BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23378_g1_i1 len=619 path=[4581:0-618]

Length=619
                                                                      Score     E

gb|EYU44641.1|  hypothetical protein MIMGU_mgv1a005164mg              80.1    5e-14   
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                            79.7    5e-14   
gb|KHN11421.1|  3-ketoacyl-CoA synthase 6                             79.0    1e-13   
ref|XP_003555901.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        79.0    1e-13   
ref|XP_006828643.1|  hypothetical protein AMTR_s00129p00101620        76.3    2e-13   
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        78.2    2e-13   
ref|XP_002315942.1|  ECERIFERUM 6 family protein                      78.2    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             78.2    2e-13   
ref|XP_010681548.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        78.2    2e-13   
gb|KDP29403.1|  hypothetical protein JCGZ_18324                       78.2    2e-13   
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                             77.8    2e-13   
ref|XP_009605059.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        76.3    4e-13   
ref|XP_009762000.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        77.4    4e-13   
ref|XP_004497096.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        77.4    4e-13   
ref|XP_007153392.1|  hypothetical protein PHAVU_003G031300g           77.4    4e-13   
ref|XP_003637444.1|  3-ketoacyl-CoA synthase                          77.0    5e-13   
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                        77.0    5e-13   
ref|XP_008446598.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             77.0    6e-13   
ref|XP_011097190.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        76.6    6e-13   
ref|XP_010926125.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        76.6    6e-13   
ref|XP_002311457.1|  hypothetical protein POPTR_0008s11920g           76.6    8e-13   Populus trichocarpa [western balsam poplar]
ref|XP_004135090.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...  76.3    8e-13   
ref|XP_004135091.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...  76.3    8e-13   
dbj|BAD94789.1|  very-long-chain fatty acid condensing enzyme (CUT1)  70.9    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282526.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             76.3    1e-12   Vitis vinifera
ref|XP_006841272.1|  hypothetical protein AMTR_s00135p00117490        75.9    1e-12   
gb|KHN05569.1|  3-ketoacyl-CoA synthase 6                             75.5    1e-12   
ref|XP_003536684.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             75.5    2e-12   
ref|XP_003614634.1|  3-ketoacyl-CoA synthase                          75.5    2e-12   
ref|XP_002531630.1|  acyltransferase, putative                        75.5    2e-12   Ricinus communis
emb|CDP02779.1|  unnamed protein product                              75.5    2e-12   
ref|XP_006344141.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.5    2e-12   
ref|XP_006828617.1|  hypothetical protein AMTR_s00129p00078690        72.8    2e-12   
ref|XP_003531926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.1    2e-12   
ref|XP_009786212.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             75.1    2e-12   
ref|XP_009390357.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.1    2e-12   
ref|XP_011076851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.1    2e-12   
ref|XP_011099560.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.1    3e-12   
ref|XP_011099559.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             75.1    3e-12   
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                               74.7    3e-12   
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             74.7    3e-12   
ref|XP_010103772.1|  3-ketoacyl-CoA synthase 6                        74.7    3e-12   
ref|XP_011007926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             74.3    4e-12   
ref|XP_010692961.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        74.3    4e-12   
gb|AIV98044.1|  3-ketoacyl-CoA synthase                               73.9    4e-12   
gb|ABA01490.1|  3-ketoacyl-CoA synthase                               74.3    4e-12   Gossypium hirsutum [American cotton]
ref|XP_007222962.1|  hypothetical protein PRUPE_ppa006758mg           73.9    4e-12   
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             74.3    4e-12   
ref|XP_004299082.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.9    5e-12   
ref|XP_006344142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.9    6e-12   
ref|XP_004238923.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.9    6e-12   
ref|XP_007142908.1|  hypothetical protein PHAVU_007G027100g           73.6    7e-12   
ref|XP_008802438.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.6    8e-12   
gb|EPS61116.1|  hypothetical protein M569_13682                       73.2    1e-11   
ref|XP_009399728.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.2    1e-11   
ref|XP_006307339.1|  hypothetical protein CARUB_v10008957mg           72.8    1e-11   
gb|EYU34398.1|  hypothetical protein MIMGU_mgv1a005204mg              72.8    1e-11   
ref|XP_009777704.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.8    1e-11   
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.8    1e-11   
ref|XP_002283730.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.8    1e-11   Vitis vinifera
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.8    1e-11   
ref|XP_009605061.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.8    1e-11   
ref|XP_010556270.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.1    2e-11   
ref|XP_010415473.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.4    2e-11   
ref|XP_010511851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    2e-11   
ref|XP_006302169.1|  hypothetical protein CARUB_v10020179mg           72.4    2e-11   
ref|XP_008389290.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    2e-11   
gb|AAM65060.1|  very-long-chain fatty acid condensing enzyme CUT1     72.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    2e-11   
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    2e-11   
ref|XP_009105040.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.4    2e-11   
ref|NP_001049406.1|  Os03g0220100                                     72.4    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_177020.1|  3-ketoacyl-CoA synthase 6                           72.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAL50069.1|  At1g68530/T26J14_10                                   72.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009598968.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.4    2e-11   
ref|XP_002888670.1|  hypothetical protein ARALYDRAFT_894621           72.4    2e-11   
emb|CDY04232.1|  BnaC06g25830D                                        72.0    2e-11   
gb|KFK41273.1|  hypothetical protein AALP_AA2G108700                  72.0    2e-11   
gb|ACN25352.1|  unknown                                               69.7    3e-11   Zea mays [maize]
gb|KDO69954.1|  hypothetical protein CISIN_1g011007mg                 71.6    3e-11   
ref|XP_006437664.1|  hypothetical protein CICLE_v10031329mg           71.6    3e-11   
gb|EMT20723.1|  3-ketoacyl-CoA synthase 6                             71.6    3e-11   
gb|ABY82171.2|  3-ketoacyl-CoA synthase I                             71.6    3e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        71.6    4e-11   
ref|XP_004232364.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             71.2    4e-11   
ref|XP_006363119.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        71.2    4e-11   
gb|ACT21783.1|  CER6                                                  71.2    4e-11   Solanum lycopersicum
ref|XP_006415873.1|  hypothetical protein EUTSA_v10007453mg           71.2    4e-11   
ref|XP_010265150.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        71.2    4e-11   
ref|XP_004238922.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             70.9    5e-11   
ref|XP_010460377.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like is...  69.3    6e-11   
ref|XP_010460376.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like is...  69.3    6e-11   
ref|XP_003558474.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.9    6e-11   
ref|XP_002890689.1|  hypothetical protein ARALYDRAFT_472828           70.5    6e-11   
ref|NP_173916.1|  3-ketoacyl-CoA synthase 5                           70.5    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842379.1|  hypothetical protein AMTR_s00079p00192440        70.5    7e-11   
