIQDLKKYLERFGYLN------GDINNDDFDDQLEAAIKTYQINYHLKA  70

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG LD  TV +M  PRCG     +   G     V +Y F+ G  KWP  K  LT+GFA G
Sbjct  71   TGTLDTKTVSKMMMPRCGKKRHPHHHGG---HTVAHYAFFQGSAKWPANKYHLTYGFAQG  127

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
            TPA     V  A   W    HFSF R +  + ADLK S   G+HGDG PFDGPGG  AHA
Sbjct  128  TPANAVGAVTRAFATWAGNTHFSFSRAKSVDSADLKISFGSGEHGDGQPFDGPGGVLAHA  187

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            ++PT G  H+DADE WV     P  +D+ +VA+HEIGHLLGL HS V GAVM      G 
Sbjct  188  YAPTNGRFHYDADETWVV-GAVPGGMDLETVALHEIGHLLGLAHSSVEGAVMLPGIRAG-  245

Query  718  KRRDLTPDDINGIRALY  768
              + L  DDI GI+ALY
Sbjct  246  FTQSLHADDIQGIKALY  262



>ref|XP_007010134.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY18944.1| Matrixin family protein, putative [Theobroma cacao]
Length=288

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 161/269 (60%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDA------DYFSDQLESAIRTYQT  162
            LQG  KG  V+GL  LK+Y K  GY+N   Y+ +S++A      + F D LESAI+ YQ 
Sbjct  21   LQGCHKGHTVEGLCELKQYFKKLGYLN---YDHASYNAYKHGNDNEFDDHLESAIKAYQV  77

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEVV--PNYRFYPGEPKWPNQKSQ  336
               LN+TG LDADTV+QM K RCG+AD++N         +    Y F+ G PKWP  K+ 
Sbjct  78   NYKLNATGNLDADTVKQMMKSRCGIADVMNSNNSRSIYGIGASRYEFFLGNPKWPLSKTH  137

Query  337  LTFGFAPGTPAKFFIPVYT----ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGV  501
            LT+ F           V +    A + W NV  F+F+   +Y  AD++     G+HGDG 
Sbjct  138  LTYNFHSSVEVPLAENVRSVCVRAFQRWANVSRFTFEEVAEYYVADIEIGFHSGEHGDGN  197

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGP G  AHA  PT G  H+DADE+W   +P P  +D+ SV +HEIGHLLGL HS VP
Sbjct  198  PFDGPQGTLAHASPPTDGKLHYDADEDWST-NPGPDEVDLESVTVHEIGHLLGLQHSLVP  256

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             AVM++ F+ G  +R L  DD++GIRALY
Sbjct  257  EAVMYAYFDSGMIKRKLHMDDVHGIRALY  285



>ref|XP_010039144.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=315

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 162/280 (58%), Gaps = 26/280 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQ-----LESAIRTYQTR  165
            LQG  KG+   G+  LK+YL+ FGY+N   YN S     +  D      LE A++TYQ  
Sbjct  40   LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  96

Query  166  RHLNSTGILDADTVRQMTKPRCGVADIING-------------RPGGPSEVVPNYRFYPG  306
             HLN TG LD  T  +M +PRCGVADIING             R  G    V +Y F  G
Sbjct  97   YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  156

Query  307  EPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
             P+WP     LT+GF PGTP     PV  A   W +V  F+F   + +E A+++   ARG
Sbjct  157  SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARG  216

Query  484  DHGDGV--PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-PHSLDIRSVAIHEIGHL  654
            DHGDG    FDGPGG  AHAF PT+G+ H+DADE W    PS   + ++ +VA+HEIGHL
Sbjct  217  DHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHL  276

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            LGL HS+V GA+M+S    G   + L  DDI GI+ALY+F
Sbjct  277  LGLGHSDVEGAIMYSSIAPGTT-KGLHADDIQGIKALYNF  315



>gb|KDO37621.1| hypothetical protein CISIN_1g035681mg [Citrus sinensis]
Length=320

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 165/273 (60%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFS--DQLESAIRTYQTRRHL  174
            L+G  KGD++KG++ LK+Y++ FGY+N  +Y + S  AD     + LESAI+TYQ   HL
Sbjct  48   LKGCHKGDKIKGIHELKEYMEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHL  107

Query  175  NSTGILDADTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWP  321
             STG+LDA+TV +MT PRCGVADI+NG    R G   +        V +Y F+P  PKWP
Sbjct  108  KSTGVLDANTVAKMTIPRCGVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWP  167

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
              K  LT+ F PGT +    PV  A + W     F F + + + +AD+K S   GDHGDG
Sbjct  168  ASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDG  227

Query  499  VPFD---GPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
             PFD   GP G  AHAF+PT G  H+DADE W        + D+ +VA+HEIGHLLGL H
Sbjct  228  NPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWAV-GAVQGAFDLETVALHEIGHLLGLHH  286

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V GA+M+     G   + L  DDI GIR LY
Sbjct  287  SSVEGAIMYPSISAGVT-KGLHGDDIQGIRDLY  318



>ref|XP_010278837.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=319

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 163/277 (59%), Gaps = 22/277 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS--SWDADYFSDQLESAIRTYQTRRHL  174
            L+G  KG  +KG++ LK+YL+ FGY+N    N S    D D F + LESA++TYQ   HL
Sbjct  40   LEGCHKGQDLKGVHQLKRYLEKFGYLNYPPGNKSLTHADDDEFDELLESAVKTYQLNYHL  99

Query  175  NSTGILDADTVRQMTKPRCGVADIING----RPG--------GPSEV--VPNYRFYPGEP  312
              TG LD+ TV+QM  PRCG+ DIING    R G        GPS +  V +Y F+P  P
Sbjct  100  KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHGPSSLHTVSHYTFFPNNP  159

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYT----ALRDWHNVGHFSFQRTQYEHA-DLKFSLA  477
            +WP  K+ LT+ F           + +    A   W  V HF+F+  Q   A D+     
Sbjct  160  RWPPSKTHLTYRFRSSVSVVGLQQLRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFH  219

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLL  657
            RGDHGDG  FDG GG  AHAF+PT+G  H+DADE+W   +P P   D+ SVA+HEIGHLL
Sbjct  220  RGDHGDGYSFDGRGGTLAHAFAPTVGRFHYDADESWST-NPQPGMFDLESVAVHEIGHLL  278

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS VP A+M+     G  +R+L  DD+ GIRALY
Sbjct  279  GLGHSSVPEAIMYPSIPDGAVKRNLHGDDVQGIRALY  315



>ref|XP_008368314.1| PREDICTED: LOW QUALITY PROTEIN: metalloendoproteinase 1-like 
[Malus domestica]
Length=309

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 158/273 (58%), Gaps = 24/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D+D F D LESAI+TYQ   H  +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DSDDFDDILESAIKTYQVNYHXKA  97

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LDA TV +M  PRCGVADIING     S                 V +Y F  G PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFXTGNPK  157

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP+ K  LT+ F   TP +    V  A   W    HFSF ++Q Y++ADL  S  +GDHG
Sbjct  158  WPSSKYHLTYAFDQSTPTEARDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDG GG  AHAF PT    H+DADE W        + D+ +VA+HEIGHLLGL HS
Sbjct  218  DGNPFDGRGGILAHAFPPTNXRFHYDADEXWAV-GAVADAYDLETVALHEIGHLLGLQHS  276

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
             V GAVM      G   + L  DDI GI+ALY+
Sbjct  277  SVEGAVMSPGVRSGFT-QSLHADDIQGIKALYN  308



>ref|XP_010273763.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=348

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 162/277 (58%), Gaps = 22/277 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDAD--YFSDQLESAIRTYQTRRHL  174
            L+G  KG  VKG++ LK+YL+ FGY+N    N S   AD   F + LESA++TYQ   HL
Sbjct  69   LEGCHKGQDVKGVHQLKRYLEKFGYLNYPPGNKSLTHADDEEFDELLESAVKTYQLNYHL  128

Query  175  NSTGILDADTVRQMTKPRCGVADIING----RPG--------GPSEV--VPNYRFYPGEP  312
              TG LD+ TV+QM  PRCG+ DIING    R G         PS +  V +Y F+P  P
Sbjct  129  KVTGSLDSKTVQQMMMPRCGIPDIINGTTSMRSGKKNHHHHHAPSSLHTVSHYTFFPNNP  188

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYT----ALRDWHNVGHFSFQRTQYEHA-DLKFSLA  477
            +WP  K+ LT+ F           + +    A   W  V HF+F+  Q   A D+     
Sbjct  189  RWPPSKTHLTYRFRSSASVVGLQELRSICSRAFSRWQQVSHFTFEEVQNGAASDIVIGFH  248

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLL  657
            RGDHGDG  FDG GG  AHAF+PTIG  H+DADE+W   +P P   D+ SVA+HEIGHLL
Sbjct  249  RGDHGDGYSFDGRGGTLAHAFAPTIGRFHYDADESWST-NPQPGVFDLESVAVHEIGHLL  307

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS VP A+M+     G  +R+L  DD+ GIRALY
Sbjct  308  GLGHSSVPEAIMYPSIPAGAVKRNLHGDDVQGIRALY  344



>ref|XP_004142461.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52414.1| hypothetical protein Csa_5G632130 [Cucumis sativus]
Length=316

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 164/274 (60%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSWDADYFSDQLESAIRTYQTRRHLN  177
            L G KKGD+V+G++ +K+YL+ FGY+N+   N S S+D D F   LESAI+TYQ   +L 
Sbjct  43   LNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  102

Query  178  STGILDADTVRQMTKPRCGVADIINGRP---------------GGPSEVVPNYRFYPGEP  312
            +TG ++A T+  M++PRCG ADI++G+                 G    V +Y F+ G P
Sbjct  103  ATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNP  162

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDH  489
            KWP  KS LT+GF PGTP+K    +  A + W    HF+F Q ++Y+ AD+K S   GDH
Sbjct  163  KWPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETGDH  222

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG  FDG  G  AH F+P  G  HFDA E+W        S D+ ++A+HEIGHLLGL H
Sbjct  223  GDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWAV-GAIADSFDLETIALHEIGHLLGLYH  281

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            S +  A+MW     G   + L  DDI GI ALY+
Sbjct  282  SSIERAIMWPSIMEGST-KGLDADDIAGINALYN  314



>ref|XP_002517412.1| Matrix metalloproteinase, putative [Ricinus communis]
 gb|EEF44954.1| Matrix metalloproteinase, putative [Ricinus communis]
Length=321

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/283 (47%), Positives = 161/283 (57%), Gaps = 32/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQ-----LESAIRTYQTR  165
            LQG  KGD++KG+  LKKYLK FGY   LSYN +   A+   D      LESAIRTYQ  
Sbjct  41   LQGCHKGDKLKGVGELKKYLKHFGY---LSYNKNQSHANEDDDDDFDDPLESAIRTYQLN  97

Query  166  RHLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEV---------------------V  282
             HLN +G+LD++T  +M  PRCGVADIING     S                       V
Sbjct  98   YHLNVSGLLDSETASKMMMPRCGVADIINGTTWMESGRKHHRHPHRHHHRRHGPKSLHKV  157

Query  283  PNYRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHAD  459
             +Y F+ G PKWP  K  LT+ F PG P     PV  A   W    HFSF  T+ Y ++D
Sbjct  158  SHYSFFSGNPKWPPSKYHLTYSFLPGFPTAAVNPVANAFETWAANTHFSFSWTRDYINSD  217

Query  460  LKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIH  639
            +  S  RGDHGDG PFDGPGG  AHAF+P  G+ H+DADE W        + D+ + A+H
Sbjct  218  ILISFYRGDHGDGHPFDGPGGTLAHAFAPQNGLFHYDADERW-SIGAVLGAYDLETTALH  276

Query  640  EIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            EIGHLLGL HS V GA+M+ +   G+  R L  DD+ GIR LY
Sbjct  277  EIGHLLGLGHSSVEGAIMYPQIFAGET-RGLHSDDLEGIRTLY  318



>ref|XP_008365496.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=319

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 158/273 (58%), Gaps = 24/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL+ FGY+N  S      D+D F D LESAI+TYQ   H  +
Sbjct  44   LKGCHKGDKVQGIQDLKKYLEKFGYLNGHS------DSDDFDDILESAIKTYQVNYHXKA  97

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LDA TV +M  PRCGVADIING     S                 V +Y F+ G PK
Sbjct  98   TGTLDAKTVXKMIMPRCGVADIINGTTSMRSGKKRHPHHHGGHGSPHTVAHYSFFTGNPK  157

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP+ K  LT+ F   TP +    V  A   W    HFSF ++Q Y++ADL  S  +GDHG
Sbjct  158  WPSSKYHLTYAFDQSTPTEAXDAVARAFATWAGNTHFSFSQSQNYKNADLTISFGKGDHG  217

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDG GG  AHAF PT    H+DADE W        + D+ +VA+HEI HLLGL HS
Sbjct  218  DGNPFDGRGGILAHAFPPTNXRFHYDADEAWAV-GAVADAYDLETVALHEIXHLLGLQHS  276

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
             V GAVM      G   + L  DDI GI+ALY+
Sbjct  277  SVEGAVMSPGXRSG-FTQSLHADDIQGIKALYN  308



>ref|XP_008355534.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=309

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 160/282 (57%), Gaps = 30/282 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSWDADYFSDQLESAIRTYQTRR  168
            L+G  KGD ++G+++LK YL+ FGY   LSY    N+   + D F +  E A++TYQ   
Sbjct  30   LRGGHKGDHIEGIHDLKLYLEKFGY---LSYAHAKNNPHANDDDFDNLXELAVKTYQLNY  86

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRP---------------------GGPSEVVP  285
            HLN+TG LD +TV +M  PRCGVADIING                       G     V 
Sbjct  87   HLNTTGTLDGETVSKMMMPRCGVADIINGTSSMRSGKKKHHHHDPDHDHHNHGSSVHAVS  146

Query  286  NYRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADL  462
            +Y F+ G  +WP  K  LT+GF P TP +   PV  A R W +  HF F R++ Y  AD+
Sbjct  147  HYSFFKGRLRWPTSKHHLTYGFLPNTPTEAMGPVSYAFRTWASNTHFRFSRSRNYRRADI  206

Query  463  KFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHE  642
            K S   GDHGDG PFDG GG  AHA++PT G  H+DADE W       +  D+ +VA+HE
Sbjct  207  KISFEYGDHGDGSPFDGEGGVLAHAYAPTNGRFHYDADEPWSVGALEGY-YDLETVALHE  265

Query  643  IGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            IGHLLGL HS V GA+M+     G  +  L  DDI GI+ LY
Sbjct  266  IGHLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  307



>ref|XP_009341183.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=340

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 124/282 (44%), Positives = 161/282 (57%), Gaps = 30/282 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSWDADYFSDQLESAIRTYQTRR  168
            L+G  KGD ++G+++LK YL+ FGY   LSY    N+   + D F + LE A++TYQ   
Sbjct  61   LKGGHKGDHIEGIHDLKLYLEKFGY---LSYAHAKNNPHANDDDFDNLLELAVKTYQLNY  117

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRP---------------------GGPSEVVP  285
            HLN+TG LD +TV +M  PRCGVAD+ING                       G     V 
Sbjct  118  HLNTTGTLDGETVSKMMMPRCGVADVINGTSSMRSGKKKHHQHDPDHDHHNHGSSVHAVS  177

Query  286  NYRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADL  462
            +Y F+ G  +WP  K  LT+GF P TP +   PV  A R W +  HF F R++ Y+ AD+
Sbjct  178  HYSFFKGRLRWPTSKHHLTYGFLPSTPTEAMGPVSHAFRTWASNTHFRFSRSRNYKRADI  237

Query  463  KFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHE  642
            K S    DHGDG PFDG GG  AHA++PT G  H+DADE W       +  D+ +VA+HE
Sbjct  238  KISFEYSDHGDGSPFDGKGGVLAHAYAPTNGRFHYDADEPWSVGALEGY-YDLETVALHE  296

Query  643  IGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            IGHLLGL HS V GA+M+     G  +  L  DDI GI+ LY
Sbjct  297  IGHLLGLGHSSVEGAIMYPYISSGATKLTLHDDDIQGIKVLY  338



>ref|XP_006448956.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
 gb|ESR62196.1| hypothetical protein CICLE_v10017926mg [Citrus clementina]
Length=314

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 159/272 (58%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN----------DLSYNSSSWDADYFSDQLESAIR  150
             QGS+KGD+VKG++ L+KYL++ GYIN          D S   S  + DYF + LESAI+
Sbjct  43   FQGSQKGDKVKGIHQLRKYLQSLGYINQNNISPSISLDNSDKESHIEDDYFGEDLESAIK  102

Query  151  TYQTRRHLNSTGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPNYRFYPGEPK  315
            TYQ   +LN+TG LD  T+  M +PRCG+ DIING     R     +   +Y F+ G P+
Sbjct  103  TYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSADKKYDIHYAFFEG-PR  161

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP  K  +TF F PGT A    PV  AL  W N   F+F+ +  YE+AD+K S  RGDHG
Sbjct  162  WPLTKKTVTFAFQPGTRADIHEPVRVALLLWSNWAPFAFEGSNDYENADIKISFQRGDHG  221

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDGP    AHAFS    + HF+ D NWV         D+++VA+HE+GH+LGL HS
Sbjct  222  DGTPFDGPWHTLAHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGHVLGLSHS  280

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  A MW     G   + L  DDI  ++ LY
Sbjct  281  SVKAASMWPSTRAGTT-KGLNDDDIRRMKMLY  311



>gb|KCW49215.1| hypothetical protein EUGRSUZ_K02795 [Eucalyptus grandis]
Length=405

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/280 (46%), Positives = 162/280 (58%), Gaps = 26/280 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQ-----LESAIRTYQTR  165
            LQG  KG+   G+  LK+YL+ FGY+N   YN S     +  D      LE A++TYQ  
Sbjct  130  LQGCHKGNHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  186

Query  166  RHLNSTGILDADTVRQMTKPRCGVADIING-------------RPGGPSEVVPNYRFYPG  306
             HLN TG LD  T  +M +PRCGVADIING             R  G    V +Y F  G
Sbjct  187  YHLNVTGTLDPQTTSKMMRPRCGVADIINGTTRMGFGKKGRNLRGIGSFHTVSHYAFLEG  246

Query  307  EPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
             P+WP     LT+GF PGTP     PV  A   W +V  F+F   + +E A+++   ARG
Sbjct  247  SPRWPASNYHLTYGFLPGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARG  306

Query  484  DHGDGV--PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-PHSLDIRSVAIHEIGHL  654
            DHGDG    FDGPGG  AHAF PT+G+ H+DADE W    PS   + ++ +VA+HEIGHL
Sbjct  307  DHGDGAHNSFDGPGGTLAHAFPPTVGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHL  366

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            LGL HS+V GA+M+S    G   + L  DDI GI+ALY+F
Sbjct  367  LGLGHSDVEGAIMYSSIAPGTT-KGLHADDIQGIKALYNF  405



>ref|XP_010255256.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=309

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 159/271 (59%), Gaps = 22/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G +KG+ VKGL  LK+YL+ FGY+N+   +          D LE AI+TYQ   +LN 
Sbjct  45   LEGCRKGETVKGLNELKRYLERFGYLNNHKDDDDF------DDLLELAIKTYQLNYNLNV  98

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSE---------VVPNYRFYPGEPKWP  321
            TG LD +T++QM+ PRCG  DI NG    R G   +          V  Y F+ G P+WP
Sbjct  99   TGSLDPETLKQMSLPRCGAPDITNGTTSMRSGKEKKHPHERKTLHTVSRYSFFSGIPRWP  158

Query  322  NQKSQLTFGFAPGTPAKFFIPVY-TALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGD  495
              K+ LT+ F PGTP     PV   A + W  V  F FQ TQ Y  AD+K S  RGDHGD
Sbjct  159  PSKTLLTYAFLPGTPVSSMRPVCDRAFQRWAAVSRFRFQETQDYLTADIKISFERGDHGD  218

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
              PFDGPGG  AHA++PT G  H+DADE W     S    D+ SVA+HEIGHLLGL HS 
Sbjct  219  KYPFDGPGGVLAHAYAPTDGRFHYDADEKWYI-GASLDGYDVESVAMHEIGHLLGLGHSS  277

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V  ++M+     G ++  L  DDI+GIR+LY
Sbjct  278  VGNSIMYPSLLMGTQKLKLDQDDIDGIRSLY  308



>ref|XP_004159087.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=457

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 164/274 (60%), Gaps = 19/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN-SSSWDADYFSDQLESAIRTYQTRRHLN  177
            L G KKGD+V+G++ +K+YL+ FGY+N+   N S S+D D F   LESAI+TYQ   +L 
Sbjct  184  LNGCKKGDKVEGIHQVKEYLQHFGYLNNYVQNYSKSFDDDEFDGVLESAIKTYQLNYNLK  243

Query  178  STGILDADTVRQMTKPRCGVADIINGRP---------------GGPSEVVPNYRFYPGEP  312
            +TG ++A T+  M++PRCG ADI++G+                 G    V +Y F+ G P
Sbjct  244  ATGTINAKTLDLMSRPRCGFADIVDGKTRMKSGKKMVNQHRKINGHFHSVSHYAFFDGNP  303

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDH  489
            KWP  KS LT+GF PGTP+K    +  A + W    HF+F Q ++Y+ AD+K S   GDH
Sbjct  304  KWPASKSHLTYGFLPGTPSKAVATIGRAFKTWGANTHFNFSQTSRYKKADIKISFETGDH  363

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG  FDG  G  AH F+P  G  HFDA E+W        S D+ ++A+HEIGHLLGL H
Sbjct  364  GDGHSFDGVRGVIAHGFAPRDGRLHFDAAESWAV-GAIADSFDLETIALHEIGHLLGLYH  422

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            S +  A+MW     G   + L  DDI GI ALY+
Sbjct  423  SSIERAIMWPSIMEGST-KGLDADDIAGINALYN  455


 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 75/140 (54%), Gaps = 3/140 (2%)
 Frame = +1

Query  349  FAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGPGGN  525
            F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG  FDGPGG 
Sbjct  2    FTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAFDGPGGV  61

Query  526  YAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEF  705
              HAF+PT G  H D D++W       +  ++ +VA+HE+GH+LGL HS +P AVMW   
Sbjct  62   VGHAFAPTDGRLHLDGDDSW-SAGLEENKFNVMNVALHELGHVLGLAHSTLPQAVMWPYI  120

Query  706  EYGQKRRDLTPDDINGIRAL  765
            +     ++L  DDI G+ AL
Sbjct  121  D-SNALKNLNDDDIAGLHAL  139



>ref|XP_002280805.2| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=335

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 170/276 (62%), Gaps = 25/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWD------ADYFSDQLESAIRTYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S +       DYF D LESAI++YQT
Sbjct  63   LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  119

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIING------------RPGGPSEVVPNYRFYPG  306
              HL +TG LD++TV +M + RCGVADI+NG            +  G    V +Y+F+PG
Sbjct  120  NYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPG  179

Query  307  EPKWP-NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLAR  480
             P+WP +  + LT+ F PGTP +  IPV  A   W +   F+F +T+ + +A+L  S   
Sbjct  180  SPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHS  239

Query  481  GDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLG  660
              HGD  PFDGPGG  AHA++PT G  H+DADE W      P +LD+ +VA+HEIGHLLG
Sbjct  240  LLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEW-SVGAVPGALDVETVALHEIGHLLG  298

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  A+M+     G   + L  DDI GIRALY
Sbjct  299  LGHSSVREAIMFPSISTGVT-KGLHRDDIEGIRALY  333



>ref|XP_011085796.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=314

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 157/272 (58%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG++ KG+++LK YL  FGY++    N    + D F D LESA++TYQ   H+  
Sbjct  45   LEGCHKGNKTKGIHHLKHYLHQFGYLD--YPNQIHANDDDFDDLLESALKTYQHNYHIKP  102

Query  181  TGILDADTVRQMTKPRCGVADIINGR---------------PGGPSEVVPNYRFYPGEPK  315
            TG LD +T+ ++  PRCG  DI+NG                       V +Y F+ G P+
Sbjct  103  TGTLDTETITKLVTPRCGNPDIVNGTNTMLPRSKKTQNSSSSPSSIHTVSHYSFFRGNPR  162

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHG  492
            WP  K+ LT+GF+  TP     PV  A   W +  HF+F R Q  +  DL     R DHG
Sbjct  163  WPPSKTHLTYGFSANTPTNAIDPVVRAFEKWDSATHFTFSRAQNNQRPDLVIGFHRRDHG  222

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDGPGG  AHAF+PT G  H+D++E W    P+ ++  + +VA+HEIGHLLGL HS
Sbjct  223  DGAPFDGPGGTIAHAFAPTDGRFHYDSEETWSI-APNANAFHLETVALHEIGHLLGLGHS  281

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V GA+M++  + G   ++L  DDI GIR LY
Sbjct  282  SVEGAIMYARIQRGAT-KNLHADDIQGIRVLY  312



>ref|XP_004297959.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 154/267 (58%), Gaps = 14/267 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+   KGD+VKG+++LKKYL  FG ++ +++  S  + D+F   LE A+RTYQ   +LN 
Sbjct  48   LKCCHKGDKVKGIHDLKKYLHKFGCLDYMNHIHS--NDDHFDQFLEEAVRTYQLNFNLNP  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN----------YRFYPGEPKWPNQK  330
            TG LD  T+  M KP CGV DIING     S  + +          Y    G+ KWP  K
Sbjct  106  TGTLDEKTISMMMKPHCGVPDIINGTTSMRSAKIKHQHRAIHTTVHYTLPDGDYKWPPSK  165

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPF  507
             QLTFGF PGTP+     +  A   W    HF F Q    ++ADLK S  + DHGDG PF
Sbjct  166  YQLTFGFLPGTPSAATGSIVQAFAIWQKSTHFKFSQSNNPQNADLKISFHKRDHGDGDPF  225

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG  AHA  PT G  H+DA+E W      P ++D  SV +HEIGHLLGL HS V GA
Sbjct  226  DGPGGQLAHAAYPTGGTLHYDAEETW-SAGAKPGAMDYGSVGLHEIGHLLGLGHSSVEGA  284

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VM+     G   + L  DDI GI+ALY
Sbjct  285  VMFPTVTEGVAYKGLHQDDIQGIKALY  311



>ref|XP_007216020.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
 gb|EMJ17219.1| hypothetical protein PRUPE_ppa014830mg, partial [Prunus persica]
Length=296

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 156/270 (58%), Gaps = 35/270 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KGD+V+G+ +LKKYL  FGY++  S N+  ++ D F DQLESAI+TYQ   HL +
Sbjct  48   LKGCHKGDKVQGIQDLKKYLGKFGYLS--SNNNGHFNDDDFDDQLESAIKTYQINYHLKA  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-------------EVVPNYRFYPGEPKWP  321
            TG LDA TV  M  PRCGVADIING     S               V +Y F+ G PKWP
Sbjct  106  TGALDAKTVSNMMMPRCGVADIINGTSSMRSGKQRHPHHHHHGGHTVAHYTFFRGNPKWP  165

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGV  501
              K  LT+ F   TPA+   P                     ++ DL  S  RG+HGDG 
Sbjct  166  ASKYHLTYAFLQDTPAEATGP-------------------SNQNPDLTVSFHRGNHGDGA  206

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
            PFDGPGG  AHAF+PT G  H+DADE +     S  + D+ +VA+HEIGHLLGL HS V 
Sbjct  207  PFDGPGGTIAHAFAPTNGRFHYDADERFSVGAVSG-AYDLETVALHEIGHLLGLGHSSVQ  265

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            GA+M+     G  ++ L  DDI GI+ALY+
Sbjct  266  GAIMYPTISPGVTQQSLHGDDIQGIKALYN  295



>ref|XP_006448955.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
 gb|ESR62195.1| hypothetical protein CICLE_v10017519mg, partial [Citrus clementina]
Length=241

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 151/236 (64%), Gaps = 8/236 (3%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTG  186
            G++KGD VKG+  LKKYL T GY+++ ++N ++ D DYF + LESA++TYQ   +LN TG
Sbjct  1    GTQKGDTVKGINALKKYLHTLGYLSNHNHNHAA-DGDYFDENLESAVKTYQRNFNLNPTG  59

Query  187  ILDADTVRQMTKPRCGVADIINGRP---GGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAP  357
             +D  TV  M KPRCGV D+IN      GGP+    +Y FYPG PKWP  K  +++ F P
Sbjct  60   HMDLKTVSMMGKPRCGVPDVINRTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISYAFLP  119

Query  358  GTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG--GNY  528
            GT      PV  A   W     FS++  Q Y+ AD+K S  RGDHGDG PF GPG     
Sbjct  120  GTRTDVQEPVRQAFLTWSKYTPFSYEFVQDYDAADIKISFQRGDHGDGYPFGGPGPYNLL  179

Query  529  AHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
            AH+FSPT G  H+D DENW      P ++D+++VA+HE+GH+LGL HS V  A+M+
Sbjct  180  AHSFSPTDGRAHYDGDENWTV-VAVPGAVDMQTVALHELGHVLGLAHSPVQAAIMY  234



>ref|XP_010091950.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB47730.1| Metalloendoproteinase 1 [Morus notabilis]
Length=370

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 167/302 (55%), Gaps = 48/302 (16%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN---------------DLSYNS--SSWDADYFSD  129
            L+GSKKGD+V+G+ +LKKYL+ FGY+N               D S N+  S+ +   F D
Sbjct  67   LEGSKKGDKVQGIRDLKKYLQHFGYLNPTQITKTQITGHSLNDNSINNDISTANDSTFDD  126

Query  130  QLESAIRTYQTRRHLNSTGILDADTVRQMTKPRCGVADIINGR-----------------  258
             LE+AI+TYQT  +L  TG LD+ T+ +M  PRC VADIIN                   
Sbjct  127  LLEAAIKTYQTNYNLKPTGTLDSQTLSKMMMPRCAVADIINNDTRMRSKKKSTTSSTKNH  186

Query  259  -----------PGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRD  405
                            + V +Y F+ G+PKWP+ K  LT+ FA G  ++    V  A + 
Sbjct  187  VHRKLLGQKYVSTDDLQTVSHYSFFSGKPKWPSSKYSLTYSFAEGMLSEDVEAVGRAFQT  246

Query  406  WHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADEN  582
            W +  HFSF R Q    AD++ S  RGDHGDG  FDG GG  AHAFSPT G  HFDADE 
Sbjct  247  WASNTHFSFSRAQGNTKADIRVSFERGDHGDGDAFDGAGGVLAHAFSPTDGRLHFDADET  306

Query  583  WVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRA  762
            W   + +  + D+ +VA+HEIGH+LGL HS V GA+M+ +   G   + L  DDI GI A
Sbjct  307  WAIGEVAD-AFDVETVALHEIGHILGLLHSSVEGAIMYPQIGSGLT-KGLNADDIQGINA  364

Query  763  LY  768
            LY
Sbjct  365  LY  366



>gb|EYU29749.1| hypothetical protein MIMGU_mgv1a023711mg, partial [Erythranthe 
guttata]
Length=265

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 152/259 (59%), Gaps = 9/259 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQGS KGDR+ G+  LK YL+ FGY+++L+   ++   + F D LESAI+TYQ   ++N 
Sbjct  15   LQGSVKGDRILGISVLKNYLQKFGYLDNLN---NTQINNEFDDALESAIKTYQQNFNINP  71

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG+LDA T           ++       G    V +Y F+ G PKWP  K  LT+GF   
Sbjct  72   TGVLDAATPAGTENHESSSSN----NQLGHIHTVSHYTFFSGNPKWPPSKYNLTYGFLSN  127

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
             PA    P   A ++W N  HF+F+R    + ADL     RGDHGDG  FDGPGG  AHA
Sbjct  128  VPANAVAPAERAFQNWDNATHFTFKRASSGQTADLIIGFQRGDHGDGSSFDGPGGILAHA  187

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F+PT G  H+DADE W   DP  +++ + +VA+HEIGHLLGL HS +  A+M+     G 
Sbjct  188  FAPTNGRLHYDADERW-SVDPVANTIHLETVALHEIGHLLGLGHSSIQAAIMYPSVSAGT  246

Query  718  KRRDLTPDDINGIRALYHF  774
             +  L  DDI GI+ALY+ 
Sbjct  247  AKIKLNADDIQGIKALYNM  265



>ref|XP_007226174.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
 gb|EMJ27373.1| hypothetical protein PRUPE_ppa015434mg, partial [Prunus persica]
Length=321

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 157/277 (57%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWD----ADYFSDQLESAIRTYQTRR  168
            L+G  KGD ++G+++LK YL+ FGY   LSY  +  +     D F D LE A++TYQ   
Sbjct  47   LKGVHKGDHIQGIHDLKLYLEKFGY---LSYAHAKHNPHADDDDFDDFLELAVKTYQLNY  103

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEV----------------VPNYRFY  300
            HL +TG LDA TV +M   RCGVADIING     S                  V +Y F+
Sbjct  104  HLKTTGTLDAKTVSKMMMSRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFF  163

Query  301  PGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLA  477
             G+ KWP  K  LTF F P TP +   P+  A R W    HF F R+Q Y+ AD+K S  
Sbjct  164  KGKLKWPRSKHHLTFAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFE  223

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLL  657
             GDHGDG  FDGPGG  AHA++PT G  H+DA+E W       +  D+ +VA+HEIGHLL
Sbjct  224  YGDHGDGSSFDGPGGVLAHAYAPTYGKFHYDAEEPWSVGALEGY-YDLETVALHEIGHLL  282

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS V GAVM+     G     L  DDI GI+ LY
Sbjct  283  GLGHSSVEGAVMYPYIASGATNLYLHDDDIRGIKVLY  319



>gb|KDO75344.1| hypothetical protein CISIN_1g037265mg [Citrus sinensis]
Length=305

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 158/272 (58%), Gaps = 19/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN----------DLSYNSSSWDADYFSDQLESAIR  150
             +GS+KGD+VKG++ L+KYL++ GY+N          D S N S  + DYF + LESAI+
Sbjct  34   FRGSQKGDKVKGIHQLRKYLQSLGYVNQNNIRPSISLDNSDNESHIEDDYFGEDLESAIK  93

Query  151  TYQTRRHLNSTGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPNYRFYPGEPK  315
            TYQ   +LN+TG LD  T+  M +PRCG+ DIING     R     +   +Y F+ G P+
Sbjct  94   TYQINFNLNATGTLDLQTISTMAQPRCGLPDIINGTTRMQRGSTDKKYDIHYAFFEG-PR  152

Query  316  WPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
            WP  K  +T+ F PGT      PV  AL  W N   F+F+ +  YE+AD+K S  RGDHG
Sbjct  153  WPLTKKTVTYAFQPGTRDDIHEPVRVALLLWSNWAPFTFEGSNDYENADIKISFQRGDHG  212

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDGP     HAFS    + HF+ D NWV         D+++VA+HE+GH+LGL HS
Sbjct  213  DGTPFDGPWHTLGHAFSDPYAVVHFNGDVNWV-MGTVKGGFDMQTVALHELGHVLGLSHS  271

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  A MW     G   + L  DDI  ++ LY
Sbjct  272  SVKAASMWPSTRAGTT-KGLNDDDIRRMKMLY  302



>ref|XP_008222422.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=319

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 157/277 (57%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWD----ADYFSDQLESAIRTYQTRR  168
            L+G  KGD + G+++LK YL+ FGY   LSY  +  +     D F D LE A++TYQ   
Sbjct  45   LKGVHKGDHIPGIHDLKLYLEKFGY---LSYAHAKHNPHADDDDFDDFLELAVKTYQLNY  101

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEV----------------VPNYRFY  300
            HL +TGILD  TV +M  PRCGVADIING     S                  V +Y F+
Sbjct  102  HLKTTGILDTKTVSKMMMPRCGVADIINGATSMQSGKKKHRGHNHDHDSNVYGVSHYSFF  161

Query  301  PGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLA  477
             G+ KWP  K  LT+ F P TP +   P+  A R W    HF F R+Q Y+ AD+K S  
Sbjct  162  KGKLKWPRSKHHLTYAFLPTTPTEAMGPISRAFRTWATNTHFRFSRSQNYKRADIKISFE  221

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLL  657
             GDHGDG  FDGPGG  AHA++PT G  H+DA+E W       +  D+ +VA+HEIGHLL
Sbjct  222  YGDHGDGNSFDGPGGVLAHAYAPTYGKFHYDAEEPWSVGALEGY-YDLETVALHEIGHLL  280

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS V GAVM+     G     L  DDI GI+ LY
Sbjct  281  GLGHSSVEGAVMYPYIASGATNLYLHDDDIQGIKVLY  317



>gb|EPS59674.1| hypothetical protein M569_15132, partial [Genlisea aurea]
Length=260

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 158/257 (61%), Gaps = 5/257 (2%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G + G+R +G++ +K+YL+ FGY+     N    D D+F ++L SA+R YQ    LN 
Sbjct  9    LEGCRLGNRSEGIHGVKRYLERFGYLR-YEGNDPHSDDDFFDERLYSAVRVYQANYRLNV  67

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG LDA T   M+  RCGV DI+NG     S   P + F+P   +WP +K+ L++ +   
Sbjct  68   TGELDAATASVMSLQRCGVPDIVNGTNLMIS-WRPYFSFFPDRQRWPPKKTHLSYLYLTN  126

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFDGPGGNYAHAF  540
             P ++   +  A   W +V  F+F R + + +D+      GDHGDGVPFDGPGG  AH+F
Sbjct  127  VPPEYIPAIDRAFESWASVTRFTFHRVE-DSSDITVGYFSGDHGDGVPFDGPGGVLAHSF  185

Query  541  SPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQK  720
            +PT G  HFDA E W D    P   D+ S+A+HEIGHLLGL HS V  A+MW+ F  G+ 
Sbjct  186  APTDGRMHFDAAEPWFD-GVKPDRFDVHSIAMHEIGHLLGLGHSSVREAIMWAYFGLGE-  243