gb|AAM67234.1|  fatty acid condensing enzyme CUT1, putative           70.5    7e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42223.1|  putative fatty acid condensing enzyme CUT1            70.5    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.5    9e-11   
ref|XP_009414779.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.1    1e-10   
gb|EMS60006.1|  3-ketoacyl-CoA synthase 6                             70.1    1e-10   
emb|CDP00615.1|  unnamed protein product                              70.1    1e-10   
ref|XP_008775195.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  70.1    1e-10   
ref|XP_010477925.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        70.1    1e-10   
ref|XP_010499108.1|  PREDICTED: 3-ketoacyl-CoA synthase 5             70.1    1e-10   
gb|AIE57499.1|  KCS6                                                  70.1    1e-10   
ref|XP_006651174.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.1    1e-10   
ref|XP_002465630.1|  hypothetical protein SORBIDRAFT_01g042600        70.1    1e-10   Sorghum bicolor [broomcorn]
ref|XP_010551269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             70.1    1e-10   
ref|NP_001130497.1|  uncharacterized protein LOC100191595             70.1    1e-10   Zea mays [maize]
ref|XP_008668455.1|  PREDICTED: uncharacterized protein LOC100191...  69.7    1e-10   
ref|XP_008801160.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             70.1    1e-10   
emb|CDP00616.1|  unnamed protein product                              69.7    1e-10   
ref|XP_006391129.1|  hypothetical protein EUTSA_v10018446mg           69.7    1e-10   
gb|ABG35744.1|  putative very long chain fatty acid condensing en...  69.7    1e-10   Hordeum vulgare [barley]
ref|XP_010527537.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        69.3    2e-10   
gb|AFV30025.1|  CUT1-like protein                                     67.4    2e-10   
ref|XP_010910111.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        69.3    2e-10   
gb|AFV30023.1|  CUT1-like protein                                     67.4    2e-10   
gb|AFV29977.1|  CUT1-like protein                                     67.4    2e-10   
gb|AFV29979.1|  CUT1-like protein                                     67.4    2e-10   
ref|XP_009390849.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        69.3    2e-10   
ref|XP_009115318.1|  PREDICTED: 3-ketoacyl-CoA synthase 5             68.2    5e-10   
emb|CDY42109.1|  BnaA09g28510D                                        68.2    5e-10   
gb|EYU26766.1|  hypothetical protein MIMGU_mgv1a005018mg              68.2    5e-10   
ref|XP_009391408.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             67.4    7e-10   
ref|XP_004985167.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        67.4    8e-10   
ref|XP_009784659.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        67.0    1e-09   
gb|AHX25585.1|  3-ketoacyl-CoA synthase 6                             67.0    1e-09   
ref|XP_009597817.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        67.0    1e-09   
gb|AEW08011.1|  hypothetical protein 0_16976_02                       61.6    2e-09   
ref|XP_009356710.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        66.2    2e-09   
ref|XP_002271250.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             65.9    3e-09   Vitis vinifera
emb|CAN63425.1|  hypothetical protein VITISV_040442                   65.5    3e-09   Vitis vinifera
ref|XP_008660394.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        65.5    4e-09   
ref|NP_001146356.1|  uncharacterized protein LOC100279934             63.9    9e-09   Zea mays [maize]
ref|XP_004953823.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        63.9    1e-08   
ref|XP_009380079.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        63.5    1e-08   
gb|KFK44525.1|  hypothetical protein AALP_AA1G267900                  63.5    1e-08   
emb|CBI33657.3|  unnamed protein product                              61.2    2e-08   
gb|ACO72624.1|  g14a                                                  62.4    3e-08   Zea mays [maize]
ref|NP_001130638.1|  g14A                                             62.4    3e-08   Zea mays [maize]
ref|XP_001753229.1|  predicted protein                                62.8    3e-08   
gb|ACO72625.1|  g14a                                                  62.4    3e-08   Zea mays [maize]
gb|ACO72623.1|  g14a                                                  62.4    3e-08   Zea mays [maize]
gb|EMS49285.1|  3-ketoacyl-CoA synthase 6                             62.0    6e-08   
gb|EMS55369.1|  3-ketoacyl-CoA synthase 6                             60.8    1e-07   
dbj|BAK06985.1|  predicted protein                                    60.5    1e-07   
gb|EAY87408.1|  hypothetical protein OsI_08814                        60.1    2e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001048023.2|  Os02g0731900                                     60.1    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87409.1|  hypothetical protein OsI_08815                        59.7    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006647846.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        58.9    4e-07   
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692           58.5    6e-07   
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947            58.5    6e-07   
gb|EMT10755.1|  3-ketoacyl-CoA synthase 6                             58.5    7e-07   
gb|AFG67884.1|  hypothetical protein 2_1205_02                        53.9    8e-07   
ref|XP_004498007.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       58.2    9e-07   
ref|XP_001753137.1|  predicted protein                                57.8    1e-06   
dbj|BAJ90995.1|  predicted protein                                    57.4    2e-06   
dbj|BAJ89275.1|  predicted protein                                    57.4    2e-06   
dbj|BAD94049.1|  beta-ketoacyl-CoA synthase                           53.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002979460.1|  hypothetical protein SELMODRAFT_444233           57.0    2e-06   
ref|XP_002977865.1|  hypothetical protein SELMODRAFT_443640           57.0    2e-06   
ref|XP_009406296.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        57.0    2e-06   
gb|ABK24632.1|  unknown                                               56.2    4e-06   Picea sitchensis
ref|XP_010522508.1|  PREDICTED: 3-ketoacyl-CoA synthase 19            56.2    4e-06   
ref|XP_002438192.1|  hypothetical protein SORBIDRAFT_10g009410        55.8    4e-06   Sorghum bicolor [broomcorn]
gb|AAP74371.1|  FAE1                                                  55.8    5e-06   Marchantia polymorpha
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.8    5e-06   
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.5    6e-06   
gb|AFK39024.1|  unknown                                               55.5    6e-06   
ref|XP_003637542.1|  Beta-ketoacyl-CoA synthase                       55.5    6e-06   
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.5    6e-06   
ref|XP_007013801.1|  3-ketoacyl-CoA synthase                          55.5    6e-06   
ref|XP_010227774.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        55.5    6e-06   
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                            55.5    7e-06   
ref|XP_006663015.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       55.1    7e-06   
ref|XP_007143888.1|  hypothetical protein PHAVU_007G110500g           55.5    7e-06   
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       55.5    7e-06   
ref|XP_006378068.1|  hypothetical protein POPTR_0010s01630g           53.5    8e-06   
gb|KHN10089.1|  3-ketoacyl-CoA synthase 11                            55.1    8e-06   
gb|KDP40263.1|  hypothetical protein JCGZ_02261                       55.5    8e-06   
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.1    8e-06   
ref|XP_009792392.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.1    8e-06   
ref|NP_001057331.2|  Os06g0263400                                     55.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KDP32347.1|  hypothetical protein JCGZ_13272                       55.1    8e-06   
ref|XP_003637030.1|  Beta-ketoacyl-CoA synthase                       55.1    8e-06   
ref|XP_008368384.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       55.1    8e-06   
gb|KCW57450.1|  hypothetical protein EUGRSUZ_H00229                   55.1    8e-06   
ref|XP_001758798.1|  predicted protein                                55.1    9e-06   
gb|EMT13637.1|  hypothetical protein F775_42822                       55.1    9e-06   
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       55.1    9e-06   
gb|EMT11185.1|  3-ketoacyl-CoA synthase 5                             55.1    9e-06   
gb|KFK32520.1|  hypothetical protein AALP_AA6G253600                  55.1    1e-05   
ref|XP_004495403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       55.1    1e-05   
ref|XP_006293899.1|  hypothetical protein CARUB_v10022892mg           55.1    1e-05   
gb|KDP33633.1|  hypothetical protein JCGZ_07204                       54.7    1e-05   
gb|AAF73979.1|AF214502_1  fiddlehead protein                          55.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ12187.1|  hypothetical protein OsJ_02069                        54.7    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAF73980.1|AF214504_1  fiddlehead protein                          54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAF73976.1|AF214496_1  fiddlehead protein                          54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            54.7    1e-05   
ref|NP_180193.1|  3-ketoacyl-CoA synthase 10                          54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                  54.7    1e-05   
ref|XP_010098974.1|  3-ketoacyl-CoA synthase 11                       54.7    1e-05   
emb|CDX77038.1|  BnaC04g38330D                                        54.7    1e-05   
ref|XP_006408788.1|  hypothetical protein EUTSA_v10001951mg           54.7    1e-05   
gb|EYU21941.1|  hypothetical protein MIMGU_mgv1a004813mg              54.7    1e-05   
gb|EMS60411.1|  3-ketoacyl-CoA synthase 6                             54.7    1e-05   
ref|XP_007145927.1|  hypothetical protein PHAVU_007G279500g           54.7    1e-05   
ref|XP_004241809.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.7    1e-05   
ref|XP_008391016.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like i...  54.7    1e-05   
ref|XP_006353644.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.7    1e-05   
ref|XP_009337302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.7    1e-05   
ref|XP_009349773.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.7    1e-05   
ref|XP_007034926.1|  3-ketoacyl-CoA synthase                          54.7    1e-05   
ref|XP_010527059.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            54.7    1e-05   
dbj|BAB91850.1|  putative very-long-chain fatty acid condensing e...  54.3    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006408789.1|  hypothetical protein EUTSA_v10001951mg           54.7    1e-05   
dbj|BAJ34066.1|  unnamed protein product                              54.7    1e-05   
dbj|BAF98214.1|  CM0216.300.nc                                        54.3    1e-05   Lotus japonicus
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    2e-05   
ref|NP_001043235.1|  Os01g0529800                                     54.3    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010025862.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    2e-05   
gb|KDO80368.1|  hypothetical protein CISIN_1g008975mg                 54.3    2e-05   
ref|XP_006420077.1|  hypothetical protein CICLE_v10004736mg           54.3    2e-05   
emb|CDY11498.1|  BnaA09g40640D                                        54.3    2e-05   
ref|XP_010417409.1|  PREDICTED: 3-ketoacyl-CoA synthase 10 isofor...  54.3    2e-05   
ref|XP_009389417.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        54.3    2e-05   
ref|XP_010417407.1|  PREDICTED: 3-ketoacyl-CoA synthase 10 isofor...  54.3    2e-05   
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       54.3    2e-05   
ref|XP_006451013.1|  hypothetical protein CICLE_v10007916mg           54.3    2e-05   
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg           54.3    2e-05   
ref|XP_010472653.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       54.3    2e-05   
ref|XP_010429645.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       54.3    2e-05   
gb|AHX25587.1|  3-ketoacyl-CoA synthase 11                            54.3    2e-05   
gb|KDO80366.1|  hypothetical protein CISIN_1g008975mg                 54.3    2e-05   
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg           54.3    2e-05   
ref|XP_009117027.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       54.3    2e-05   
ref|XP_009140735.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  54.3    2e-05   
ref|XP_008219888.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    2e-05   
emb|CDX76724.1|  BnaC08g33100D                                        53.9    2e-05   
emb|CDY35309.1|  BnaA04g15380D                                        53.9    2e-05   
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    2e-05   
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    2e-05   
ref|XP_009607438.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    2e-05   
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg           53.9    2e-05   
ref|XP_009801870.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.9    2e-05   
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                            53.9    2e-05   
ref|XP_008800772.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        53.9    2e-05   
ref|XP_008659433.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        53.5    2e-05   
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        53.9    2e-05   
ref|XP_006847589.1|  hypothetical protein AMTR_s00014p00234760        53.9    3e-05   
gb|AFW86298.1|  hypothetical protein ZEAMMB73_237043                  53.5    3e-05   
ref|XP_004968881.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        53.9    3e-05   
gb|ACY78677.1|  fatty acid elongase                                   53.9    3e-05   Pistacia chinensis [Chinese pistachio]
ref|NP_001057329.1|  Os06g0262200                                     53.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80357.1|  hypothetical protein OsI_22448                        53.5    3e-05   Oryza sativa Indica Group [Indian rice]
gb|EEC80356.1|  hypothetical protein OsI_22447                        53.5    3e-05   Oryza sativa Indica Group [Indian rice]
emb|CAN78895.1|  hypothetical protein VITISV_022820                   51.2    3e-05   Vitis vinifera
ref|XP_002992903.1|  hypothetical protein SELMODRAFT_43379            53.5    3e-05   
ref|XP_002980157.1|  hypothetical protein SELMODRAFT_53281            53.5    3e-05   
ref|XP_009334788.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.5    3e-05   
ref|XP_008352048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.5    3e-05   
ref|XP_001757568.1|  predicted protein                                53.5    3e-05   
ref|XP_002880771.1|  predicted protein                                53.5    4e-05   
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                  53.1    4e-05   
ref|XP_002436822.1|  hypothetical protein SORBIDRAFT_10g009460        53.1    4e-05   Sorghum bicolor [broomcorn]
ref|XP_010069186.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       53.1    4e-05   
ref|XP_001762506.1|  predicted protein                                53.1    4e-05   
gb|ADE77445.1|  unknown                                               53.1    4e-05   
gb|KHG14239.1|  3-ketoacyl-CoA synthase 10 -like protein              53.1    4e-05   
gb|AAL67993.1|  fiddlehead-like protein                               53.1    4e-05   Gossypium hirsutum [American cotton]
ref|XP_007034925.1|  3-ketoacyl-CoA synthase                          53.1    4e-05   
gb|KHN20068.1|  3-ketoacyl-CoA synthase 4                             53.1    4e-05   
ref|XP_006420076.1|  hypothetical protein CICLE_v10004738mg           53.1    4e-05   
ref|XP_007154946.1|  hypothetical protein PHAVU_003G160400g           53.1    4e-05   
ref|XP_002438200.1|  hypothetical protein SORBIDRAFT_10g009490        53.1    4e-05   Sorghum bicolor [broomcorn]
gb|AET83339.1|  hypothetical protein                                  50.4    4e-05   
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        53.1    4e-05   
gb|AET83309.1|  hypothetical protein                                  50.4    4e-05   
emb|CDX69040.1|  BnaC01g04130D                                        53.1    5e-05   
gb|EAZ00421.1|  hypothetical protein OsI_22442                        53.1    5e-05   
gb|AID60137.1|  3-ketoacyl-CoA synthase 16                            53.1    5e-05   
emb|CDX75415.1|  BnaA01g02870D                                        52.8    5e-05   
gb|AAO85419.1|  fatty acid elongase                                   52.4    5e-05   
ref|XP_006645959.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        53.1    5e-05   
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        52.8    5e-05   
ref|XP_009114823.1|  PREDICTED: 3-ketoacyl-CoA synthase 16            52.8    5e-05   
ref|NP_001057327.1|  Os06g0260500                                     52.8    5e-05   
ref|XP_010093608.1|  3-ketoacyl-CoA synthase 5                        52.8    5e-05   
gb|ACC60973.1|  beta-ketoacyl-CoA synthase                            52.8    5e-05   
gb|EAZ00427.1|  hypothetical protein OsI_22451                        52.8    5e-05   
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.8    5e-05   