Query  721  RRDLTPDDINGIRALYH  771
            RR + PDDI+GI+ALY+
Sbjct  244  RRTIQPDDIDGIKALYN  260



>ref|XP_007216949.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
 gb|EMJ18148.1| hypothetical protein PRUPE_ppa016355mg, partial [Prunus persica]
Length=252

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/257 (47%), Positives = 153/257 (60%), Gaps = 8/257 (3%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTG  186
            G + GD+V G+ +LKKYL  FGY++    ++++   D F DQL SAI+TYQ   +L +TG
Sbjct  1    GFQNGDKVPGIQDLKKYLGRFGYLS----SNNNQTTDDFDDQLASAIKTYQLNYNLKTTG  56

Query  187  ILDADTVRQMTKPRCGVADIINGRPGGPS-EVVPNYRFYPGEPKWPNQKSQLTFGFAPGT  363
            ILDA TV  M  PRCGV DIING     S + + +Y F+PG+PKWP  K  LT+ F  GT
Sbjct  57   ILDAQTVSNMMMPRCGVPDIINGTSSMRSGKQIAHYTFFPGKPKWPASKYHLTYAFLRGT  116

Query  364  PAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGPGGNYAHAF  540
            P     PV  A   W     F F Q  + +  DL  S  R  HGDG PFDGPGG  AH+F
Sbjct  117  PTAAKGPVARAFNTWAAHTQFKFSQARRNQKPDLTVSFHRRSHGDGHPFDGPGGILAHSF  176

Query  541  SPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQK  720
            +P  G  H+DADE W        +  + +VA+HEIGHLLGL HS V  A+M+     G+ 
Sbjct  177  APKDGRFHYDADEKW-SVGVVRGAFHLETVALHEIGHLLGLGHSSVRRAIMYPTISSGET  235

Query  721  RRDLTPDDINGIRALYH  771
             + L  DDI GI+ALYH
Sbjct  236  -KGLNRDDIQGIKALYH  251



>ref|XP_011073059.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 160/269 (59%), Gaps = 17/269 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND-----LSYNSSSWDADYFSDQLESAIRTYQTR  165
            L G++KG   KG+  LKKYL  FGY+N      L++ +     D+F D LE AI++YQT 
Sbjct  49   LVGTRKGTTSKGISQLKKYLSHFGYMNHKNNIILAHQTD----DFFDDNLELAIKSYQTF  104

Query  166  RHLNSTGILDADTVRQMTKPRCGVADIIN-GRPGGPSEVVPN----YRFYPGEPKWPNQK  330
              L   GI+DA+T+ QM+ PRCGV D  N  R       +P     Y F+PGEPKWP  K
Sbjct  105  FKLEVNGIMDANTITQMSPPRCGVPDSFNLNRSHELYLRIPTLASHYIFFPGEPKWPPTK  164

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPF  507
              LT+ F  G P      +  A + W +V  F+F  T  Y+ AD+K S    DHGDG PF
Sbjct  165  RSLTYSFPSGAPTDVTNSILHATQIWASVSPFTFSYTPDYDQADIKISFQNRDHGDGNPF  224

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG  AHA++P+ G  HFD DE WVD   +P + D+++V +HE+GH+LGL HS   GA
Sbjct  225  DGPGGILAHAYAPSDGRLHFDGDERWVD-GVTPGAFDLQTVGLHELGHVLGLGHSNDTGA  283

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            VM+     G  R+ L  DDINGI+ALY F
Sbjct  284  VMYPYIGDGL-RKVLGQDDINGIKALYQF  311



>ref|XP_004139164.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66657.1| hypothetical protein Csa_1G654860 [Cucumis sativus]
Length=314

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 158/278 (57%), Gaps = 23/278 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN---DLSYNSSSWDA-DYFSDQLESAIRTYQTRR  168
            LQG KKGD VKG+  LK + + +GY+N   + + +    DA D F D+LESAI+TYQ   
Sbjct  37   LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDIDANDIFDDRLESAIKTYQQYF  96

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGP----------------SEVVPNYRFY  300
            HLN TG L+A+T+ Q+  PRCG  DIIN   G                     V +Y F+
Sbjct  97   HLNPTGSLNAETLSQLATPRCGNPDIINETTGRMLSEDIDNVSSHDHHHLPHAVSHYAFF  156

Query  301  PGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLA  477
            PG  +WP+ K +LT+ F PGT A    PV  A   W    HF F   T Y  ADLK    
Sbjct  157  PGRLRWPSTKYRLTYAFLPGTRADAKAPVARAFATWARNTHFKFTLVTNYRRADLKIGFY  216

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLL  657
            RG+HGDG PFDGPGG  AHAF+PT G  H+D+ E W          D+++VA+HEIGHLL
Sbjct  217  RGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWAV-GAVRGRYDLQTVALHEIGHLL  275

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            GL HS V  A+M+   + G   + L  DDI GI+ LY+
Sbjct  276  GLGHSTVKNAIMYPYIKSGST-KGLNVDDIKGIKVLYN  312



>ref|XP_009368959.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
 ref|XP_009342471.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=320

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 158/274 (58%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + D F D LESAI++YQ   HLN 
Sbjct  48   LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDDEFDDLLESAIKSYQKSFHLNV  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSE---------VVPNYR-FYPGEPKWPNQK  330
            TG LD  TV+QM  PRCGV D++NG   G             V  Y  F+PG  +WP  K
Sbjct  106  TGSLDTTTVKQMMVPRCGVPDVVNGTRKGTKNHNRKLKSIHGVSYYEFFFPGPLRWPPTK  165

Query  331  SQLTFGFA------PGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            + L + FA      PGT     I    A + W  V  F+F+       AD+     RG H
Sbjct  166  THLRYRFASSASQVPGTENVRSI-CAQAFQKWAQVTSFTFEEVPATSSADITIGFHRGAH  224

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GD  PFDG  G  AHA  PT G  HFDADE W   +P P+ +D+ SVA+HEIGHLLGLDH
Sbjct  225  GDMAPFDGFKGALAHANPPTGGNFHFDADEKW-SANPGPNEVDLESVAVHEIGHLLGLDH  283

Query  670  S-EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            + ++P A+M+ +F YG  +RDLT DDI+GIRALY
Sbjct  284  NLDLPDAIMYPKFSYGIVKRDLTGDDIDGIRALY  317



>emb|CAN73130.1| hypothetical protein VITISV_030258 [Vitis vinifera]
Length=437

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 169/276 (61%), Gaps = 25/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWD------ADYFSDQLESAIRTYQT  162
            LQG  K D+VKG++ LKKYL+ FGY   LSYNS S +       DYF D LESAI++YQT
Sbjct  49   LQGCNKRDKVKGIHKLKKYLEQFGY---LSYNSHSKNQIRTDDDDYFDDLLESAIKSYQT  105

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIING------------RPGGPSEVVPNYRFYPG  306
              HL +TG LD++TV +M + RCGVADI+NG            +  G    V +Y+F+PG
Sbjct  106  NYHLKATGKLDSETVSEMMRSRCGVADIVNGTSWMQSSKKRHDQGHGSLHTVSHYQFFPG  165

Query  307  EPKWP-NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLAR  480
             P+WP +  + LT+ F PGTP +  IPV  A   W +   F+F +T+ + +A+L  S   
Sbjct  166  SPRWPTSNNAHLTYAFLPGTPDEAKIPVSRAFGKWASATSFTFAQTEDHRNANLTISFHS  225

Query  481  GDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLG  660
              HGD  PFDGPGG  AHA++PT G  H+DADE W      P  LD+ +VA+HEIGHLLG
Sbjct  226  LLHGDWNPFDGPGGTIAHAYAPTDGRFHYDADEEW-SVGAVPGXLDVETVALHEIGHLLG  284

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  A+M+     G   + L  DDI GIRA+Y
Sbjct  285  LGHSSVREAIMFPSISTGVT-KGLHRDDIEGIRAVY  319



>ref|XP_009351242.1| PREDICTED: metalloendoproteinase 1-like [Pyrus x bretschneideri]
Length=317

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 157/274 (57%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + D F D LESAI++YQ   HLN 
Sbjct  45   LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDDEFDDLLESAIKSYQKSFHLNV  102

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYR----------FYPGEPKWPNQK  330
            TG LD  TV+QM  PRCGV D++NG   G        +          F+PG  +WP  K
Sbjct  103  TGSLDTTTVKQMMVPRCGVPDVVNGTRKGTKNHNRKLKSIHGVSYYEFFFPGPLRWPPTK  162

Query  331  SQLTFGFA------PGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            + L + FA      PGT     I    A + W  V  F+F+       AD+     RG H
Sbjct  163  THLRYRFASSASQVPGTENVRSI-CAQAFQRWAQVTSFTFEEVPATSSADITIGFHRGAH  221

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GD  PFDG  G  AHA  PT G  HFDADE W   +P P+ +D+ SVA+HEIGHLLGLDH
Sbjct  222  GDMAPFDGFKGALAHANPPTGGNFHFDADEKW-SANPGPNEVDLESVAVHEIGHLLGLDH  280

Query  670  S-EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            + ++P A+M+ +F YG  +RDLT DDI+GIRALY
Sbjct  281  NLDLPDAIMYPKFSYGIVKRDLTGDDIDGIRALY  314



>emb|CCH68443.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=363

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 159/272 (58%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L G + G +V G+  +KKY + FGYIN+L S+N +    D F D LESA++TYQ   +L 
Sbjct  49   LLGCQPGQKVDGIAKIKKYFQHFGYINNLTSFNFT----DEFDDTLESALKTYQRNFNLK  104

Query  178  STGILDADTVRQMTKPRCGVADIINGRP---GGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            +TG+LDA T++ + KPRCG AD++NG      G    V +Y F+PG PKWP  K+ LT+ 
Sbjct  105  ATGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYA  164

Query  349  FAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPG  519
            F P       I  V++ A   W  V   SF     ++ AD+K     GDH DG PFDGP 
Sbjct  165  FLPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPM  224

Query  520  GNYAHAFSPTIGICHFDADENW-VDHDPSPH--------SLDIRSVAIHEIGHLLGLDHS  672
            G  AHAFSP  G  H D +ENW VD  P           ++D+ SVA+HEIGHLLGL HS
Sbjct  225  GTLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHS  284

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  ++M+   E G +R +L  DDI G++ LY
Sbjct  285  SVEDSIMYPSLESGIRRVELVEDDIKGVQELY  316



>ref|XP_006363533.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=370

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 156/279 (56%), Gaps = 28/279 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G  V GL  +KKY   FGYIN    NSSS   D F D LESA++TYQ   +LN+
Sbjct  48   LLGCHSGQTVDGLAKIKKYFHYFGYIN----NSSSNFTDDFDDTLESALKTYQLNFNLNT  103

Query  181  TGILDADTVRQMTKPRCGVADIINGR---------PGGPS-EVVPNYRFYPGEPKWPNQK  330
            TG+LDA T++ + KPRCG AD++NG           G P+   V +Y F+PG P+WP  K
Sbjct  104  TGVLDASTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGRPRWPANK  163

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
              LT+ FAP  G      I    A   W  V   +F +   Y+ AD+K     GDH DG 
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTHAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSP----------HSLDIRSVAIHEIGH  651
            PFDGP G  AHAFSP  G  H D +ENWV  D +P           ++D+ SVA+HEIGH
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVI-DGAPIVDGNFFSILSAVDLESVAVHEIGH  282

Query  652  LLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LLGL HS V  A+M+     G +R +L  DDI G++ LY
Sbjct  283  LLGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>ref|XP_004237082.2| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=387

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 159/272 (58%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L G + G +V G+  +KKY + FGYIN+L S+N +    D F D LESA++TYQ   +L 
Sbjct  73   LLGCQPGQKVDGIAKIKKYFQHFGYINNLTSFNFT----DEFDDTLESALKTYQRNFNLK  128

Query  178  STGILDADTVRQMTKPRCGVADIINGRP---GGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            +TG+LDA T++ + KPRCG AD++NG      G    V +Y F+PG PKWP  K+ LT+ 
Sbjct  129  ATGVLDAPTIQHLIKPRCGNADLVNGTSTMNAGKPHTVAHYSFFPGRPKWPEGKTDLTYA  188

Query  349  FAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPG  519
            F P       I  V++ A   W  V   SF     ++ AD+K     GDH DG PFDGP 
Sbjct  189  FLPANNLTDDIKSVFSRAFDRWSEVTPLSFTEIPSFQSADIKIGFLTGDHNDGEPFDGPM  248

Query  520  GNYAHAFSPTIGICHFDADENW-VDHDPSPH--------SLDIRSVAIHEIGHLLGLDHS  672
            G  AHAFSP  G  H D +ENW VD  P           ++D+ SVA+HEIGHLLGL HS
Sbjct  249  GTLAHAFSPPAGHFHLDGEENWVVDGVPVNEGNFFSILSAVDLESVAVHEIGHLLGLGHS  308

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  ++M+   E G +R +L  DDI G++ LY
Sbjct  309  SVEDSIMYPSLESGIRRVELVEDDIKGVQELY  340



>ref|NP_001266203.1| matrix metalloproteinase precursor [Solanum lycopersicum]
 emb|CCH68442.1| matrix metalloproteinase precursor [Solanum lycopersicum]
Length=367

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 157/279 (56%), Gaps = 28/279 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G  V GL  +KKY   FGYIN    NSS+   D F D LESA++TYQ   +LN+
Sbjct  48   LLGCHSGQTVDGLAKIKKYFHYFGYIN----NSSTNFTDDFDDTLESALKTYQLNFNLNT  103

Query  181  TGILDADTVRQMTKPRCGVADIINGR---------PGGPS-EVVPNYRFYPGEPKWPNQK  330
            TG+LDA+T++ + KPRCG AD++NG           G P+   V +Y F+PG P+WP  K
Sbjct  104  TGVLDANTIQHLIKPRCGNADVVNGTSTMNSGKPPAGSPTMHTVAHYSFFPGSPRWPANK  163

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
              LT+ FAP  G      I    A   W  V   +F +   Y+ AD+K     GDH DG 
Sbjct  164  RDLTYAFAPQNGLTDDIKIVFTRAFDRWSEVTPLTFTEIASYQSADIKIGFFSGDHNDGE  223

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSP----------HSLDIRSVAIHEIGH  651
            PFDGP G  AHAFSP  G  H D +ENWV  D +P           ++D+ SVA+HEIGH
Sbjct  224  PFDGPMGTLAHAFSPPAGHFHLDGEENWVI-DGAPIVDGNFFSILSAVDLESVAVHEIGH  282

Query  652  LLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LLGL HS V  A+M+     G +R +L  DDI G++ LY
Sbjct  283  LLGLGHSSVEDAIMYPTLGAGTRRVELRNDDILGVQELY  321



>gb|EYU35921.1| hypothetical protein MIMGU_mgv1a019701mg [Erythranthe guttata]
Length=304

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 151/263 (57%), Gaps = 8/263 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G +KG + KGL  LK +L   GY+ + +  + + + D F D LE AI+ YQ   HLN 
Sbjct  45   LVGVRKGQKAKGLVELKTHLSNLGYMKNNNNEAKA-NNDLFDDDLELAIKKYQVFFHLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVP----NYRFYPGEPKWPNQKSQLTFG  348
             GILDA TV  +  PRCGVAD +N         +P    +Y F+PGEPKWP  K+ LT+ 
Sbjct  104  NGILDAKTVEHLLLPRCGVADFVNLNASQFKNEIPTIASHYTFFPGEPKWPPGKTNLTYS  163

Query  349  FAPGTPAKFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGDGVPFDGPGGN  525
            F PG   +    +  A + W  V HF F   T Y+HAD+K S    DH DG  FDG GG 
Sbjct  164  FPPGASNEVMQAIKDATQLWAGVTHFKFTYITDYDHADIKISFQVWDHKDGAAFDGRGGI  223

Query  526  YAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEF  705
             AHAF+P+ G  HFD DE WVD    P   D++ V +HE+GH+LGL H+   GA+M    
Sbjct  224  LAHAFAPSDGRLHFDGDEVWVD-GVVPGKFDLQMVGLHELGHVLGLGHTTDGGAIMTPTL  282

Query  706  EYGQKRRDLTPDDINGIRALYHF  774
              G  R+ L  DDINGI+ALYH 
Sbjct  283  GSG-FRKGLGQDDINGIKALYHL  304



>ref|XP_008230961.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=311

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 155/272 (57%), Gaps = 21/272 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G + GD+V G+ +LKKYL  FGY++    ++++   D F DQL SAI+TYQ   +L +
Sbjct  45   LKGFQNGDKVPGIQDLKKYLGRFGYLS----SNNNQTTDEFDDQLASAIKTYQLNYNLKT  100

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPN----------YRFYPGEPKW  318
            TGILD  TV  M  PRCGV DIING    R G  S   PN          Y F+PG+PKW
Sbjct  101  TGILDTQTVSNMMMPRCGVPDIINGTSSMRSGKQSHPPPNHHHKGHTVAHYAFFPGKPKW  160

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGD  495
            P  K  LT+ F  GTP     PV  A   W     F F Q  + +  DL  S  R  HGD
Sbjct  161  PASKYHLTYAFLRGTPTAAKGPVARAFNTWAAHTQFKFSQAPRNQKPDLTVSFHRRSHGD  220

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G PFDGPGG  AH+F+P  G  H+DADE W        +  + +VA+HEIGHLLGL HS 
Sbjct  221  GHPFDGPGGILAHSFAPKDGRFHYDADEKW-SVGVVRGAFHLETVALHEIGHLLGLGHSS  279

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            V  A+M+     G+  + L  DDI GI+ALYH
Sbjct  280  VRRAIMYPTISSGET-KGLNRDDIQGIKALYH  310



>gb|EYU38312.1| hypothetical protein MIMGU_mgv11b017434mg [Erythranthe guttata]
Length=251

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 136/233 (58%), Gaps = 16/233 (7%)
 Frame = +1

Query  115  DYFSDQLESAIRTYQTRRHLNSTGILDADTVRQMTKPRCGVADIING-------------  255
            D+ +   ESAI+TYQ   H+  TGILDA TV +MT PRCG ADI+NG             
Sbjct  15   DFINQLEESAIKTYQRNYHIAPTGILDATTVSKMTTPRCGYADIVNGINTMQLNKGKKYL  74

Query  256  RPGGPSEVVPNYRF-YPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF  432
                    V +YRF  P   +WP  K+ LT+ F P TP     PV  A + WH++  FSF
Sbjct  75   NSNNDIHTVSHYRFTVPRNRRWPRSKANLTYRFLPNTPEIAVGPVSRAFQKWHSISGFSF  134

Query  433  QRTQ-YEHADLKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPH  609
             R Q     DL     +  HGDG PFDGPGG  AHAF PT G  H+DADE W D  P+P 
Sbjct  135  SRVQDSSSTDLVIGFFKRSHGDGAPFDGPGGVTAHAFRPTDGRLHYDADEKWSD-GPAPD  193

Query  610  SLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            ++D+ S+A+HEIGHLLGL HS+V  A+M+S   YG  +     DDINGI+ALY
Sbjct  194  AMDLESIAVHEIGHLLGLGHSDVKAAIMYSYLNYGMNKTKFDADDINGIKALY  246



>ref|XP_004139163.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN66654.1| hypothetical protein Csa_1G654840 [Cucumis sativus]
Length=315

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 126/283 (45%), Positives = 153/283 (54%), Gaps = 24/283 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSWDADYFSDQLESAIRTYQTRR  168
            LQGSKKGD VKG+  LK + + +GY    IN   +       D F D+ ESA++TYQ   
Sbjct  35   LQGSKKGDNVKGISKLKNFFRRYGYLNHQINVTGHLIDHDADDTFDDRFESAVKTYQQYF  94

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPG-----------------GPSEVVPNYRF  297
            HLNSTG L+A+T+ Q+  PRCG  DI+N   G                   S  VP+Y F
Sbjct  95   HLNSTGSLNAETLSQLATPRCGNPDILNEATGRMLLENNNNDSSHDHYHQLSHAVPHYSF  154

Query  298  YPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQ-RTQYEHADLKFSL  474
            +PG P+WP  K  LT+ F P T A    PV  A   W    HF F   T    ADLK   
Sbjct  155  FPGRPRWPPTKYHLTYEFLPNTHADAKAPVTRAFATWARHTHFKFSLATNSRRADLKIGF  214

Query  475  ARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHL  654
             RG+HGDG PFDG GG  AHAF+PT G  HFD+ E WV         D+ +VA+HEIGHL
Sbjct  215  YRGNHGDGYPFDGSGGTLAHAFTPTDGRVHFDSTEKWVV-GAVRGRFDLETVALHEIGHL  273

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF*QP  783
            LGL HS V  A+M+   E G   + L  DDI GI  LY+   P
Sbjct  274  LGLGHSRVKNAIMYPTIESGST-KGLNADDIEGIEVLYNVPLP  315



>gb|KDP45419.1| hypothetical protein JCGZ_09668 [Jatropha curcas]
Length=270

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 154/271 (57%), Gaps = 25/271 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            G++ K ++ LK+YL+ FGY+N     S S D++ F   LESAI+TYQ    L+ TG LD+
Sbjct  2    GEKNKKIHQLKEYLEQFGYMN--KKGSVSLDSNSFDGDLESAIKTYQLNYRLDPTGTLDS  59

Query  199  DTVRQMTKPRCGVADIINGR--------------------PGGPSEVVPNYRFYPGEPKW  318
            +TV  M KPRCGV DIING                            V +Y F+PG PKW
Sbjct  60   ETVETMIKPRCGVPDIINGTNRMQNGNISPSSSPSPSPSSSPNSFHTVSHYAFFPGTPKW  119

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGD  495
               K  LT+ F P TP      +  A + W N  HF+F+R T    AD+K    + DHGD
Sbjct  120  EASKYHLTYEFGPQTPPIAIEVISQAFQTWANNSHFTFERGTDITTADIKIRFRKRDHGD  179

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G+PFDG GG  AHA+SP  G  HFDA+ENWV       + D+ +VA+HEIGHLLGL+HS 
Sbjct  180  GIPFDGRGGILAHAYSPQDGRFHFDAEENWVT-GAREGAYDLGTVALHEIGHLLGLEHSS  238

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V  A+M+     G   + L  DDI+GI+ALY
Sbjct  239  VEEAIMYPTIPSGAT-KGLHKDDIDGIQALY  268



>ref|XP_006363534.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=363

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/272 (43%), Positives = 159/272 (58%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G + G +V G+  +KKY + FGYIN  ++ +S++  D F D LESA++TYQ   +LN+
Sbjct  48   LLGCQPGQKVDGIAKIKKYFQHFGYIN--TFTTSNF-TDEFDDTLESALKTYQRNFNLNA  104

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---GGPSEVVPNYRFYPGEPKWPNQKSQLTFGF  351
            TG+ D  T++ + KPRCG AD++NG      G    V +Y F+PG PKWP  K+ LT+ F
Sbjct  105  TGLFDEPTIQNLIKPRCGNADVVNGTSTMNAGKPHTVAHYSFFPGRPKWPESKTDLTYSF  164

Query  352  APGTPAKFFI-PVYT-ALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGPGG  522
             P       I  V++ A   W  V   SF +   ++ AD+K     GDH DG PFDGP G
Sbjct  165  LPANNLTEDIKSVFSRAFDRWSEVTPLSFTEIASFQSADIKIGFFTGDHNDGEPFDGPMG  224

Query  523  NYAHAFSPTIGICHFDADENWVDHDPSP----------HSLDIRSVAIHEIGHLLGLDHS  672
              AHAFSP  G  H D +ENWV  D  P           ++D+ SVA+HEIGHLLGL HS
Sbjct  225  TLAHAFSPPAGHFHLDGEENWV-VDGVPVNDGNFFSILSAVDLESVAVHEIGHLLGLGHS  283

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  ++M+   E G +R +L  DD+ G++ LY
Sbjct  284  SVEDSIMYPSLEAGIRRVELVDDDVKGVQELY  315



>ref|XP_011072962.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=311

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 156/265 (59%), Gaps = 9/265 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDAD-YFSDQLESAIRTYQTRRHLN  177
            L G++KG   KG+  LKKYL  FGY+N  +    +   D +F D LE AI++YQT   L 
Sbjct  49   LIGTQKGTTSKGISQLKKYLSHFGYMNHKNNTILTHQTDDFFDDNLELAIKSYQTFFKLK  108

Query  178  STGILDADTVRQMTKPRCGVADIIN-GRPGGPSEVVPN----YRFYPGEPKWPNQKSQLT  342
              GI+DA+ V +M+ PRCGV D  N  R       +P     Y F+PGEPKWP  K  LT
Sbjct  109  VNGIMDANIVAKMSHPRCGVPDSFNLNRSHKLYLRIPTLASHYTFFPGEPKWPPTKRSLT  168

Query  343  FGFAPGTPAKFFIPVYTALRDWHNVGHFSFQ-RTQYEHADLKFSLARGDHGDGVPFDGPG  519
            + F  G P      +  A + W +V  F F  RT Y+ AD+K S    DHGDG PFDGPG
Sbjct  169  YSFPLGGPTNVNSSILHATQIWASVTPFRFSYRTNYDQADIKISFQYRDHGDGYPFDGPG  228

Query  520  GNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWS  699
            G  AHAF+P+ G  HFD DE WVD   +  + D+++V +HE+GH+LGL H+   GA+M+ 
Sbjct  229  GILAHAFAPSDGRLHFDGDERWVD-GVTLGAFDMQTVGLHELGHVLGLGHTNDTGAIMYP  287

Query  700  EFEYGQKRRDLTPDDINGIRALYHF  774
                G  R+ L  DDINGI+ALY F
Sbjct  288  YIGDGL-RKVLGQDDINGIKALYQF  311



>ref|XP_008458911.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 150/270 (56%), Gaps = 21/270 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L GS+K D  +G++ +K YL+ +GY++D   N+ S DA  F D LESAI++YQ    LN 
Sbjct  40   LIGSRKNDNFEGIHKVKAYLQRYGYLSDEKENNLSIDA--FDDDLESAIKSYQKVFKLNV  97

Query  181  TGILDADTVRQMTKPRCGVADII-------------NGRPGGPSEVVPNYRFYPGEPKWP  321
            +G+LD +T++QM +PRCGV D               N + GG      +Y FYP + KWP
Sbjct  98   SGVLDRETLQQMARPRCGVTDDFILVAQQDHENNNTNIQIGGS-----HYMFYPNKLKWP  152

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDG  498
             +K  LT+GF    P +    V  A   W     F+F    + + AD+  S  RGDHGDG
Sbjct  153  VEKRHLTYGFIHNYPPEHAAAVIRAFDTWEANTKFTFSHAARVQTADILLSFERGDHGDG  212

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEV  678
             PFDGPGG   HAF    G  HFD DE W          D+ SVA+HEIGH LGL HS  
Sbjct  213  KPFDGPGGALGHAFGAIDGRVHFDGDEQWETGSFWQEYFDVESVALHEIGHALGLGHSRE  272

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            P AVMW+  + G  +  LT DDI GI ALY
Sbjct  273  PSAVMWANMDSGVTKTHLTIDDIEGIHALY  302



>ref|XP_010110202.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXC25440.1| Metalloendoproteinase 1 [Morus notabilis]
Length=332

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 160/294 (54%), Gaps = 40/294 (14%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYN----SSSWD----ADYFSDQLESAIRTY  156
            L G  KG+ V GL  LK+YL+ FGY++  +      + ++D     DYF D LESAI+ Y
Sbjct  43   LTGGHKGEIVPGLSELKQYLQRFGYLDSEAVENVAEAQNYDDVNSIDYFDDVLESAIKAY  102

Query  157  QTRRHLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEV-------------------  279
            Q   +LN TG LD  TVRQM  PRCG  D +NG    P                      
Sbjct  103  QRNYNLNVTGTLDPPTVRQMMLPRCGFPDTVNGTTSFPISHDHDHDHDHNHDHDHVHKQL  162

Query  280  ---VPNYRFYPGEPKWPNQKSQLTFGFA-----PGTPAKFFIPVYTALRDWHNVGHFSFQ  435
               V +Y F+ G P+W   K QLT+ F      PGT     I VY A + W  V  F+F 
Sbjct  163  IHGVRHYSFFRGSPRW--NKYQLTYRFVAGVQVPGTSNIRSI-VYRAFQRWARVTRFTFT  219

Query  436  RTQYE-HADLKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHS  612
                   +D+     RG HGD  PFDG GG  AHA++P++G  H+DADE W + +P+ + 
Sbjct  220  EVASNVQSDISIGFFRGYHGDNAPFDGTGGTIAHAYAPSVGWFHYDADEYWSE-NPNYYQ  278

Query  613  LDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            +D+ SVA+HEIGHLLGLDHS V  A+M+     G  +R+L  DDINGIRALY F
Sbjct  279  MDLESVAVHEIGHLLGLDHSTVAAAIMYPSINSGAIKRELNADDINGIRALYAF  332



>ref|XP_004297896.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=313

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 160/266 (60%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY----NSSSWDADYFSDQLESAIRTYQTRR  168
            L+GS KGD ++G+ +LK +L+ FGY   LSY    N    D D F D LESA++ YQ   
Sbjct  49   LKGSHKGDHIQGILDLKLFLEKFGY---LSYGNDKNHIHADDDDFDDVLESAVKDYQHYF  105

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEV-----VPNYRFYPGEPKWPNQKS  333
            HL +TG LD  TV +MTKPRCGV+D I       S+      V +Y F+  + KWP  K 
Sbjct  106  HLRTTGTLDGKTVSKMTKPRCGVSDHIGVHKIDYSKKDHIHEVSHYSFFSSKQKWPPSKY  165

Query  334  QLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
             LT+ FAPGT ++   P+  A + W    HF F+R + Y+ AD+K S  +GDHGDG  FD
Sbjct  166  HLTYAFAPGTLSEAMTPIAQAFQTWAASTHFKFRRHRDYKKADIKISFEQGDHGDGSSFD  225

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAV  690
            G GG  AHA++PT G  H+DADE W       +  D+ +VA+HEIGHLLGL HS    A+
Sbjct  226  GTGGILAHAYAPTYGKLHYDADEPWSIGALEGY-YDLETVALHEIGHLLGLAHSSEEDAI  284

Query  691  MWSEFEYGQKRRDLTPDDINGIRALY  768
            M+     G  + DL  DDI+GIRALY
Sbjct  285  MYPYISSGVTKLDLHHDDIHGIRALY  310



>ref|XP_002311051.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
 gb|EEE88418.2| hypothetical protein POPTR_0008s02790g [Populus trichocarpa]
Length=295

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 152/266 (57%), Gaps = 21/266 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L  S+KG  V  L+ +K+YLK FGY+          D D  +D+LESAIRTYQ   HL  
Sbjct  39   LVESQKGQSVSKLHLVKQYLKKFGYL----------DYDLSNDRLESAIRTYQQNFHLEV  88

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPN--YRFYPGEPKWPNQKSQLT  342
            TG LD  TV QM KPRCGVADI N          S+ V N  Y F+PG P+W ++  + T
Sbjct  89   TGRLDKRTVNQMMKPRCGVADIFNSTKHHNSSKSSDGVANADYSFFPGAPRWSSKHLKYT  148

Query  343  FGFAPGTPAKFFI--PVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDG  513
            FG          I      + + W  V  F+F+       AD+K +  + DHGD  PFDG
Sbjct  149  FGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEPFDG  208

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEV-PGAV  690
            PGG +AH F PTIG+ HFDADE W   +P    LD+ SVA+HEIGHL  L HSE  P A+
Sbjct  209  PGGIFAHGFRPTIGMLHFDADETWSS-NPGSLELDLESVAVHEIGHLPELGHSEDHPDAI  267

Query  691  MWSEFEYGQKRRDLTPDDINGIRALY  768
            M+  F+YG+ +R L  DDI GIR LY
Sbjct  268  MYPYFDYGKTKRSLQEDDIEGIRDLY  293



>ref|XP_011003818.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 159/274 (58%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG  VKGL  LK +LK  GY   D  ++     +D F +  ESA++TYQ    LN
Sbjct  39   LEGCQKGQNVKGLKELKHHLKNIGYYPKDHQHDIKL--SDDFDEIFESALKTYQKNYRLN  96

Query  178  STGILDADTVRQMTKPRCGVADIIN---GRPGGPSE---------VVPNYRFYPGEPKWP  321
             TG LD+DT++++  PRCGV D IN    +  G +E          V +Y F+ G P+WP
Sbjct  97   VTGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWP  156

Query  322  NQKSQLTFGFAPGTPA----KFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGD  486
            + K  LT+ F+         +       A + W +V  F+FQ  +Q   AD+      GD
Sbjct  157  SSKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGD  216

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLD  666
            HGDG PFDGPG   AHAF+PT G  H+DADE W   +PS   +D+ SVA+HEIGHLLGLD
Sbjct  217  HGDGDPFDGPGRILAHAFAPTDGRLHYDADEKWST-NPSTDEVDLESVAVHEIGHLLGLD  275

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS    ++M++E   G  +R+L  DDI+GIRALY
Sbjct  276  HSMDQNSIMFAEIPQGTIKRELGQDDIDGIRALY  309



>gb|KDO37628.1| hypothetical protein CISIN_1g039411mg [Citrus sinensis]
Length=222

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 137/221 (62%), Gaps = 15/221 (7%)
 Frame = +1

Query  145  IRTYQTRRHLNSTGILDADTVRQMTKPRCGVADIING----RPGGPSE--------VVPN  288
            ++TYQ   HLNSTG+LD +TV  MT+PRCGVADI+NG    R G  S          V +
Sbjct  1    MKTYQLNYHLNSTGVLDGNTVAMMTRPRCGVADIVNGTTRMRSGMKSHQHGANHFHTVSH  60

Query  289  YRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLK  465
            Y F+PG P+WP   S LT+ F PGTPA+    V  A + W  + HF F +TQ Y +A+LK
Sbjct  61   YEFFPGRPRWPPSNSHLTYAFLPGTPAEAINAVGRAFQTWAAISHFKFSQTQDYTNANLK  120

Query  466  FSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEI  645
             S  RG HGD  PFDG GG  AHA  P  GI  +DADE W      P + D+ +VA+HEI
Sbjct  121  ISFQRGWHGDSSPFDGRGGTIAHAAPPRGGIFDYDADEQWAV-GARPGAFDLETVALHEI  179

Query  646  GHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GHLLGLDHS V GA+M++  + G   + L  DD+ GIRALY
Sbjct  180  GHLLGLDHSLVEGAIMYAYIDPGAT-KGLHTDDVQGIRALY  219



>ref|XP_006387200.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
 gb|ABK94796.1| unknown [Populus trichocarpa]
 gb|ERP46114.1| hypothetical protein POPTR_1544s00200g [Populus trichocarpa]
Length=309

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 152/273 (56%), Gaps = 25/273 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI--NDLSYNSSSWDADYFSDQLESAIRTYQTRRHL  174
            L+G KKG  V+GL  LK+YLK  GY   +D++  SS +D     D LE A++TYQ   HL
Sbjct  43   LEGVKKGQTVQGLIELKQYLKKLGYYPSDDITLTSSDFD-----DHLELALKTYQEYFHL  97

Query  175  NSTGILDADTVRQMTKPRCGVADIINGRPGGPSE---------VVPNYRFYPGEPKWPNQ  327
            N TG LD+ T++QM  PRCG  DIIN     P+          +V +Y F  G  KWP  
Sbjct  98   NVTGNLDSSTIQQMVIPRCGTPDIINTPSTKPNSTKSKHKKVHMVAHYAF--GAEKWPPS  155

Query  328  KSQLTFGFAPGTPA----KFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHG  492
            K  LT+ F  G               A + W  V  F+FQ  T    AD+      GDHG
Sbjct  156  KYALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFQEATAGASADIVIEFYSGDHG  215

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            D  PFDGPG   AHAF P  G  H+DADENW   DP+    D+ SV +HEIGHLLGL HS
Sbjct  216  DRYPFDGPGKTLAHAFYPQDGRLHYDADENW-STDPAMDQTDLESVTVHEIGHLLGLHHS  274

Query  673  -EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             + P A+M+   E G+K+RDL  DDI+GI ALY
Sbjct  275  TDHPEAIMYPTIEAGKKKRDLAQDDIDGIHALY  307



>gb|EYU31381.1| hypothetical protein MIMGU_mgv1a023026mg, partial [Erythranthe 
guttata]
Length=267

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 151/263 (57%), Gaps = 10/263 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G++KG + K +  LKK+L   GY+   + N +    D F D LE AI+ YQ   HL+ 
Sbjct  10   LIGARKGHKAKSVLELKKHLSNIGYMKH-NNNEAKEKTDLFDDDLELAIKKYQVFFHLDV  68

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN----YRFYPGEPKWPNQKSQLTFG  348
            TGILDA TV+ +  PRCGVAD +N         +P     Y F+PGEPKWP  K+ LT+ 
Sbjct  69   TGILDAKTVKNLLLPRCGVADFVNLNASQFKNKIPTLASHYTFFPGEPKWP--KTNLTYS  126

Query  349  FAPGTPAKFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGDGVPFDGPGGN  525
            F PGT A     +  A + W +V +F F     Y+HAD+K S    +HGDG PFDG GG 
Sbjct  127  FPPGTRADALQAIKDATQMWASVSNFKFTYIADYDHADIKISFQVWEHGDGTPFDGRGGA  186

Query  526  YAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEF  705
             AH+  P   + HFD DE W D    P   D++++ +HE+GH LGL H+   GA+M+   
Sbjct  187  LAHSSGPYDSLLHFDGDELWAD-GVVPGKYDLQTIGLHELGHKLGLGHTNDGGAIMYPTI  245

Query  706  EYGQKRRDLTPDDINGIRALYHF  774
              G  R+ L  DDI+GI+ALYH 
Sbjct  246  GSGF-RKGLGKDDIDGIKALYHL  267



>ref|XP_006482471.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
Length=254

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 151/255 (59%), Gaps = 19/255 (7%)
 Frame = +1

Query  58   LKTFGYINDLSYNSSSWDA--DYFSDQLESAIRTYQTRRHLNSTGILDADTVRQMTKPRC  231
            ++ FGY+N  +Y + S  A  D F + LESAI+TYQ   HL STGILDA+TV +M  PRC
Sbjct  1    MEKFGYLNYDNYKNQSKHANDDDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRC  60

Query  232  GVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQLTFGFAPGTPAKFF  378
            GVADI+NG    R G   +        V +Y F+ G P+WP  K  LT+ F PGT +   
Sbjct  61   GVADIVNGTTQMRSGKKRQQHNHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAI  120

Query  379  IPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD---GPGGNYAHAFSP  546
             PV  A + W     F F + + + +AD+K S   GDHGDG PFD   GP G  AHAF+P
Sbjct  121  TPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAP  180

Query  547  TIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRR  726
            T G  H+DADE W        + D+ +VA+HEIGHLLGL HS V GA+M+     G K +
Sbjct  181  TNGRFHYDADEPWAV-GAVQGAFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAGVK-K  238

Query  727  DLTPDDINGIRALYH  771
             L  DDI GIR LY+
Sbjct  239  GLHGDDIQGIRDLYN  253



>ref|XP_011071055.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=374

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 159/273 (58%), Gaps = 21/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G KKG +  GL  LK+Y + FGY+N  SY+  S   D F D LE A++TYQ   +LN+
Sbjct  51   LVGCKKGQKADGLPKLKEYFQYFGYLNT-SYSDFS---DEFDDSLEIAVKTYQLNFNLNA  106

Query  181  TGILDADTVRQMTKPRCGVADIINGR----PGGPSE-----VVPNYRFYPGEPKWPNQKS  333
            TG +DA+T++++  PRCG  DI+NG     PG PS       V +Y F+P  P+WP  KS
Sbjct  107  TGQIDAETIKRIVVPRCGNPDIVNGTSAMHPGKPSANSTIHTVAHYSFFPNRPRWPPSKS  166

Query  334  QLTFGFAPGTPAKFFIPVY--TALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVP  504
            QLT+ F P       +      A   W  V   +F + + +  AD++      +HGDG P
Sbjct  167  QLTYAFLPENQLSDVVKTVFSRAFERWSEVTTLTFTEISSFNRADIRIGFFSREHGDGEP  226

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWV-DHD---PSPHS-LDIRSVAIHEIGHLLGLDH  669
            FDG  G  AHAFSP  G CHFD +ENWV D D    +P S +D+ SVA+HEIGH+LGL H
Sbjct  227  FDGVLGTLAHAFSPPTGRCHFDGEENWVIDGDFLNGAPLSAVDLESVAVHEIGHILGLGH  286

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  287  SSVEEAIMYPSISSGTRKVELADDDIMGIQELY  319



>ref|XP_004167464.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52408.1| hypothetical protein Csa_5G632070 [Cucumis sativus]
Length=306

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 156/266 (59%), Gaps = 13/266 (5%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYFSNENENNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTVRQMTKPRCGVADII------NGRPGGPSEVV--PNYRFYPGEPKWPNQKS  333
             +G+LD +T++QM++PRCGVAD        +G     +  +   ++ F+PG+ KWP +K 
Sbjct  98   VSGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGSHFMFFPGKGKWPYRKW  157

Query  334  QLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFD  510
             LT+GF    P K    V  A   W     F+F    + + AD+  S  RGDHGDG PFD
Sbjct  158  HLTYGFVHNYPMKHAAAVVRAFDKWAANSKFTFSLAWRIQTADILLSFERGDHGDGKPFD  217

Query  511  GPGGNYAHAFSPTIGICHFDADENWVD-HDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            G GG   HAF P  G  HFDADE W +    +  + D  SVA+HEIGH LGL HS  P A
Sbjct  218  GEGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGHALGLGHSIFPSA  277

Query  688  VMWSEFEYGQKRRDLTPDDINGIRAL  765
            VMW+  E G  + +LT DDI G+ AL
Sbjct  278  VMWANMETGVNKTELTIDDIEGVHAL  303



>ref|XP_004142466.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=306

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 156/266 (59%), Gaps = 13/266 (5%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L GS K D  V+G++ +K YL+ +GY ++ + N+ S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYFSNENENNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTVRQMTKPRCGVADII------NGRPGGPSEVV--PNYRFYPGEPKWPNQKS  333
             +G+LD +T++QM++PRCGVAD        +G     +  +   ++ F+PG+ KWP +K 
Sbjct  98   VSGVLDRETLQQMSRPRCGVADNFQSVAQQDGENNNTTVQIGGSHFMFFPGKGKWPYRKW  157

Query  334  QLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFD  510
             LT+GF    P K    V  A   W     F+F    + + AD+  S  RGDHGDG PFD
Sbjct  158  HLTYGFVHNYPMKHAAAVVRAFDKWAANSKFTFSLAWRIQTADILLSFERGDHGDGKPFD  217

Query  511  GPGGNYAHAFSPTIGICHFDADENWVD-HDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            G GG   HAF P  G  HFDADE W +    +  + D  SVA+HEIGH LGL HS  P A
Sbjct  218  GEGGILGHAFGPIDGRVHFDADEQWAEIGSLTNENFDFESVALHEIGHALGLGHSIFPSA  277

Query  688  VMWSEFEYGQKRRDLTPDDINGIRAL  765
            VMW+  E G  + +LT DDI G+ AL
Sbjct  278  VMWANMETGVNKTELTIDDIEGVHAL  303



>ref|XP_009624303.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=365

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 152/278 (55%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G +V GL  +KKY   FGYI  LS  +     D F D LESA++TYQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLSNFT-----DDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDADTVRQMTKPRCGVADIINGR---------PGGPS-EVVPNYRFYPGEPKWPNQK  330
            TG+LDA T++ + +PRCG AD++NG           G PS   V +Y F+PG P+WP  K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSPSMHTVAHYSFFPGRPRWPASK  161

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGV  501
            + LT+ F P  G           A   W  V   +F  T  ++ AD+K     GDH DG 
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFERWSEVTPLTFSETASFQSADIKIGFFAGDHNDGE  221

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWV---------DHDPSPHSLDIRSVAIHEIGHL  654
            PFDGP G  AHAFSP  G  H D DENWV         +      ++D+ SVA+HEIGHL
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVINGVPIDEGNFFSILSAVDLESVAVHEIGHL  281

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  ++M+     G +R +L  DDI G++ LY
Sbjct  282  LGLGHSSVEDSIMYPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_008443669.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=313

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 152/277 (55%), Gaps = 23/277 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGY----INDLSYNSSSWDADYFSDQLESAIRTYQTRR  168
            LQG KKGD VKG+  LK + + +GY    IN   +   +   D F D+LE AI+TYQ   
Sbjct  36   LQGCKKGDNVKGISKLKNFFRYYGYLNHQINATGHLIDTDADDTFDDRLEFAIKTYQQYF  95

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGGP----------------SEVVPNYRFY  300
            HLN TG L+A+T+ Q+  PRCG  DIIN   G                     V +Y F+
Sbjct  96   HLNPTGSLNAETISQLATPRCGNPDIINESTGRMLSEHNNNDSSHDHHHLPHAVSHYAFF  155

Query  301  PGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLA  477
            PG  +WP+ K +LT+ F PGT A    PV  A   W    HF F   T Y  ADLK    
Sbjct  156  PGRRRWPSTKYRLTYAFLPGTRADAKAPVTRAFATWARNTHFKFSLITNYRRADLKIGFY  215

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLL  657
            RG+HGDG PFDGPGG  AHAF+PT G  H+D+ E W          D+++VA+HEIGHLL
Sbjct  216  RGNHGDGYPFDGPGGTLAHAFAPTDGRFHYDSTEKWAV-GAVKGRYDLQTVALHEIGHLL  274

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS V  A+M+     G   + L  DDI GI+ LY
Sbjct  275  GLGHSTVRNAIMYPYIRSGST-KGLNADDIKGIKVLY  310



>gb|KCW49214.1| hypothetical protein EUGRSUZ_K02794, partial [Eucalyptus grandis]
Length=227

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/264 (44%), Positives = 147/264 (56%), Gaps = 44/264 (17%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQG  KG+   G+  LK+YL+ F                      E A++TYQ   HLN 
Sbjct  2    LQGCHKGNHTGGIRELKRYLEKF----------------------EFAVKTYQLNYHLNV  39

Query  181  TGILDADTVRQMTKPRCGVADIING--RPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFA  354
            TG LD  T  +M +PRCGVADIING  R G               P+WP     LT+GF 
Sbjct  40   TGTLDPQTTSKMMRPRCGVADIINGTTRMG---------------PRWPASNYHLTYGFL  84

Query  355  PGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV--PFDGPGGN  525
            PGTP     PV  A   W +V  F+F   + +E A+++   ARGDHGDG    FDGPGG 
Sbjct  85   PGTPEAATAPVARAFATWTSVTRFTFSYVEDHEIANIQIGFARGDHGDGAHNSFDGPGGT  144

Query  526  YAHAFSPTIGICHFDADENWVDHDPS-PHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSE  702
             AHAF PT+G+ H+DADE W    PS   + ++ +VA+HEIGHLLGL HS+V GA+M+S 
Sbjct  145  LAHAFPPTVGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHLLGLGHSDVEGAIMYSS  204

Query  703  FEYGQKRRDLTPDDINGIRALYHF  774
               G   + L  DDI GI+ALY+F
Sbjct  205  IAPGTT-KGLHADDIQGIKALYNF  227



>ref|XP_011003815.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=311

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 158/274 (58%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG  VKGL  LK +L+  GY   D  ++     +D F +  ESA++TYQ    LN
Sbjct  39   LEGCQKGQNVKGLKELKHHLRNIGYYPKDHQHDIKL--SDDFDEIFESALKTYQKNYRLN  96

Query  178  STGILDADTVRQMTKPRCGVADIIN---GRPGGPSE---------VVPNYRFYPGEPKWP  321
             TG LD+DT++++  PRCGV D IN    +  G +E          V +Y F+ G P+WP
Sbjct  97   VTGSLDSDTIKELMIPRCGVPDPINHDTSKQAGRTEHDNKSRKFHTVSHYSFFGGTPRWP  156

Query  322  NQKSQLTFGFAPGTPA----KFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGD  486
            + K  LT+ F+         +       A + W +V  F+FQ  +Q   AD+      GD
Sbjct  157  SSKFHLTYTFSSSVQVVDMQELRSACSRAFQKWADVTQFTFQEASQGSQADIVIGFQSGD  216

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLD  666
            HGDG PFDGPG   AHAF+PT G  H+DADE W   +P    +D+ SVA+HEIGHLLGLD
Sbjct  217  HGDGDPFDGPGRILAHAFAPTDGRLHYDADEKWST-NPRTDEVDLESVAVHEIGHLLGLD  275

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS    ++M++E   G  +R+L  DDI+GIRALY
Sbjct  276  HSMDQNSIMFAEIPQGTIKRELGQDDIDGIRALY  309



>gb|ABF58910.1| matrix metalloprotease 1 [Nicotiana tabacum]
Length=365

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 154/278 (55%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G +V GL  +KKY   FGYI  LS  +     D F D LESA++TYQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLSNFT-----DDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDADTVRQMTKPRCGVADIINGR--------PGGPSEV--VPNYRFYPGEPKWPNQK  330
            TG+LDA T++ + +PRCG AD++NG         P G   +  V ++ F+PG P+WP+ K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGV  501
            + LT+ F P  G           A   W  V   SF  T  ++ AD+K     GDH DG 
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWV-DHDPSPH--------SLDIRSVAIHEIGHL  654
            PFDGP G  AHAFSP  G  H D DENWV D  P           ++D+ SVA+HEIGHL
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGHL  281

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  ++M+     G +R +L  DDI G++ LY
Sbjct  282  LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_006376166.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
 gb|ERP53963.1| hypothetical protein POPTR_0013s10410g [Populus trichocarpa]
Length=304

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 160/268 (60%), Gaps = 20/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  +S +D     D LESA++TYQ   HLN
Sbjct  43   LEGVRKGQTVEGLVELKQYLKRFGYYPSDVNLMTSDFD-----DLLESALKTYQNYFHLN  97

Query  178  STGILDADTVRQMTKPRCGVADII-NGRPGGPSE--VVPNYRFYPGEPKWPNQKSQLTFG  348
             TGILD  T++QM  PRCG+ DI  N      ++  +V +Y F+ G PKW   K  LT+ 
Sbjct  98   VTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYT  157

Query  349  FAPGTPAKFFIPVYT-------ALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGDGVP  504
            F  G+     + + T       A + W +V   +FQ  +    A++  +  RGDHGDG P
Sbjct  158  F--GSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYP  215

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPG  684
            FDGPG   AHAFSP  G  H+DADE W   +P+   +D+ SVA+HEIGHLLGL HS    
Sbjct  216  FDGPGKILAHAFSPENGRFHYDADEKW-STNPAMDQIDLESVAVHEIGHLLGLAHSSDSN  274

Query  685  AVMWSEFEYGQKRRDLTPDDINGIRALY  768
            AVM+     G K+R+L  DDI+GI ALY
Sbjct  275  AVMYPSIAAGTKKRNLAQDDIDGIHALY  302



>gb|ABK95950.1| unknown [Populus trichocarpa]
Length=304

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 160/268 (60%), Gaps = 20/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  +S +D     D LESA++TYQ   HLN
Sbjct  43   LEGVRKGQTVEGLVELKQYLKRFGYYPSDVNLMTSDFD-----DLLESALKTYQNYFHLN  97

Query  178  STGILDADTVRQMTKPRCGVADII-NGRPGGPSE--VVPNYRFYPGEPKWPNQKSQLTFG  348
             TGILD  T++QM  PRCG+ DI  N      ++  +V +Y F+ G PKW   K  LT+ 
Sbjct  98   VTGILDDSTIKQMMIPRCGMHDITPNNTKSNYTKFHMVMHYTFFNGMPKWRPSKYHLTYT  157

Query  349  FAPGTPAKFFIPVYT-------ALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGDGVP  504
            F  G+     + + T       A + W +V   +FQ  +    A++  +  RGDHGDG P
Sbjct  158  F--GSDGVQVVDMDTLRSVCSDAFKKWSDVSPLTFQEASDGASANIVIAFYRGDHGDGYP  215

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPG  684
            FDGPG   AHAFSP  G  H+DADE W   +P+   +D+ SVA+HEIGHLLGL HS    
Sbjct  216  FDGPGKILAHAFSPENGRFHYDADEKW-STNPAMDQIDLESVAVHEIGHLLGLAHSSDSN  274

Query  685  AVMWSEFEYGQKRRDLTPDDINGIRALY  768
            AVM+     G K+R+L  DDI+GI ALY
Sbjct  275  AVMYPSIAAGTKKRNLAQDDIDGIHALY  302



>ref|XP_009758591.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana sylvestris]
Length=365

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 154/278 (55%), Gaps = 27/278 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G +V GL  +KKY   FGYI  LS  +     D F D LESA++TYQ   +LN+
Sbjct  47   LLGCHAGQKVDGLAKIKKYFYNFGYIPSLSNFT-----DDFDDALESALKTYQQNFNLNT  101

Query  181  TGILDADTVRQMTKPRCGVADIINGR--------PGGPSEV--VPNYRFYPGEPKWPNQK  330
            TG+LDA T++ + +PRCG AD++NG         P G   +  V ++ F+PG P+WP+ K
Sbjct  102  TGVLDAPTIQHLIRPRCGNADVVNGTSTMNSGKPPAGSQNMHTVAHFSFFPGRPRWPDSK  161

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGV  501
            + LT+ F P  G           A   W  V   SF  T  ++ AD+K     GDH DG 
Sbjct  162  TDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLSFTETASFQSADIKIGFFAGDHNDGE  221

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWV-DHDPSPH--------SLDIRSVAIHEIGHL  654
            PFDGP G  AHAFSP  G  H D DENWV D  P           ++D+ SVA+HEIGHL
Sbjct  222  PFDGPMGTLAHAFSPPGGHFHLDGDENWVIDGVPIVEGNFFSILSAVDLESVAVHEIGHL  281

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  ++M+     G +R +L  DDI G++ LY
Sbjct  282  LGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  319



>ref|XP_011010763.1| PREDICTED: metalloendoproteinase 1-like [Populus euphratica]
Length=308

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 160/269 (59%), Gaps = 14/269 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSS--SWDADYFSDQLESAIRTYQTRRH  171
            L  S+KG  V  L+ +K+YLK FGY++ DLS N +    D D F D LESAIRTYQ   H
Sbjct  39   LVESQKGQSVSKLHLVKQYLKKFGYLDYDLSSNKNRNQVDDDEFDDLLESAIRTYQQNFH  98

Query  172  LNSTGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPN--YRFYPGEPKWPNQKS  333
            L  TG LD  TV QM KPRCGVADI N          S+ V N  Y F+PG P+W  +  
Sbjct  99   LEVTGRLDKRTVNQMMKPRCGVADIFNSTKHRNSSKSSDGVANADYSFFPGAPRWSKKHL  158

Query  334  QLTFGFAPGTPAKFFI--PVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVP  504
            + TFG          I      + + W  V  F+F+       AD+K +  + DHGD  P
Sbjct  159  KYTFGATVQVAGAESIRSVCKQSFQKWAQVTDFTFEEVPNSADADIKIAFYQLDHGDDEP  218

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS-EVP  681
            FDGPGG +AH F PTIG+ HFDADE W   +P    LD+ SVA+HEIGHLLGL HS + P
Sbjct  219  FDGPGGIFAHGFRPTIGMLHFDADETW-SSNPGRLELDLESVAVHEIGHLLGLGHSGDHP  277

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             A+M+  F+YG+ +R+L  DDI+GIR LY
Sbjct  278  DAIMYPYFDYGKTKRNLQEDDIDGIRDLY  306



>ref|XP_006438497.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
 ref|XP_006483764.1| PREDICTED: metalloendoproteinase 1-like [Citrus sinensis]
 gb|ESR51737.1| hypothetical protein CICLE_v10031870mg [Citrus clementina]
Length=371

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/280 (43%), Positives = 151/280 (54%), Gaps = 28/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   GD++ GL  LKKY   FGYI DL  N +    D F D LESA++TYQ   +L  
Sbjct  51   FTGCHPGDKMDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEP  106

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEV------------VPNYRFYPGEP  312
            TG LD+ T++ + +PRCG  DI+NG      G P+              V +Y F+PG P
Sbjct  107  TGQLDSQTMQHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMP  166

Query  313  KWPNQKSQLTFGFAPGTPAKFFIP--VYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
            +WP+ K  LT+ F P       +     TA   W      +F RT  Y  AD++     G
Sbjct  167  RWPSNKRDLTYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTG  226

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIG  648
            DHGDG PFDGP G  AHAFSP  G  H D DENWV         S  ++D+ SVA+HEIG
Sbjct  227  DHGDGEPFDGPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIG  286

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  A+M+     G ++ +L  DDI GI+ALY
Sbjct  287  HLLGLGHSSVEDAIMYPSISSGSRKVELANDDIQGIQALY  326



>ref|XP_010255281.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=378

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 147/273 (54%), Gaps = 21/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G+RV GL  LKKY + FGYI D   N +    D F D  ESA++ YQ   +LN+
Sbjct  59   FAGCHSGERVDGLAGLKKYFQHFGYIPDSPSNFT----DDFDDAFESALKKYQQNFNLNA  114

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS----------EVVPNYRFYPGEPKWPNQK  330
            TG+LD  T++QM +PRCGVADIING     S            V +Y F+P  P WP  K
Sbjct  115  TGVLDESTIQQMVRPRCGVADIINGTSTMNSGKSAKSTHSIHTVAHYSFFPYRPTWPPSK  174

Query  331  SQLTFGFAPGTPAKFFIPVYTA--LRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
              LT+ F P       +    A     W  V   SF + + Y  AD+K +  RGDH DG 
Sbjct  175  RDLTYAFLPANQLSDTVKAVFAHSFARWSAVTPLSFTESSVYLTADIKIAFFRGDHNDGE  234

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS----PHSLDIRSVAIHEIGHLLGLDH  669
            PFDG  G  AHAFSP  G  H D  ENWV  D      P ++D+ SVA+HEIGHLLGL H
Sbjct  235  PFDGVLGTLAHAFSPPDGRFHLDGAENWVVDDARKSSIPSAVDLESVAVHEIGHLLGLGH  294

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S    A+M+     G K+ +L  DDI GI+ LY
Sbjct  295  SSQEEAIMFPTISSGMKKVELANDDIQGIQFLY  327



>ref|XP_002325947.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
 gb|EEF00329.1| hypothetical protein POPTR_0019s10230g [Populus trichocarpa]
Length=308

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 154/272 (57%), Gaps = 24/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  SS +D     D LE A++TYQ   HLN
Sbjct  43   LEGIQKGQTVEGLIELKQYLKKFGYYPSDITLTSSDFD-----DHLELALKTYQEYFHLN  97

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSE---------VVPNYRFYPGEPKWPNQK  330
             TG LD+ T++QM  PRCG+ DIIN     P+          VV +Y F  G  KWP  K
Sbjct  98   VTGNLDSSTIQQMMIPRCGMPDIINTPSAKPNSTKSKHKKVHVVAHYAF--GAQKWPPSK  155

Query  331  SQLTFGFAPGTPA----KFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGD  495
              LT+ F  G               A + W  V  F+F+  T    AD+      GDHGD
Sbjct  156  YALTYRFGSGVQVVGSDTLRSVCSKAFQTWAKVSKFTFREATGGASADIVIEFFSGDHGD  215

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS-  672
              PFDGPG   AHAF P  G  H+DADENW   DP+   +D+ +V +HEIGHLLGL HS 
Sbjct  216  QSPFDGPGNQLAHAFYPQDGRLHYDADENW-STDPAMDQIDLETVTVHEIGHLLGLYHSK  274

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            + P A+M+   + G K+RDL  DDI+GI ALY
Sbjct  275  DHPEAIMYPTTQRGSKKRDLAQDDIDGIHALY  306



>ref|XP_006856883.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
 gb|ERN18350.1| hypothetical protein AMTR_s00055p00201730 [Amborella trichopoda]
Length=357

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 150/268 (56%), Gaps = 19/268 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L G  KG+ V GL  +K+YL TFGYI  +L++       D F D LESAI+TYQ    LN
Sbjct  43   LSGCHKGEHVPGLTAIKQYLHTFGYIPQNLNFT------DDFDDSLESAIKTYQQNFRLN  96

Query  178  STGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPNYRFYPGEPKWPNQKSQLT  342
            +TG LD+ TVRQM  PRCGV D++NG     R  G S V+  Y F+PG P+WP  K  LT
Sbjct  97   ATGSLDSGTVRQMMSPRCGVPDVVNGTTTMMRSRGLSSVM-RYTFFPGNPRWPVWKRNLT  155

Query  343  FGFAPGT-----PAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVP  504
            +   PGT               A   W      SF + T Y  AD++ +   GDHGDG P
Sbjct  156  YAIRPGTFSTSDDTAARAVFARAFARWAAATTLSFTESTSYSTADIRIAFFGGDHGDGEP  215

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPG  684
            FDG  G  AHAFSP  G  H DA E WV    S   +D+ SVA+HEIGH+LGL HS    
Sbjct  216  FDGALGTLAHAFSPPDGRLHLDAAELWVVSGNSRLGIDLESVAVHEIGHVLGLGHSSDEA  275

Query  685  AVMWSEFEYGQKRRDLTPDDINGIRALY  768
            A+M+     G +R +L  DDI GI+ LY
Sbjct  276  AIMFPTITTGTRRVELATDDIMGIQELY  303



>ref|XP_011085865.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=283

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 157/275 (57%), Gaps = 28/275 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI---NDLSYNSSSWDADYFSDQLESAIRTYQTRRH  171
            L+G  KG++ K +++LK YL  FGY+   N +  N++ +D     D LESA++ YQ   +
Sbjct  16   LEGCHKGNKTKDIHHLKHYLHQFGYLDYPNQIHANNNDFD-----DLLESALKEYQRYYN  70

Query  172  LNSTGILDADTVRQMTKPRCGVADIING------RPGGPSE---------VVPNYRFYPG  306
            +N TG +DA+T+ +M  PRCG  DI++G      RP               V  Y F+PG
Sbjct  71   INPTGAVDAETIAKMVIPRCGNRDIVHGTNTMLPRPNKKENSNSSTNSIHTVSQYSFFPG  130

Query  307  EPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARG  483
              +W   K+ LT+GF+P TP     PV  A   W +  HF+F R Q  +  DL     R 
Sbjct  131  NLRW--SKTHLTYGFSPNTPTATIDPVIRAFAKWDSATHFTFSRAQNNQRPDLIIGFHRR  188

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGL  663
            DHGDG PFDGPGG  AHAF+P+ G  H+D+DE W    P  ++  + +VA+HEIGHLLGL
Sbjct  189  DHGDGSPFDGPGGTIAHAFAPSDGRFHYDSDEAW-SMSPVGNAFHLETVALHEIGHLLGL  247

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  A+M+     G   ++L  DDI GI+ALY
Sbjct  248  GHSSVADAIMYPSISRGAT-KNLHADDIQGIKALY  281



>ref|XP_008458910.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=296

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 150/264 (57%), Gaps = 11/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+GS+ G+ ++G+Y++K YLK +GY+     N+ S   D F   LESAI+T+Q    LN 
Sbjct  34   LKGSRIGNNIEGIYSVKLYLKRYGYLITNVPNTDS--NDTFDVLLESAIKTFQKYHSLNV  91

Query  181  TGILDADTVRQMTKPRCGVADII-------NGRPGGPSEVVPNYRFYPGEPKWPNQKSQL  339
            +G+LD +T+  M+ PRCG++DI+       N      S    +Y F PG PKWP  K  L
Sbjct  92   SGVLDKETLTLMSLPRCGISDIVHNNNVMDNNIQMNSSSFHSHYTFLPGNPKWPISKYNL  151

Query  340  TFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGP  516
             + F  G P  F  PV  A+  W     F F  T   E  D+ F+  RG+HGDG PFDG 
Sbjct  152  KYTFLEGFPNDFKEPVMNAMDQWALFSLFRFSETIGGEEVDITFNFVRGNHGDGHPFDGK  211

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
            GG  AHAF P  G  HFD DE+W D       +++  VA+HE+GH+LGL HS +  A+MW
Sbjct  212  GGVLAHAFGPLDGRVHFDWDEDWADGSVGGF-INVGMVALHELGHVLGLAHSTIRDAIMW  270

Query  697  SEFEYGQKRRDLTPDDINGIRALY  768
                 G++ R L  DDI GI+ LY
Sbjct  271  PYMHVGEQTRGLQFDDIEGIQTLY  294



>ref|XP_006431003.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
 gb|ESR44243.1| hypothetical protein CICLE_v10012543mg [Citrus clementina]
Length=254

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 149/254 (59%), Gaps = 19/254 (7%)
 Frame = +1

Query  58   LKTFGYINDLSYNSSSWDADYFS--DQLESAIRTYQTRRHLNSTGILDADTVRQMTKPRC  231
            ++ FGY+N  +Y + S  AD     + LESAI+TYQ   HL STG+LDA+TV +MT PRC
Sbjct  1    MEKFGYLNYDNYKNQSTHADDDDFDELLESAIKTYQLNYHLKSTGVLDANTVAKMTIPRC  60

Query  232  GVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQLTFGFAPGTPAKFF  378
            GVADI+NG    R G   +        V +Y F+P  PKWP  K  LT+ F PGT +   
Sbjct  61   GVADIVNGTTRMRSGKKRQQHNHHFRTVSHYSFFPRSPKWPASKFSLTYAFRPGTRSDAI  120

Query  379  IPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD---GPGGNYAHAFSP  546
             PV  A + W     F F + + + +AD+K S   GDHGDG PFD   GP G  AHAF+P
Sbjct  121  TPVARAFQTWAANTQFKFSKIEDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAP  180

Query  547  TIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRR  726
            T G  H+DADE W        + D+ +VA+HEIGHLLGL HS V GA+M+     G   +
Sbjct  181  TNGRFHYDADEPWAV-GAVQGAFDLETVALHEIGHLLGLHHSSVEGAIMYPSISAGVT-K  238

Query  727  DLTPDDINGIRALY  768
             L  DDI GIR LY
Sbjct  239  GLHGDDIQGIRDLY  252



>ref|XP_008376281.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=362

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 155/274 (57%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG  V GL  LKK+L  FGY N    +S   D D F D LESAI++YQ   HL  
Sbjct  90   LEGCHKGQNVSGLQELKKHLTKFGYFN--YDHSKHADNDEFDDLLESAIKSYQKSYHLKV  147

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEV---------VPNYR-FYPGEPKWPNQK  330
            TG LD  T +QM  PRCGV D++NG   G  +          V +Y  F+PG  +WP+ +
Sbjct  148  TGSLDTTTAKQMMVPRCGVPDVVNGTRKGSKKYNRKLKSLHGVSHYEFFFPGPLRWPSTQ  207

Query  331  SQLTFGFA------PGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            + L + FA      PGT     I    A + W  V  F+F+       AD+     RG+H
Sbjct  208  THLRYRFASSARQVPGTENVRSI-CAQAFQRWAQVTTFTFEEVPSTSAADITIGFHRGNH  266

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GD  PFDG  G YAHA  P  G  HFDA E W   +P P+ +D+ SV++HEIGHLLGL+H
Sbjct  267  GDRSPFDGFKGTYAHANPPGGGNFHFDAXETW-SANPGPNEIDLESVSVHEIGHLLGLNH  325

Query  670  S-EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
              ++P  +M+  FEYG  +RDL  DDI+GIRALY
Sbjct  326  XPDLPDXIMYPYFEYGMVKRDLNRDDIDGIRALY  359



>ref|XP_010272073.1| PREDICTED: metalloendoproteinase 1 [Nelumbo nucifera]
Length=371

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/273 (43%), Positives = 150/273 (55%), Gaps = 21/273 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + G++V GL  LK+Y   FGYI D   N +    D F D +ESA++ YQ   +LN+
Sbjct  54   FAGCRNGEQVDGLGKLKEYFHHFGYIPDSPSNFT----DDFDDTMESALKKYQQNFNLNA  109

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS----------EVVPNYRFYPGEPKWPNQK  330
            TG+LD  T++Q+ +PRCGVADIING     S            V +Y F+P +P WP+ +
Sbjct  110  TGVLDNSTIQQLIRPRCGVADIINGTNTMSSGKSAASTHSLHTVGHYTFFPHQPTWPSSR  169

Query  331  SQLTFGFAPGTPAKFFIPVY--TALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGV  501
              LT+GF P       +      A   W  V   +F  T  Y  AD+K +   GDH DG 
Sbjct  170  LDLTYGFLPDNQLSDTVKAVFAKAFARWAAVTPLTFTMTDSYSMADIKIAFYTGDHSDGE  229

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSL----DIRSVAIHEIGHLLGLDH  669
            PFDG  G  AHAFSPT G  H D  ENWV  D S  S+    D+ SVA+HEIGHLLGL H
Sbjct  230  PFDGVLGTLAHAFSPTDGRFHLDGAENWVVDDASKSSISSAVDLESVAVHEIGHLLGLGH  289

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S    A+M+     G K+ +L  DDI GI+ LY
Sbjct  290  SSYGDAIMYPTISSGTKKVELWSDDIEGIQLLY  322



>ref|XP_002319607.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
 gb|EEE95530.2| hypothetical protein POPTR_0013s03350g [Populus trichocarpa]
Length=312

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/274 (42%), Positives = 154/274 (56%), Gaps = 20/274 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G +KG  VKGL  LK +LK  GY     +      +D F +  ESA++TYQ    L  
Sbjct  39   LEGCQKGQNVKGLKELKHHLKNIGYYPK-DHQHDIKLSDDFDEIFESALKTYQKNYRLKV  97

Query  181  TGILDADTVRQMTKPRCGVADIIN----GRPGGPSE---------VVPNYRFYPGEPKWP  321
            TG LD+DT++++  PRCGV D IN     +  G +E          V +Y F+ G P+WP
Sbjct  98   TGSLDSDTIKELMIPRCGVPDPINHVDTSKQAGRTEHDSKSSKFHTVSHYSFFGGTPRWP  157

Query  322  NQKSQLTFGFAPGTPA----KFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGD  486
            + K  LT+ F+         +       A + W +V  F+FQ  ++   AD+      GD
Sbjct  158  SSKFHLTYTFSSSVQVIDMQELRSACSRAFQKWADVTQFTFQEASEGSQADIVIGFQSGD  217

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLD  666
            HGD  PFDGPG   AHAF+PT G  H+DADE W   +PS   +D+ SVA+HEIGHLLGLD
Sbjct  218  HGDRYPFDGPGRILAHAFAPTDGRFHYDADEKWST-NPSADEVDLESVAVHEIGHLLGLD  276

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS    ++M++E   G  +RDL  DDI GIRALY
Sbjct  277  HSMDQNSIMFAEIPQGTIKRDLGQDDIAGIRALY  310



>gb|KGN51345.1| hypothetical protein Csa_5G522910 [Cucumis sativus]
Length=295

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 154/267 (58%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS------SWDADYFSDQLESAIRTYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N+S        +++ F D LESAI+ YQ 
Sbjct  33   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNTSIDSHIIELNSNKFDDSLESAIKLYQK  89

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADII----NGRPGGPSEVVPNYRFYPGEPKWPNQK  330
              HLN +GILD +T+ QM KPRCGV D+     N       E+  +Y  +PG  KWP+ K
Sbjct  90   WSHLNVSGILDQETLDQMFKPRCGVRDVFKFNSNKNLEDDLEMSSHYTLFPGNLKWPDYK  149

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPF  507
              LT+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG+PF
Sbjct  150  RHLTYVFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLPF  209

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG   HAF+PT G  H D D+ W         +++ +VA+HE+GH+LGL HS +P A
Sbjct  210  DGPGGVVGHAFAPTDGRLHLDGDDTW-SAGMEVQKVNVMNVALHELGHVLGLAHSTLPQA  268

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VMW   +     ++L  DDI G+ ALY
Sbjct  269  VMWPYID-SNALKNLNDDDIAGLHALY  294



>gb|ADD21635.1| matrix metalloprotease 1 [Nicotiana benthamiana]
Length=364

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/279 (42%), Positives = 152/279 (54%), Gaps = 29/279 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G +V GL  +KKY   FGYI+ LS  +     D F D LESA++TYQ   +LN+
Sbjct  46   LLGCHAGQKVDGLAKIKKYFYNFGYISSLSNFT-----DDFDDALESALKTYQQNFNLNT  100

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSE------VVPNYRFYPGEPKWPNQK  330
            TG+LDA T+  + +PRCG AD++NG      G PS        V ++ F+PG P+WP   
Sbjct  101  TGVLDAPTIEHLIRPRCGNADVVNGTSTMNSGKPSAGSQNIHTVAHFSFFPGRPRWPESN  160

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
              LT+ F P  G           A   W  V   +F +   ++ AD+K     GDH DG 
Sbjct  161  RDLTYAFLPQNGLTDNIKSVFSRAFDRWSEVTPLTFTEIASFQSADIKIGFFAGDHNDGE  220

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSP----------HSLDIRSVAIHEIGH  651
            PFDGP G  AHAFSP  G  H D DENWV  D +P           ++D+ SVA+HEIGH
Sbjct  221  PFDGPMGTLAHAFSPPGGHFHLDGDENWVI-DGAPIVEGNFFSILSAVDLESVAVHEIGH  279

Query  652  LLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LLGL HS V  ++M+     G +R +L  DDI G++ LY
Sbjct  280  LLGLGHSSVEDSIMFPSLAAGTRRVELANDDIQGVQVLY  318



>gb|KCW56124.1| hypothetical protein EUGRSUZ_I01878 [Eucalyptus grandis]
Length=294

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 155/272 (57%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G  KG   +G+  +K+YL+ FGY   +   N  +   D F + LESA+++YQ   HL 
Sbjct  25   LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  84

Query  178  STGILDADTVRQMTKPRCGVADIINGR-----PGGPSE--VVPNYRFYPGEPKWPNQKSQ  336
             TG LDADTV QM+ PRCGV D ++ R        PS+  +V  Y F+P +P+WP  K+ 
Sbjct  85   VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  144

Query  337  LTFGFAPGTPAKFFIPVYT-------ALRDWHNVGHFSFQRTQYE-HADLKFSLARGDHG  492
            L + F P  PA   IP+         A + W +V  F+F         DL     RGDHG
Sbjct  145  LNYAFGP-VPAA--IPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHG  201

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDGPG   AH+FSPT G  H+D +E W   +PS    D+ SV +HEIGHLLGL H+
Sbjct  202  DGYPFDGPGKILAHSFSPTDGRFHYDVEEQW-STNPSSTQFDLESVTLHEIGHLLGLAHT  260

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
                AVM++    G ++RDL  DDI+GI ALY
Sbjct  261  PDQNAVMFATISPGAQKRDLRQDDIDGIHALY  292



>ref|XP_010030761.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=311

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 155/272 (57%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G  KG   +G+  +K+YL+ FGY   +   N  +   D F + LESA+++YQ   HL 
Sbjct  42   LEGVLKGQTKQGIKEVKRYLRAFGYWGYEEDENEVALMDDEFDETLESALQSYQRFYHLE  101

Query  178  STGILDADTVRQMTKPRCGVADIINGR-----PGGPSE--VVPNYRFYPGEPKWPNQKSQ  336
             TG LDADTV QM+ PRCGV D ++ R        PS+  +V  Y F+P +P+WP  K+ 
Sbjct  102  VTGKLDADTVNQMSAPRCGVPDAVHPRHAEWNATKPSKLRIVARYNFFPNKPRWPPTKTH  161

Query  337  LTFGFAPGTPAKFFIPVYT-------ALRDWHNVGHFSFQRTQYE-HADLKFSLARGDHG  492
            L + F P  PA   IP+         A + W +V  F+F         DL     RGDHG
Sbjct  162  LNYAFGP-VPAA--IPLEELRGVCSRAFQRWADVTSFTFSEASAGGQIDLVIGFYRGDHG  218