ref|XP_010088926.1|  3-ketoacyl-CoA synthase 4                        52.8    5e-05   
gb|KHN12706.1|  3-ketoacyl-CoA synthase 4                             52.4    6e-05   
ref|XP_010091264.1|  3-ketoacyl-CoA synthase 11                       52.8    6e-05   
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  52.8    6e-05   
ref|XP_002308642.1|  hypothetical protein POPTR_0006s26530g           52.8    6e-05   
gb|KHG17042.1|  3-ketoacyl-CoA synthase 17 -like protein              52.8    6e-05   
emb|CDP08625.1|  unnamed protein product                              52.8    6e-05   
gb|KDO53945.1|  hypothetical protein CISIN_1g009935mg                 52.8    6e-05   
ref|XP_006489489.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       52.8    6e-05   
gb|KCW75691.1|  hypothetical protein EUGRSUZ_D00055                   49.7    6e-05   
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                            52.8    6e-05   
emb|CDO99138.1|  unnamed protein product                              52.8    6e-05   
gb|EMS67920.1|  3-ketoacyl-CoA synthase 5                             52.8    6e-05   
ref|XP_006398946.1|  hypothetical protein EUTSA_v10013296mg           52.8    6e-05   
ref|XP_004508546.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  52.4    6e-05   
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             52.8    6e-05   
ref|XP_004968880.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        52.4    7e-05   
ref|XP_006581119.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        52.4    7e-05   
gb|EMT31015.1|  3-ketoacyl-CoA synthase 5                             52.4    7e-05   
emb|CDM86023.1|  unnamed protein product                              52.4    7e-05   
gb|EMS68290.1|  3-ketoacyl-CoA synthase 15                            52.4    7e-05   
ref|XP_004965180.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        52.4    7e-05   
gb|ACJ85761.1|  unknown                                               52.4    7e-05   
gb|AFK48523.1|  unknown                                               52.4    7e-05   
ref|NP_001168534.1|  uncharacterized protein LOC100382314             52.4    7e-05   
ref|XP_010100962.1|  3-ketoacyl-CoA synthase 7                        52.4    7e-05   
gb|EMS59568.1|  3-ketoacyl-CoA synthase 6                             52.4    7e-05   
ref|XP_011019752.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            52.4    7e-05   
gb|AFW76936.1|  hypothetical protein ZEAMMB73_155419                  52.4    8e-05   
ref|XP_004508544.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  52.4    8e-05   
ref|XP_011030604.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.4    8e-05   
ref|XP_010025860.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.4    8e-05   
gb|KCW55362.1|  hypothetical protein EUGRSUZ_I01277                   52.4    8e-05   
ref|XP_007034920.1|  3-ketoacyl-CoA synthase 2                        52.4    8e-05   
emb|CDX81929.1|  BnaC08g36720D                                        52.4    8e-05   
gb|ACR15953.1|  fatty acid elongase 1                                 52.4    9e-05   
ref|XP_007034924.1|  3-ketoacyl-CoA synthase                          50.8    9e-05   
emb|CDX94721.1|  BnaC07g17300D                                        52.0    9e-05   
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        52.0    9e-05   
ref|XP_008800778.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        52.0    9e-05   
emb|CDY21665.1|  BnaA09g44160D                                        52.0    9e-05   
ref|XP_009117539.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             52.0    9e-05   
ref|XP_006387087.1|  hypothetical protein POPTR_1902s002001g          49.7    1e-04   
ref|XP_010692949.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            52.0    1e-04   
ref|NP_001168833.1|  uncharacterized protein LOC100382638             52.0    1e-04   
ref|XP_003563983.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        52.0    1e-04   
ref|XP_010932594.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        52.0    1e-04   
gb|ACF78768.1|  unknown                                               51.6    1e-04   
gb|KHN15129.1|  3-ketoacyl-CoA synthase 11                            52.0    1e-04   
ref|NP_001130522.1|  uncharacterized protein LOC100191621             52.0    1e-04   
emb|CDY22336.1|  BnaA06g36580D                                        51.6    1e-04   
gb|AFW81175.1|  acyltransferase                                       52.0    1e-04   
gb|AFY98637.1|  beta-ketoacyl-CoA synthase II                         52.0    1e-04   
ref|XP_003549787.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.0    1e-04   
ref|XP_003524525.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.0    1e-04   
ref|XP_004985602.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       52.0    1e-04   
ref|XP_003558754.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.0    1e-04   
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                  52.0    1e-04   
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            52.0    1e-04   
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        52.0    1e-04   
ref|XP_009101767.1|  PREDICTED: 3-ketoacyl-CoA synthase 19            52.0    1e-04   
ref|XP_006655984.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        52.0    1e-04   
gb|AGK29988.1|  3-ketoacyl-CoA synthase 1                             52.0    1e-04   
gb|AGK29989.1|  3-ketoacyl-CoA synthase 2                             52.0    1e-04   
gb|ABV60087.1|  beta-ketoacyl-CoA synthase                            52.0    1e-04   
gb|KHG21958.1|  3-ketoacyl-CoA synthase 11 -like protein              52.0    1e-04   
gb|KHG01499.1|  3-ketoacyl-CoA synthase 11 -like protein              52.0    1e-04   
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g           52.0    1e-04   
ref|XP_010436266.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like       51.6    1e-04   
ref|XP_009630522.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        52.0    1e-04   
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1  52.0    1e-04   
gb|EMT19713.1|  3-ketoacyl-CoA synthase 5                             51.6    1e-04   
ref|XP_004951508.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       52.0    1e-04   
ref|XP_007034923.1|  3-ketoacyl-CoA synthase                          51.6    1e-04   
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g           51.6    1e-04   
ref|XP_010437646.1|  PREDICTED: 3-ketoacyl-CoA synthase 16            51.6    1e-04   
ref|XP_003563315.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        51.6    1e-04   
ref|XP_002283935.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            51.6    1e-04   
ref|XP_008347473.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       50.8    1e-04   
gb|AES91419.2|  3-ketoacyl-CoA synthase-like protein                  51.6    1e-04   
gb|ACJ61777.1|  3-ketoacyl-CoA synthase                               51.6    1e-04   
ref|NP_001057330.1|  Os06g0262800                                     51.6    1e-04   
emb|CBI38700.3|  unnamed protein product                              51.6    1e-04   
gb|AAO48425.1|  beta-ketoacyl-CoA-synthase                            51.6    1e-04   
ref|XP_004134106.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like       51.6    1e-04   
gb|EEE65482.1|  hypothetical protein OsJ_20887                        51.6    1e-04   
gb|EMS54145.1|  3-ketoacyl-CoA synthase 5                             51.6    1e-04   
ref|XP_004165059.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  51.6    1e-04   
ref|NP_180232.1|  3-ketoacyl-CoA synthase 11                          51.6    1e-04   
gb|AGH32920.1|  ketoacyl-CoA synthase                                 51.6    1e-04   
gb|KDO53949.1|  hypothetical protein CISIN_1g046876mg                 51.6    1e-04   
gb|KFK30058.1|  hypothetical protein AALP_AA7G211400                  51.6    1e-04   
ref|XP_010098399.1|  3-ketoacyl-CoA synthase 10                       51.6    1e-04   
gb|EMT08811.1|  3-ketoacyl-CoA synthase 5                             51.6    1e-04   
ref|XP_010447115.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like       51.6    1e-04   
ref|XP_004501406.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       51.6    1e-04   
ref|XP_002457953.1|  hypothetical protein SORBIDRAFT_03g023131        51.6    1e-04   
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  51.6    1e-04   
ref|XP_003609222.1|  Beta-ketoacyl-coa synthase family protein        51.6    2e-04   
ref|XP_010932851.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    2e-04   
gb|KDP46259.1|  hypothetical protein JCGZ_10099                       51.6    2e-04   
ref|XP_008438597.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       51.6    2e-04   
ref|XP_010473048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  51.6    2e-04   
ref|XP_006420074.1|  hypothetical protein CICLE_v10006419mg           51.2    2e-04   
ref|XP_009394797.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.6    2e-04   
ref|XP_006378366.1|  hypothetical protein POPTR_0010s08990g           51.2    2e-04   
gb|ABK96299.1|  unknown                                               51.2    2e-04   
ref|XP_002455729.1|  hypothetical protein SORBIDRAFT_03g022990        51.2    2e-04   
ref|XP_004508545.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  51.2    2e-04   
gb|ADE76365.1|  unknown                                               51.2    2e-04   
ref|XP_002533930.1|  hypothetical protein RCOM_0155580                50.8    2e-04   
gb|KDP28427.1|  hypothetical protein JCGZ_14198                       51.2    2e-04   
ref|XP_003570501.2|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        51.2    2e-04   
ref|XP_006387707.1|  hypothetical protein POPTR_0658s00200g           51.2    2e-04   
gb|AGK29991.1|  3-ketoacyl-CoA synthase 7                             51.2    2e-04   
ref|XP_008782856.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       51.2    2e-04   
ref|XP_006341948.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        51.2    2e-04   
gb|KDO53948.1|  hypothetical protein CISIN_1g041111mg                 50.8    2e-04   
ref|XP_004238271.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             51.2    2e-04   
gb|AGK30017.1|  3-ketoacyl-CoA synthase 8                             51.2    2e-04   
gb|EYU26540.1|  hypothetical protein MIMGU_mgv1a006237mg              51.2    2e-04   
ref|XP_004975571.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        51.2    2e-04   
ref|XP_010109073.1|  3-ketoacyl-CoA synthase 5                        50.8    2e-04   
ref|XP_007012476.1|  3-ketoacyl-CoA synthase 10                       51.2    2e-04   
ref|XP_011027418.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       51.2    2e-04   
ref|XP_009129759.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 20   51.2    2e-04   
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        51.2    2e-04   
ref|XP_002878994.1|  hypothetical protein ARALYDRAFT_901443           51.2    2e-04   
ref|XP_002436823.1|  hypothetical protein SORBIDRAFT_10g009462        50.8    2e-04   
gb|EMT13284.1|  3-ketoacyl-CoA synthase 6                             50.8    2e-04   
gb|ABF51009.1|  putative very long chain fatty acid condensing en...  50.8    2e-04   
ref|XP_008651259.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.8    2e-04   
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g           50.8    2e-04   
ref|XP_006293527.1|  hypothetical protein CARUB_v10024547mg           50.8    2e-04   
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    2e-04   
gb|AGK30005.1|  3-ketoacyl-CoA synthase                               50.8    2e-04   
ref|XP_009123908.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.8    2e-04   
emb|CDY14892.1|  BnaA02g22340D                                        50.8    2e-04   
emb|CDX96912.1|  BnaC02g30500D                                        50.8    2e-04   
emb|CDY05644.1|  BnaC02g38930D                                        50.8    2e-04   
ref|XP_002312562.1|  hypothetical protein POPTR_0008s15990g           50.8    2e-04   
ref|XP_010518010.1|  PREDICTED: 3-ketoacyl-CoA synthase 8-like        50.8    2e-04   
ref|XP_010690872.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             50.8    2e-04   
gb|EMS60883.1|  3-ketoacyl-CoA synthase 5                             50.8    2e-04   
gb|EMS59116.1|  3-ketoacyl-CoA synthase 11                            50.8    2e-04   
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    2e-04   
gb|EMT11381.1|  3-ketoacyl-CoA synthase 6                             50.8    2e-04   
gb|ACQ41892.1|  3-ketoacyl-CoA synthase                               50.8    2e-04   
ref|XP_006412251.1|  hypothetical protein EUTSA_v10025022mg           50.8    2e-04   
ref|XP_011088405.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...  50.8    2e-04   
ref|XP_010925263.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    2e-04   
ref|XP_010924276.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        50.8    3e-04   
ref|XP_009416553.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        50.8    3e-04   
emb|CDY33931.1|  BnaA02g30560D                                        50.8    3e-04   
ref|XP_010917638.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.8    3e-04   
ref|XP_002883879.1|  hypothetical protein ARALYDRAFT_480389           50.8    3e-04   
ref|XP_009392409.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.8    3e-04   
gb|ABS18382.1|  3-ketoacyl-CoA synthase                               50.8    3e-04   
gb|EPS57140.1|  hypothetical protein M569_17681                       50.8    3e-04   
ref|XP_011088403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...  50.8    3e-04   
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860        50.8    3e-04   
ref|XP_006299425.1|  hypothetical protein CARUB_v10015586mg           50.4    3e-04   
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    3e-04   
emb|CBI29070.3|  unnamed protein product                              50.4    3e-04   
ref|XP_008785403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    3e-04   
ref|NP_179113.2|  3-ketoacyl-CoA synthase 8                           50.4    3e-04   
ref|XP_010467283.1|  PREDICTED: 3-ketoacyl-CoA synthase 8-like        50.4    3e-04   
gb|KDP38510.1|  hypothetical protein JCGZ_04435                       50.4    3e-04   
ref|XP_010488941.1|  PREDICTED: 3-ketoacyl-CoA synthase 8             50.4    3e-04   
gb|AAD03366.1|  putative fatty acid elongase                          50.4    3e-04   
ref|XP_010533183.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...  50.4    3e-04   
ref|XP_006656205.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    3e-04   
ref|XP_010914942.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    3e-04   
ref|XP_009142612.1|  PREDICTED: 3-ketoacyl-CoA synthase 13            50.4    3e-04   
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        50.4    3e-04   
ref|XP_002869162.1|  hypothetical protein ARALYDRAFT_491244           50.4    3e-04   
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.4    3e-04   
ref|XP_002536124.1|  acyltransferase, putative                        50.1    3e-04   
ref|XP_009786610.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.4    3e-04   
gb|KFK44079.1|  hypothetical protein AALP_AA1G213300                  50.4    3e-04   
gb|AGK29994.1|  3-ketoacyl-CoA synthase 4                             50.4    3e-04   
ref|XP_002517035.1|  acyltransferase, putative                        50.4    4e-04   
ref|XP_010255193.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        50.4    4e-04   
gb|EMT28137.1|  3-ketoacyl-CoA synthase 6                             50.4    4e-04   
ref|XP_003563984.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        50.4    4e-04   
ref|XP_007017550.1|  3-ketoacyl-CoA synthase 4                        50.4    4e-04   
ref|XP_002449888.1|  hypothetical protein SORBIDRAFT_05g025040        50.4    4e-04   
ref|XP_001778803.1|  predicted protein                                50.4    4e-04   
gb|EAY99068.1|  hypothetical protein OsI_21025                        50.1    4e-04   
ref|XP_010069188.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.1    4e-04   
ref|XP_011100666.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             50.4    4e-04   
ref|XP_006356047.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.1    4e-04   
ref|XP_008805392.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        50.1    4e-04   
ref|XP_009388450.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.1    4e-04   
emb|CDY26665.1|  BnaA06g13570D                                        50.1    4e-04   
ref|XP_007222815.1|  hypothetical protein PRUPE_ppa004243mg           50.1    4e-04   
dbj|BAJ90111.1|  predicted protein                                    50.1    4e-04   
emb|CDY29431.1|  BnaA06g13650D                                        50.1    4e-04   
ref|XP_008792115.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       50.1    4e-04   
ref|XP_008671656.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       49.3    4e-04   
ref|XP_010547021.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 20   50.1    4e-04   
ref|XP_010417808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            50.1    5e-04   
gb|EMS59163.1|  3-ketoacyl-CoA synthase 6                             50.1    5e-04   
ref|XP_009149432.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             50.1    5e-04   
ref|XP_008644844.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       50.1    5e-04   
ref|XP_004965178.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        50.1    5e-04   