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG PFDGPG   AH+FSPT G  H+D +E W   +PS    D+ SV +HEIGHLLGL H+
Sbjct  219  DGYPFDGPGKILAHSFSPTDGRFHYDVEEQW-STNPSSTQFDLESVTLHEIGHLLGLAHT  277

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
                AVM++    G ++RDL  DDI+GI ALY
Sbjct  278  PDQNAVMFATISPGAQKRDLRQDDIDGIHALY  309



>ref|XP_003517862.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 152/275 (55%), Gaps = 20/275 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + G    GL NLK Y   FGYI+++S  SS++ +D F D LE+A+R YQ   +LN 
Sbjct  59   FTGCRPGKTYNGLSNLKNYFHYFGYISNVSSKSSNF-SDDFDDALEAAVRAYQKNFNLNI  117

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-----------EVVPNYRFYPGEPKWPNQ  327
            TG LD  T+ Q+ KPRCGVADIING     S             V +Y F+ G+P+WP  
Sbjct  118  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKTNTTDSPTFHTVAHYSFFDGQPRWPVG  177

Query  328  KSQLTFGFAPGTPAKFFIPVY--TALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDG  498
              +LT+ F P       I      A   W  V   SF+ T  Y  AD++     GDHGDG
Sbjct  178  TQELTYAFDPDNALDDVIKTVFGNAFSRWSEVTTISFRETASYVAADIRIGFYGGDHGDG  237

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDH-DPSPHSL----DIRSVAIHEIGHLLGL  663
             PFDG  G  AHAFSPT G+ H D+ E+WV   D +  SL    D+ SVA+HEIGHLLGL
Sbjct  238  EPFDGVLGTLAHAFSPTNGMFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLLGL  297

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  A+M+       ++ +L  DDI GI+ LY
Sbjct  298  GHSSVEDAIMYPTITARTRKVELNEDDIQGIQVLY  332



>ref|XP_002275671.1| PREDICTED: metalloendoproteinase 1-like [Vitis vinifera]
Length=303

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 158/265 (60%), Gaps = 11/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSWDA-DYFSDQLESAIRTYQTRRHL  174
            LQGS+KGD+V+G++ +KKYL+ FGY+    S   +  D+ D+F D LESAI+ +QT  HL
Sbjct  39   LQGSQKGDKVEGIHKVKKYLQHFGYLGSTHSQTETQVDSEDHFDDALESAIKAFQTYYHL  98

Query  175  NSTGILDADTVRQMTKPRCGVADI------INGRPGGPSEVVPNYRFYPGEPKWPNQKSQ  336
              TGILDA T  QM++ RCGV D       IN        +  +Y F+P +P+WP  K  
Sbjct  99   KPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRH  158

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHGDGVPFDG  513
            L +     +  +    V  A   W  V +F+F+RT   + A+L  S    DHGDG PFDG
Sbjct  159  LLYSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKVRDHGDGRPFDG  218

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
             GG  AHAF+PT G  HFD DE WV      +S+D+++VA HEIGHLLGL H+ V  A+M
Sbjct  219  RGGILAHAFAPTDGRFHFDGDETWVI-GAVANSMDLQTVARHEIGHLLGLAHTPVQEAIM  277

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            ++    G   + L  DDI+GIRALY
Sbjct  278  YAIISPGVT-KGLNQDDIDGIRALY  301



>gb|KHN16358.1| Metalloendoproteinase 1 [Glycine soja]
Length=292

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 156/265 (59%), Gaps = 20/265 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG +  G+  L+ YL+ FGY+ +          D F + +ESA++ YQ   HL S
Sbjct  41   LRGVHKGQKANGVGELRSYLQHFGYLTN-----GDSSNDNFDNNVESALKHYQEFNHLRS  95

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN-YRFYPGEPKWPNQKSQLTFGFAP  357
            TG++D +T+++M+ PRCG+ DI+         V PN Y F+PG+PKW  +K  LT+G   
Sbjct  96   TGVVDDETIKRMSLPRCGMPDIVTQPNANQLLVAPNNYSFFPGQPKW--RKFALTYGHMS  153

Query  358  GT--PAKFFIPVYTA----LRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFDGPG  519
                   FF  V  A    L+ W  V +F+F   +   AD+ +   RGDHGDG PFDGP 
Sbjct  154  SVVLSNNFFSSVRAAKLRALQTWARVTNFTFTE-RAPPADIVYGFHRGDHGDGYPFDGPY  212

Query  520  GNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWS  699
            G  AHAF+P  G CH+DADE W   + +  ++D  +VA+HE GHLLGL HS   G+VM  
Sbjct  213  GVLAHAFAPQNGRCHYDADEPW---NFNGQNIDFETVALHECGHLLGLGHSNTRGSVM--  267

Query  700  EFEYGQKRRDLTPDDINGIRALYHF  774
            E  Y  +RR LT DDI+GIRALY F
Sbjct  268  EATYAGQRRSLTQDDIDGIRALYQF  292



>ref|XP_008458715.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=317

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 151/267 (57%), Gaps = 13/267 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            LQG   GD  +G+  +KKYL+ FGYI  ++  +S+    D F   LESA++TYQT  +L 
Sbjct  51   LQGCHLGDTKQGIQQIKKYLQRFGYITTNIQKHSNPIFDDTFDQVLESALKTYQTNHNLA  110

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPS---------EVVPNYRFYPGEPKWPNQK  330
             +GILD++T+ Q+ KPRCGV D+I  +    +           V ++ F+ G  KWP+ K
Sbjct  111  PSGILDSNTLAQIAKPRCGVQDVIKNKKRNQNYKNNGHIHFHKVSHFTFFEGNLKWPSSK  170

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPF  507
              L++GF P  P +   PV  A   W    HF F     Y  AD+K S  RG+HGD  PF
Sbjct  171  FHLSYGFLPNYPIEAIKPVSRAFSKWSLNTHFKFSHVVDYRKADIKISFERGEHGDNAPF  230

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DG GG  AHA+ PT G  HFD DE W     S +  D+ +VA+HEIGH+LGL HS +  A
Sbjct  231  DGVGGVLAHAYPPTDGRLHFDGDEAWSVGAISGY-FDVETVALHEIGHILGLQHSTIEEA  289

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            +M+     G   + L  DDI GI+ LY
Sbjct  290  IMFPSIPEGV-TKGLHGDDIAGIKTLY  315



>emb|CBI34987.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 158/265 (60%), Gaps = 11/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDL-SYNSSSWDA-DYFSDQLESAIRTYQTRRHL  174
            LQGS+KGD+V+G++ +KKYL+ FGY+    S   +  D+ D+F D LESAI+ +QT  HL
Sbjct  32   LQGSQKGDKVEGIHKVKKYLQHFGYLGSTHSQTETQVDSEDHFDDALESAIKAFQTYYHL  91

Query  175  NSTGILDADTVRQMTKPRCGVADI------INGRPGGPSEVVPNYRFYPGEPKWPNQKSQ  336
              TGILDA T  QM++ RCGV D       IN        +  +Y F+P +P+WP  K  
Sbjct  92   KPTGILDAPTATQMSRTRCGVPDNPPVTNNINSHGHSHLNIGTHYAFFPNKPRWPAGKRH  151

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQY-EHADLKFSLARGDHGDGVPFDG  513
            L +     +  +    V  A   W  V +F+F+RT   + A+L  S    DHGDG PFDG
Sbjct  152  LLYSLDSASHPEAANAVANAFGAWAGVTNFTFERTSDPKIANLYISFKVRDHGDGRPFDG  211

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
             GG  AHAF+PT G  HFD DE WV      +S+D+++VA HEIGHLLGL H+ V  A+M
Sbjct  212  RGGILAHAFAPTDGRFHFDGDETWVI-GAVANSMDLQTVARHEIGHLLGLAHTPVQEAIM  270

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            ++    G   + L  DDI+GIRALY
Sbjct  271  YAIISPGVT-KGLNQDDIDGIRALY  294



>ref|XP_004159085.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 154/264 (58%), Gaps = 10/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSS--SWDADYFSDQLESAIRTYQTRRH  171
            L G +KGD V+G+ N+KKYL+ +GY++ ++S +S     +++ F D LESAI+ YQ   H
Sbjct  33   LYGCRKGDNVEGIRNIKKYLQRYGYLSHNMSIDSHIIELNSNKFDDSLESAIKLYQKWTH  92

Query  172  LNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQKSQL  339
            LN +G+LD +T+ QM KPRCGV D+             E+  +Y  +PG P+WP+ K  L
Sbjct  93   LNVSGVLDQETLDQMFKPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNPQWPDYKRHL  152

Query  340  TFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGP  516
            T+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG+PFDGP
Sbjct  153  TYVFTNNFPIDFVPSVTEAMARWAGQSLFTFSEASDAQSADINISFQIKDHADGLPFDGP  212

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
            GG   HAF+PT G  H D D++W         +++ + A+HE+GH+LGL HS +P AVMW
Sbjct  213  GGIVGHAFAPTDGRLHLDGDDSW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVMW  271

Query  697  SEFEYGQKRRDLTPDDINGIRALY  768
               E     ++L  DDI G+ ALY
Sbjct  272  PYIE-SNALKNLNDDDIAGLHALY  294



>ref|XP_004142465.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52409.1| hypothetical protein Csa_5G632080 [Cucumis sativus]
Length=295

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/264 (40%), Positives = 152/264 (58%), Gaps = 12/264 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQGS+ G+ ++G++N+K YLK +GY+ ++   +S+   + F   LESAI+T+Q    LN 
Sbjct  34   LQGSRIGNNIEGIHNVKLYLKRYGYLTNVESTNSN---NTFDVLLESAIKTFQKYHSLNV  90

Query  181  TGILDADTVRQMTKPRCGVADII-------NGRPGGPSEVVPNYRFYPGEPKWPNQKSQL  339
            +G++D +T+  M+ PRCG+ DI+       N      S    ++ F+P   KWP  K  L
Sbjct  91   SGVIDEETLTLMSLPRCGIPDIMHNINVMDNNVQMNSSSFHSHFTFFPDNLKWPVSKYNL  150

Query  340  TFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGP  516
             + F    P  F  PV  A+  W     F F +  + + AD+ F+  RG+HGDG PFDG 
Sbjct  151  RYTFLDDFPNDFKEPVMNAMEQWALFSLFRFSEAVEAQEADITFNFVRGNHGDGYPFDGK  210

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
            GG  AHAF P  G  HFD DE+W D       +++  VA+HE+GH+LGL HS +  A+MW
Sbjct  211  GGVLAHAFGPLDGRVHFDWDEDWADGSVGGF-INVGMVALHELGHVLGLAHSTIRDAIMW  269

Query  697  SEFEYGQKRRDLTPDDINGIRALY  768
               E G++ R L  DDI GI+ LY
Sbjct  270  PYMEAGEQTRGLQFDDIEGIQTLY  293



>ref|XP_010255269.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=316

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 154/275 (56%), Gaps = 26/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+GS+KGDRVKGL   K+YL  FGY++  + +            LESAI+TYQ   +LN 
Sbjct  46   LEGSRKGDRVKGLNEAKRYLHRFGYLDHHNDDDDF------DHHLESAIKTYQLYYNLNE  99

Query  181  TGILDADTVRQMTKPRCGVADIING------------RPGGPSEVV---PNYRFYPGEPK  315
            TG LD +TV+QM  PRCG  DIING            R GG    V    +Y F+    K
Sbjct  100  TGSLDFETVKQMMLPRCGFPDIINGETWMRSGKEKNRRLGGRKTAVGFSSHYAFFNNSLK  159

Query  316  WPNQKSQLTFGFAPGTPAKFFIP---VYTALRDWHNVGHFSFQRT-QYEHADLKFSLARG  483
            WP  K  L +      P    +     Y A   W  +  F+F+RT     AD+  S  +G
Sbjct  160  WPPSKMHLKYALDTNVPFDDVVMNPLCYVAFDKWAAISDFTFERTYDLSSADILISFFKG  219

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGL  663
            DHGDG  FDGPGG  AH+F+PT G  H+D +ENWV       S D+ SVA+HEIGHLLGL
Sbjct  220  DHGDGHLFDGPGGVLAHSFAPTGGRLHYDLEENWVA-GIRAGSFDLESVAVHEIGHLLGL  278

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             H+ V  AVM++  + G ++ +L  DDI+G+RALY
Sbjct  279  WHTPVTEAVMFAYLKDGTQKVNLHQDDIDGLRALY  313



>ref|XP_004509890.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=377

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 155/283 (55%), Gaps = 33/283 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN---DLSYNSSSWDADYFSDQLESAIRTYQTRRH  171
              G   G +  GL NLK Y + FGYI+    L++      +D F D LE+AI+TYQ   +
Sbjct  53   FTGCHHGVKYDGLSNLKNYFQHFGYISHAPQLNF------SDNFDDALENAIKTYQKNFN  106

Query  172  LNSTGILDADTVRQMTKPRCGVADIING----RPGGPSEV------------VPNYRFYP  303
            LN TG LD +T+RQ+  PRCGVADIING      G   E             + ++  +P
Sbjct  107  LNITGELDDNTLRQIVLPRCGVADIINGTTAMNAGKEKETTSYGHSKPKFHTLSHFTVFP  166

Query  304  GEPKWPNQKSQLTFGFAPGTP-AKFFIPVY-TALRDWHNVGHFSFQRTQ-YEHADLKFSL  474
            G+P+WP  K +LT+ F PG   +K    V+ TA   W  V   +F  T+ Y  AD+K   
Sbjct  167  GQPRWPEGKQELTYAFFPGNDLSKTVKSVFATAFARWSEVTTLTFTETESYSSADMKIGF  226

Query  475  ARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIH  639
              GDHGDG PFDG  G  AHAFSPT G  H DA E+WV          P ++D+ SVA+H
Sbjct  227  FEGDHGDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDISKSSLPTAVDLESVAVH  286

Query  640  EIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            EIGHLLGL HS V  A+M+       K+  L  DD+ GI+ LY
Sbjct  287  EIGHLLGLGHSSVEDAIMFPTISSRMKKVVLAEDDVRGIQYLY  329



>ref|XP_007153680.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
 gb|ESW25674.1| hypothetical protein PHAVU_003G055800g [Phaseolus vulgaris]
Length=376

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 152/278 (55%), Gaps = 25/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G  +G+   GL NLK Y + FGY     +   S  +D F D LESAI+TYQ   +LN 
Sbjct  53   LTGCHRGENYDGLANLKSYFERFGY---FPHAPPSNFSDEFDDALESAIKTYQKNFNLNV  109

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEV----------VPNYRFYPGEPKW  318
            TG+LD  T++Q+  PRCGVADIING      G  +E           V ++  +PG P+W
Sbjct  110  TGVLDDATLQQIVLPRCGVADIINGTTTMNAGKQNETASFSKPRFHTVAHFALFPGNPRW  169

Query  319  PNQKSQLTFGFAPGTPAKFFIP--VYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            P    +LT+ F PG      +     +A   W  V   +F+ T  Y +AD++     GDH
Sbjct  170  PEGTEELTYAFNPGNDLSNTVKGVFASAFARWAEVTSLTFRETASYFNADIRIGFFSGDH  229

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHL  654
            GDG PFDG  G  AHAFSPT G  H DADE+W     V       ++D+ SVA+HEIGHL
Sbjct  230  GDGEPFDGSLGTLAHAFSPTNGRFHLDADEDWVVSGDVTQSALSSAVDLESVAVHEIGHL  289

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  AVM+      +K+  L  DDI GI+ LY
Sbjct  290  LGLGHSSVEEAVMFPTISSRRKKVVLAQDDIEGIQFLY  327



>gb|KDO82628.1| hypothetical protein CISIN_1g021444mg [Citrus sinensis]
Length=312

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 147/271 (54%), Gaps = 28/271 (10%)
 Frame = +1

Query  28   VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDADTV  207
            + GL  LKKY   FGYI DL  N +    D F D LESA++TYQ   +L  TG LD+ T+
Sbjct  1    MDGLAKLKKYFHYFGYIPDLPSNFT----DDFDDMLESAVKTYQKNFNLEPTGQLDSQTM  56

Query  208  RQMTKPRCGVADIING----RPGGPSEV------------VPNYRFYPGEPKWPNQKSQL  339
            + + +PRCG  DI+NG      G P+              V +Y F+PG P+WP+ K  L
Sbjct  57   QHILRPRCGNPDIVNGTTTMNSGKPTSYNATSSTNGHLHSVGHYSFFPGMPRWPSNKRDL  116

Query  340  TFGFAPGTPAKFFIP--VYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
            T+ F P       +     TA   W      +F RT  Y  AD++     GDHGDG PFD
Sbjct  117  TYAFLPDNQLTDEVKNVFATAFDRWSEATSLTFTRTDVYTTADIRIGFFTGDHGDGEPFD  176

Query  511  GPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            GP G  AHAFSP  G  H D DENWV         S  ++D+ SVA+HEIGHLLGL HS 
Sbjct  177  GPMGTLAHAFSPPNGRFHLDGDENWVITSGTTTSISMSAIDLESVAVHEIGHLLGLGHSS  236

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V  A+M+     G ++ +L  DDI GI+ALY
Sbjct  237  VEDAIMYPSISSGSRKVELANDDIQGIQALY  267



>gb|EYU46220.1| hypothetical protein MIMGU_mgv1a010241mg [Erythranthe guttata]
Length=318

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 153/265 (58%), Gaps = 11/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND---LSYNSSSWDADYFSDQLESAIRTYQTRRH  171
            L G++KG+  KGL +LK YL   GY+N    ++  S   + D F + LE A+R YQ+   
Sbjct  54   LVGTRKGNTAKGLSHLKGYLSNLGYMNIDSIIAKPSPEQNNDSFDENLELAVRAYQSFFK  113

Query  172  LNSTGILDADTVRQMTKPRCGVAD---IINGRPGGPSE--VVPNYRFYPGEPKWPNQKSQ  336
            L  TG+LDA TV QM +PRCGVAD   ++N          +  +Y F+PG+P W   K+ 
Sbjct  114  LKVTGVLDAATVNQMMQPRCGVADNFSVLNQTHLMTESPVIAKHYTFFPGKPVWWPGKTD  173

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDG  513
            LT+ F  G        ++ A   W+N   F F   + Y+ AD+K S    DHGD  PFDG
Sbjct  174  LTYSFPAGASYDLDEGIFEATGLWNNNSIFKFAYIKDYDKADVKISFQVWDHGDRAPFDG  233

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
            PGG  AHAF+PT G  HFD  E WVD      + D++SV +HE+GH+LGL HS    AVM
Sbjct  234  PGGVLAHAFAPTDGRLHFDGSEKWVD-GVKDGAFDVQSVGLHELGHILGLGHSADANAVM  292

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            W  F+  Q R+ L  DDI+GI+ALY
Sbjct  293  WPTFQTKQ-RKGLGQDDIDGIKALY  316



>ref|XP_006495379.1| PREDICTED: metalloendoproteinase 1-like, partial [Citrus sinensis]
Length=235

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 139/234 (59%), Gaps = 17/234 (7%)
 Frame = +1

Query  115  DYFSDQLESAIRTYQTRRHLNSTGILDADTVRQMTKPRCGVADIING----RPGGPSE--  276
            D F + LESAI+TYQ   HL STGILDA+TV +M  PRCGVADI+NG    R G   +  
Sbjct  3    DDFDELLESAIKTYQLNYHLKSTGILDANTVAKMAIPRCGVADIVNGTTQMRSGKKRQQH  62

Query  277  -----VVPNYRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT  441
                  V +Y F+ G P+WP  K  LT+ F PGT +    PV  A + W     F F + 
Sbjct  63   NHHFRTVSHYSFFRGSPRWPASKFSLTYAFRPGTRSDAITPVARAFQTWAANTQFKFSKI  122

Query  442  Q-YEHADLKFSLARGDHGDGVPFD---GPGGNYAHAFSPTIGICHFDADENWVDHDPSPH  609
            + + +AD+K S   GDHGDG PFD   GP G  AHAF+PT G  H+DADE W        
Sbjct  123  EDFANADIKISFESGDHGDGNPFDGRGGPEGIIAHAFAPTNGRFHYDADEPWAV-GAVQG  181

Query  610  SLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYH  771
            + D+ +VA+HEIGHLLGL HS V GA+M+     G K + L  DDI GIR LY+
Sbjct  182  AFDLETVALHEIGHLLGLHHSSVEGAIMYPSIAAGVK-KGLHGDDIQGIRDLYN  234



>gb|EPS61169.1| matrixin family protein, partial [Genlisea aurea]
Length=313

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 155/274 (57%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G KKG +  G+  +KKYL+ FGY+ND SY   S   D F + L++A+R YQ   +L  
Sbjct  7    LVGCKKGIKAAGIGLMKKYLQYFGYLND-SYRDFS---DEFDENLDAAVRDYQLNFNLGV  62

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----GGPSEV------VPNYRFYPGEPKWPNQK  330
            TG LD  TV  M +PRCG  D+ING      G  S+       V  + F+P  P+WP  +
Sbjct  63   TGELDESTVDLMAQPRCGNLDVINGTSTMASGKSSDTFRGIRNVGRHSFFPNRPRWPPGR  122

Query  331  SQLTFGFAPGT--PAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV  501
             +LT+ F P    PA        A R W  V   SF  T+ +E AD++ +  RGDHGDG 
Sbjct  123  DRLTYAFLPENRLPAPTRSAFARAFRRWSAVTPLSFVETEAFEGADIRIAFFRGDHGDGE  182

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENW-VDHD----PSPHSLDIRSVAIHEIGHLLGLD  666
            PFDG  G  AHAFSP  G  H D DENW VD D        ++D+ SVA+HEIGHLLGL 
Sbjct  183  PFDGLLGTLAHAFSPPSGRFHLDGDENWVVDGDFLDATRTSAVDLESVAVHEIGHLLGLG  242

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  A+M+    +G ++ DL  DDI GI+ LY
Sbjct  243  HSSVREAIMYPTIAFGTRKVDLVDDDIAGIQELY  276



>ref|XP_006371427.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
 gb|ERP49224.1| hypothetical protein POPTR_0019s10270g [Populus trichocarpa]
Length=308

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/272 (44%), Positives = 152/272 (56%), Gaps = 24/272 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G +KG  V+GL  LK+YLK FGY  +D++  SS +D     D LE A++TYQ   HLN
Sbjct  43   LEGVQKGQTVQGLVELKQYLKKFGYYPSDITLTSSDFD-----DHLELALKTYQEYFHLN  97

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSE---------VVPNYRFYPGEPKWPNQK  330
             TG LD+ T++QM  PRCG+ DIIN     P+          +V +Y F  G  KWP  K
Sbjct  98   VTGNLDSSTIQQMMIPRCGMPDIINTPSTKPNSTTSKHNKFHMVVHYDF--GTRKWPPSK  155

Query  331  SQLTFGFAPGTPA----KFFIPVYTALRDWHNVGHFSFQR-TQYEHADLKFSLARGDHGD  495
              LT+ F  G               A + W  V  F+FQ  T    AD+      GDHGD
Sbjct  156  YALTYRFGSGVQVVGSDTLRSVCSNAFQTWAKVSPFTFQEATDGASADIVIEFFSGDHGD  215

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHS-  672
              PFDGPG   AH F P  G  H+DADENW   DP+    D+ SV +HEIGHLLGL HS 
Sbjct  216  QDPFDGPGKQLAHGFFPQDGRLHYDADENW-STDPAMDQTDLESVTVHEIGHLLGLYHSK  274

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            + P A+M+     G+K+RDL  DDI+GI ALY
Sbjct  275  DHPEAIMYPTIAPGKKKRDLAQDDIDGIHALY  306



>ref|XP_011086481.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=373

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 158/277 (57%), Gaps = 25/277 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G +KG +  GL  LKKY + FGY+N+ SY++ S   D F D LE AIRTYQ   +L +
Sbjct  52   LDGCRKGVKADGLAKLKKYFQLFGYLNN-SYDNFS---DDFDDYLEKAIRTYQLNFNLYA  107

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSE---------VVPNYRFYPGEPKWP  321
            TG LDA T++ +  PRCG  D++NG    R G PS           V +Y F+P  P+WP
Sbjct  108  TGELDAPTLKHIVLPRCGNPDVVNGTSTMRSGKPSNRYSANSTIHTVAHYSFFPNRPRWP  167

Query  322  NQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
              +++LT+ F P       +  V+  A   W  V   +F  T  +  ADL+     GDHG
Sbjct  168  PGRTRLTYAFLPENQLSDVVKGVFARAFERWSEVTPLTFTETSSFYGADLRIGFFSGDHG  227

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWV-DHD---PSPHS-LDIRSVAIHEIGHLL  657
            DG PFDG  G  AHAFSP  G  H D DENWV D D    SP S +D+ SVA+HEIGHLL
Sbjct  228  DGEPFDGVLGTLAHAFSPPAGRFHLDGDENWVIDGDFLNSSPMSAVDLESVAVHEIGHLL  287

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  288  GLGHSSVEDAIMYPTISSGTRKVELANDDIMGIQELY  324



>ref|NP_001267680.1| metalloendoproteinase 1-like precursor [Cucumis sativus]
 emb|CAB76364.1| matrix metalloproteinase [Cucumis sativus]
 gb|KGN52412.1| hypothetical protein Csa_5G632110 [Cucumis sativus]
Length=320

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 151/270 (56%), Gaps = 16/270 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN-DLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            LQG   GD  +G++ +KKYL+ FGYI  ++  +S+    D F   LESA++TYQT  +L 
Sbjct  51   LQGCHLGDTKQGIHQIKKYLQRFGYITTNIQKHSNPIFDDTFDHILESALKTYQTNHNLA  110

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSEV------------VPNYRFYPGEPKWP  321
             +GILD++T+ Q+  PRCGV D+I  +                   V ++ F+ G  KWP
Sbjct  111  PSGILDSNTIAQIAMPRCGVQDVIKNKKTKKRNQNFTNNGHTHFHKVSHFTFFEGNLKWP  170

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            + K  L++GF P  P     PV  A   W    HF F     Y  AD+K S  RG+HGD 
Sbjct  171  SSKLHLSYGFLPNYPIDAIKPVSRAFSKWSLNTHFKFSHVADYRKADIKISFERGEHGDN  230

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEV  678
             PFDG GG  AHA++PT G  HFD D+ W     S +  D+ +VA+HEIGH+LGL HS +
Sbjct  231  APFDGVGGVLAHAYAPTDGRLHFDGDDAWSVGAISGY-FDVETVALHEIGHILGLQHSTI  289

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
              A+M+     G   + L  DDI GI+ALY
Sbjct  290  EEAIMFPSIPEGV-TKGLHGDDIAGIKALY  318



>ref|XP_008458917.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=295

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/264 (41%), Positives = 151/264 (57%), Gaps = 10/264 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS--SWDADYFSDQLESAIRTYQTRRHL  174
            L G +KGD V+G++++KKYL  +GY++  +  SS    +++ F D LESA++ YQ    L
Sbjct  33   LYGCRKGDNVEGIHSIKKYLHRYGYLSHNTNTSSHIELNSNTFDDTLESAVKLYQKWSKL  92

Query  175  NSTGILDADTVRQMTKPRCGVADII-----NGRPGGPSEVVPNYRFYPGEPKWPNQKSQL  339
            N +GILD  T+ Q+ KPRCG+ D+I     N       E+  +Y  +PG  KWP+ K  L
Sbjct  93   NVSGILDQQTLDQIFKPRCGLPDVIMKSNSNKNTEDDLEISSHYALFPGNQKWPDYKRHL  152

Query  340  TFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHA-DLKFSLARGDHGDGVPFDGP  516
            T+ F    P  F   V  A+++W     F+F +   +   D+  S   GDHGDGVPFDGP
Sbjct  153  TYTFTNNFPIDFVPSVTEAMKEWAAHSLFTFSQAADDQVPDINISFQVGDHGDGVPFDGP  212

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
            GG   HAF+PT G  H D D+ W         +++ + A+HE+GH+LGL HS V  AVMW
Sbjct  213  GGVVGHAFAPTDGRLHLDGDDKW-SAGLETQKVNVMNAALHELGHVLGLAHSTVQQAVMW  271

Query  697  SEFEYGQKRRDLTPDDINGIRALY  768
               +     + LT DDI G+ ALY
Sbjct  272  PYIDV-YALKALTDDDIAGLTALY  294



>ref|XP_004159086.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/265 (40%), Positives = 152/265 (57%), Gaps = 14/265 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----WDADYFSDQLESAIRTYQTRR  168
            L G +KGD V+G++N+KKYL+ +GY   LS+N+ S     +++ F D LESAI+ YQ   
Sbjct  33   LYGCRKGDNVEGIHNIKKYLQRYGY---LSHNTDSHIIELNSNKFDDSLESAIKLYQKWS  89

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQKSQ  336
            HLN +GILD +T+ QM +PRCGV D+             E+  +Y  +PG  KWP+ K  
Sbjct  90   HLNVSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRH  149

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDG  513
            LT+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG+PFDG
Sbjct  150  LTYVFTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDG  209

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
            PGG   HAF+P  G  H D D++W         +++ + A+HE+GH+LGL HS +P AVM
Sbjct  210  PGGVVGHAFAPIDGRLHLDGDDSW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVM  268

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            W   E     +++  DDI G+ ALY
Sbjct  269  WPYIE-SNALKNMNDDDIAGLHALY  292



>ref|XP_003530663.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=370

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 147/278 (53%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G  +GD+  GL NLK Y + FGY        SS  +D F D LESAI+TYQ   +LN 
Sbjct  50   FTGCHRGDKYDGLANLKSYFERFGYFPHAP--PSSNFSDEFDDALESAIKTYQKNFNLNV  107

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSE--------------VVPNYRFYPGEPKW  318
            TG+LD  TV+Q+  PRCGVADIING     +                V ++  +PG P+W
Sbjct  108  TGVLDDATVQQIVLPRCGVADIINGTTTMNAAKENETASFSKPKFHTVAHFTLFPGMPRW  167

Query  319  PNQKSQLTFGFAPGTPAKFFIP--VYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            P    +LT+ F PG      +      A   W  V    F+ T  Y  AD++     GDH
Sbjct  168  PEGTQELTYAFFPGNGLSDAVKGVFAAAFARWAEVTSLKFRETASYFGADIRIGFFSGDH  227

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHL  654
            GDG PFDG  G  AHAFSPT G  H DA E+W     V     P ++D+ SVA+HEIGHL
Sbjct  228  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTRSALPTAVDLESVAVHEIGHL  287

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  AVM+      +K+  L  DDI GI+ LY
Sbjct  288  LGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  325



>gb|EYU34695.1| hypothetical protein MIMGU_mgv1a024051mg, partial [Erythranthe 
guttata]
Length=224

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 132/227 (58%), Gaps = 18/227 (8%)
 Frame = +1

Query  139  SAIRTYQTRRHLNSTGILDADTVRQMTKPRCGVADIINGR----PGGPSE----------  276
            SA++TYQ   H+N TG LDA TV +MT PRCGV DII+G+      G  E          
Sbjct  1    SAVKTYQRNYHINPTGTLDATTVSKMTTPRCGVPDIIDGKNTMQKHGTKEHESNSSSKHI  60

Query  277  -VVPNYRFYPGEPKWPNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEH  453
              V +Y F+ G P+WP  K+ LT+ F P TP     PV  A + W +  HF+F   Q   
Sbjct  61   HTVSHYSFFQGNPRWPPSKTHLTYRFLPNTPGAAVGPVSRAFQKWASSTHFTFSLAQSS-  119

Query  454  ADLKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVA  633
            ADL     RGDHGDG PFDG GG  AHAF+PT G  H+DADE W    P   + D+ +VA
Sbjct  120  ADLVIGFHRGDHGDGNPFDGRGGTLAHAFAPTNGRFHYDADEQW-SVGPVQDAFDLETVA  178

Query  634  IHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            +HEIGHLLGL HS V  A+M+S    G   + L  DDI GIRALY+ 
Sbjct  179  LHEIGHLLGLGHSSVEAAIMYSGIGAGVT-KGLHADDIQGIRALYNI  224



>emb|CDP00221.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 151/274 (55%), Gaps = 24/274 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTG  186
            G   G +V GL  LK+Y + FGYI+    N +    D F D L SA++TYQ   +LN TG
Sbjct  61   GCHTGQKVDGLAKLKQYFQRFGYIDTSLLNFT----DDFDDYLGSALKTYQRNFNLNETG  116

Query  187  ILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN-----------YRFYPGEPKWPNQKS  333
             LDA T++ +T+PRCG  DI+NG     S  V N           Y F+PG P+WP  K+
Sbjct  117  ELDAPTLQHITRPRCGNPDIVNGTTSMNSGKVANANSLRPHTVAHYSFFPGMPRWPAGKT  176

Query  334  QLTFGFAPGTPAKFFI--PVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVP  504
             LT+ F P    +  +      A   W  V   +F  T  +  AD+K  +  GDHGDG P
Sbjct  177  DLTYAFLPENQVEDVVRRVFANAFDRWSEVTTLNFTETASFSLADIKIGIFSGDHGDGEP  236

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWV-DHD----PSPHS-LDIRSVAIHEIGHLLGLD  666
            FDG  G  AHAFSP  G  H D DENWV D D    PS  S +D+ SVA+HEIGHLLGL 
Sbjct  237  FDGVLGTLAHAFSPPSGRLHLDGDENWVIDGDFFSAPSLASAVDLESVAVHEIGHLLGLG  296

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  A+M+       ++ +LT DDI GI+ LY
Sbjct  297  HSSVEEAIMYPSIGSATRKVELTKDDIQGIQMLY  330



>ref|XP_006602365.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=368

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 151/278 (54%), Gaps = 24/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G  +GD+  GL NLK Y + FGYI      S+   +D F D LESAI+TYQ   +LN 
Sbjct  43   FTGCHRGDKYDGLANLKSYFERFGYIPHAPPPSNF--SDEFDDALESAIKTYQKNFNLNV  100

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSE----------VVPNYRFYPGEPKW  318
            TG+LD  T++++  PRCGVADIING      G  +E           V ++  +PG P+W
Sbjct  101  TGVLDDATLQKIVLPRCGVADIINGTTTMNAGKENETASFSKPKFHTVAHFSLFPGMPRW  160

Query  319  PNQKSQLTFGFAPGTPAKFFIP--VYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            P    +LT+ F PG      +     TA   W  V    F+ +  Y  AD++     GDH
Sbjct  161  PEGTQELTYAFFPGNELSDTVKGVFATAFARWAEVTSLKFRESASYFGADIRIGFFSGDH  220

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHL  654
            GDG PFDG  G  AHAFSPT G  H DA E+W     V     P ++D+ SVA+HEIGHL
Sbjct  221  GDGEPFDGSLGTLAHAFSPTNGRFHLDAAEDWVVSGDVTLSALPTAVDLESVAVHEIGHL  280

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  AVM+      +K+  L  DDI GI+ LY
Sbjct  281  LGLGHSSVEEAVMFPTISSRKKKVVLARDDIEGIQFLY  318



>ref|XP_004142459.1| PREDICTED: matrix metalloproteinase-9-like [Cucumis sativus]
Length=293

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/265 (40%), Positives = 152/265 (57%), Gaps = 14/265 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS----WDADYFSDQLESAIRTYQTRR  168
            L G +KGD V+G++N+KKYL+ +GY   LS+N+ S     +++ F D LESAI+ YQ   
Sbjct  33   LYGCRKGDNVEGIHNIKKYLQRYGY---LSHNTDSHIIELNSNKFDDSLESAIKLYQKWS  89

Query  169  HLNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQKSQ  336
            HLN +GILD +T+ QM +PRCGV D+             E+  +Y  +PG  KWP+ K  
Sbjct  90   HLNVSGILDQETLDQMFQPRCGVRDVFKFNSSKNLEDDLEMSSHYALFPGNLKWPDYKRH  149

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDG  513
            LT+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG+PFDG
Sbjct  150  LTYVFTNNFPINFVPSVTEAMARWAAHSLFTFSEASDAQSADINISFQIKDHADGMPFDG  209

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
            PGG   HAF+P  G  H D D++W         +++ + A+HE+GH+LGL HS +P AVM
Sbjct  210  PGGVVGHAFAPIDGRLHLDGDDSW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQAVM  268

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            W   +     ++L  DDI G+ ALY
Sbjct  269  WPYID-SNALKNLNDDDIAGLHALY  292



>ref|XP_002520211.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF42266.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=364

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 150/274 (55%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G + GD+++GL  LK Y   FGYI     N+ S   D F D LESAI+TYQ   +LN 
Sbjct  50   LAGCRAGDKLEGLSKLKNYFHYFGYIP----NTLSNFTDDFDDALESAIKTYQQNFNLNV  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS----------EVVPNYRFYPGEPKWPNQK  330
            TG LD  T+ Q+ +PRCG ADIING     S            V +Y F+PG P+WP+ K
Sbjct  106  TGELDEQTLDQLVRPRCGNADIINGSTTMNSGKWQTTTTSFHAVGHYSFFPGTPRWPDSK  165

Query  331  SQLTFGFAPGTP-AKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV  501
              LT+ F P     +    V+T A   W  V   +F  T+ Y  AD++     GDHGDG 
Sbjct  166  RDLTYAFWPSNQLTEVEKSVFTRAFDRWSTVIPMNFTETESYNVADIRIGFFSGDHGDGE  225

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLD  666
            PFDG  G  AHAFSP  G  H D +ENWV            ++D+ SVA+HEIGHLLGL 
Sbjct  226  PFDGVLGTLAHAFSPPSGRFHLDGEENWVVSGDISSSTISSAVDLESVAVHEIGHLLGLG  285

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  A+M+       ++ +L  DDI GI+ LY
Sbjct  286  HSSVEEAIMYPTIPSRTRKIELANDDIQGIQYLY  319



>ref|XP_007033356.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY04282.1| Matrixin family protein, putative [Theobroma cacao]
Length=384

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 154/263 (59%), Gaps = 14/263 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQG++KG +VKGL ++K+Y K FGY     Y +     D + D LESA++ YQ    L  
Sbjct  128  LQGAQKGYKVKGLNHVKQYFKAFGY-----YPNHINLTDDYDDSLESALKKYQENYRLKV  182