>gb|EYU44641.1| hypothetical protein MIMGU_mgv1a005164mg [Erythranthe guttata]
Length=495

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P AD PW DCIH+YPVHIPE++KL
Sbjct  455  SGFKCNSAVWKCNRTIKTP-ADGPWTDCIHRYPVHIPEIVKL  495



>gb|AGK29999.1| 3-ketoacyl-CoA synthase 13 [Gossypium raimondii]
Length=492

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PWADCIH+YPVHIPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-KDGPWADCIHRYPVHIPEVVKL  492



>gb|KHN11421.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=460

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK PV D PWADCI +YPVHIPE++KL
Sbjct  420  SGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVHIPEIVKL  460



>ref|XP_003555901.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
Length=496

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK PV D PWADCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVHIPEIVKL  496



>ref|XP_006828643.1| hypothetical protein AMTR_s00129p00101620 [Amborella trichopoda]
 gb|ERM96059.1| hypothetical protein AMTR_s00129p00101620 [Amborella trichopoda]
Length=253

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK    D PWADCI QYPVHIPEV+KL
Sbjct  210  SGFKCNSAVWKCNRSIKVG-TDGPWADCIDQYPVHIPEVVKL  250



>ref|XP_010916172.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=496

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK PV D PWADCIH+YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCIRTIKTPV-DGPWADCIHRYPVHIPEVVKL  496



>ref|XP_002315942.1| ECERIFERUM 6 family protein [Populus trichocarpa]
 gb|ABK94727.1| unknown [Populus trichocarpa]
 gb|EEF02113.1| ECERIFERUM 6 family protein [Populus trichocarpa]
Length=496

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  DSPWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDSPWADCIDRYPVHIPEVVKL  496



>ref|XP_010066726.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Eucalyptus grandis]
 gb|KCW64742.1| hypothetical protein EUGRSUZ_G02324 [Eucalyptus grandis]
Length=496

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P+ D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKTPI-DGPWADCIDRYPVHIPEVVKL  496



>ref|XP_010681548.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC +++K P+ DSPW DCIH+YP+HIP+V+KL
Sbjct  451  SGFKCNSAVWKCLKTVKTPIKDSPWLDCIHKYPIHIPDVVKL  492



>gb|KDP29403.1| hypothetical protein JCGZ_18324 [Jatropha curcas]
Length=496

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK P+ D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRSIKTPL-DGPWADCIDRYPVHIPEVVKL  496



>gb|AGK30000.1| 3-ketoacyl-CoA synthase 5 [Gossypium raimondii]
Length=496

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCIH+YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKKP-TDGPWEDCIHRYPVHIPEVVKL  496



>ref|XP_009605059.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=343

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV  +PWADCI +YPV IP+V+KL
Sbjct  302  SGFKCNSAVWKCNRTIKTPVTHNPWADCIDRYPVDIPDVVKL  343



>ref|XP_009762000.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=498

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV  SPWADCI +YPV IP+V+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTPVTHSPWADCIDRYPVDIPDVVKL  498



>ref|XP_004497096.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cicer arietinum]
Length=496

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV D  W+DCIH+YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTPV-DGAWSDCIHRYPVHIPEIVKL  496



>ref|XP_007153392.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
 gb|ESW25386.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
Length=543

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSI+ P  D PW+DCIH YPVHIPE++KL
Sbjct  503  SGFKCNSAVWKCNRSIETPF-DGPWSDCIHSYPVHIPEIVKL  543



>ref|XP_003637444.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH44222.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK P+ D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRSIKTPI-DGPWTDCIDRYPVHIPEIVKL  496



>ref|XP_007044356.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
 gb|EOY00188.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
Length=496

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWADCIDRYPVHIPEVVKL  496



>ref|XP_008446598.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Cucumis melo]
Length=496

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK PV D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNKTIKTPV-DGPWADCIDRYPVHIPEVVKL  496



>ref|XP_011097190.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTPV-DGPWVDCIERYPVHIPEIVKL  496



>ref|XP_010926125.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=497

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV D PWADCIH+YPV IPEV+K 
Sbjct  457  SGFKCNSAVWKCNRTIKTPV-DGPWADCIHRYPVDIPEVVKF  497



>ref|XP_002311457.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
 gb|EEE88824.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
Length=496

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV D PW DCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKTPV-DGPWVDCIDRYPVHIPEVVKL  496



>ref|XP_004135090.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159295.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 gb|KGN52079.1| hypothetical protein Csa_5G609650 [Cucumis sativus]
Length=496

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK P+ D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNKTIKTPI-DGPWADCIDRYPVHIPEVVKL  496



>ref|XP_004135091.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159296.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
Length=450

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK P+ D PWADCI +YPVHIPEV+KL
Sbjct  410  SGFKCNSAVWKCNKTIKTPI-DGPWADCIDRYPVHIPEVVKL  450



>dbj|BAD94789.1| very-long-chain fatty acid condensing enzyme (CUT1) [Arabidopsis 
thaliana]
Length=80

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  40   SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  80



>ref|XP_002282526.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=496

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSA+WKCNRSI+ P  D PW DCIH+YPVHIPEV+KL
Sbjct  456  SGFKCNSAIWKCNRSIEPP-RDGPWLDCIHRYPVHIPEVVKL  496



>ref|XP_006841272.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
 gb|ERN02947.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
Length=498

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSA+WKCNRSIK P  DSPWADCI QYPV IPEV+KL
Sbjct  458  SGFKCNSAIWKCNRSIK-PETDSPWADCIDQYPVLIPEVVKL  498



>gb|KHN05569.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=461

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK PV D PWADCI +YPV IPE++KL
Sbjct  421  SGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVDIPEIVKL  461



>ref|XP_003536684.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Glycine max]
Length=496

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK PV D PWADCI +YPV IPE++KL
Sbjct  456  SGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVDIPEIVKL  496



>ref|XP_003614634.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES97592.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSIK PV + PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRSIKTPV-NGPWEDCIDRYPVHIPEIVKL  496



>ref|XP_002531630.1| acyltransferase, putative [Ricinus communis]
 gb|EEF30758.1| acyltransferase, putative [Ricinus communis]
Length=488

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK P  D PWADCI +YPVHIPEV+KL
Sbjct  448  SGFKCNSAVWKCNKTIKTP-TDGPWADCIDRYPVHIPEVVKL  488



>emb|CDP02779.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IKAP+ + PW DCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKAPM-EGPWQDCIDRYPVHIPEVVKL  496



>ref|XP_006344141.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=493

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK P +D PW+DCIH+YPV+IPE++KL
Sbjct  453  SGFKCNSAVWKCNKTIKTP-SDGPWSDCIHKYPVYIPEIVKL  493



>ref|XP_006828617.1| hypothetical protein AMTR_s00129p00078690 [Amborella trichopoda]
 gb|ERM96033.1| hypothetical protein AMTR_s00129p00078690 [Amborella trichopoda]
Length=207

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
             GFKCNSAVWKCNRSIKA  AD PWAD I QYP+HIPEV+KL
Sbjct  164  GGFKCNSAVWKCNRSIKAE-ADGPWADRIDQYPMHIPEVVKL  204



>ref|XP_003531926.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
 gb|KHN14249.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=496

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+CNRSI+ P  D PWADCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWRCNRSIQTPF-DGPWADCIDRYPVHIPEIVKL  496



>ref|XP_009786212.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana sylvestris]
Length=496

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWQDCIDRYPVHIPEIVKL  496



>ref|XP_009390357.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P+ D PW++CIH+YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCMRTVKTPI-DGPWSECIHRYPVHIPEVVKL  496



>ref|XP_011076851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV + PWADCI +YPV+IPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKTPV-EGPWADCIDKYPVYIPEVVKL  496



>ref|XP_011099560.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=497

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCI +YPVHIPE++KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-TDGPWQDCIDRYPVHIPEIVKL  497



>ref|XP_011099559.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Sesamum indicum]
Length=496

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWQDCIDRYPVHIPEIVKL  496



>gb|ACZ51240.1| 3-ketoacyl-CoA synthase [Arachis hypogaea]
Length=496

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK P+ D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNKTIKTPI-DGPWTDCIDRYPVHIPEIVKL  496



>ref|XP_008243224.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Prunus mume]
Length=496

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNRSI+ P ++ PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRSIEKP-SEGPWADCIDRYPVHIPEVVKL  496



>ref|XP_010103772.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
 gb|EXB97050.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
Length=482

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SG KCNSAVWKCNR+IK P  D PWADCI +YPVHIPE++KL
Sbjct  442  SGLKCNSAVWKCNRTIKTP-TDGPWADCIDRYPVHIPEIVKL  482



>ref|XP_011007926.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Populus euphratica]
Length=495

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVL  121
            SGFKCNSAVWKCNR+IK P  DSPWADCI +YPVHIPEV+
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDSPWADCIDRYPVHIPEVV  494



>ref|XP_010692961.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSA+WKCNR+IKAP  + PW DCIH+YPV+IP+V+KL
Sbjct  450  SGFKCNSAIWKCNRTIKAP-TEGPWDDCIHRYPVYIPDVVKL  490



>gb|AIV98044.1| 3-ketoacyl-CoA synthase, partial [Malus domestica]
Length=415

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK   +D PWADCI +YPVHIPEV+KL
Sbjct  375  SGFKCNSAVWKCNRAIKT-ASDGPWADCIDRYPVHIPEVVKL  415



>gb|ABA01490.1| 3-ketoacyl-CoA synthase [Gossypium hirsutum]
Length=492

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PWADCI  YP HIPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-KDGPWADCIQGYPAHIPEVVKL  492



>ref|XP_007222962.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
 gb|EMJ24161.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
Length=396

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I+ P ++ PWADCI +YPVHIPEV+KL
Sbjct  356  SGFKCNSAVWKCNRNIETP-SEGPWADCIDRYPVHIPEVVKL  396



>ref|XP_008339680.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Malus domestica]
Length=496

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK   +D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRAIKT-ASDGPWADCIDRYPVHIPEVVKL  496



>ref|XP_004299082.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Fragaria vesca subsp. 
vesca]
Length=498

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIK-APVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK A   DSPWADCI +YPVHIP+V+KL
Sbjct  456  SGFKCNSAVWKCNRTIKTAENDDSPWADCIERYPVHIPDVVKL  498



>ref|XP_006344142.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=494

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVAD-SPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV D +PWADCI +YPV IPEV++L
Sbjct  452  SGFKCNSAVWKCNRTIKLPVDDHNPWADCIDRYPVDIPEVVRL  494