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG--GPSEVVPNYRFYPGEPKWPNQKSQLTFGF-  351
            TG +D DT+++M  PRCGVADI N         ++V NY F+ G PKW   K QLT+ F 
Sbjct  183  TGRIDPDTIKEMLIPRCGVADIFNESNSEYDKLDMVANYTFFDGMPKWS--KRQLTYTFR  240

Query  352  --APGTPAKFFIPVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPG  519
              A     +   P+   A   W  V  F+F++   +  AD+     R  H D  PFDGPG
Sbjct  241  SSAIVISVQQLRPIIARAFEKWAAVSQFTFRQAPTFTQADIVIGFHRRFHWDNYPFDGPG  300

Query  520  GNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWS  699
               AHAF+P  G  H+DADENW  +  + + +D+ SVA+HEIGHLLGL HS  P A+M++
Sbjct  301  NVLAHAFAPQDGRFHYDADENWSTNPTTVNQIDVESVAVHEIGHLLGLGHSRDPNAIMFA  360

Query  700  EFEYGQKRRDLTPDDINGIRALY  768
             +  G  +R+L  DDI+G+RALY
Sbjct  361  LYMPGTIKRNLGQDDIDGMRALY  383



>ref|XP_010695886.1| PREDICTED: metalloendoproteinase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=323

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 121/286 (42%), Positives = 158/286 (55%), Gaps = 34/286 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSY---------NSSSW----DADYFSDQLES  141
            L+G KKG  V+GL++LK YL  FGY+  L Y         N++S     D   F++ LE 
Sbjct  41   LEGCKKGQNVEGLHHLKSYLAKFGYLEPLYYHPVVPKIGVNTTSMTIQKDDQLFNESLEK  100

Query  142  AIRTYQTRRHLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSE-----------VVPN  288
            AIRTYQ    LN +G LDA TV+QM KPRCG ADIING+     E           +   
Sbjct  101  AIRTYQLNYRLNVSGHLDAATVQQMMKPRCGFADIINGKNTMQREDKKIGYKSRKSMYGT  160

Query  289  YRFYPGEPKWPNQKSQLTF-----GFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYE  450
              +     +WP+   QLT+         G     +I V   L  W     F+FQ   +  
Sbjct  161  SLYALIGRRWPS--YQLTYQVQSQTLVSGAENMRYI-VAQQLYKWAQYSPFTFQEVPEGS  217

Query  451  HADLKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSV  630
             +DL F  A+GDHGDG PFDG GG  AH+FSP+ G  H+DA E W D +P  H +D+ SV
Sbjct  218  QSDLVFGFAQGDHGDGYPFDGIGGILAHSFSPSDGRSHYDATEYWSD-NPGQHEMDLNSV  276

Query  631  AIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             +HEIGHLLGL H++ P AVM S    G+++R L  DD+ GI+A+Y
Sbjct  277  VLHEIGHLLGLAHTQDPTAVMHSGISPGERKRFLQEDDVEGIQAIY  322



>gb|KDP21290.1| hypothetical protein JCGZ_21761 [Jatropha curcas]
Length=371

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 154/280 (55%), Gaps = 31/280 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G + G ++ GL  LK+Y   FGYI +   N +    D F D LESA++TYQ   +LN 
Sbjct  53   LSGCRAGQKLDGLNKLKQYFHDFGYIPNTFANFT----DDFDDALESALKTYQQNFNLNV  108

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-------------EVVPNYRFYPGEPKWP  321
            TG LD  T+ Q+ KPRCG ADI+NG     S               V +Y F+PG P+WP
Sbjct  109  TGELDEQTLSQLIKPRCGNADIVNGTTAMNSGKWTPPFNTTSHFHTVGHYTFFPGSPRWP  168

Query  322  NQKSQLTFGFAPG----TPAKFFIPVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARG  483
            + K  LT+ F PG    T AK    V+T A   W  V   +F  T  +  AD++     G
Sbjct  169  DSKRDLTYAFWPGNNLTTEAK---SVFTRAFDRWSTVIPMTFAETDSFTIADIRIGFFSG  225

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENW-VDHDPSPHSL----DIRSVAIHEIG  648
            DHGDG PFDG  G  AHAFSP  G  H D DENW V  D S  S+    D+ SVA+HEIG
Sbjct  226  DHGDGEPFDGVLGTLAHAFSPPSGRFHLDGDENWVVSGDISDSSIISAVDLESVAVHEIG  285

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  A+M+       ++ +L  DDI+G++ LY
Sbjct  286  HLLGLGHSSVEDAIMYPTIPSRTRKVELAQDDIDGVQQLY  325



>ref|XP_011080437.1| PREDICTED: metalloendoproteinase 1-like [Sesamum indicum]
Length=308

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 152/262 (58%), Gaps = 8/262 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNS-SSWDADYFSDQLESAIRTYQTRRHLN  177
            L G++KG   KG+  LKKYL   GY+ND ++ + ++   D+F D+LE AI+ YQT   L 
Sbjct  47   LIGARKGTTSKGIPQLKKYLSRLGYMNDNNHTTPANQTNDFFDDKLELAIKRYQTFFKLT  106

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN----YRFYPGEPKWPNQKSQLTF  345
               I+D +TV QM++PRCGV D            +P     Y F P +P WP  K  LT+
Sbjct  107  VNRIMDDNTVTQMSRPRCGVPDFNLNTSNELFLQIPTSASHYTFLPNKPTWPRTKRNLTY  166

Query  346  GFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPGG  522
             F        +  +  A   W     F F  TQ Y+ AD+K S   G+HGDG PFDG GG
Sbjct  167  SFPVIARRDVYPAIEHATELWAFFSSFKFSYTQNYDRADIKISFQYGNHGDGYPFDGRGG  226

Query  523  NYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSE  702
               HA  PTIGI H+DADENWV+ + +P + D++++ +HE+GH+LGL H+    A+M+  
Sbjct  227  ILGHALPPTIGILHYDADENWVNGE-TPGAFDLQTIGLHELGHILGLGHTNDVRAIMYPN  285

Query  703  FEYGQKRRDLTPDDINGIRALY  768
             + G  R+ L  DD++GI+ALY
Sbjct  286  MDPGV-RKVLGQDDMDGIKALY  306



>ref|XP_007220919.1| hypothetical protein PRUPE_ppb025548mg [Prunus persica]
 gb|EMJ22118.1| hypothetical protein PRUPE_ppb025548mg [Prunus persica]
Length=315

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 157/276 (57%), Gaps = 27/276 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADY-FSDQLESAIRTYQTRRHLN  177
            L+G  KG  V GL  LKKYL  FGY+N   Y+ S    D  F D LESAI++YQ   HL 
Sbjct  44   LEGCHKGQNVSGLQELKKYLTKFGYLN---YDHSKHANDEEFDDILESAIKSYQKSYHLK  100

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSEV---------VPNYRFYPGEPKWPNQK  330
             TG LD  T +QM  PRCGV D++NG   G  +          V +Y F+PG  +W   K
Sbjct  101  VTGTLDTTTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHGVAHYEFFPGPRRW--SK  158

Query  331  SQLTFGFA------PGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            + LT+ F+      PGT     I    A + W  V  F+F+       AD+     RG+H
Sbjct  159  THLTYRFSSSVNQVPGTQNVRSI-CAQAFQRWAQVTSFTFEEVPATSAADITIGFHRGNH  217

Query  490  GD--GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGL  663
            GD  G  FDGP G  AHA  P  G  H+DADE W   +P P+ +D+ SV +HEIGHLLGL
Sbjct  218  GDGPGNAFDGPRGTLAHANPPRGGNFHYDADERWSS-NPGPNEVDLESVTVHEIGHLLGL  276

Query  664  DHS-EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            +H+ ++P A+M+  F++G  +RDL  DDI+GIRALY
Sbjct  277  NHNPDLPDAIMYPYFDHGIIKRDLHRDDIDGIRALY  312



>gb|KGN52417.1| hypothetical protein Csa_5G633150 [Cucumis sativus]
Length=294

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 106/267 (40%), Positives = 151/267 (57%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS------WDADYFSDQLESAIRTYQT  162
            L G +KGD V+G++N+KKYL+ +GY   LS+N+S+       +++ F D LESAIR YQ 
Sbjct  32   LNGCRKGDNVEGIHNIKKYLQRYGY---LSHNTSTDSNIIELNSNKFDDSLESAIRLYQK  88

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQK  330
              HLN +GILD +T+ QM + RCG+ D+             E+  +Y  +P   KWP+ K
Sbjct  89   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYK  148

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPF  507
              LT+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG  F
Sbjct  149  RHLTYMFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAF  208

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG   HAF+PT G  H D D++W       +  ++ +VA+HE+GH+LGL HS +P A
Sbjct  209  DGPGGVVGHAFAPTDGRLHLDGDDSW-SAGLEENKFNVMNVALHELGHVLGLAHSTLPQA  267

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VMW   +     ++L  DDI G+ ALY
Sbjct  268  VMWPYID-SNALKNLNDDDIAGLHALY  293



>ref|XP_004143787.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004157318.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN51182.1| hypothetical protein Csa_5G484630 [Cucumis sativus]
Length=366

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 152/274 (55%), Gaps = 23/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G + GDR  GL NLK YL  FGYI      SS    D F   L+SA++TYQT  +LN+
Sbjct  46   LKGCRPGDRFNGLSNLKTYLNRFGYIP-----SSPNFTDLFDPLLQSALKTYQTNFNLNA  100

Query  181  TGILDADTVRQMTKPRCGVADIIN-------GRPGGPSE----VVPNYRFYPGEPKWPNQ  327
            TG+LD  T+ Q+  PRCG+ DIIN       G+P G        V +Y F+PG P WP  
Sbjct  101  TGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGQPTGRQSPHFHSVSHYSFFPGRPIWPAH  160

Query  328  KSQLTFGFAPGTPAKFFIPVYTALRDWHN--VGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            +  LT+ FAP  P    +    A        V   +F   + +  AD++     GDHGDG
Sbjct  161  RRDLTYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRSADIRIGFYAGDHGDG  220

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDPSP-HSLDIRSVAIHEIGHLLGLD  666
             PFDG  G  AHAFSP  G  H D DE+WV   D   +P  ++D+ SVA+HEIGHLLGL 
Sbjct  221  EPFDGVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGLG  280

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  ++M+       ++ DL  DDINGI+ LY
Sbjct  281  HSSVEESIMFPTITSRTRKVDLAADDINGIQELY  314



>ref|XP_008233236.1| PREDICTED: metalloendoproteinase 1-like [Prunus mume]
Length=381

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 158/276 (57%), Gaps = 26/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG  V GL  LKKYL  FGY+N    +S   + D F D LESAI++YQ   HL  
Sbjct  110  LEGCHKGQNVSGLQELKKYLTKFGYLN--YDHSKHANDDEFDDILESAIKSYQKSYHLKV  167

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSE---------VVPNYRFY-PGEPKWPNQK  330
            TG LDA T +QM  PRCGV D++NG   G  +          V +Y F+ PG  +W   K
Sbjct  168  TGTLDASTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHEVAHYEFFLPGPLRW--SK  225

Query  331  SQLTFGF------APGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            + LT+ F       PGT     I    A + W  V  F+F+       AD+     RG+H
Sbjct  226  THLTYRFRSSVNQVPGTQNVRSICA-QAFQRWAQVTSFTFEEVPATSAADITIGFHRGNH  284

Query  490  GDG--VPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGL  663
            GDG    FDGP G +AHA  P+ G  H+DADE W   +P P+ +D+ SVA+HEIGHLLGL
Sbjct  285  GDGPHNAFDGPRGTFAHANPPSGGNFHYDADERWSS-NPGPNEVDLESVAVHEIGHLLGL  343

Query  664  DHS-EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            DH+ ++  A+M+  F+YG  +RDL  DDI+GIR LY
Sbjct  344  DHNPDLRDAIMYPYFDYGIIKRDLHRDDIDGIRVLY  379



>gb|EYU28648.1| hypothetical protein MIMGU_mgv1a008442mg [Erythranthe guttata]
Length=374

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 152/278 (55%), Gaps = 26/278 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G  KG + +GL  LKKY + FGY+N    NS +  +D F + LESA+++YQ   +LN 
Sbjct  56   LTGCHKGVKSQGLPKLKKYFQFFGYLN----NSYTNFSDDFDEYLESAVKSYQLNFNLNV  111

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN-------------YRFYPGEPKWP  321
            TG LDA T+  +  PRCG ADI+NG     S   PN             Y F+P  P+WP
Sbjct  112  TGQLDAPTLNHIVLPRCGNADIVNGTSIMRSGKSPNTYSANSTIHTVAHYSFFPDRPRWP  171

Query  322  NQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHG  492
               +QLT+ F P       +  V++ A   W  V  F+F  T  +  ADLK +   GDHG
Sbjct  172  PGTTQLTYAFLPENQLSDAVKGVFSRAFERWSEVTAFTFVETASFYDADLKIAFFGGDHG  231

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWV------DHDPSPHSLDIRSVAIHEIGHL  654
            DG PFDG  G  AHAF+P  G  H D DENWV          S  ++D+ SVA+HEIGHL
Sbjct  232  DGEPFDGVMGTLAHAFAPPAGRFHLDGDENWVIDGNFLGAAASVAAVDLESVAVHEIGHL  291

Query  655  LGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LGL HS V  A+M+       ++ +L  DDI GI+ LY
Sbjct  292  LGLGHSSVEEAIMYPTISSSTRKVELANDDIMGIQELY  329



>ref|XP_008465718.1| PREDICTED: metalloendoproteinase 1 [Cucumis melo]
Length=362

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 150/270 (56%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G + GDR+ GL NLK YL  FGYI       S    D F   L+SA++TYQT  +LN+
Sbjct  46   LKGCRPGDRLNGLSNLKTYLNHFGYIP-----PSPNFTDLFDPLLQSALKTYQTNFNLNA  100

Query  181  TGILDADTVRQMTKPRCGVADIIN-------GRPGGPSEVVPNYRFYPGEPKWPNQKSQL  339
            TG+LD  T+ Q+  PRCG+ DIIN       GR       V +Y F+PG P WP  +  L
Sbjct  101  TGLLDDQTLAQIQLPRCGIPDIINNSTSMNSGRHSPHFHSVSHYTFFPGRPIWPAHRRDL  160

Query  340  TFGFAPGTPAKFFIPVYTALRDWHN--VGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
            T+ FAP  P    +    A        V   +F   + +  AD++     GDHGDG PFD
Sbjct  161  TYAFAPENPLSNEVKAVFARAFARWAAVTPLTFSAVESFRTADIRIGFYAGDHGDGEPFD  220

Query  511  GPGGNYAHAFSPTIGICHFDADENWV---DHDPSP-HSLDIRSVAIHEIGHLLGLDHSEV  678
            G  G  AHAFSP  G  H D DE+WV   D   +P  ++D+ SVA+HEIGHLLGL HS V
Sbjct  221  GVLGTLAHAFSPPSGHFHLDGDESWVVSGDLRSAPLAAIDLESVAVHEIGHLLGLGHSSV  280

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
              ++M+       ++ DL  DDINGI+ LY
Sbjct  281  EESIMFPTITSRTRKVDLAADDINGIQELY  310



>ref|XP_008458915.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=303

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 153/270 (57%), Gaps = 22/270 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ + N+ S DA  F D LESAI++YQ   +L 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENDNNLSTDA--FDDDLESAIKSYQKFSNLK  97

Query  178  STGILDADTVRQMTKPRCGVADII------------NGRPGGPSEVVPNYRFYPGEPKWP  321
             +G+LD  T+  M K RCGV D              N   GG      +Y FY     WP
Sbjct  98   VSGVLDRKTLEHMYKFRCGVKDTFVSAAQEHENKNTNIEIGGS-----HYTFYFNNVSWP  152

Query  322  NQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDG  498
             ++  L++GF    P +F  P+  A + W +   FSF   ++ + AD+  S  RG+HGD 
Sbjct  153  AERKHLSYGFIHNYPPQFIDPLVRAFQTWEDNTKFSFFLASRVQTADILVSFERGEHGDI  212

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEV  678
             PFDGPGG  AH+     G  HFDADE W + +PS   +D+ SVA+HE+GH LGL HS  
Sbjct  213  DPFDGPGGTLAHSLGAIDGRVHFDADEQW-EGEPSEERIDLESVALHELGHTLGLGHSSD  271

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            P AVM++  E    +  LT DDI GIRALY
Sbjct  272  PSAVMFAYMEPDTYKTTLTSDDIEGIRALY  301



>ref|XP_003554856.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=299

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 153/269 (57%), Gaps = 23/269 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI-NDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L+G  KG +VKG+  L+ YL+ FGYI N  S N      D F + LESAI+ YQ   HL 
Sbjct  43   LRGVHKGQKVKGVGTLRSYLQHFGYIANGDSSN------DNFDEILESAIKDYQGFHHLR  96

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGP----SEVVPNYRFYPGEPKWPNQKSQLTF  345
             TG++D +T++ ++ PRCGV DI+      P    S    NY F+PG P+W  +K  LT+
Sbjct  97   VTGVVDDETIKTLSLPRCGVPDIVTNPNPNPNPRGSTDPENYSFFPGSPRW--RKWALTY  154

Query  346  GFAPGTPAKFFI------PVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPF  507
                G              +  AL+ W  V +F+F       AD+ +   RG+HGDG PF
Sbjct  155  ALLSGATVSTISGNAVRQAMQNALQKWAQVSNFTFTEIGRTPADIVYGFHRGNHGDGYPF  214

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPG   AHAFSP  G  H+DADE W  +D S  ++D  +V +HE+GH+ GL HS V GA
Sbjct  215  DGPGRVLAHAFSPQDGRLHYDADEQWNSNDGS--NVDFETVTLHELGHIFGLGHSNVTGA  272

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            VM+    Y   RR L+ DDI+GIRALY F
Sbjct  273  VMFP--TYAGLRRFLSQDDIDGIRALYGF  299



>ref|XP_004297678.1| PREDICTED: metalloendoproteinase 1-like [Fragaria vesca subsp. 
vesca]
Length=373

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 147/275 (53%), Gaps = 29/275 (11%)
 Frame = +1

Query  10   SKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGI  189
             + G++V GL  LKKY   FGYI +L  N +    D F D+L+SA++TYQ   +LN TG 
Sbjct  57   CRPGEKVDGLAKLKKYFNYFGYIPNLPTNCT----DEFDDELQSALKTYQKNFNLNVTGE  112

Query  190  LDADTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQ  336
            LD  T+  + +PRCG  DI+NG      G P          V +Y F+PG P WP  +  
Sbjct  113  LDDQTINHLVRPRCGNPDIVNGTTTMHSGKPVTFNNSKLHTVGHYSFFPGTPVWPTGRRD  172

Query  337  LTFGFAPGT-----PAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDG  498
            LTF F P           F+    A + W  V   +F + T Y  AD+K     GDHGDG
Sbjct  173  LTFAFLPDNELSDEAKSVFV---GAFQKWSTVIPMTFTETTSYYSADIKIGFYVGDHGDG  229

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGL  663
              FDG  G  AHAFSP  G+ H D DENWV            ++D+ SVA+HEIGHLLGL
Sbjct  230  EAFDGVLGTLAHAFSPPSGLFHLDGDENWVIGGDISTSTVTSAIDLESVAVHEIGHLLGL  289

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  ++M+       K+ DL  DD+ GI++LY
Sbjct  290  GHSSVEESIMYPTITSKTKKVDLANDDVEGIQSLY  324



>ref|XP_010100525.1| Metalloendoproteinase 1 [Morus notabilis]
 gb|EXB82659.1| Metalloendoproteinase 1 [Morus notabilis]
Length=374

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 145/276 (53%), Gaps = 24/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + G +  GL  LK Y K FGYI D  +N +    D F D+LESAI+TYQ   +LN 
Sbjct  53   FTGCRPGQKSDGLSKLKDYFKNFGYIPDSQHNFT----DDFDDELESAIKTYQKNFNLNV  108

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSE--------VVPNYRFYPGEPKWPN  324
            TG LD  T+  + K RCG ADI+NG      G P+          V +Y F+ G P WP 
Sbjct  109  TGELDDKTIENLMKSRCGNADIVNGTSTMNSGKPASSNSSLNFHAVRHYSFFEGRPTWPE  168

Query  325  QKSQLTFGFAPGTP-AKFFIPVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGD  495
                LT+ F P    +     V+T A   W  V   +F  T  Y  ADLK +   GDHGD
Sbjct  169  YHRDLTYAFLPDNELSNTTKEVFTRAFERWAAVTTLTFTETDSYYEADLKVAFYTGDHGD  228

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHLLG  660
            G PFDG  G  AHAFSPT G  H D  E W     V    +  ++D+ SVA+HEIGHLLG
Sbjct  229  GEPFDGVLGTLAHAFSPTSGRFHLDGAETWVAEGDVTKSSTSSAIDLESVAVHEIGHLLG  288

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  A+M+       ++ +L  DDI GI+ LY
Sbjct  289  LGHSSVEEAIMYPTISAKTRKVELASDDIQGIQELY  324



>ref|XP_007044491.1| Matrixin family protein, putative [Theobroma cacao]
 gb|EOY00323.1| Matrixin family protein, putative [Theobroma cacao]
Length=369

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 153/276 (55%), Gaps = 24/276 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + G++  GL  LK+Y   FGYI     NS +  +D F+D+LE A++ YQ   +LN 
Sbjct  51   FAGCQSGEKRDGLSKLKQYFNNFGYIP----NSPTNFSDDFNDELEKALKIYQQNFNLNV  106

Query  181  TGILDADTVRQMTKPRCGVADIINGR------------PGGPSEVVPNYRFYPGEPKWPN  324
            TG LD  T++Q+ +PRCG ADI+NG               G      +Y F+PG P WP 
Sbjct  107  TGQLDDQTLQQIVRPRCGNADIVNGTSSMNSGKSSSFHTTGHFRTTAHYAFFPGRPFWPA  166

Query  325  QKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGD  495
             +  LT+GF P       +  V+T A   W  V   +F +T  +  AD+K +   GDHGD
Sbjct  167  NRRDLTYGFLPANELSDEVKAVFTRAFEKWSAVTPLTFTQTDSFFSADIKIAFYSGDHGD  226

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENW-VDHDPSPHSL----DIRSVAIHEIGHLLG  660
            G PFDG  G  AHAFSPT G  H D  ENW V  D +  SL    D+ SVA+HEIGHLLG
Sbjct  227  GEPFDGVLGTLAHAFSPTNGRFHLDLAENWVVSGDVTTSSLSSAVDLESVAVHEIGHLLG  286

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  A+M+       ++ +L  DD++GI++LY
Sbjct  287  LGHSSVEDAIMFPTISSRTRKVELANDDVDGIQSLY  322



>ref|XP_003519796.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
Length=379

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/275 (43%), Positives = 148/275 (54%), Gaps = 20/275 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + G    GL NLK Y + FGYI+     SS++  D F D LE+AI+ YQ   +LN 
Sbjct  58   FTGCRPGKTYNGLSNLKNYFQYFGYISKALSKSSNFTDD-FDDALEAAIKAYQKNFNLNI  116

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---GGPSEV--------VPNYRFYPGEPKWPNQ  327
            TG LD  T+ Q+ KPRCGVADIING      G S          V +Y F+ G+P+WP  
Sbjct  117  TGELDDPTMNQIVKPRCGVADIINGTTTMNSGKSNTTDSPKFHSVAHYSFFDGQPRWPEG  176

Query  328  KSQLTFGFAPGTPAKFFIPVY--TALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDG  498
              +LT+ F P              A   W  V   SF+ T  Y  AD++     GDHGDG
Sbjct  177  TQELTYAFDPDNALDDVSKTVFGNAFSRWSEVTTISFRETSSYAAADIRIGFYGGDHGDG  236

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDH-DPSPHSL----DIRSVAIHEIGHLLGL  663
             PFDG  G  AHAFSPT G  H D+ E+WV   D +  SL    D+ SVA+HEIGHLLGL
Sbjct  237  EPFDGVLGTLAHAFSPTNGRFHLDSAEDWVASGDVTKASLSNAVDLESVAVHEIGHLLGL  296

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  A+M+       ++ +L  DDI GI+ LY
Sbjct  297  GHSSVEDAIMYPTITARTRKVELNEDDILGIQVLY  331



>ref|XP_010414620.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=369

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 150/274 (55%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  + ++ +   D F D L+SAI TYQ   +L  
Sbjct  54   LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVDNCT---DDFDDVLQSAIDTYQKNFNLKV  110

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----GGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LD+ T+RQ+ KPRCG  D+I+G      G        Y F+PG+P+WP +K  LT+ 
Sbjct  111  TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  170

Query  349  FAPGT-----PAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
            F P         + F   +T    W  V  F+F R++    AD+      G+HGDG PFD
Sbjct  171  FVPQNNLTDEVKRVFARAFTR---WSEVTPFNFTRSESLVGADIVIGFFSGEHGDGEPFD  227

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLD  666
            G  G  AHA SP  G+ H D+DE+W+  D        P    +D+ SV +HEIGHLLGL 
Sbjct  228  GAMGTLAHASSPPTGMLHLDSDEDWLISDGGISRRILPVTSVVDLESVVVHEIGHLLGLG  287

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  288  HSSVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  321



>gb|KHN28682.1| Metalloendoproteinase 1 [Glycine soja]
Length=400

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 147/266 (55%), Gaps = 18/266 (7%)
 Frame = +1

Query  16   KGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILD  195
            +G   KGL N+K Y    GYI +   N+   D D F D L SAI+T+Q   +L+ TG LD
Sbjct  47   RGHNYKGLSNVKNYFHHLGYIPNP--NAPPLD-DKFDDTLVSAIKTFQKNYNLDITGKLD  103

Query  196  ADTVRQMTKPRCGVADIINGRPGGPS-----EVVPNYRFYPGEPKWPNQKSQLTFGFAP-  357
             +T+RQ+T PRCGV DIIN              V +Y F+ G P+WP    QLT+ F+P 
Sbjct  104  NNTLRQLTTPRCGVPDIINTNTTTQHTQLHIHTVSHYSFFNGAPRWPAGTRQLTYAFSPE  163

Query  358  ----GTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFDGPGGN  525
                      F   +       N+  +    + Y+ A++K +   GDH DG+PFDGP G 
Sbjct  164  LNLNSAAKSLFARAFNRWTQVVNIAFYEIASSSYQTANIKIAFLSGDHNDGLPFDGPLGE  223

Query  526  YAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAV  690
            + HAF+PT G CHFDADE W     V   P   ++D+ S+A+HEIGHLLGL HS    A+
Sbjct  224  WTHAFAPTNGWCHFDADEYWVASGDVTQSPVARAVDLESIAVHEIGHLLGLHHSSDQRAI  283

Query  691  MWSEFEYGQKRRDLTPDDINGIRALY  768
            M++      ++ +L  DDINGIR LY
Sbjct  284  MYAYLPPRTRKVNLAQDDINGIRHLY  309



>ref|XP_006838196.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
 gb|ERN00765.1| hypothetical protein AMTR_s00106p00141160 [Amborella trichopoda]
Length=355

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 147/266 (55%), Gaps = 14/266 (5%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
             Q +  G  + G+  LKKY + FGY+ +   NSS    D F ++ ESA+RTYQ R  L+ 
Sbjct  50   FQDAPLGSNITGMVELKKYFQRFGYLLN-PPNSSETLTDCFDEEFESAVRTYQARLSLSV  108

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG LD DT+ Q+  PRCG+ D      GGP   V +Y F+PG PKWP  K  LT+G +P 
Sbjct  109  TGRLDPDTLAQVMTPRCGMPD---KGLGGPFHEVGHYAFFPGVPKWPRGKKALTYGISPT  165

Query  361  TPAKFF------IPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG  519
                +       + +  A   W NV   +F  TQ Y  AD+K     GDHGDG PFDG  
Sbjct  166  NMVNYLDMEDVRMALSRAFDRWSNVIPLNFTETQDYYGADIKIGFFSGDHGDGQPFDGVL  225

Query  520  GNYAHAFSPTIGICHFDADENWVDH---DPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAV  690
            G  AHAFSP+ G  H DA E W        S  ++D+ SVA HEIGHLLGL HS+   A+
Sbjct  226  GILAHAFSPSNGNFHLDASETWSTDFGVQKSRVAIDLESVATHEIGHLLGLGHSKEKEAI  285

Query  691  MWSEFEYGQKRRDLTPDDINGIRALY  768
            M+       K+ +L  DDI G+++LY
Sbjct  286  MYPSLSPRTKKMELRSDDIIGVQSLY  311



>ref|XP_009626465.1| PREDICTED: metalloendoproteinase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 146/274 (53%), Gaps = 24/274 (9%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTG  186
            G   G +V+GL  +K+Y + FGYIN LS N S    D F D L SA++TYQ   +LN+TG
Sbjct  52   GCHVGQKVEGLAKIKQYFQHFGYINSLSKNFS----DEFDDVLFSAVKTYQLNFNLNTTG  107

Query  187  ILDADTVRQMTKPRCGVADIINGRPGGPS----------EVVPNYRFYPGEPKWPNQKSQ  336
              DA T++ M KPRCG  DI+NG     S            + ++ F+ G P+WP  K+ 
Sbjct  108  EFDAVTLQHMIKPRCGNPDIVNGTTSMNSGNSPANSPAMHTMAHFSFFEGRPRWPPSKTN  167

Query  337  LTFGFAPGTPAKFFIPVY--TALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPF  507
            L + F P       +      A   W  V   SF  T  Y  AD++     GDHGDG PF
Sbjct  168  LNYAFLPENQLTDSVKAAFGRAFDKWSEVTPLSFTETGSYRTADIRIGFLVGDHGDGNPF  227

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVD-----HDP--SPHSLDIRSVAIHEIGHLLGLD  666
            DGP    AHAFSP  G  H D +ENWV       +P      +D+ SVA+HEIGHLLGLD
Sbjct  228  DGPMKILAHAFSPPTGFFHLDGEENWVVDGGFLKEPVLEISGVDLESVAVHEIGHLLGLD  287

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS    A+M+     G ++ +L+ DDI G+  LY
Sbjct  288  HSSKKEAIMFPTLGAGVRKVELSSDDIKGVHMLY  321



>ref|XP_004142843.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=295

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/267 (39%), Positives = 150/267 (56%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS------SWDADYFSDQLESAIRTYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N+S        +++ F D LESAI+ YQ 
Sbjct  33   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNTSIDSHIIELNSNKFDDSLESAIKLYQK  89

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQK  330
              HLN +GILD +T+ QM + RCG+ D+             E+  +Y  +P   KWP+ K
Sbjct  90   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNKKWPDYK  149

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPF  507
              LT+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG+PF
Sbjct  150  RHLTYMFTNNFPIDFMPSVTEAMARWAAQSLFTFSEASDAQSADINISFQIKDHADGLPF  209

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG   HAF+PT G  H D D+ W         +++ + A+HE+GH+LGL HS +P A
Sbjct  210  DGPGGVVGHAFAPTDGRLHLDGDDTW-SAGMEVQKVNVMNAALHELGHVLGLAHSTLPQA  268

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VMW   +     ++L  DDI G+ ALY
Sbjct  269  VMWPYID-SNALKNLNDDDIAGLHALY  294



>gb|KHN16355.1| Metalloendoproteinase 1 [Glycine soja]
Length=282

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 153/268 (57%), Gaps = 21/268 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  KG +VKG+  L+ YL+ FGY   L+   SS   D F +  ESAI+ YQ   HL+ 
Sbjct  26   LRGVHKGQKVKGVGTLRSYLQHFGY---LANGDSS--NDNFDEIFESAIKDYQGFHHLHV  80

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGP----SEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG++D +T++ ++ PRCGV DI+      P    S    NY F+PG P+W  +K  LT+ 
Sbjct  81   TGVVDDETIKTLSLPRCGVPDIVTNPNPNPNPRGSTDPENYSFFPGSPRW--RKWALTYA  138

Query  349  FAPGTPAKFFI------PVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFD  510
               G              +  AL+ W  V +F+F       AD+ +   RG+HGDG PFD
Sbjct  139  LLSGATVSTISGNAVRQAMQNALQKWAQVSNFTFTEIGRTPADIVYGFHRGNHGDGYPFD  198

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAV  690
            GPG   AHAFSP  G  H+DADE W  +D S  ++D  +V +HE+GH+ GL HS V GAV
Sbjct  199  GPGRVLAHAFSPQDGRLHYDADEQWNSNDGS--NVDFETVTLHELGHIFGLGHSNVTGAV  256

Query  691  MWSEFEYGQKRRDLTPDDINGIRALYHF  774
            M+    Y   RR L+ DDI+GIRALY F
Sbjct  257  MFP--TYAGLRRFLSQDDIDGIRALYGF  282



>emb|CAN76268.1| hypothetical protein VITISV_004096 [Vitis vinifera]
Length=364

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 146/275 (53%), Gaps = 25/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   GD+  GL  LK+Y   FGYI++ +Y       D F D  E A++TYQ   +LN+
Sbjct  49   FAGCHAGDKADGLAKLKEYFHYFGYIHNSNYT------DDFDDAFEQALKTYQLNFNLNT  102

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG-----------GPSEVVPNYRFYPGEPKWPNQ  327
            TG LD  T+ Q+  PRCG ADI NG              G    V +Y F+ G+P WP  
Sbjct  103  TGQLDXATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPES  162

Query  328  KSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDG  498
            K  LT+GF P       +  V+T A   W  V   +F  +  Y  ADL+ +   GDHGDG
Sbjct  163  KRNLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDG  222

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDPSPHS--LDIRSVAIHEIGHLLGL  663
              FDG  G  AHAFSPT G  H D +ENWV   D   S  S  +D+ SVA+HEIGHLLGL
Sbjct  223  EAFDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHLLGL  282

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  A+M+       K+ +L  DDI GI+ LY
Sbjct  283  GHSSVEEAIMYPTITSRTKKVELASDDIQGIQELY  317



>ref|XP_010264870.1| PREDICTED: metalloendoproteinase 1-like [Nelumbo nucifera]
Length=318

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/280 (42%), Positives = 152/280 (54%), Gaps = 31/280 (11%)
 Frame = +1

Query  4    QGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNST  183
            +G  KGDRVKGL  +K+YL+ FGY++  + +        F   LESAI+TYQ   +L  T
Sbjct  42   EGCHKGDRVKGLNQVKRYLQRFGYLDHHNDDDDD-----FDHHLESAIKTYQLNYNLKET  96

Query  184  GILDADTVRQMTKPRCGVADIING----RPGGPSE---------------VVPNYRFYPG  306
            G LD  TV+QM  PRCGV DII G    R G   +                  +Y F+  
Sbjct  97   GSLDVATVKQMMLPRCGVPDIIKGETWMRSGKEKKEKRLLGVSGRKTTLGFSSHYTFFNN  156

Query  307  EP--KWPNQKSQLTFGFAPGTPAKFFIP---VYTALRDWHNVGHFSFQRTQ-YEHADLKF  468
             P  KWP  K  L +      P    +     Y A   W  V +F+F+ TQ    AD++F
Sbjct  157  TPTPKWPPYKMHLKYVLDSTVPVDDLLMHPLCYVAFARWAAVSNFTFEETQDLSSADIRF  216

Query  469  SLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIG  648
            S  +GDHGDG PFDGPGG  AHA++P  G  HFD++E W         +D  SVA+HEIG
Sbjct  217  SFFKGDHGDGNPFDGPGGVLAHAYAPIDGRVHFDSEERWTT-GIRADWIDTASVAMHEIG  275

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS   GAVM+   + G ++ +L PDDI GI++LY
Sbjct  276  HLLGLGHSSEHGAVMFPYIDVGSQKVNLHPDDIQGIQSLY  315



>ref|XP_002267298.2| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
Length=373

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 146/275 (53%), Gaps = 25/275 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   GD+  GL  LK+Y   FGYI++ +Y       D F D  E A++TYQ   +LN+
Sbjct  58   FAGCHAGDKADGLAKLKEYFHYFGYIHNSNYT------DDFDDAFEQALKTYQLNFNLNT  111

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG-----------GPSEVVPNYRFYPGEPKWPNQ  327
            TG LD  T+ Q+  PRCG ADI NG              G    V +Y F+ G+P WP  
Sbjct  112  TGQLDEATLNQIVSPRCGNADIENGSSSMNSGKSTPSTSGHFHTVGHYSFFDGKPVWPES  171

Query  328  KSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDG  498
            K  LT+GF P       +  V+T A   W  V   +F  +  Y  ADL+ +   GDHGDG
Sbjct  172  KRNLTYGFLPDNQLSDTVKAVFTSAFERWAAVTPLTFTESDSYYSADLRIAFYTGDHGDG  231

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDPSPHS--LDIRSVAIHEIGHLLGL  663
              FDG  G  AHAFSPT G  H D +ENWV   D   S  S  +D+ SVA+HEIGHLLGL
Sbjct  232  EAFDGVLGTLAHAFSPTNGRFHLDGEENWVATGDVTTSSISSAIDLESVAVHEIGHLLGL  291

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  A+M+       K+ +L  DDI GI+ LY
Sbjct  292  GHSSVEEAIMYPTITSRTKKVELASDDIQGIQELY  326



>ref|XP_004142468.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 ref|XP_004159089.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
 gb|KGN52406.1| hypothetical protein Csa_5G631560 [Cucumis sativus]
Length=295

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 149/267 (56%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSS------WDADYFSDQLESAIRTYQT  162
            L G +K D V+G++++KKYL+ +GY   LS+N+S+       +++ F D LESAIR YQ 
Sbjct  33   LYGCRKDDNVEGIHSIKKYLQRYGY---LSHNTSTDSNIIELNSNKFDDSLESAIRLYQK  89

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQK  330
              HLN +GI+D +T+ QM +PRCGV D+             E+  +Y  +P   KWP+ K
Sbjct  90   WSHLNVSGIIDQETLDQMFQPRCGVPDVFKFNSSKNLEDDLEMSSHYALFPNNEKWPDYK  149

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPF  507
              LT+ F    P  F   +  A+  W     F+F + +  + AD+  S    DH DG  F
Sbjct  150  RHLTYMFTNNFPIDFVPSMTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGFAF  209

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG   HAF+PT G  H D D+ W         +++ + A+HE+GH+LGL HS +P A
Sbjct  210  DGPGGVVGHAFAPTDGRLHLDGDDTW-SAGLEEKKVNVMNAALHELGHVLGLAHSTLPQA  268

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VMW   E     ++L  DDI GI ALY
Sbjct  269  VMWPYIE-SNALKNLNDDDIAGIHALY  294



>gb|KCW85819.1| hypothetical protein EUGRSUZ_B02562 [Eucalyptus grandis]
Length=374

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 150/275 (55%), Gaps = 23/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G+R  GL NLKKY + FGYI +   N +    D F D L SAI+TYQ   +L  
Sbjct  55   FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  110

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG---GPSE--------VVPNYRFYPGEPKWPNQ  327
            TG LD  T+ Q+ +PRCG  DI+NG      G +E         V +Y F+PG P+WP+ 
Sbjct  111  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  170

Query  328  KSQLTFGFAPGTP-AKFFIPVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDG  498
            KS LT+ F P    +     V++ A + W  V   +F  T  Y  AD+K     GDHGDG
Sbjct  171  KSDLTYAFLPANQLSDDEKAVFSRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGDHGDG  230

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWVDH-DPSPHSL----DIRSVAIHEIGHLLGL  663
              FDG  G  AHAFSP  G  H D DENWV   D +  SL    D+ SVA+HEIGHLLGL
Sbjct  231  EAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGHLLGL  290

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS V  ++M+       K+ DL  DD+ GI+ LY
Sbjct  291  GHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  325



>gb|KCW49213.1| hypothetical protein EUGRSUZ_K02793, partial [Eucalyptus grandis]
Length=236

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/267 (42%), Positives = 143/267 (54%), Gaps = 41/267 (15%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQ-----LESAIRTYQTR  165
            LQG  KGD   G+  LK+YL+ FGY+N   YN S     +  D      LE A++TYQ  
Sbjct  2    LQGCHKGDHTGGIRELKRYLEKFGYLN---YNQSGHPTIHADDDDFDDLLEFAVKTYQLN  58

Query  166  RHLNSTGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTF  345
             HLN TG LD  T  +M +P                            P+WP     LT+
Sbjct  59   YHLNVTGTLDPQTTSKMMRP----------------------------PRWPASNYHLTY  90

Query  346  GFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGV--PFDGP  516
            GF PGTP     PV  A   W +V  F+F   Q ++ A+++   ARGDHGDG    FDGP
Sbjct  91   GFLPGTPEAATAPVARAFAKWTSVTRFTFSYVQDHQFANIQIGFARGDHGDGAHNSFDGP  150

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPS-PHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
            GG  AHAF PT G+ H+DADE W    PS   + ++ +VA+HEIGHLLGL HS+V  A+M
Sbjct  151  GGTLAHAFPPTSGLFHYDADEKWAVDPPSGSAAFNVETVALHEIGHLLGLGHSDVEAAIM  210

Query  694  WSEFEYGQKRRDLTPDDINGIRALYHF  774
            +S    G   + L  DDI GI+ALY+F
Sbjct  211  YSSIAPGTT-KGLHADDIQGIKALYNF  236



>ref|NP_176205.1| Matrixin family protein [Arabidopsis thaliana]
 gb|AAD14473.1| Strong similarity to gi|2829864 F3I6.6 zinc metalloproteinase 
homolog from Arabidopsis thaliana BAC gb|AC002396. EST gb|Z26412 
comes from this gene [Arabidopsis thaliana]
 dbj|BAD44472.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ABF19013.1| At1g59970 [Arabidopsis thaliana]
 gb|AEE33645.1| Matrixin family protein [Arabidopsis thaliana]
Length=360

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 148/271 (55%), Gaps = 20/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+ + GL  LK+Y + FGYI      ++    D F D L+SAI TYQ   +L  
Sbjct  48   LAGCHIGENINGLSKLKQYFRRFGYIT-----TTGNCTDDFDDVLQSAINTYQKNFNLKV  102

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----GGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LD+ T+RQ+ KPRCG  D+I+G      G        Y F+PG+P+WP +K  LT+ 
Sbjct  103  TGKLDSSTLRQIVKPRCGNPDLIDGVSEMNGGKILRTTEKYSFFPGKPRWPKRKRDLTYA  162

Query  349  FAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG  519
            FAP       +  V++ A   W  V   +F R++    AD+      G+HGDG PFDG  
Sbjct  163  FAPQNNLTDEVKRVFSRAFTRWAEVTPLNFTRSESILRADIVIGFFSGEHGDGEPFDGAM  222

Query  520  GNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G  AHA SP  G+ H D DE+W+  +        P    +D+ SVA+HEIGHLLGL HS 
Sbjct  223  GTLAHASSPPTGMLHLDGDEDWLISNGEISRRILPVTTVVDLESVAVHEIGHLLGLGHSS  282

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  283  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  313



>ref|NP_001235535.1| metalloendoproteinase 1 precursor [Glycine max]
 sp|P29136.2|MEP1_SOYBN RecName: Full=Metalloendoproteinase 1; AltName: Full=SMEP1; Flags: 
Precursor [Glycine max]
 gb|AAB26959.1| metalloproteinase [Glycine max]
Length=305

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 144/259 (56%), Gaps = 14/259 (5%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            G   KGL N+K Y    GYI     N+  +D D F D L SAI+TYQ   +LN TG  D 
Sbjct  48   GQNYKGLSNVKNYFHHLGYIP----NAPHFD-DNFDDTLVSAIKTYQKNYNLNVTGKFDI  102

Query  199  DTVRQMTKPRCGVADII-NGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPGTPA--  369
            +T++Q+  PRCGV DII N        ++ +Y F+   P+W    +QLT+ F+P      
Sbjct  103  NTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEPRLDD  162

Query  370  KFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPGGNYAHAFSP  546
             F   +  A   W  V + +FQ T  YE A++K   A  +HGD  PFDGPGG   HAF+P
Sbjct  163  TFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGHAFAP  222

Query  547  TIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEY  711
            T G CHFDADE W     V   P   + D+ SVA+HEIGHLLGL HS    A+M+     
Sbjct  223  TDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPP  282

Query  712  GQKRRDLTPDDINGIRALY  768
              ++ +L  DDI+GIR LY
Sbjct  283  RTRKVNLAQDDIDGIRKLY  301



>ref|XP_008244963.1| PREDICTED: metalloendoproteinase 1 [Prunus mume]
Length=425

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 147/269 (55%), Gaps = 23/269 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            GD+V+GL  LKKY   FGYI +L  N +    D F D L+SA++TYQ   +LN TG LD 
Sbjct  110  GDKVEGLAKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  165

Query  199  DTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQLTF  345
             T++ + KPRCG  DI+NG      G PS         V +Y  +PG P WP  +  LT+
Sbjct  166  PTIQHLVKPRCGNPDIVNGTTTMNSGKPSSSNTSNLHTVAHYSTFPGTPVWPLNRRDLTY  225

Query  346  GFAPGTP-AKFFIPVYT-ALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGP  516
             F P    A     V+  A   W      +F + T +  AD+K    RGDHGDG PFDG 
Sbjct  226  AFLPENKLADDVKAVFLRAFERWSAATPLNFSETTSFYTADIKIGFFRGDHGDGEPFDGV  285

Query  517  GGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
             G  AHAFSP  G  H D DENWV            ++D+ SVA+HEIGHLLGL HS V 
Sbjct  286  LGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGHSSVE  345

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             A+M+       K+ +L  DD+ GI++LY
Sbjct  346  EAIMFPTISSRTKKVELASDDVLGIQSLY  374



>ref|XP_009360449.1| PREDICTED: metalloendoproteinase 1 [Pyrus x bretschneideri]
Length=375

 Score =   191 bits (485),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 148/271 (55%), Gaps = 26/271 (10%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L   + +   D F D LE+A++TYQT  +LN TG LD 
Sbjct  60   GEKVDGLGKLKKYFNRFGYIPNLPTANLT---DDFDDDLEAALKTYQTNFNLNVTGELDG  116

Query  199  DTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQLTF  345
             T+  + KPRCG  DI+NG      G P+         V +Y F+PG P WP  +  LT+
Sbjct  117  PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYTFFPGTPVWPQNRRDLTY  176

Query  346  GFAP----GTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFD  510
             F P      P K       A + W      +F  T  ++ AD+K    +GDHGDG PFD
Sbjct  177  AFVPENELSDPVKAVF--VGAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEPFD  234

Query  511  GPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G  G  AHAFSP  G  H D DENWV            ++D+ SVA+HEIGHLLGL HS 
Sbjct  235  GVLGTLAHAFSPPSGRFHLDGDENWVIAGDISKSSVTSAVDLESVAVHEIGHLLGLGHSS  294

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V GA+M+       K+ +L  DD+ GI++LY
Sbjct  295  VEGAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_004142460.1| PREDICTED: metalloendoproteinase 1-like [Cucumis sativus]
Length=294

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/267 (39%), Positives = 149/267 (56%), Gaps = 16/267 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSS------SWDADYFSDQLESAIRTYQT  162
            L G +KGD V+G++++KKYL+ +GY   LS+N S        +++ F D LESAI+ YQ 
Sbjct  32   LYGCRKGDNVEGIHSIKKYLQRYGY---LSHNMSIDSHIIELNSNKFDDSLESAIKLYQK  88

Query  163  RRHLNSTGILDADTVRQMTKPRCGVADIINGRPGG----PSEVVPNYRFYPGEPKWPNQK  330
              HLN +GILD +T+ QM + RCG+ D+             E+  +Y  +P   KWP+ K
Sbjct  89   WSHLNVSGILDQETLDQMFQQRCGIRDVFKFNSSKNLEDDLEMSSHYVLFPNNEKWPDYK  148

Query  331  SQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPF  507
              LT+ F    P  F   V  A+  W     F+F + +  + AD+  S    DH DG  F
Sbjct  149  RHLTYMFTNNFPVDFVPSVTEAMARWAAQSLFTFSEASDAQSADINISFQVKDHADGSAF  208

Query  508  DGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
            DGPGG   HAF+PT G  H D D++W       +  ++ +VA+HE+GH+LGL HS +P A
Sbjct  209  DGPGGVVGHAFAPTDGRLHLDGDDSW-SAGLEENKFNVMNVALHELGHVLGLAHSTLPQA  267

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VMW   +     ++L  DDI G+ ALY
Sbjct  268  VMWPYID-SNALKNLNDDDIAGLHALY  293



>ref|XP_002533939.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28446.1| Metalloendoproteinase 1 precursor, putative [Ricinus communis]
Length=226

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 133/224 (59%), Gaps = 17/224 (8%)
 Frame = +1

Query  142  AIRTYQTRRHLNSTGILDADTVRQMTKPRCGVADII--NG-------RPGGPSEVVPNYR  294
            AIR YQ   HL  TGILD  TV QM KPRCG+ D++  NG       R       + +Y+
Sbjct  2    AIRNYQHNYHLKDTGILDNYTVSQMMKPRCGMPDVVTNNGTKHQSHNRKLMSIHSLVHYK  61

Query  295  FYPGEPKWPNQKSQLTFGF-----APGTPAKFFIPVYTALRDWHNVGHFSFQRTQYE-HA  456
            F+ GEP+WP +++ L + F      PGT     I    A + W  V HF+F+       A
Sbjct  62   FFHGEPRWPAERTHLRYRFRSSTQVPGTQNIGSICA-RAFQKWAEVTHFTFEEVASNAQA  120

Query  457  DLKFSLARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAI  636
            +++    R  HGDG PFDG  G  AHA +PT G+ HFD DENW + +P  + +D+ SVA+
Sbjct  121  EIEIGFHRRSHGDGHPFDGRSGTLAHATAPTGGMFHFDGDENWSE-NPEANEVDLESVAV  179

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS+ P AVM++ F YG  +RDL  DD+ GIRALY
Sbjct  180  HEIGHLLGLHHSDDPNAVMYATFRYGITKRDLDSDDVQGIRALY  223



>ref|XP_010913461.1| PREDICTED: metalloendoproteinase 1-like [Elaeis guineensis]
Length=366

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 144/270 (53%), Gaps = 20/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G  +GD   GL +LK YL  FGY+   ++       D F + LE A++TYQ    LN+
Sbjct  53   LSGCHRGDNRTGLADLKDYLSRFGYLPTANFT------DAFDEALEEALKTYQQNFGLNA  106

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN---YRFYPGEPKWPNQKSQLTFGF  351
            TG LD  TV Q+  PRCGVADIING     S  +P    Y ++PG P WP+ K  LT+  
Sbjct  107  TGSLDDSTVSQLIIPRCGVADIINGTSSMRSAKLPGRNLYAYFPGSPTWPSWKRDLTYAL  166

Query  352  APGTPAKF----FIPVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDG  513
               +           V+  A   W      +F  +     AD++     GDHGDG PFDG
Sbjct  167  VSTSAVSIDTSALRTVFARAFGRWAAATTLTFTESDSVSDADIQIGFYSGDHGDGEPFDG  226

Query  514  PGGNYAHAFSPTIGICHFDADENWV-DHDPSPHS----LDIRSVAIHEIGHLLGLDHSEV  678
              G  AHAFSPT G  H DA E WV D D +  S    +D+ SVA+HEIGHLLGL HS V
Sbjct  227  VLGTLAHAFSPTDGRFHLDAAEQWVADGDVTQASSNVAVDLESVAVHEIGHLLGLGHSSV  286

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
              A+M+   +   K+ +L  DD+ GI+ LY
Sbjct  287  EEAIMYPTIKTKTKKVELASDDVEGIQNLY  316



>ref|XP_007219827.1| hypothetical protein PRUPE_ppa026649mg, partial [Prunus persica]
 gb|EMJ21026.1| hypothetical protein PRUPE_ppa026649mg, partial [Prunus persica]
Length=344

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 152/273 (56%), Gaps = 36/273 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADY-FSDQLESAIRTYQTRRHLN  177
            L+G  KG  V GL  LKKYL  FGY+N   Y+ S    D  F D LESAI++YQ   HL 
Sbjct  89   LEGCHKGQNVSGLQELKKYLTKFGYLN---YDHSKHANDEEFDDILESAIKSYQKSYHLK  145

Query  178  STGILDADTVRQMTKPRCGVADIINGRPGGPSEV---------VPNYRFYPGEPKWPNQK  330
             TG LD  T +QM  PRCGV D++NG   G  +          V +Y F+PG  +W   K
Sbjct  146  VTGTLDTTTGKQMMMPRCGVPDVVNGTRKGSKKHNHKHKSIHGVAHYEFFPGPRRW--SK  203

Query  331  SQLTFGFA------PGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDH  489
            + LT+ F+      PGT  +           W  V  F+F+       AD+     RG+H
Sbjct  204  THLTYRFSSSVNQVPGTQNR-----------WAQVTSFTFEEVPATSAADITIGFHRGNH  252

Query  490  GDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            GDG  FDGP G +AHA  P  G  H+DADE W   +P P+ +D+ SVA+HEIGHLLGL+H
Sbjct  253  GDGSAFDGPRGTFAHANPPRGGNFHYDADERWSS-NPGPNEVDLESVAVHEIGHLLGLNH  311

Query  670  S-EVPGAVMWSEFEYGQKRRDLTPDDINGIRAL  765
            + ++P A+M+  F YG  +R+L  DD NG+  L
Sbjct  312  NPDLPDAIMYPYFNYGSIKRNLHRDD-NGMLTL  343



>ref|XP_006300514.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
 gb|EOA33412.1| hypothetical protein CARUB_v10020497mg [Capsella rubella]
Length=370

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 146/274 (53%), Gaps = 26/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G + G+++ GL  LK+Y   FGYI  +   +     D F D L+SAI TYQ   +L  
Sbjct  53   LAGCQIGEKIDGLSKLKQYFHRFGYITTIKNCT-----DDFDDALQSAINTYQKNFNLKV  107

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LD+ T+RQ+ KPRCG  D+I+G      G        Y F+PG+P+WP +K  LT+ 
Sbjct  108  TGKLDSFTLRQIVKPRCGNPDMIDGFSEMNGGRKLRTTERYSFFPGKPRWPKRKRDLTYA  167

Query  349  FAPGT-----PAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
            F P         + F   +T    W  V   +F R++    AD+      G+HGDG PFD
Sbjct  168  FLPQNNLTDEVKRVFARAFTR---WAEVTPLNFARSESLRGADIFIGFFSGEHGDGEPFD  224

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLD  666
            G  G  AHA SP  G+ H D DE+W+  D        P    +D+ SV +HEIGHLLGL 
Sbjct  225  GAMGTLAHASSPPTGMLHLDGDEDWLISDGAISRRILPVTTVVDLESVVVHEIGHLLGLG  284

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  285  HSSVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  318



>ref|XP_008353003.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=377

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 145/269 (54%), Gaps = 22/269 (8%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L   + +   D F   LE+A++TYQ   +LN TG LD 
Sbjct  60   GEKVDGLSKLKKYFNRFGYIPNLPTTNLT---DDFDGDLEAALKTYQKNFNLNVTGELDG  116

Query  199  DTVRQMTKPRCGVADIING----RPGGPSEV-------VPNYRFYPGEPKWPNQKSQLTF  345
             T+  + KPRCG ADI+NG      G P+         V +Y F+PG P WP  +  LT+
Sbjct  117  PTLEHLVKPRCGNADIVNGTTTMNSGKPASYNSTKFHSVSHYSFFPGTPVWPQNRRDLTY  176

Query  346  GFAPGTPAKFFIPVY--TALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGP  516
             F P       +      A + W      +FQ T  +  AD+K     GDHGDG PFDG 
Sbjct  177  AFLPENELSDEVKTVFVGAFQRWSAATPLTFQETTSFYSADIKIGFFVGDHGDGEPFDGV  236

Query  517  GGNYAHAFSPTIGICHFDADENWV-DHDPSPHS----LDIRSVAIHEIGHLLGLDHSEVP  681
             G  AHAFSP  G  H D DENWV   D S  S    +D+ SVA+HEIGHLLGL HS V 
Sbjct  237  LGTLAHAFSPPSGRFHLDGDENWVITGDISKFSVESAVDLESVAVHEIGHLLGLGHSSVE  296

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             A+M+       K+ +L  DD+ GI+ LY
Sbjct  297  DAIMYPTISSRTKKVELASDDVLGIQTLY  325



>ref|XP_002888162.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64421.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=351

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 146/274 (53%), Gaps = 26/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+ + GL  LK+Y + FGYI   +  +     D F D L+SAI TYQ   +L  
Sbjct  37   LAGCHIGENINGLSKLKQYFRRFGYITGTNNCT-----DDFDDVLQSAINTYQKNFNLKV  91

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LD+ T+RQ+ KPRCG  D+I+G      G        Y F+PG+P+WP +K  LT+ 
Sbjct  92   TGKLDSSTLRQIVKPRCGNPDMIDGVSEMNGGKKLRATERYSFFPGKPRWPKRKRDLTYA  151

Query  349  FAPGT-----PAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
            + P         + F   +T    W  V   +F R++    AD+      G+HGDG PFD
Sbjct  152  YVPQNNLTDEVKRVFARAFTR---WAEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFD  208

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLD  666
            G  G  AHA SP  G+ H D DE+W+  D        P    +D+ SVA+HEIGHLLGL 
Sbjct  209  GAMGTLAHASSPPTGMLHLDGDEDWLISDGEISRRVLPVTSVVDLESVAVHEIGHLLGLG  268

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  269  HSSVEDAIMFPAISGGDRKVELAKDDIEGIQHLY  302



>ref|XP_006603838.1| PREDICTED: metalloendoproteinase 1-like [Glycine max]
 gb|KHN16354.1| Metalloendoproteinase 1 [Glycine soja]
Length=328

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 157/291 (54%), Gaps = 39/291 (13%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+   KG RV+G+  LK YLK FGY   L+ N +S + ++F   +E A++ YQ   HL  
Sbjct  42   LKDINKGQRVRGVGELKSYLKKFGY---LTTNDNSSNNNHFDKNVEFALKEYQVFHHLRP  98

Query  181  TGILDADTVRQMTKPRCGVADII---NGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGF  351
            TG +DA+T+++M  PRCGV DII   N +  G   ++ NY F+ G PKW   K  LT+ F
Sbjct  99   TGRVDAETIKRMGLPRCGVPDIITPQNHKLKGLV-ILANYSFFSGSPKWEESKRALTYTF  157

Query  352  APGTPAKFFIPVYTALRD----WHNVGHFSFQRTQYEH---ADLKFSLARGDHGDGVPFD  510
                       V  A R+    W    +F+F     E+   A++     RGDHGDG PFD
Sbjct  158  VSSANVLRMYDVRLATRNAFQSWARASNFTFMEMPSEYNNLANIVLGFHRGDHGDGYPFD  217

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHDP-----------------------SPHSLDI  621
            GPG   AH F+P  G  HFDADE W                            S  ++D+
Sbjct  218  GPGQVLAHTFAPQDGRLHFDADEPWSIESTSWNVGPGWNVGWDWRRWVRPRWQSRRTIDL  277

Query  622  RSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            ++VA+HEIGHLLGL HS VPG++M+  +E    +RDLT DD++GIRALY  
Sbjct  278  QTVALHEIGHLLGLGHSNVPGSIMYPSYE--GVKRDLTQDDVDGIRALYRL  326



>ref|XP_010553642.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=375

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 148/284 (52%), Gaps = 31/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GDRV GL  LK+Y + FGYI   +  + +   D F D LESAIR YQ    L  
Sbjct  47   LAGCHAGDRVSGLSKLKQYFRRFGYITTAATGNFT---DDFDDVLESAIRIYQKNFDLKV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRP--------------GGPSEV--VPNYRFYPGEP  312
            TG LDA T+RQ+  PRCG +D+I+G                 G + +     Y F+PG+P
Sbjct  104  TGELDAATLRQIVLPRCGNSDVIDGSSDMNAGKGFQKTAMTAGAARIRTTKRYSFFPGKP  163

Query  313  KWPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARG  483
            +WP +K  L + F P       +  V++ A   W NV    F R+     AD+      G
Sbjct  164  RWPARKRDLIYAFVPQNNLTEDVKRVFSRAFDRWANVTPLRFTRSGSLLRADIVIGFFSG  223

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHS---------LDIRSVAI  636
            DHGDG PFDG  G  AHA SP  G+ H D DE+W+  D    +         +D+ SVA+
Sbjct  224  DHGDGEPFDGAMGTLAHASSPPTGMFHLDGDEDWLISDGGGENRRILSVTSLVDLESVAV  283

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  284  HEIGHLLGLGHSSVKDAIMYPTIAGGDRKVELAKDDIEGIQHLY  327



>ref|XP_010552627.1| PREDICTED: metalloendoproteinase 1 [Tarenaya hassleriana]
Length=376

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/281 (40%), Positives = 147/281 (52%), Gaps = 28/281 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + GD+V GLY LK+Y + FGYI +   N S    D F D L  AI  YQ    LN 
Sbjct  49   FTGCRSGDKVDGLYKLKQYFQRFGYIPE---NFSGNFTDDFDDILRHAIEMYQRNFRLNV  105

Query  181  TGILDADTVRQMTKPRCGVADIING----------------RPGGPSEVVPNYRFYPGEP  312
            +G LD  TVR +  PRCG  DI+NG                R G     +  Y  +PGEP
Sbjct  106  SGELDELTVRHLVIPRCGNPDIVNGSSAMHGGKKYEVNFAGRRGQRFHALKRYSLFPGEP  165

Query  313  KWPNQKSQLTFGFAPGTPAKFFIP-VY-TALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
            +WP  + QLT+ F P       +  V+  A   W  V   +F R + +  +D+      G
Sbjct  166  RWPEDRRQLTYAFDPRNALTEEVKGVFGRAFARWAAVTKLTFTRVETFPDSDITIGFYTG  225

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHD------PSPHSLDIRSVAIHEI  645
            DHGDG PFDG  G  AHAFSP  G  H D+DENWV             ++D+ SVA+HEI
Sbjct  226  DHGDGEPFDGVLGTLAHAFSPPSGRFHLDSDENWVVSGDVGGILSMTSAVDLESVAVHEI  285

Query  646  GHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GHLLGL HS +  ++M+     G+++ +LT DDI+GI+ LY
Sbjct  286  GHLLGLGHSTIEDSIMYPTISTGRRKVELTRDDIDGIQYLY  326



>dbj|BAE98757.1| predicted GPI-anchored protein [Arabidopsis thaliana]
Length=378

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 152/280 (54%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQT  +LN 
Sbjct  47   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---GGPSEV------------VPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG     GG  +             V  Y  +PGEP+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  316  WPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            WP  +  LT+ F P  P    +  V++ A   W +V   +F  ++ +  +D+      GD
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>gb|ACU20327.1| unknown [Glycine max]
Length=305

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 143/259 (55%), Gaps = 14/259 (5%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            G   KGL N+K Y    GYI     N+  +D D F D L SAI+TYQ   +LN TG  D 
Sbjct  48   GQNYKGLSNVKNYFHHLGYIP----NAPHFD-DNFDDTLVSAIKTYQKNYNLNVTGKFDI  102

Query  199  DTVRQMTKPRCGVADII-NGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPGTPA--  369
            +T++Q+  PRCGV DII N        ++ +Y F+   P+W    +QLT+ F+P      
Sbjct  103  NTLKQIMTPRCGVPDIIINTNKTTSFGMISDYTFFKDMPRWQAGTTQLTYAFSPEPRLDD  162

Query  370  KFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPGGNYAHAFSP  546
             F   +  A   W  V + +FQ T  YE A++K   A  +HGD  PFDGPGG   HAF+P
Sbjct  163  TFKSAIARAFSKWTPVVNIAFQETTSYETANIKILFASKNHGDPYPFDGPGGILGHAFAP  222

Query  547  TIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEY  711
            T G CHFDADE W     V   P   + D+ SVA+HEIGHLLGL HS    A+M+     
Sbjct  223  TDGRCHFDADEYWVASGDVTKSPVTSAFDLESVAVHEIGHLLGLGHSSDLRAIMYPSIPP  282

Query  712  GQKRRDLTPDDINGIRALY  768
              ++ +L  D I+GIR LY
Sbjct  283  RTRKVNLAQDGIDGIRKLY  301



>emb|CDY45157.1| BnaA09g14350D [Brassica napus]
Length=354

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 145/272 (53%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI TYQ   +L  
Sbjct  50   LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAITTYQKNFNLKV  105

Query  181  TGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTF  345
            TG LDA T+ Q+ KPRCG  D+I+G       G     V  Y F+PG+P+WP +   L++
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKLRTVARYSFFPGKPQWPKRNRDLSY  165

Query  346  GFAP-GTPAKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGP  516
             F P     +    V+  A   W +V   +F R++    AD+      GDHGDG PFDGP
Sbjct  166  AFFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGP  225

Query  517  GGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLDHS  672
             G  AHA SP  G+ H D DE+W+           P    +D+ SVA+HEIGHLLGL HS
Sbjct  226  MGTLAHASSPPTGMFHLDGDEDWLISGEDVSRQILPVTSVVDLESVAVHEIGHLLGLGHS  285

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  286  SVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  317



>ref|NP_177174.1| matrix metalloproteinase [Arabidopsis thaliana]
 gb|AAB61099.1| Similar to Glycine metalloendoproteinase (gb|U63725) [Arabidopsis 
thaliana]
 gb|AEE35027.1| matrix metalloproteinase [Arabidopsis thaliana]
Length=378

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 152/280 (54%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQT  +LN 
Sbjct  47   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQTNFNLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---GGPSEV------------VPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG     GG  +             V  Y  +PGEP+
Sbjct  104  TGELDALTIQHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  316  WPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            WP  +  LT+ F P  P    +  V++ A   W +V   +F  ++ +  +D+      GD
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSESFSTSDITIGFYTGD  223

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>ref|XP_009113266.1| PREDICTED: metalloendoproteinase 1 [Brassica rapa]
Length=394

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 145/272 (53%), Gaps = 20/272 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI TYQ   +L  
Sbjct  90   LTGCHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLQSAISTYQKNFNLKV  145

Query  181  TGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTF  345
            TG LDA T+ Q+ KPRCG  D+I+G       G     V  Y F+PG+P+WP +   L++
Sbjct  146  TGKLDASTLGQIVKPRCGNPDMIDGTTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSY  205

Query  346  GFAP-GTPAKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGP  516
             F P     +    V+  A   W +V   +F R++    AD+      GDHGDG PFDGP
Sbjct  206  AFVPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGP  265

Query  517  GGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLDHS  672
             G  AHA SP  G+ H D DE+W+           P    +D+ SVA+HEIGHLLGL HS
Sbjct  266  MGTLAHASSPPTGMFHLDGDEDWLISGEDMSRQILPVTSVVDLESVAVHEIGHLLGLGHS  325

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  326  SVEDAIMYPAISGGHRKVELAKDDIEGIQHLY  357



>ref|XP_004504503.1| PREDICTED: metalloendoproteinase 1-like [Cicer arietinum]
Length=374

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 144/284 (51%), Gaps = 34/284 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G    GL  LK Y + FGYI +   ++ +   D F D LESA+R YQ   +LN 
Sbjct  54   FTGCSPGKTYDGLSKLKNYFQRFGYITNAPPSNFT---DDFDDALESAVRAYQQNFNLNV  110

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-----------------EVVPNYRFYPGE  309
            TG LD  T+  + KPRCGVADIING     S                   V +Y F+PGE
Sbjct  111  TGELDNATMNYIVKPRCGVADIINGTTSMNSGKFNFNNTSENKENPKFHTVAHYSFFPGE  170

Query  310  PKWPNQKSQLTFGFAPG-----TPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFS  471
            P+WP     LT+ F P      T  + F     A   W  V   +F + T +  AD+K  
Sbjct  171  PRWPAGTKSLTYAFDPNENLDETTKQVFA---NAFNQWSKVTTITFSETTSFSTADIKIG  227

Query  472  LARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAI  636
               GDHGDG  FDG  G  AHAFSPT G  H D  E+W     V      +++D+ SVA+
Sbjct  228  FYSGDHGDGEAFDGVLGTLAHAFSPTDGRFHLDKAEDWVVSGDVTESTLSNAVDLESVAV  287

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS V  A+M+       ++ +L  DDI+GI+ LY
Sbjct  288  HEIGHLLGLGHSSVEEAIMYPTISSKTRKVELVNDDIDGIQQLY  331



>gb|ACJ24812.1| matrix metalloproteinase [Pinus taeda]
Length=364

 Score =   187 bits (476),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/267 (39%), Positives = 154/267 (58%), Gaps = 18/267 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L  + KGDR++GL +LK+Y + FGY++  + N+ + D   F + +ESA+RTYQ    LN 
Sbjct  59   LTNACKGDRMQGLPDLKRYFRRFGYLS--AQNNVTED---FDEAVESAVRTYQKNFGLNV  113

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG+LD  T+ Q+  PRCG  DIING        +  + F+PG P+W   K  L++ F+P 
Sbjct  114  TGVLDEATISQLMVPRCGREDIINGSSAMRGRGL--FPFFPGSPRWGPDKRVLSYAFSPD  171

Query  361  -------TPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGP  516
                   + A+    V  A + W +V   +F + + Y  AD+K     GDHGDG PFDGP
Sbjct  172  HEVLSEISLAELSTVVGRAFKRWADVIPITFTESSDYSSADIKVGFYSGDHGDGHPFDGP  231

Query  517  GGNYAHAFSPTIGICHFDADENW---VDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
             G  AH+FSP  G  H DA E+W   +  D +  ++D+ S+A HEIGHLLGL H+    A
Sbjct  232  LGTLAHSFSPPDGRFHLDAAESWTVDLSSDSAATAIDLESIATHEIGHLLGLGHTTEKAA  291

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALY  768
            VM+       ++ DL  DD++G++ +Y
Sbjct  292  VMYPSIAPRTRKVDLVLDDVDGVQYVY  318



>gb|KDO75343.1| hypothetical protein CISIN_1g043086mg [Citrus sinensis]
Length=257

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 137/230 (60%), Gaps = 27/230 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSW--DADYFSDQLESAIRTYQTRRHL  174
             QG++KGD VKG+  LKKYL T GY+++ ++N ++   D DYF + LESA++TYQ   +L
Sbjct  46   FQGTQKGDTVKGINALKKYLHTLGYLSNHNHNHAAAAADGDYFDENLESAVKTYQRNFNL  105

Query  175  NSTGILDADTVRQMTKPRCGVADIINGRP---GGPSEVVPNYRFYPGEPKWPNQKSQLTF  345
            N TG +D  TV  M KPRCGV D+ING     GGP+    +Y FYPG PKWP  K  ++ 
Sbjct  106  NPTGHMDLKTVSMMGKPRCGVPDVINGTTRMQGGPAHYHTHYVFYPGRPKWPATKQIISC  165

Query  346  GFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFDGPG--  519
             F PGT                       Q   Y+ AD+K S  RGDHGDG PFDGPG  
Sbjct  166  AFLPGTRT-------------------DVQEPDYDAADVKISFQRGDHGDGYPFDGPGPY  206

Query  520  GNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDH  669
               AH+F PT G  H+D DENW      P ++D+++VA+HE+ H+LGL H
Sbjct  207  NLLAHSFPPTDGRFHYDGDENWTV-GAVPGAVDMQTVALHELRHVLGLAH  255



>ref|XP_008458914.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   186 bits (472),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 150/271 (55%), Gaps = 23/271 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L GS K D  V+G++ +K YL+ +GY N+ + N+ S DA  F D+LESAI+ YQ   +L 
Sbjct  40   LIGSSKNDNIVEGIHKVKAYLQRYGYFNNENDNNLSTDA--FDDRLESAIKLYQKFSNLK  97

Query  178  STGILDADTVRQMTKPRCGVADII-------------NGRPGGPSEVVPNYRFYPGEPKW  318
             +G+LD +T++QM+KPRCGV D               N   GG       Y F+     W
Sbjct  98   VSGVLDRETLQQMSKPRCGVRDTFASIAQQEHENKNTNIEIGGS-----RYTFFFNNVSW  152

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGD  495
            P ++  L++GF    P +F  P+  A + W +   FSF    + + AD+  S  RG HGD
Sbjct  153  PAERKHLSYGFIHNYPPQFVDPLLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGAHGD  212

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
               FDG GG  AH+     G  HFDADE W +  P    +D+ SVA+HE+GH LGL HS 
Sbjct  213  YQAFDGEGGILAHSLGAIDGRVHFDADEAW-ERIPIEQRVDLESVALHELGHTLGLGHSS  271

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
               AVM++  E G  +  LT DDI GIRALY
Sbjct  272  EISAVMFAYMEPGLYKTRLTIDDIEGIRALY  302



>dbj|BAJ94792.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92632.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/271 (41%), Positives = 140/271 (52%), Gaps = 17/271 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GD   GL  LK YL  FGY+++    +SS  +D F  +LE+A+ TYQ    LN+
Sbjct  51   LSGCHMGDERDGLARLKDYLSHFGYLSEAP--TSSPFSDAFDAELEAAVATYQRNFGLNA  108

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN------YRFYPGEPKWPNQKSQLT  342
            TG+LD  TV QM  PRCGVAD+ING                 Y ++PG P WP  + +L 
Sbjct  109  TGVLDPPTVSQMVAPRCGVADVINGTSTMDRNASAAGHGRHLYTYFPGGPMWPPFRRELR  168

Query  343  FGFAPGTP-----AKFFIPVYTALRDWHNVGHFSFQRTQYEH-ADLKFSLARGDHGDGVP  504
            +            A        A   W +     F     E  AD+      G HGDG  
Sbjct  169  YAITATAATSIDRATLGAVFARAFARWSDATTLRFAEAASESDADITIGFYAGSHGDGEA  228

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWVDHDP---SPHSLDIRSVAIHEIGHLLGLDHSE  675
            FDGP G  AHAFSPT G  H DA E WV       +P ++D+ SVA+HEIGHLLGL HS 
Sbjct  229  FDGPLGTLAHAFSPTDGRFHLDAAEAWVADGQGGDAPGAVDLESVAVHEIGHLLGLGHSS  288

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V GA+M+     G ++ DL  DD+ GI++LY
Sbjct  289  VQGAIMYPTIRTGTRKVDLESDDVQGIQSLY  319



>emb|CBI34986.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/265 (43%), Positives = 154/265 (58%), Gaps = 11/265 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSW--DADYFSDQLESAIRTYQTRRHL  174
            LQGSKKGD+V+G++ ++ YL+ FGY++     + S     D+F D LESAI+ +QT  HL
Sbjct  39   LQGSKKGDKVEGIHKVRNYLQRFGYLSSTHSKTESQVDGDDHFDDDLESAIQAFQTYYHL  98

Query  175  NSTGILDADTVRQMTKPRCGVAD----IINGRPGGPS--EVVPNYRFYPGEPKWPNQKSQ  336
              TGILDA T   M++PRCGV D      N    G S   +  ++ F+P  P+WP  ++ 
Sbjct  99   KPTGILDAPTAALMSRPRCGVPDNPSVTNNTNSHGHSHLNIGTHFAFFPNNPRWPPGQTH  158

Query  337  LTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDG  513
            L +    G+ ++    V  A   W  +  F+F++T     A+L  S    +HGDG PFDG
Sbjct  159  LLYVLDSGSHSEAADAVGKAFGAWAAISKFTFEQTSDPTVANLNISFQIREHGDGSPFDG  218

Query  514  PGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
            PGG  AHA  PT G  HFD DE WV      +S+D+++VA HEIGHLLGL HS V  A+M
Sbjct  219  PGGTIAHAAPPTDGRFHFDGDETWVV-GAVANSIDLQTVATHEIGHLLGLAHSSVEAAIM  277

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            ++    G   + L  DDI GI ALY
Sbjct  278  FAYIAPG-ATKGLNQDDIAGITALY  301



>gb|KFK40830.1| hypothetical protein AALP_AA2G047000 [Arabis alpina]
Length=364

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 147/274 (54%), Gaps = 22/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GD++ GL  LK+Y   FGY+   +   ++   D F D L+SAI TYQ   +L  
Sbjct  46   LAGCHVGDKIDGLSKLKQYFHRFGYLTTTTTAGTN-FTDDFDDILQSAINTYQKNFNLKV  104

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LDA T+RQ+ KPRCG  D+I+G      G        Y F+PG+P+WP +K  LT+ 
Sbjct  105  TGNLDASTLRQIVKPRCGNPDMIDGVSEMNAGRKLRTTERYSFFPGKPRWPKRKRDLTYA  164

Query  349  FAPGT-----PAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFD  510
            F P         + F   +T    W  V   +F R++    AD+      G+HGDG PFD
Sbjct  165  FVPQNNLTDEVKRVFARAFTR---WSEVTPLNFTRSESILRADIVIGFFAGEHGDGEPFD  221

Query  511  GPGGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLD  666
            G  G  AHA SP  G+ H D DE+W+  +        P    +D+ SVA+HEIGHLLGL 
Sbjct  222  GAMGTLAHASSPPTGMFHLDGDEDWLISEDEISRGILPVTSVVDLESVAVHEIGHLLGLG  281

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS V  ++M+     G ++ +L  DDI GI+ LY
Sbjct  282  HSSVEDSIMYPAIAGGDRKVELGKDDIEGIQHLY  315



>ref|XP_008458912.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/271 (41%), Positives = 150/271 (55%), Gaps = 23/271 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L GS K D  V+G++ +K YL+ +GY+++ + N+ S DA  F D LESAI++YQ    + 
Sbjct  40   LIGSSKNDSIVEGIHKVKAYLQRYGYLSNENENNLSTDA--FDDDLESAIKSYQKFSKIK  97

Query  178  STGILDADTVRQMTKPRCGVADII-------------NGRPGGPSEVVPNYRFYPGEPKW  318
             +G+LD +T++QM+ PRCGV D               N   GG      +Y FY    KW
Sbjct  98   VSGVLDRETLQQMSTPRCGVRDTFVSVAQQEHENKSTNIEIGGS-----HYTFYYNNVKW  152

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGD  495
            P +K  L++GF    P +    V  A + W +   FSF    + + AD+  S  RG+HGD
Sbjct  153  PAEKKHLSYGFIHNFPPQHVPTVLRAFQTWEDNTKFSFFLAPRVQTADILVSFERGEHGD  212

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
              PFDGPGG  AH+     G  HFDADE W +  P     D+ ++A+HE+GH LGL HS 
Sbjct  213  DEPFDGPGGILAHSLGAVDGRVHFDADEQW-EGGPVEKRYDLETLALHELGHALGLGHSS  271

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
               AVMW+    G  +  LT DDI GIRALY
Sbjct  272  SSLAVMWAYMYAGFPKTRLTIDDIEGIRALY  302



>ref|XP_006304956.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
 gb|EOA37854.1| hypothetical protein CARUB_v10011449mg [Capsella rubella]
Length=381

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 149/282 (53%), Gaps = 29/282 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G++  GLY LK+Y + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  49   FTGCHAGNKYDGLYKLKQYFQHFGYIPE---TFSGNFTDDFDDILKNAVEMYQRNFRLNV  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----------------GGPSEVVPNYRFYPGEP  312
            TG+LD  T++Q+  PRCG  D++NG                  G     V  Y F+PGEP
Sbjct  106  TGVLDELTLKQVVIPRCGNPDVVNGTSTMHSGRRTYEVSFSGGGQRFHAVKRYSFFPGEP  165

Query  313  KWPNQKSQLTFGFAP-GTPAKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
            +WP  +  LT+ F P     +    V++ A   W  V   +F R + + ++D+      G
Sbjct  166  RWPRHRRDLTYAFNPRNMLTEEVKTVFSRAFARWAEVTPLTFTRVESFSNSDIFIGFYSG  225

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-------PHSLDIRSVAIHE  642
            +HGDG PFDGP    AHAFSP  G  H D +ENW+            P ++D+ SVA+HE
Sbjct  226  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDREENWIISGEGGDGVISVPEAVDLESVAVHE  285

Query  643  IGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            IGHLLGL HS V G++M+     G+++ DLT DD+ G++ LY
Sbjct  286  IGHLLGLGHSSVEGSIMYPTIMTGKRKVDLTTDDVEGVQYLY  327



>gb|EYU46223.1| hypothetical protein MIMGU_mgv1a025538mg [Erythranthe guttata]
Length=293

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/257 (42%), Positives = 150/257 (58%), Gaps = 10/257 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G+ KGD+ KGL  LK+YLK  GYIN     ++ +D D+F D LE AI+ YQ   ++  
Sbjct  44   LSGTHKGDKSKGLNKLKEYLKNLGYINS-KIPTNKYD-DFFDDTLELAIKKYQEFYNIKI  101

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGFAPG  360
            TG LD +TV  M KPRCGVAD++      P     N   Y     WP  K  LT+     
Sbjct  102  TGFLDPETVTLMLKPRCGVADLLTTN-RTPFRSYYNLSGY----SWPPNKRNLTYSLPKD  156

Query  361  TPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPGGNYAHA  537
            T    + P+  AL  W +V  F+F  T  +E++D+K S    DHGDG PFDGP G   H+
Sbjct  157  TRKDAYTPIVKALIKWVSVSPFNFTFTDDFENSDVKISFETRDHGDGYPFDGPYGVLGHS  216

Query  538  FSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEYGQ  717
            F PT G  HFDA+ENW     +  S  + +VA+HE+GH+LGL HS+   ++M++    G+
Sbjct  217  FYPTDGRLHFDAEENWKPFAEA-GSFYLGTVALHELGHILGLAHSQDEKSIMYAYIGEGE  275

Query  718  KRRDLTPDDINGIRALY  768
              +DLT DDI+GI+++Y
Sbjct  276  -NKDLTQDDIHGIKSIY  291



>ref|XP_008798076.1| PREDICTED: metalloendoproteinase 1-like, partial [Phoenix dactylifera]
Length=410

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 142/270 (53%), Gaps = 20/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+   GL +LK YL  FGY+   ++       D F D LE A+RTYQ    LN+
Sbjct  48   LSGCHPGENRAGLADLKDYLSRFGYLPTSNFT------DAFDDALEEALRTYQQNFGLNA  101

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN---YRFYPGEPKWPNQKSQLTFGF  351
            TG LD  TV Q+  PRCGVADI+NG     S  +P    Y ++PG P WP+ K  LT+  
Sbjct  102  TGSLDDSTVNQLIIPRCGVADIVNGTSSMRSAKLPGRNLYAYFPGNPTWPSWKRDLTYAL  161

Query  352  APGTPAKFFIPVYT-----ALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDG  513
               +         +     A   W      +F  T     AD+K     GDHGDG PFDG
Sbjct  162  VSTSAVSIDTSAISTVFARAFGRWSAATTLTFTETDSASDADIKIGFYSGDHGDGEPFDG  221

Query  514  PGGNYAHAFSPTIGICHFDADENWV-DHDPSPHS----LDIRSVAIHEIGHLLGLDHSEV  678
              G  AHAFSPT G  H DA E WV D D +  S    +D+ SVA+HEIGHLLGL HS  
Sbjct  222  VLGTLAHAFSPTDGRFHLDAAEQWVADGDVTEASSSVAVDLESVAVHEIGHLLGLGHSSE  281

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
              A+M+   +   K+ +L  DD++GI+ LY
Sbjct  282  AEAIMYPTIKTRTKKVELASDDVDGIQNLY  311



>gb|AES96374.2| matrix metalloproteinase [Medicago truncatula]
Length=368

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 142/277 (51%), Gaps = 27/277 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G  +G    GL  LK Y   FGYI +      S   D F + LESA+RTYQ   +LN 
Sbjct  55   FTGCSRGKTYDGLSKLKNYFNHFGYIPN---GPPSNFTDDFDEALESAVRTYQKNFNLNI  111

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS----------EVVPNYRFYPGEPKWPNQK  330
            TG LD  T+  + KPRCGVADIING     S            V +Y F+PG+P+WP   
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  331  SQLTFGFAPG-----TPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHG  492
              LT+ F P         + F     A   W  V   +F + T Y  +D+K     GDHG
Sbjct  172  QTLTYAFDPSENLDDATKQVFA---NAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDHG  228

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENW-VDHDPSPHSL----DIRSVAIHEIGHLL  657
            DG  FDG  G  AHAFSPT G  H D  E+W V+ D +  SL    D+ SV +HEIGHLL
Sbjct  229  DGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGHLL  288

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS +  A+M+       K+ +L  DDI GI+ LY
Sbjct  289  GLGHSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_004965108.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=368

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 143/274 (52%), Gaps = 26/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +G+  LK YL  FGY+ + S  +  +DAD     LE AI+ YQ    LN 
Sbjct  53   LTGCHFGEEQQGVAKLKDYLAHFGYLPESSGFTDIFDAD-----LEEAIKVYQRNFGLNI  107

Query  181  TGILDADTVRQMTKPRCGVADIINGRP--GGPSEVVPN--YRFYPGEPKWPNQKSQLTFG  348
            TG++DA TV QM  PRCGVAD+ING    G  S       Y ++PG P WP  K +LT+ 
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNLYSYFPGSPSWPRSKKRLTYA  167

Query  349  FAP--------GTPAKFFIPVYTALRDWHNVGHFSFQRTQYEH-ADLKFSLARGDHGDGV  501
                        T ++ F     A   W      +F  T     AD+      GDHGDG 
Sbjct  168  ITDTAATTIDRATLSRVFA---RAFARWSAATTLNFTETASARDADITIGFHAGDHGDGE  224

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLD  666
             FDGP G  AHAFSPT G  H DA E WV         S  ++D+ SVA+HEIGHLLGL 
Sbjct  225  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVAAGDVSRASSDVAVDLESVAVHEIGHLLGLG  284

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS  PGA+M+       ++ DL  DD+ GI++LY
Sbjct  285  HSSEPGAIMYPTITSRTRKVDLASDDVVGIQSLY  318



>gb|AAC00572.1| similar to zinc metalloproteinases [Arabidopsis thaliana]
Length=377

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 147/282 (52%), Gaps = 28/282 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G +  GLY LK+Y + FGYI +   N S    D F D L++A+  YQ    LN 
Sbjct  42   FTGCHAGKKYDGLYMLKQYFQHFGYITET--NLSGNFTDDFDDILKNAVEMYQRNFQLNV  99

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----------------GGPSEVVPNYRFYPGEP  312
            TG+LD  T++ +  PRCG  D++NG                  G     V +Y F+PGEP
Sbjct  100  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  159

Query  313  KWPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
            +WP  +  LT+ F P       +  V++ A   W  V   +F R + +  +D+      G
Sbjct  160  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSG  219

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-------PHSLDIRSVAIHE  642
            +HGDG PFDGP    AHAFSP  G  H D +ENW+              ++D+ SVA+HE
Sbjct  220  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHE  279

Query  643  IGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            IGHLLGL HS V G++M+     G+++ DLT DD+ G++ LY
Sbjct  280  IGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  321



>ref|XP_010043822.1| PREDICTED: metalloendoproteinase 1-like [Eucalyptus grandis]
Length=499

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 148/279 (53%), Gaps = 31/279 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G+R  GL NLKKY + FGYI +   N +    D F D L SAI+TYQ   +L  
Sbjct  180  FSGCHAGERRDGLANLKKYFRYFGYIPETPSNFT----DDFDDALASAIKTYQHNFNLEP  235

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG---GPSE--------VVPNYRFYPGEPKWPNQ  327
            TG LD  T+ Q+ +PRCG  DI+NG      G +E         V +Y F+PG P+WP+ 
Sbjct  236  TGQLDDATLTQLVRPRCGNPDIVNGSTAMNSGKAESLSATHFHAVGHYTFFPGTPRWPDG  295

Query  328  KSQLTFGFAPGT------PAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGD  486
            KS LT+ F P         A F      A + W  V   +F  T  Y  AD+K     GD
Sbjct  296  KSDLTYAFLPANQLSDDEKAVF----SRAFQRWAAVTPLTFTATDSYTAADIKIGFFSGD  351

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDH-DPSPHSL----DIRSVAIHEIGH  651
            HGDG  FDG  G  AHAFSP  G  H D DENWV   D +  SL    D+ SVA+HEIGH
Sbjct  352  HGDGEAFDGVLGTLAHAFSPPSGRFHLDRDENWVATGDVTTSSLSSAVDLESVAVHEIGH  411

Query  652  LLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            LLGL HS V  ++M+       K+ DL  DD+ GI+ LY
Sbjct  412  LLGLGHSSVEESIMYPTITSRTKKVDLATDDVQGIQVLY  450



>ref|NP_173824.2| putative metalloproteinase [Arabidopsis thaliana]
 gb|AAU90055.1| At1g24140 [Arabidopsis thaliana]
 gb|AEE30482.1| putative metalloproteinase [Arabidopsis thaliana]
Length=384

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 147/282 (52%), Gaps = 28/282 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G +  GLY LK+Y + FGYI +   N S    D F D L++A+  YQ    LN 
Sbjct  49   FTGCHAGKKYDGLYMLKQYFQHFGYITET--NLSGNFTDDFDDILKNAVEMYQRNFQLNV  106

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----------------GGPSEVVPNYRFYPGEP  312
            TG+LD  T++ +  PRCG  D++NG                  G     V +Y F+PGEP
Sbjct  107  TGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRKTFEVSFAGRGQRFHAVKHYSFFPGEP  166

Query  313  KWPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARG  483
            +WP  +  LT+ F P       +  V++ A   W  V   +F R + +  +D+      G
Sbjct  167  RWPRNRRDLTYAFDPRNALTEEVKSVFSRAFTRWEEVTPLTFTRVERFSTSDISIGFYSG  226

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-------PHSLDIRSVAIHE  642
            +HGDG PFDGP    AHAFSP  G  H D +ENW+              ++D+ SVA+HE
Sbjct  227  EHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVSEAVDLESVAVHE  286

Query  643  IGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            IGHLLGL HS V G++M+     G+++ DLT DD+ G++ LY
Sbjct  287  IGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>ref|XP_003613416.1| Matrix metalloproteinase-9 [Medicago truncatula]
Length=393

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 142/277 (51%), Gaps = 27/277 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G  +G    GL  LK Y   FGYI +      S   D F + LESA+RTYQ   +LN 
Sbjct  55   FTGCSRGKTYDGLSKLKNYFNHFGYIPN---GPPSNFTDDFDEALESAVRTYQKNFNLNI  111

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS----------EVVPNYRFYPGEPKWPNQK  330
            TG LD  T+  + KPRCGVADIING     S            V +Y F+PG+P+WP   
Sbjct  112  TGELDDATMNYIVKPRCGVADIINGTTSMNSGKFNSSSTNFHTVAHYSFFPGQPRWPEGT  171

Query  331  SQLTFGFAPG-----TPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHG  492
              LT+ F P         + F     A   W  V   +F + T Y  +D+K     GDHG
Sbjct  172  QTLTYAFDPSENLDDATKQVFA---NAFNQWSKVTTITFTEATSYSSSDIKIGFYSGDHG  228

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENW-VDHDPSPHSL----DIRSVAIHEIGHLL  657
            DG  FDG  G  AHAFSPT G  H D  E+W V+ D +  SL    D+ SV +HEIGHLL
Sbjct  229  DGEAFDGVLGTLAHAFSPTDGRLHLDKAEDWVVNGDVTESSLSNAVDLESVVVHEIGHLL  288

Query  658  GLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GL HS +  A+M+       K+ +L  DDI GI+ LY
Sbjct  289  GLGHSSIEEAIMYPTISSRTKKVELESDDIEGIQMLY  325



>ref|XP_003628627.1| Matrix metalloproteinase-9 [Medicago truncatula]
 gb|AET03103.1| matrix metalloproteinase [Medicago truncatula]
Length=373

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 147/280 (53%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G ++G+   GL NLK Y + FGYI     +  S  +D F D L+ AI+TYQ   +LN 
Sbjct  49   FTGCRQGENYNGLSNLKNYFQHFGYI---PRSPKSNFSDDFDDDLQEAIKTYQKNFNLNV  105

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPN------------YRFYPGEP  312
            TG LD  T+RQ+  PRCGVADIING      G  +E   N            +  +PG+P
Sbjct  106  TGELDDMTLRQVMLPRCGVADIINGTTTMNAGKDTETTSNSDSKLRFHTVSHFTVFPGQP  165

Query  313  KWPNQKSQLTFGFAPGTPAKFFIPVY--TALRDWHNVGHFSF-QRTQYEHADLKFSLARG  483
            +WP  K +LT+ F PG      +     TA   W  V    F + T Y  AD+K     G
Sbjct  166  RWPEGKQELTYAFFPGNELTETVKSVFATAFARWSEVTTLKFTETTLYSGADIKIGFFNG  225

Query  484  DHGDGVPFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIG  648
            DHGDG PFDG  G  AHAFSP  G  H DA E+W     V     P ++D+ SVA+HEIG
Sbjct  226  DHGDGEPFDGSLGTLAHAFSPRNGRFHLDAAEDWVVSGDVSKSSLPTAVDLESVAVHEIG  285

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS    A+M+       K+  L  DD+ GI+ LY
Sbjct  286  HLLGLGHSSEEEAIMFPTISSRMKKVVLADDDVRGIQYLY  325



>ref|XP_007157519.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
 gb|ESW29513.1| hypothetical protein PHAVU_002G076600g [Phaseolus vulgaris]
Length=377

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 145/274 (53%), Gaps = 21/274 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G + G    GL NLK Y   FGYI     ++ +   D F D LE+A++ YQ   +LN 
Sbjct  60   FTGCRHGKAYDGLSNLKNYFHYFGYIPTAPPSNFT---DDFDDALEAAVKAYQKNFNLNI  116

Query  181  TGILDADTVRQMTKPRCGVADIINGRP--GGPSEV--------VPNYRFYPGEPKWPNQK  330
            TG LD  T++Q+ +PRCGVAD+ING     G S          V +Y F+ G P+WP   
Sbjct  117  TGELDDATMQQIVRPRCGVADVINGTTTMNGKSNTTTTPKFHTVAHYSFFDGMPRWPQGT  176

Query  331  SQLTFGFAP--GTPAKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
             +LT+ F P  G           A + W  V   SF + + Y  AD+      GDHGDG 
Sbjct  177  EELTYAFEPDNGLDDTVKGVFSNAFKRWAEVTTISFSEASSYAVADITIGFYSGDHGDGE  236

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHLLGLD  666
            PFDG  G  AHAFSPT G+ H D  E+W     V      +++D+ SVA+HEIGHLLGL 
Sbjct  237  PFDGVLGTLAHAFSPTNGMFHLDEAEDWVATGDVTEASMSNAVDLESVAVHEIGHLLGLG  296

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS +  A+M+       ++ +L  DDI GI+ LY
Sbjct  297  HSSIEEAIMYPTISAKTRKVELAEDDIEGIQVLY  330



>ref|XP_002887284.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63543.1| hypothetical protein ARALYDRAFT_476141 [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 150/280 (54%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V+GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVEGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKTAVELYQRNFKLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---GGPSEV------------VPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG     GG  +             V  Y  +PGEP+
Sbjct  104  TGELDAMTIKHIVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  163

Query  316  WPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRT-QYEHADLKFSLARGD  486
            WP  +  LT+ F P  P    +  V++ A   W +V   +F  +  +  +D+      GD
Sbjct  164  WPRNRRDLTYAFDPKNPLTEEVKSVFSRAFGRWSDVTALNFTLSDSFSTSDITIGFYTGD  223

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  224  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  283

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  HLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  323



>gb|EYU46221.1| hypothetical protein MIMGU_mgv1a010535mg [Erythranthe guttata]
Length=309

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 146/266 (55%), Gaps = 10/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSWDADYFSDQLESAIRTYQTRRHL  174
            L G +KG+  KGL +LK YL   GY+N   +       + D F + LE AIR YQ+   L
Sbjct  46   LVGIRKGNSAKGLSHLKNYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFFKL  105

Query  175  NSTGILDADTVRQMTKPRCGVAD---IINGR--PGGPSEVVPNYRFYPGEPKWPNQKSQL  339
              TG+LD DTV+Q+ +PRCGVAD   ++N          +   Y F+PG+P WP  K  L
Sbjct  106  KVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKRSL  165

Query  340  TFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGP  516
            T+ F PGT       +  A   W     F F     Y +AD+K S    DHGDG PFDGP
Sbjct  166  TYSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDGP  225

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
             G  AHAF+PT G  H D DE W D        D+++V +HE+GH+LGL H+   GAVM+
Sbjct  226  LGILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGHILGLMHTGDVGAVMY  284

Query  697  SEFEYGQKRRDLTPDDINGIRALYHF  774
              +     R+ L  DD++GI+ALY F
Sbjct  285  P-YIGPNSRKGLGQDDVDGIKALYPF  309



>gb|EYU46222.1| hypothetical protein MIMGU_mgv1a027058mg, partial [Erythranthe 
guttata]
Length=284

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 145/266 (55%), Gaps = 10/266 (4%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIN--DLSYNSSSWDADYFSDQLESAIRTYQTRRHL  174
            L G +KG   KGL +LK YL   GY+N   +       + D F + LE AIR YQ+   L
Sbjct  21   LVGIRKGTTAKGLSHLKSYLSNLGYMNIEGIKKPPPGANDDSFDENLELAIRAYQSFFKL  80

Query  175  NSTGILDADTVRQMTKPRCGVAD---IINGR--PGGPSEVVPNYRFYPGEPKWPNQKSQL  339
              TG+LD DTV+Q+ +PRCGVAD   ++N          +   Y F+PG+P WP  K  L
Sbjct  81   KVTGMLDGDTVKQIMEPRCGVADNFAVLNKTLLQSKMPIIASRYTFFPGKPVWPAGKRSL  140

Query  340  TFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGP  516
            T+ F PGT       +  A   W     F F     Y +AD+K S    DHGDG PFDGP
Sbjct  141  TYSFPPGTRPDINRCLLAATDIWGANSAFGFTYIDDYANADVKISFQVRDHGDGNPFDGP  200

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
             G  AHAF+PT G  H D DE W D        D+++V +HE+GH+LGL H+   GAVM+
Sbjct  201  LGILAHAFAPTDGRLHMDGDEKWCD-GVYEGQFDMQTVGLHEMGHILGLMHTGDVGAVMY  259

Query  697  SEFEYGQKRRDLTPDDINGIRALYHF  774
              +     R+ L  DD++GI+ALY F
Sbjct  260  P-YIGPNSRKGLGQDDVDGIKALYPF  284



>ref|NP_001151749.1| metalloendoproteinase 1 precursor [Zea mays]
 gb|ACG44214.1| metalloendoproteinase 1 precursor [Zea mays]
Length=365

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 140/273 (51%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F   LE+AI TYQ    LN+
Sbjct  46   LSGCHMGEERQGLAGLKDYLSHFGYLPPPPPSSPFSDA--FDQNLEAAIATYQRNFGLNA  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN------YRFYPGEPKWPNQKSQLT  342
            TG LD  TV QM  PRCGVAD+ING          +      Y ++PG P WP  +  L 
Sbjct  104  TGALDPSTVSQMVAPRCGVADVINGTSTMARSSSADAHGRHLYAYFPGGPTWPPFRRDLK  163

Query  343  FGFAPGTPAKF----FIPVYT-ALRDWHNVGHFSFQRTQYEH-ADLKFSLARGDHGDGVP  504
            +     + A         V+  A   W    +  F  T  E  AD+      G HGDG P
Sbjct  164  YAITATSAASIDRSTLSDVFARAFSRWAAATNLRFAETASESDADITIGFYSGSHGDGEP  223

Query  505  FDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDH  669
            FDGP G  AHAFSPT G  H DA E WV         +  ++D+ SVA+HEIGHLLGL H
Sbjct  224  FDGPLGTLAHAFSPTDGRFHLDAAEAWVAGSDVSRSSATGAVDLESVAVHEIGHLLGLGH  283

Query  670  SEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            S VP A+M+     G ++ +L  DD+ GI++LY
Sbjct  284  SSVPDAIMYPTIRTGTRKVELEADDVQGIQSLY  316



>ref|XP_010415694.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 148/280 (53%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG     S                 V  Y  +PGEP+
Sbjct  105  TGELDAFTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRSRLHAVKRYTLFPGEPR  164

Query  316  WPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            WP  +  LT+ F P  P    +  V+  A   W +V   +F R++ +  +D+      GD
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  285  HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_008458913.1| PREDICTED: metalloendoproteinase 1-like [Cucumis melo]
Length=304

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 149/271 (55%), Gaps = 23/271 (8%)
 Frame = +1

Query  1    LQGSKKGDR-VKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
            L GS K D  V+G++ +K YL+ +GY ++   N+++   D F + LESAI++YQ    L 
Sbjct  40   LIGSSKNDNIVEGIHKVKAYLQRYGYFSN--ENANTLSTDVFDNDLESAIKSYQKFSKLK  97

Query  178  STGILDADTVRQMTKPRCGVADII-------------NGRPGGPSEVVPNYRFYPGEPKW  318
             +G+LD +T++QM+KPRCGV D               N   GG      +Y FY     W
Sbjct  98   VSGVLDRETLQQMSKPRCGVRDTFVSVAQQEHENKNTNIEIGGS-----HYTFYFNNVTW  152

Query  319  PNQKSQLTFGFAPGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGD  495
            P +K  L++GF    P +F  P+  A   W +   FSF    + + AD+  S  RGDHGD
Sbjct  153  PAEKKHLSYGFIHNYPPQFVDPLVRAFETWEDNTKFSFFLAPRVQTADILVSFERGDHGD  212

Query  496  GVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSE  675
               FDG GG  AH+     G  HFDADE W +  P    +D+ SVA+HE+GH LGL HS 
Sbjct  213  YQAFDGEGGILAHSLGAVDGRVHFDADEPW-ESGPIEDRVDLESVALHELGHTLGLGHSR  271

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             P AVM++  + G  +  LT DDI GI ALY
Sbjct  272  EPSAVMYAFMDPGVYKTHLTIDDIEGICALY  302



>gb|KFK41437.1| hypothetical protein AALP_AA2G130300 [Arabis alpina]
Length=380

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 149/284 (52%), Gaps = 31/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY LKKY + FGYI +     S    D F D L++A+  YQ    L+ 
Sbjct  47   FTGCHHGQTVDGLYRLKKYFQRFGYIPE---TFSGNFTDDFDDVLKTAVELYQKNFQLDV  103

Query  181  TGILDADTVRQMTKPRCGVADIING----------------RPGGPS---EVVPNYRFYP  303
            TG LDA T++ M  PRCG  D++NG                 PGG         +Y  +P
Sbjct  104  TGELDALTIKHMVIPRCGNPDVVNGTSLMHGGRRKTFEVNFSPGGRGPRLHTFKHYTLFP  163

Query  304  GEPKWPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRT-QYEHADLKFSL  474
            GEP+WP  +  LT+ F P  P    +  V++ A + W +V   +F     +  +D+    
Sbjct  164  GEPRWPRNRRDLTYAFDPRNPLTEEVKGVFSRAFQRWSDVTALNFTLIDSFTRSDITIGF  223

Query  475  ARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAI  636
              GDHGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+
Sbjct  224  YSGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  HEIGHLLGLGHSSVEDSIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_004965107.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=321

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 142/274 (52%), Gaps = 26/274 (9%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +G+  LK YL  FGY+ + S  +  +DAD     LE AI+ YQ    LN 
Sbjct  53   LTGCHFGEEQQGVAKLKDYLAHFGYLPESSGFTDIFDAD-----LEEAIKVYQRNFGLNI  107

Query  181  TGILDADTVRQMTKPRCGVADIINGRP--GGPSEVVPN--YRFYPGEPKWPNQKSQLTFG  348
            TG++DA TV QM  PRCGVAD+ING    G  S       Y ++PG P WP  K +LT+ 
Sbjct  108  TGVMDATTVAQMMAPRCGVADVINGTSTMGASSHAHGRNLYSYFPGSPSWPRSKKRLTYA  167

Query  349  FAP--------GTPAKFFIPVYTALRDWHNVGHFSFQRTQYEH-ADLKFSLARGDHGDGV  501
                        T ++ F     A   W      +F  T     AD+      GDHGDG 
Sbjct  168  ITDTAATTIDRATLSRVFA---RAFARWSAATTLNFTETASARDADITIGFHAGDHGDGE  224

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENW-----VDHDPSPHSLDIRSVAIHEIGHLLGLD  666
             FDGP G  AHAF+PT G  H DA E W     V    S  + D+ SVA+HEIGHLLGL 
Sbjct  225  AFDGPLGTLAHAFAPTDGRFHLDAAEAWVAAGDVSRASSDVAYDLESVAVHEIGHLLGLG  284

Query  667  HSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HS  PGA+M+       ++ DL  DD+ GI++LY
Sbjct  285  HSSEPGAIMYPSITPRTRKVDLASDDVVGIQSLY  318



>ref|XP_007223246.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
 gb|EMJ24445.1| hypothetical protein PRUPE_ppa007227mg [Prunus persica]
Length=377

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 146/269 (54%), Gaps = 23/269 (9%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            GD+V+GL  LKKY   FGYI +L  N +    D F D L+SA++TYQ   +LN TG LD 
Sbjct  62   GDKVEGLSKLKKYFNYFGYIPNLPSNFT----DDFDDDLQSALKTYQKNFNLNVTGELDE  117

Query  199  DTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQLTF  345
             T++ + K RCG  DI+NG      G P+         V +Y  +PG P WP  +  LT+
Sbjct  118  RTIQHLVKRRCGNPDIVNGTTTMNSGKPTSSNTSNLHTVAHYSTFPGTPVWPPSRRDLTY  177

Query  346  GFAPGTP-AKFFIPVYT-ALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGVPFDGP  516
             F P    A     V+  A + W      +F + T +  AD+K     GDHGDG PFDG 
Sbjct  178  AFLPENKLADDVKAVFLRAFQRWSAATPLNFSETTSFYTADIKIGFFSGDHGDGEPFDGV  237

Query  517  GGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDHSEVP  681
             G  AHAFSP  G  H D DENWV            ++D+ SVA+HEIGHLLGL HS V 
Sbjct  238  LGTLAHAFSPPSGRFHLDLDENWVITGDISTSSVTSAVDLESVAVHEIGHLLGLGHSSVE  297

Query  682  GAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             A+M+       K+ +L  DD+ GI++LY
Sbjct  298  EAIMFPTISSRTKKVELASDDVLGIQSLY  326



>emb|CDX68356.1| BnaA07g23960D [Brassica napus]
Length=373

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 150/276 (54%), Gaps = 23/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL+ +KKY + FGYI + +Y  +    D F D L++A+  YQ    L+ 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE-TYTGNF--TDDFDDILKAAVELYQKNFRLDV  103

Query  181  TGILDADTVRQMTKPRCGVADIING--------RPGGPS---EVVPNYRFYPGEPKWPNQ  327
            TG LDA T++ +  PRCG  D++NG         PGG       V +Y  +PGEP+WP  
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  328  KSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            +  LT+ F P  P    +  V+  A   W  V   +F   + +  +D+      GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTNEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIGHLLG  660
             PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>emb|CDY23516.1| BnaC06g24850D [Brassica napus]
Length=373

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/276 (41%), Positives = 149/276 (54%), Gaps = 23/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL+ +KKY + FGYI   +Y  +    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPQ-TYTGNF--TDDFDDILKAAVELYQKNFGLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIING--------RPGGPS---EVVPNYRFYPGEPKWPNQ  327
            TG LDA T++ +  PRCG  D++NG         PGG       V +Y  +PGEP+WP  
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSTFEVNFSPGGRIPRLHTVKHYTLFPGEPRWPKD  163

Query  328  KSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            +  LT+ F P  P    +  V+  A   W  V   +F   + +  +D+      GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGFYTGDHGDG  223

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIGHLLG  660
             PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  319



>ref|XP_002893327.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69586.1| hypothetical protein ARALYDRAFT_889959 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/284 (38%), Positives = 150/284 (53%), Gaps = 32/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYI--NDLSYNSSSWDADYFSDQLESAIRTYQTRRHL  174
              G   G +  GLY LK+Y + FGYI   DLS N +    D F D L++A+  YQ    L
Sbjct  49   FTGCHAGKKYDGLYKLKQYFQHFGYIPETDLSGNFT----DDFDDILKNAVEMYQRNFQL  104

Query  175  NSTGILDADTVRQMTKPRCGVADIINGRP----------------GGPSEVVPNYRFYPG  306
            N TG+LD  T++ +  PRCG  D++NG                  G     V +Y F+PG
Sbjct  105  NVTGVLDELTLKHVVIPRCGNPDVVNGTSTMHSGRRTFEVSFAGRGQRFHTVKHYSFFPG  164

Query  307  EPKWPNQKSQLTFGFAP-GTPAKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLA  477
            EP+WP  +  LT+ F P  +  +    V++ A   W  V   +F R + +  +D+     
Sbjct  165  EPRWPRNRRDLTYAFDPRNSLTEEVKSVFSRAFARWAEVTPLTFTRVERFSTSDISIGFY  224

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-------PHSLDIRSVAI  636
             G+HGDG PFDGP    AHAFSP  G  H D +ENW+              ++D+ SVA+
Sbjct  225  SGEHGDGEPFDGPMRTLAHAFSPPTGHFHLDGEENWIVSGEGGDGFISVDEAVDLESVAV  284

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS V G++M+     G+++ DLT DD+ G++ LY
Sbjct  285  HEIGHLLGLGHSSVEGSIMYPTIRTGRRKVDLTTDDVEGVQYLY  328



>ref|XP_010510985.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=367

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 146/271 (54%), Gaps = 18/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  +  + +   D F D L+SAI TYQ   +L  
Sbjct  51   LAGCHIGEKIDGLSKLKRYFHRFGYISAAAVENCT---DDFDDVLQSAIDTYQKNFNLKV  107

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LD+ T+RQ+ KPRCG  D+I+G      G        Y F+PG+P+WP +K  LT+ 
Sbjct  108  TGKLDSSTLRQIVKPRCGNPDMIDGFSEMNGGRKLRATERYSFFPGKPRWPKRKRYLTYA  167

Query  349  FAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG  519
            F         I  V+  A   W  V   +F R++    AD+      G+HGDG PFDG  
Sbjct  168  FVTQNNLTEEIKRVFARAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  227

Query  520  GNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G  AHA SP  G+ H D+DE+W+  D             +D+ SV +HEIGHLLGL HS 
Sbjct  228  GTLAHASSPPTGMLHLDSDEDWLISDGGISRRISSVTSVVDLESVVVHEIGHLLGLGHSS  287

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  288  VEDAIMFPAISGGHRKVELAKDDIEGIQHLY  318



>gb|KDP32993.1| hypothetical protein JCGZ_13024 [Jatropha curcas]
Length=306

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 109/261 (42%), Positives = 144/261 (55%), Gaps = 7/261 (3%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            LQG  KGD++KG+  LK+YLK FGY+     N +  + DYF D LESAI+ YQ    L +
Sbjct  50   LQGCHKGDKIKGIQELKEYLKYFGYLR--YKNRAHANDDYFDDVLESAIKMYQQNYRLKT  107

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEV--VPNYRFYPGEPKWPNQKSQLTFGFA  354
            TG L ++TV +M  PRCGVAD+ NG     S       Y F+PG PKWP  K  LT+   
Sbjct  108  TGSLTSETVSKMMMPRCGVADLTNGTIKKSSNAYHTSGYTFFPGNPKWPASKYALTYELR  167

Query  355  PGTPAKFFIPVYTALRDWHNVGHFSFQRTQYE-HADLKFSLARGDHGDGVPFDGPGGNYA  531
              TP     P+  A + W NV  F+F       + D+   L +GDHGDG PFD  G   A
Sbjct  168  YDTPPHLIPPLQNAFQAWANVTPFTFSPFHGRGNPDITIGLYKGDHGDGYPFDAFGAIAA  227

Query  532  HAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMWSEFEY  711
            H++ P  G  HF++   +      P+  D  +VA HEIGHLLGL HS    A+M+    +
Sbjct  228  HSWPPQDGRLHFNSYGRFCI-GAFPNLYDFGTVASHEIGHLLGLGHSRDEEAIMYPVAPF  286

Query  712  GQKRRDLTPDDINGIRALYHF  774
            G + + +   DI G+RALY F
Sbjct  287  G-RVKGIHQYDIEGVRALYEF  306



>ref|XP_006416025.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
 gb|ESQ34378.1| hypothetical protein EUTSA_v10007920mg [Eutrema salsugineum]
Length=382

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 151/285 (53%), Gaps = 33/285 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND-LSYNSSSWDADYFSDQLESAIRTYQTRRHLN  177
              G   G +V GLY LK+Y + FGYI   L  N +    D F D L++A+ TYQ   HLN
Sbjct  49   FTGCHAGMKVNGLYKLKQYFQHFGYIRQTLPKNFT----DDFDDILKNAVETYQRNFHLN  104

Query  178  STGILDADTVRQMTKPRCGVADIINGRPG----------------GPS-EVVPNYRFYPG  306
             TG LD  T++ +  PRCGV DI+NG                   GP    V  Y F+PG
Sbjct  105  ITGELDELTLKHVVMPRCGVPDIVNGTSTMHNGRRRTYEVSFSGKGPRFHAVKRYSFFPG  164

Query  307  EPKWPNQKSQLTFGFAP-GTPAKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLA  477
            EP+WP +   LT+ F P  +  +    V++ A   W  V   +F R + +  +D++    
Sbjct  165  EPRWPERNRDLTYAFDPRNSLTEEVKSVFSRAFVRWAEVIPVTFTRVEVFSISDIRIGFY  224

Query  478  RGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVA  633
             GDHGDG PFDG  G  AHAFSP  G  H D DENW+               ++D+ SVA
Sbjct  225  SGDHGDGEPFDGVMGTLAHAFSPPNGHFHLDGDENWIVSGDVGGDRLLSVTAAVDLESVA  284

Query  634  IHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            +HEIGHLLGL HS V  ++M+     G+++ DLT DD+ G++ LY
Sbjct  285  VHEIGHLLGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  329



>ref|XP_010320628.1| PREDICTED: metalloendoproteinase 1 [Solanum lycopersicum]
Length=357

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 146/262 (56%), Gaps = 11/262 (4%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTG  186
            G + G ++KGL  +K+Y + FGYI+D   N  +   D F   L SA+++YQ   +LN TG
Sbjct  51   GCRVGQKIKGLAKIKQYFQRFGYIDDSLSNDFT---DEFDQLLLSALKSYQLNFNLNVTG  107

Query  187  ILDADTVRQMTKPRCGVADIINGRPGGPS---EVVPNYRFYPGEPKWPNQKSQLTFGFAP  357
              D  T++ M KPRCG  DI     GG +     V ++ F+ G+ +WP+ KS+L + F P
Sbjct  108  EFDFSTLQNMVKPRCGNPDIAKKGYGGKTPMDHTVAHFSFFEGQRRWPSSKSKLKYAFLP  167

Query  358  GTPA--KFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPGGNY  528
                     +    A   W  V   +F+    Y  AD++      DHGDG PFDGP    
Sbjct  168  ENQLTDSVKLAFRRAFDKWSKVTPLTFKEMGSYRSADIRIGFFVRDHGDGNPFDGPMKVL  227

Query  529  AHAFSPTIGICHFDADENW-VDHDPSPHSL-DIRSVAIHEIGHLLGLDHSEVPGAVMWSE  702
            AHAF+P IG  H D +ENW VD +     + D+ SVA+HEIGHLLGLDHS    AVM+  
Sbjct  228  AHAFAPPIGFFHLDGEENWMVDGEYLKEGMVDLESVAVHEIGHLLGLDHSFEKDAVMFPT  287

Query  703  FEYGQKRRDLTPDDINGIRALY  768
             E G ++ +L+ DDI G++ LY
Sbjct  288  LEDGTRKVELSRDDIEGVQMLY  309



>emb|CDY30915.1| BnaC09g14910D [Brassica napus]
Length=353

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 146/273 (53%), Gaps = 19/273 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GD+  GL  LK+Y   FGYI     N +    D F D L+SAI TYQ   +L  
Sbjct  50   LTGYHVGDKADGLSKLKQYFSRFGYIPAAVDNFT----DDFDDVLKSAISTYQKNFNLKV  105

Query  181  TGILDADTVRQMTKPRCGVADIING----RPGGPSEVVPNYRFYPGEPKWPNQKSQLTFG  348
            TG LDA T+ Q+ KPRCG  D+I+G      G     V  Y F+PG+P+WP +   L++ 
Sbjct  106  TGKLDASTLGQIVKPRCGNPDMIDGTSEMNAGKKFRTVARYSFFPGKPQWPKRNRDLSYA  165

Query  349  FAP-GTPAKFFIPVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG  519
            F P     +    V+  A   W +V   +F R++    AD+      GDHGDG PFDGP 
Sbjct  166  FFPLNNLTEEVKQVFARAFTRWADVTPLNFTRSESILRADIVIGFFAGDHGDGEPFDGPM  225

Query  520  GNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G  AHA SP  G+ H D +E+W+           P    +D+ SVA+HEIGHLLGL HS 
Sbjct  226  GTLAHASSPPTGMFHLDNEEDWLISGEDMSRQILPVTSVVDLESVAVHEIGHLLGLGHSS  285

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALYHF  774
            V  A+M+     G ++ +L  DDI GI+ LY +
Sbjct  286  VEDAIMYPAISGGHRKVELAKDDIEGIQHLYGY  318



>ref|XP_006390919.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
 gb|ESQ28205.1| hypothetical protein EUTSA_v10018701mg [Eutrema salsugineum]
Length=383

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/285 (40%), Positives = 149/285 (52%), Gaps = 32/285 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL  +KKY + FGYI +     S    D F D L+SA+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLNRIKKYFQRFGYIPE---TFSGNFTDDFDDILKSAVELYQKNFRLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIING-----------------RPGGPS---EVVPNYRFY  300
            TG LDA T++ +  PRCG  D++NG                  PGG       V  Y  +
Sbjct  104  TGELDALTIKHIVIPRCGNPDVVNGTSLMHGERRRKTFEVNFSPGGRRPRFHSVKRYTLF  163

Query  301  PGEPKWPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFS  471
            PGEP+WP+ +  LT+ F P  P    +  V++ A   W  V   +F + + +  AD+   
Sbjct  164  PGEPRWPSDRRDLTYAFDPRNPLTEEVKSVFSRAFGRWSEVTELNFTKIESFSTADITIG  223

Query  472  LARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHD---PSPHSLDIRSVA  633
               GDHGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA
Sbjct  224  FYTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVA  283

Query  634  IHEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            +HEIGHLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  VHEIGHLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  328



>ref|XP_010512095.1| PREDICTED: metalloendoproteinase 1 [Camelina sativa]
Length=378

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 147/280 (53%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    L  
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLKV  104

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG     S                 V  Y  +PGEP+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  316  WPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            WP  +  LT+ F P  P    +  V+  A   W +V   +F R++ +  +D+      GD
Sbjct  165  WPKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  285  HLLGLGHSSVEDSIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>ref|XP_009105693.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=378

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 150/284 (53%), Gaps = 31/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL+ +KKY + FGYI + +Y  +    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE-TYTGNF--TDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIING----------------RPGGPS---EVVPNYRFYP  303
            TG LDA T++ +  PRCG  D++NG                 PGG       V +Y  +P
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVNFSPGGKVPRLHTVKHYTLFP  163

Query  304  GEPKWPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSL  474
            GEP+WP  +  LT+ F P  P    +  V+  A   W  V   +F   + +  +D+    
Sbjct  164  GEPRWPRDRRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGF  223

Query  475  ARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAI  636
              GDHGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  327



>ref|XP_004953898.1| PREDICTED: metalloendoproteinase 1-like [Setaria italica]
Length=372

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 144/281 (51%), Gaps = 34/281 (12%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F + LE+AI TYQ    LN+
Sbjct  53   LSGCHMGEERQGLAGLKDYLSHFGYLPPPPSSSPFTDA--FDEDLEAAIATYQRNFGLNA  110

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN-----------YRFYPGEPKWPNQ  327
            TG LDA TV QM  PRCGVAD+ING     S +  N           Y ++PG P+WP  
Sbjct  111  TGALDASTVAQMVSPRCGVADVINGT----STMARNSSAAGAHGRHLYAYFPGGPRWPPF  166

Query  328  KSQLTFGFAP--------GTPAKFFIPVYTALRDWHNVGHFSFQRTQYEH-ADLKFSLAR  480
            +  L +             T +  F   +       N+    F  T  E  AD+      
Sbjct  167  RRDLKYAITATSATSIDRSTLSDVFARAFAQWAAATNL---RFAETASESDADITIGFYT  223

Query  481  GDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEI  645
            G HGDG PFDGP G  AHAFSPT G  H DA E WV         SP  +D+ SVA+HEI
Sbjct  224  GSHGDGEPFDGPLGTLAHAFSPTDGRFHLDAAEAWVAGGDVSRASSPGVVDLESVAVHEI  283

Query  646  GHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            GHLLGL HS VP A+M+     G ++ +L  DD+ GI++LY
Sbjct  284  GHLLGLGHSSVPEAIMYPTIRTGTRKVELEADDVQGIQSLY  324



>dbj|BAJ93963.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89432.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 138/271 (51%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND--LSYNSSSWDADYFSDQLESAIRTYQTRRHL  174
            L G   GD  +GL  LK YL  FGY+      +N      D F   +E+AIRTYQ    L
Sbjct  52   LSGCHFGDERQGLARLKDYLSRFGYLPAPPAKFN------DMFDADMETAIRTYQHNFGL  105

Query  175  NSTGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN--YRFYPGEPKWPNQKSQLTFG  348
             +TG LDA TV +M  PRCGVADIING       V     Y ++PG P WP  K  L + 
Sbjct  106  EATGQLDAATVAKMMSPRCGVADIINGTSSMGKTVHGRNLYSYFPGSPSWPRSKKSLRYA  165

Query  349  FAPGTP-----AKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFD  510
                T      A       +A   W      +F  T     AD+      GDHGDG  FD
Sbjct  166  ITAATETTIDRATLSRVFASAFARWSAATTLNFTETASASDADITIGFHSGDHGDGEAFD  225

Query  511  GPGGNYAHAFSPTIGICHFDADENWV-DHDPSPHSL----DIRSVAIHEIGHLLGLDHSE  675
            GP G  AHAFSPT G  H DA E WV   D S  SL    D+ SVA+HEIGHLLGL HS 
Sbjct  226  GPLGTLAHAFSPTDGRFHLDASEAWVAGGDVSRASLDAAVDLESVAVHEIGHLLGLGHSS  285

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V GA+M+       ++ +L  DD+ GI++LY
Sbjct  286  VEGAIMYPTITSRTQKVELANDDVVGIQSLY  316



>emb|CDY11609.1| BnaC06g31300D [Brassica napus]
Length=373

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 150/276 (54%), Gaps = 23/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL+ +KKY + FGYI + +Y+ +    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE-TYSGNF--TDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-----------EVVPNYRFYPGEPKWPNQ  327
            TG LDA T++ +  PRCG  D++NG     +             V +Y  +PGEP+WP  
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  328  KSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            +  LT+ F P  P    +  V+  A   W +V   +F   + +  +D+      GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIGHLLG  660
             PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>gb|KFK44477.1| hypothetical protein AALP_AA1G261400 [Arabis alpina]
Length=378

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 149/283 (53%), Gaps = 30/283 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G +V GLY +K+Y + FGYI +    + +   D F D L++A+  YQ    LN 
Sbjct  45   FTGCHTGMKVDGLYKIKQYFQHFGYIPETLPGNFT---DDFDDILKNAVEMYQRNFQLNV  101

Query  181  TGILDADTVRQMTKPRCGVADIINGRPG----------------GPS-EVVPNYRFYPGE  309
            TG LD  T+  +  PRCGV D++NG                   GP    V  Y F+PGE
Sbjct  102  TGELDELTLIHVVIPRCGVPDVVNGTSTMHGHGRRTYEVSFTGRGPRFHAVRRYSFFPGE  161

Query  310  PKWPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLAR  480
            P+WPN +  LT+ F P       +  V++ A   W  V   +F R + +  AD++     
Sbjct  162  PRWPNHRRDLTYAFDPRNALTEEVKNVFSRAFVRWAEVTPLTFTRAESFLTADIRVGFYS  221

Query  481  GDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWVDHDPS-------PHSLDIRSVAIH  639
            GDHGDG PFDG  G  AHAFSP  G  H D DENWV  D           ++D+ SVA+H
Sbjct  222  GDHGDGEPFDGVMGTLAHAFSPPSGHFHLDGDENWVVSDSGGDGFLSVTAAVDLESVAVH  281

Query  640  EIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            EIGH+LGL HS V  ++M+     G+++ DLT DD+ G++ LY
Sbjct  282  EIGHILGLGHSSVQDSIMYPTITTGRRKVDLTSDDVEGVQYLY  324



>ref|XP_006357274.1| PREDICTED: metalloendoproteinase 1-like [Solanum tuberosum]
Length=338

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 106/266 (40%), Positives = 144/266 (54%), Gaps = 16/266 (6%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWD-ADYFSDQLESAIRTYQTRRHLNST  183
            G + G ++KGL  +K+Y K FGYI+    NS S D  D F   L SA++TYQ   +LN T
Sbjct  60   GCRVGQKIKGLAKIKQYFKHFGYID----NSLSNDFTDEFDQLLFSALKTYQLNFNLNIT  115

Query  184  GILDADTVRQMTKPRCGVADIINGRPGGPS------EVVPNYRFYPGEPKWPNQKSQLTF  345
            G  D  T++ M KPRCG  DI+NG     S        V ++ F+ G+P+WP+ KS+L +
Sbjct  116  GEFDIPTLQHMVKPRCGNPDIVNGTTHMNSGKTPTDHTVAHFSFFEGQPRWPSSKSKLKY  175

Query  346  GFAPGTPAKFFIPVY--TALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGP  516
             F P       + V    A   W  V   +F+    Y   D++      DHGDG PFDGP
Sbjct  176  AFLPENQLTDSVKVAFRRAFDKWSKVTPLTFKEMDSYRLVDIRIRFFVRDHGDGNPFDGP  235

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDP--SPHSLDIRSVAIHEIGHLLGLDHSEVPGAV  690
                AHAF+P     H D +ENWV          +D+ SVA+HEIGHLLGLDH     A+
Sbjct  236  MKILAHAFAPPTRFFHLDGEENWVVDGEYLKEGMVDLESVAVHEIGHLLGLDHLSEKEAI  295

Query  691  MWSEFEYGQKRRDLTPDDINGIRALY  768
            M+   E G ++ +L+ DDI G++ LY
Sbjct  296  MFPTIEDGTRKVELSRDDIEGVQMLY  321



>ref|XP_010470167.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=364

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 148/271 (55%), Gaps = 18/271 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+++ GL  LK+Y   FGYI+  + ++ +   D F D L+SAI TYQ   +L  
Sbjct  49   LAGCHIGEKIDGLSKLKQYFHRFGYISAAAVDNCT---DDFDDVLQSAIDTYQKNFNLKV  105

Query  181  TGILDADTVRQMTKPRCGVADIING--RPGGPSEV--VPNYRFYPGEPKWPNQKSQLTFG  348
            TG LD+ T+RQ+ KPRCG  D+I+G     G  ++     Y F+ G+P+WP +K  LT+ 
Sbjct  106  TGKLDSSTLRQIVKPRCGNLDMIDGVSEMNGRRKLRTTERYSFFHGKPRWPKRKRDLTYA  165

Query  349  FAPGTPAKFFIP--VYTALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDGVPFDGPG  519
            F P       +      A   W  V   +F R++    AD+      G+HGDG PFDG  
Sbjct  166  FVPQNNLTEEVKRVFERAFTRWSEVTPLNFTRSESLLGADIVIGFFSGEHGDGEPFDGAM  225

Query  520  GNYAHAFSPTIGICHFDADENWVDHD--------PSPHSLDIRSVAIHEIGHLLGLDHSE  675
            G  AHA SP  G+ H D+DE+W+  +        P    +D+ SV +HEIGHLLGL HS 
Sbjct  226  GTLAHASSPPTGMLHLDSDEDWLISNGEISRRILPVTSVVDLESVVVHEIGHLLGLGHSS  285

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V  A+M+     G ++ +L  DDI GI+ LY
Sbjct  286  VEDAIMFPAISGGDRKVELAKDDIEGIQHLY  316



>ref|XP_009410261.1| PREDICTED: metalloendoproteinase 1 [Musa acuminata subsp. malaccensis]
Length=361

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 141/270 (52%), Gaps = 19/270 (7%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G + G+   GL +LK+YL  FGY+      ++S+D     D LE+AI+TYQ    LN 
Sbjct  45   LSGCRFGEHRPGLADLKEYLNQFGYLPAAPNFTNSFD-----DNLEAAIKTYQRNFGLNV  99

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN---YRFYPGEPKWPNQKSQLTFGF  351
            TG LD  TV Q+  PRCG+ DIING     S  V     Y ++PG P WP+ K++L +  
Sbjct  100  TGELDDATVEQLIVPRCGMPDIINGTSTMNSSFVRGRNLYAYFPGTPTWPSDKTELKYAI  159

Query  352  APGTPAKFFIPVYT-----ALRDWHNVGHFSFQRTQYEH-ADLKFSLARGDHGDGVPFDG  513
               +     + V       A   W      +F  T     AD+      G HGDG PFDG
Sbjct  160  TATSAVSIDLSVLKTVFARAFGRWSAATTLTFTETDSSSDADITIGFYNGSHGDGEPFDG  219

Query  514  PGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDHSEV  678
              G  AHAFSPT G  H DA E WV         S  ++D+ SVA+HEIGHLLGL HS V
Sbjct  220  VLGTLAHAFSPTDGRFHLDAAETWVAEGDVTQADSDVAVDLESVAVHEIGHLLGLGHSSV  279

Query  679  PGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
              A+M+   +   K+ DL  DD+ GI+ LY
Sbjct  280  AEAIMYPTIKTRTKKVDLASDDVEGIQNLY  309



>ref|XP_008389591.1| PREDICTED: metalloendoproteinase 1-like [Malus domestica]
Length=387

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 147/272 (54%), Gaps = 28/272 (10%)
 Frame = +1

Query  19   GDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTGILDA  198
            G++V GL  LKKY   FGYI +L   + +   D F D LE+A++TYQ   +LN TG LD 
Sbjct  60   GEKVDGLGKLKKYFNRFGYIPNLPTANLT---DEFDDDLEAALKTYQKNFNLNVTGELDG  116

Query  199  DTVRQMTKPRCGVADIING----RPGGPSE-------VVPNYRFYPGEPKWPNQKSQLTF  345
             T+  + KPRCG  DI+NG      G P+         V +Y F+PG P WP  +  LT+
Sbjct  117  PTLEHLVKPRCGNPDIVNGTTTMNSGKPASYNATKFHTVSHYSFFPGTPVWPENRRDLTY  176

Query  346  GFAP-----GTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPF  507
             F        T    F+    A + W      +F  T  ++ AD+K    +GDHGDG PF
Sbjct  177  AFVSENELSDTVKAVFV---GAFQRWSEATTLTFTETTSFDSADIKIGFFKGDHGDGEPF  233

Query  508  DGPGGNYAHAFSPTIGICHFDADENWV-----DHDPSPHSLDIRSVAIHEIGHLLGLDHS  672
            DG  G  AHAFSP  G  H DA+ENWV            ++D+ SVA+HEIGHLLGL HS
Sbjct  234  DGVLGTLAHAFSPPSGRFHLDAEENWVITGDISKTSVTSAVDLESVAVHEIGHLLGLGHS  293

Query  673  EVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             V  A+M+       K+ +L  DD+ GI++LY
Sbjct  294  SVEEAIMYPTIASRTKKVELANDDVLGIQSLY  325



>ref|XP_010471013.1| PREDICTED: metalloendoproteinase 1-like [Camelina sativa]
Length=378

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 147/280 (53%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  48   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDILKAAVELYQRNFRLNV  104

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS---------------EVVPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG     S                 V  Y  +PGEP+
Sbjct  105  TGELDALTIKHIVIPRCGNPDVVNGTSLMHSGRRKTFEVNFSRTHLHAVKRYTLFPGEPR  164

Query  316  WPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            W   +  LT+ F P  P    +  V+  A   W +V   +F R++ +  +D+      GD
Sbjct  165  WRKDRRDLTYAFDPRNPLTEEVKGVFARAFGRWSDVTALNFTRSESFSTSDITIGFYTGD  224

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  225  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  284

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  285  HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  324



>emb|CDY38799.1| BnaA07g28710D [Brassica napus]
Length=370

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 149/276 (54%), Gaps = 23/276 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL+ +KKY + FGYI + +Y+ +    D F D L++A+  YQ    LN 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE-TYSGNF--TDDFDDILKNAVELYQKNFRLNV  103

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPS-----------EVVPNYRFYPGEPKWPNQ  327
            TG LDA T++ +  PRCG  D++NG     +             V +Y  +PGEP+WP  
Sbjct  104  TGELDALTIKHIVVPRCGNPDVVNGTSLMHNGRRKTFEVPRLHTVKHYTLFPGEPRWPRD  163

Query  328  KSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHGDG  498
            +  LT+ F P  P    +  V+  A   W  V   +F   + +  +D+      GDHGDG
Sbjct  164  RRDLTYAFDPRNPLTDEVKGVFARAFGRWSEVTALNFTNIESFTTSDITIGFYTGDHGDG  223

Query  499  VPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIGHLLG  660
             PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIGHLLG
Sbjct  224  EPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIGHLLG  283

Query  661  LDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            L HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  LGHSSVEESIMYPTITTGKRKVDLTSDDVEGIQYLY  319



>ref|XP_009418044.1| PREDICTED: metalloendoproteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/278 (40%), Positives = 144/278 (52%), Gaps = 18/278 (6%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   GD   GL  LK YLK FGY+   S NS+    D F D LE AI++YQ    LN+
Sbjct  47   LSGCHHGDDKPGLAGLKHYLKHFGYLPTSSMNST----DSFDDALEIAIQSYQRFFGLNA  102

Query  181  TGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGF---  351
            TG +D  TV Q+  PRCGVAD +NG    P   +  Y ++P  P WP  +  L +     
Sbjct  103  TGEIDEPTVDQLMAPRCGVADFVNGSSALPGRNL--YAYFPDAPTWPFWRRNLKYAITAT  160

Query  352  --APGTPAKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPGG  522
               P   A        A   W +    +F+ T     AD+     RG+HGDG PFDG  G
Sbjct  161  SDVPIDRAVLKAVFARAFGRWSSATTLTFEETDSAADADITIGFYRGEHGDGEPFDGVLG  220

Query  523  NYAHAFSPTIGICHFDADENWVDHD-----PSPHSLDIRSVAIHEIGHLLGLDHSEVPGA  687
               HAFSPT G  H DA E WV         S  ++D+ SVA+HEIGHLLGL HS    A
Sbjct  221  TLGHAFSPTDGRLHLDAAEAWVAEGDMTKGSSDVAVDLESVAVHEIGHLLGLGHSAAADA  280

Query  688  VMWSEFEYGQKRRDLTPDDINGIRALYHF*QPSWRTTM  801
            +M+   +   ++ +LT DD+ GI++LY    P++R  M
Sbjct  281  IMYPAIKTRTRKVELTTDDVEGIQSLYGS-NPNYRGAM  317



>ref|XP_009104967.1| PREDICTED: metalloendoproteinase 1-like [Brassica rapa]
Length=381

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 150/284 (53%), Gaps = 31/284 (11%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GL+ +KKY + FGYI + +Y  +    D F D L++A+  YQ    L+ 
Sbjct  47   FTGCHHGQNVDGLFRIKKYFQRFGYIPE-TYTGNF--TDDFDDILKAAVELYQKNFRLDV  103

Query  181  TGILDADTVRQMTKPRCGVADIING----------------RPGGPS---EVVPNYRFYP  303
            TG LDA T++ +  PRCG  D++NG                 PGG       V +Y  +P
Sbjct  104  TGELDAPTIKHIVIPRCGNPDVVNGTSVMHNGRRKTFEVNFSPGGRIPRLHTVKHYTLFP  163

Query  304  GEPKWPNQKSQLTFGFAPGTPAKFFIP-VYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSL  474
            GEP+WP  +  LT+ F P  P    +  V+  A   W  V   +F   + +  +D+    
Sbjct  164  GEPRWPKDRRDLTYAFDPRNPLTDEVKGVFARAFGRWAEVTELNFTNIESFTTSDITIGF  223

Query  475  ARGDHGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAI  636
              GDHGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+
Sbjct  224  YTGDHGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAV  283

Query  637  HEIGHLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HEIGHLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  284  HEIGHLLGLGHSSVEESIMYPTITTGKRKVDLTNDDVEGIQYLY  327



>ref|XP_006300509.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
 gb|EOA33407.1| hypothetical protein CARUB_v10020468mg [Capsella rubella]
Length=380

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 148/280 (53%), Gaps = 27/280 (10%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
              G   G  V GLY +KKY + FGYI +     S    D F D L++A+  YQ    LN 
Sbjct  49   FTGCHHGQNVDGLYRIKKYFQRFGYIPE---TFSGNFTDDFDDVLKTAVELYQRNFRLNV  105

Query  181  TGILDADTVRQMTKPRCGVADIINGRP---GGPSEV------------VPNYRFYPGEPK  315
            TG LDA T++ +  PRCG  D++NG      G  +             V  Y  +PGEP+
Sbjct  106  TGELDALTIKHIVIPRCGNPDVVNGTSLMHNGRRKTFEVNFSRSHLHAVKRYTLFPGEPR  165

Query  316  WPNQKSQLTFGFAPGTPAKFFI-PVYT-ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGD  486
            WP  +  LT+ F P  P    +  V+  A   W +V   +F  ++ +  +D+      GD
Sbjct  166  WPRNRRDLTYAFDPRNPLTDEVKSVFARAFGRWSDVTALNFTPSEDFTSSDITIGFYTGD  225

Query  487  HGDGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDP---SPHSLDIRSVAIHEIG  648
            HGDG PFDG  G  AHAFSP  G  H DADENWV   D D       ++D+ SVA+HEIG
Sbjct  226  HGDGEPFDGVLGTLAHAFSPPSGKFHLDADENWVVSGDLDSFLSVTAAVDLESVAVHEIG  285

Query  649  HLLGLDHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            HLLGL HS V  ++M+     G+++ DLT DD+ GI+ LY
Sbjct  286  HLLGLGHSSVEESIMYPTITTGRRKVDLTNDDVEGIQYLY  325



>gb|EAY79487.1| hypothetical protein OsI_34615 [Oryza sativa Indica Group]
 gb|EAZ16948.1| hypothetical protein OsJ_32430 [Oryza sativa Japonica Group]
Length=337

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 141/275 (51%), Gaps = 23/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L  + +G  V GL  LK+YL  FGY+     +++    D F + LE A+R YQTR  L  
Sbjct  24   LLDAGRGSHVTGLAELKRYLARFGYMAKPGRDTT----DAFDEHLEVAVRRYQTRFSLPV  79

Query  181  TGILDADTVRQMTKPRCGVAD-------IINGRPGGPSEVVPNYRFYPGEPKWPNQKSQL  339
            TG LD  T+ Q+  PRCGV D        +   PG    VV  + F+ GEP+W      +
Sbjct  80   TGRLDNATLDQIMSPRCGVGDDDVERPVSVALSPGAQGGVVSRFTFFKGEPRWTRSDPPI  139

Query  340  TFGFA--PGTPAKFFIPVYT------ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
               +A  P     +  P         A   W       F  T  YE AD+K     G+HG
Sbjct  140  VLSYAVSPTATVGYLPPAAVRAVFQRAFARWARTIPVGFVETDDYEAADIKVGFYAGNHG  199

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDPSPHSLDIRSVAIHEIGHLLGL  663
            DGVPFDGP G   HAFSP  G  H DA E+W    D D +  ++D+ SVA HEIGH+LGL
Sbjct  200  DGVPFDGPLGILGHAFSPKNGRLHLDASEHWAVDFDVDATASAIDLESVATHEIGHVLGL  259

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS  P AVM+   +  +K+  LT DD+ G++ALY
Sbjct  260  GHSASPRAVMYPSIKPREKKVRLTVDDVEGVQALY  294



>gb|KHN16360.1| Metalloendoproteinase 1 [Glycine soja]
Length=297

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 148/264 (56%), Gaps = 20/264 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L+G  +G   KG+  L+ YL+ +GY   L+  SSS   D F + +ESA++ YQ   HL  
Sbjct  43   LRGVHRGQNAKGVGELRGYLQKYGY---LTKGSSS--NDNFDENVESALKHYQAFHHLRD  97

Query  181  TGILDADTVRQMTKPRCGVADII---NGRPGGPSEVVPNYRFYPGEPKWPNQKSQLTFGF  351
            TG++D DT+++M+ PRCG+ DII   N  P G      NY F+PG PKW   K  LT+  
Sbjct  98   TGVVDDDTIKKMSLPRCGMPDIITNPNPNPNGLVGAPENYTFFPGSPKW--SKFFLTYRR  155

Query  352  APGTPAKFF-IPVYTALRD----WHNVGHFSFQRTQYEHADLKFSLARGDHGDGVPFDGP  516
              G         V  A+RD    W NV  F+F  T    AD+ +   RG H D  PFDGP
Sbjct  156  TSGATVSINETAVRRAMRDAFQSWANVSPFTFNETTDRSADITYGFHRGLHLDLYPFDGP  215

Query  517  GGNYAHAFSPTIGICHFDADENWVDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVMW  696
            G   AHAF+P  G  HFDADE W  +      +D ++V +HE+GH LGL HS    AVM 
Sbjct  216  GRVLAHAFAPEDGRIHFDADELWRSNGS---DIDFQTVGLHELGHSLGLGHSNDTDAVM-  271

Query  697  SEFEYGQKRRDLTPDDINGIRALY  768
             +  Y  +RR L+ DDI+GI+ALY
Sbjct  272  -QPNYDGQRRSLSQDDIDGIQALY  294



>dbj|BAJ98922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 137/271 (51%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYIND--LSYNSSSWDADYFSDQLESAIRTYQTRRHL  174
            L G   GD  +GL  LK YL  FGY+      +N      D F   +E+AIRTYQ    L
Sbjct  52   LSGCHFGDERQGLARLKDYLSRFGYLPAPPAKFN------DMFDADMETAIRTYQHNFGL  105

Query  175  NSTGILDADTVRQMTKPRCGVADIINGRPGGPSEVVPN--YRFYPGEPKWPNQKSQLTFG  348
             +TG LDA TV +M  PRCGVADIING       V     Y ++PG P WP  K  L + 
Sbjct  106  EATGQLDAATVAKMMSPRCGVADIINGTSSMGKTVHGRNLYSYFPGSPSWPRSKKSLRYA  165

Query  349  FAPGTP-----AKFFIPVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFD  510
                T      A       +A   W      +F  T     AD+      GDHGDG  FD
Sbjct  166  ITAATETTIDRATLSRVFASAFARWSAATTLNFTETASASDADITIGFHSGDHGDGEAFD  225

Query  511  GPGGNYAHAFSPTIGICHFDADENWV-DHDPSPHSL----DIRSVAIHEIGHLLGLDHSE  675
            GP G  AHAFSPT G  H DA E WV   D S  SL    D+ SVA+HEIGHLLGL H  
Sbjct  226  GPLGTLAHAFSPTDGRFHLDASEAWVAGGDVSRASLDAAVDLESVAVHEIGHLLGLGHLS  285

Query  676  VPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
            V GA+M+       ++ +L  DD+ GI++LY
Sbjct  286  VEGAIMYPTITSRTQKVELANDDVVGIQSLY  316



>ref|XP_002274477.1| PREDICTED: metalloendoproteinase 1 [Vitis vinifera]
 emb|CBI16616.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/265 (40%), Positives = 142/265 (54%), Gaps = 20/265 (8%)
 Frame = +1

Query  7    GSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNSTG  186
            G+++G R+ G+  LKKY   FGY+     N +    D F  +LESA+  YQ +  L  TG
Sbjct  53   GARRGSRISGMAELKKYFNRFGYLGFQDGNVT----DVFDTRLESAVAAYQAKLGLPVTG  108

Query  187  ILDADTVRQMTKPRCGVADIINGRPGGPSEVVPNYRFYPGEPKWPNQ-KSQLTFGFAPGT  363
             LD++T+ QM  PRCG+ D +      P     +Y ++PG+P+W       LT+ F+P  
Sbjct  109  RLDSETLSQMMSPRCGMRDAMQ-----PMHAAMHYVYFPGKPRWARPIPMTLTYAFSPEN  163

Query  364  PAKFFI------PVYTALRDWHNVGHFSFQRT-QYEHADLKFSLARGDHGDGVPFDGPGG  522
               +            A   W +V   SF  T  Y  AD+K    RGDHGDG PFDG  G
Sbjct  164  LVGYLSLEDIRGAFKLAFARWASVIPVSFSETDTYSFADIKIGFYRGDHGDGEPFDGVLG  223

Query  523  NYAHAFSPTIGICHFDADENW---VDHDPSPHSLDIRSVAIHEIGHLLGLDHSEVPGAVM  693
              AHAFSP  G  H DA E W   ++ + S  ++D+ SVA HEIGHLLGL HS V  +VM
Sbjct  224  VLAHAFSPESGKFHLDAAETWAVDLESEKSTVAIDLESVATHEIGHLLGLAHSPVKESVM  283

Query  694  WSEFEYGQKRRDLTPDDINGIRALY  768
            +   +   K+ DL  DDI  ++ALY
Sbjct  284  YPSLKPRAKKADLKLDDIEAVQALY  308



>ref|NP_001065361.2| Os10g0557900 [Oryza sativa Japonica Group]
 gb|AAK55453.1|AC069300_8 putative metalloproteinase [Oryza sativa Japonica Group]
 gb|AAP54980.1| Matrixin family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27198.2| Os10g0557900 [Oryza sativa Japonica Group]
Length=355

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 141/275 (51%), Gaps = 23/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L  + +G  V GL  LK+YL  FGY+     +++    D F + LE A+R YQTR  L  
Sbjct  42   LLDAGRGSHVTGLAELKRYLARFGYMAKPGRDTT----DAFDEHLEVAVRRYQTRFSLPV  97

Query  181  TGILDADTVRQMTKPRCGVAD-------IINGRPGGPSEVVPNYRFYPGEPKWPNQKSQL  339
            TG LD  T+ Q+  PRCGV D        +   PG    VV  + F+ GEP+W      +
Sbjct  98   TGRLDNATLDQIMSPRCGVGDDDVERPVSVALSPGAQGGVVSRFTFFKGEPRWTRSDPPI  157

Query  340  TFGFA--PGTPAKFFIPVYT------ALRDWHNVGHFSFQRTQ-YEHADLKFSLARGDHG  492
               +A  P     +  P         A   W       F  T  YE AD+K     G+HG
Sbjct  158  VLSYAVSPTATVGYLPPAAVRAVFQRAFARWARTIPVGFVETDDYEAADIKVGFYAGNHG  217

Query  493  DGVPFDGPGGNYAHAFSPTIGICHFDADENWV---DHDPSPHSLDIRSVAIHEIGHLLGL  663
            DGVPFDGP G   HAFSP  G  H DA E+W    D D +  ++D+ SVA HEIGH+LGL
Sbjct  218  DGVPFDGPLGILGHAFSPKNGRLHLDASEHWAVDFDVDATASAIDLESVATHEIGHVLGL  277

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS  P AVM+   +  +K+  LT DD+ G++ALY
Sbjct  278  GHSASPRAVMYPSIKPREKKVRLTVDDVEGVQALY  312



>gb|EAY87473.1| hypothetical protein OsI_08881 [Oryza sativa Indica Group]
Length=372

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 142/275 (52%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  50   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  181  TGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPN--YRFYPGEPKWPNQKSQL  339
            TG LD DTV QM  PRCGVAD+ING     R    + +     Y ++PG P WP  +  L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPMWPPFRRNL  167

Query  340  TFGFAPGTP-----AKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
             +     +      A        A   W       F + +   +AD+      GDHGDG 
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDH-DPSPHS-----LDIRSVAIHEIGHLLGL  663
             FDGP G  AHAFSPT G  H DA E WV   D S  S     +D+ SVA+HEIGHLLGL
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLLGL  287

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS VP ++M+     G ++ DL  DD+ GI++LY
Sbjct  288  GHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>ref|NP_001048075.1| Os02g0740700 [Oryza sativa Japonica Group]
 dbj|BAD15762.1| putative zinc metalloproteinase [Oryza sativa Japonica Group]
 dbj|BAF09989.1| Os02g0740700 [Oryza sativa Japonica Group]
Length=372

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 142/275 (52%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  50   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  181  TGILDADTVRQMTKPRCGVADIING-----RPGGPSEVVPN--YRFYPGEPKWPNQKSQL  339
            TG LD DTV QM  PRCGVAD+ING     R    + +     Y ++PG P WP  +  L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSAAALRGRHLYSYFPGGPMWPPFRRNL  167

Query  340  TFGFAPGTP-----AKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
             +     +      A        A   W       F + +   +AD+      GDHGDG 
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWVDH-DPSPHS-----LDIRSVAIHEIGHLLGL  663
             FDGP G  AHAFSPT G  H DA E WV   D S  S     +D+ SVA+HEIGHLLGL
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLLGL  287

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS VP ++M+     G ++ DL  DD+ GI++LY
Sbjct  288  GHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



>gb|EAZ24565.1| hypothetical protein OsJ_08327 [Oryza sativa Japonica Group]
Length=372

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 141/275 (51%), Gaps = 21/275 (8%)
 Frame = +1

Query  1    LQGSKKGDRVKGLYNLKKYLKTFGYINDLSYNSSSWDADYFSDQLESAIRTYQTRRHLNS  180
            L G   G+  +GL  LK YL  FGY+     +S   DA  F D LE+AI  YQ    LN+
Sbjct  50   LSGCHAGEEREGLGRLKDYLSHFGYLPPPPSSSPYSDA--FDDSLEAAIAAYQRNFGLNA  107

Query  181  TGILDADTVRQMTKPRCGVADIINGRP----GGPSEVVPN---YRFYPGEPKWPNQKSQL  339
            TG LD DTV QM  PRCGVAD+ING         S  +     Y ++PG P WP  +  L
Sbjct  108  TGELDTDTVDQMVAPRCGVADVINGTSTMDRNSSSAALRGRNLYSYFPGGPMWPPFRRNL  167

Query  340  TFGFAPGTP-----AKFFIPVYTALRDWHNVGHFSF-QRTQYEHADLKFSLARGDHGDGV  501
             +     +      A        A   W       F + +   +AD+      GDHGDG 
Sbjct  168  RYAITATSATSIDRATLSAVFARAFSRWAAATRLQFTEVSSASNADITIGFYSGDHGDGE  227

Query  502  PFDGPGGNYAHAFSPTIGICHFDADENWV-DHDPSPHS-----LDIRSVAIHEIGHLLGL  663
             FDGP G  AHAFSPT G  H DA E WV   D S  S     +D+ SVA+HEIGHLLGL
Sbjct  228  AFDGPLGTLAHAFSPTDGRFHLDAAEAWVASGDVSTSSSFGTAVDLESVAVHEIGHLLGL  287

Query  664  DHSEVPGAVMWSEFEYGQKRRDLTPDDINGIRALY  768
             HS VP ++M+     G ++ DL  DD+ GI++LY
Sbjct  288  GHSSVPDSIMYPTIRTGTRKVDLESDDVLGIQSLY  322



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1807486864830