>ref|XP_004238923.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=494

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++I+ P  D PW+DCIH+YPV+IPE++KL
Sbjct  454  SGFKCNSAVWKCNKTIETP-TDGPWSDCIHKYPVYIPEIVKL  494



>ref|XP_007142908.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
 gb|ESW14902.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
Length=496

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK PV D  W+DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRNIKTPV-DGAWSDCIDRYPVHIPEIVKL  496



>ref|XP_008802438.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=497

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK PV D PWADCIH+YPV IPEV+K 
Sbjct  457  SGFKCNSAVWKCIRTIKTPV-DGPWADCIHRYPVDIPEVVKF  497



>gb|EPS61116.1| hypothetical protein M569_13682, partial [Genlisea aurea]
Length=504

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN ++K PV D PW+DCI +YPVHIPE++KL
Sbjct  464  SGFKCNSAVWKCNTTVKNPV-DGPWSDCIERYPVHIPEIVKL  504



>ref|XP_009399728.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=494

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+C R+ KAPV D PW+DCIH+YPVH+PE++KL
Sbjct  453  SGFKCNSAVWRCLRAPKAPV-DGPWSDCIHRYPVHVPEMVKL  493



>ref|XP_006307339.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
 gb|EOA40237.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
Length=492

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-TDGPWSDCIDRYPVFIPEVVKL  492



>gb|EYU34398.1| hypothetical protein MIMGU_mgv1a005204mg [Erythranthe guttata]
Length=493

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPV-ADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+++     D PW DCIH+YPVHIPEV+KL
Sbjct  451  SGFKCNSAVWKCNRTVRIDSDGDGPWQDCIHRYPVHIPEVVKL  493



>ref|XP_009777704.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=496

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK  ++D PW+DCIH+YPV+IPEV+KL
Sbjct  456  SGFKCNSAVWKCNKTIKN-LSDGPWSDCIHKYPVYIPEVVKL  496



>ref|XP_009356268.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Pyrus x bretschneideri]
Length=496

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I    +D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTITT-TSDGPWADCIDKYPVHIPEVVKL  496



>ref|XP_002283730.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
 emb|CAN74750.1| hypothetical protein VITISV_023219 [Vitis vinifera]
Length=492

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I  P  D PWADCI +YPV+IPE++KL
Sbjct  452  SGFKCNSAVWKCNRTITTP-TDGPWADCIDRYPVYIPEIVKL  492



>ref|XP_009356269.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I    +D PWADCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTITT-TSDGPWADCIDKYPVHIPEVVKL  496



>ref|XP_009605061.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=530

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 39/42 (93%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK  ++D PW+DCIH+YPV+IPEV+KL
Sbjct  490  SGFKCNSAVWKCNKTIKN-LSDGPWSDCIHKYPVYIPEVVKL  530



>ref|XP_010556270.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Tarenaya hassleriana]
Length=231

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK  + D PW DCI +YPV+IPE++KL
Sbjct  191  SGFKCNSAVWKCNRTIKG-LTDGPWTDCIDRYPVYIPEIVKL  231



>ref|XP_010415473.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
 ref|XP_010470803.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_010511851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Camelina sativa]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_006302169.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
 gb|EOA35067.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
Length=498

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  458  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  498



>ref|XP_008389290.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Malus domestica]
Length=496

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I    +D PWADCI  YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTITT-TSDGPWADCIDNYPVHIPEVVKL  496



>gb|AAM65060.1| very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
Length=492

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  492



>ref|XP_004233492.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=496

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I  P  D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTINTP-NDGPWQDCIDKYPVHIPEIVKL  496



>ref|XP_010263663.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  +SPW DCI++YPVHIPE++KL
Sbjct  457  SGFKCNSAVWKCNRTIK-PDPESPWFDCINRYPVHIPEIVKL  497



>ref|XP_009105040.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Brassica rapa]
 emb|CDY07381.1| BnaA07g24600D [Brassica napus]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>ref|NP_001049406.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|ABF94686.1| very-long-chain fatty acid condensing enzyme, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11320.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|EAY89070.1| hypothetical protein OsI_10556 [Oryza sativa Indica Group]
 gb|EAZ26093.1| hypothetical protein OsJ_09950 [Oryza sativa Japonica Group]
 dbj|BAG90041.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96897.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P AD PW DCIH+YPV IPEV+KL
Sbjct  454  SGFKCNSAVWKCLRTVKTP-ADGPWDDCIHRYPVDIPEVVKL  494



>ref|NP_177020.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
 sp|Q9XF43.1|KCS6_ARATH RecName: Full=3-ketoacyl-CoA synthase 6; Short=KCS-6; AltName: 
Full=Cuticular protein 1; AltName: Full=Very long-chain fatty 
acid condensing enzyme 6; Short=VLCFA condensing enzyme 
6 [Arabidopsis thaliana]
 gb|AAD37122.1|AF129511_1 very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
 gb|AAG52390.1|AC011915_4 very-long-chain fatty acid condensing enzyme (CUT1); 56079-54227 
[Arabidopsis thaliana]
 gb|AEE34804.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>gb|AAL50069.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
 gb|AAM16230.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>ref|XP_009598968.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana tomentosiformis]
Length=496

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK    D PW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTS-TDGPWQDCIDRYPVHIPEIVKL  496



>ref|XP_002888670.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64929.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>emb|CDY04232.1| BnaC06g25830D [Brassica napus]
Length=497

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>gb|KFK41273.1| hypothetical protein AALP_AA2G108700 [Arabis alpina]
Length=497

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKTP-KDGPWSDCIDRYPVFIPEVVKL  497



>gb|ACN25352.1| unknown [Zea mays]
Length=231

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC RSIK P  + PW DCIH+YPV +PEV+KL
Sbjct  191  SGFKCNSAVWKCLRSIKTPT-NGPWDDCIHRYPVDVPEVVKL  231



>gb|KDO69954.1| hypothetical protein CISIN_1g011007mg [Citrus sinensis]
Length=496

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK    D+PW+DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNKTIKT-TTDNPWSDCIDRYPVHIPEIVKL  496



>ref|XP_006437664.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
 ref|XP_006484467.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Citrus sinensis]
 gb|ESR50904.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
Length=496

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK    D+PW+DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNKTIKT-TTDNPWSDCIDRYPVHIPEIVKL  496



>gb|EMT20723.1| 3-ketoacyl-CoA synthase 6 [Aegilops tauschii]
Length=496

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P  D PW DCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCLRTVKTP-TDGPWDDCIQRYPVHIPEVVKL  496



>gb|ABY82171.2| 3-ketoacyl-CoA synthase I [Triticum aestivum]
Length=496

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P  D PW DCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCLRTVKTP-TDGPWDDCIQRYPVHIPEVVKL  496



>ref|XP_010265151.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=496

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IKA   +SPW DCI +YPVHIPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKAD-PESPWFDCIDRYPVHIPEIVKL  496



>ref|XP_004232364.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=496

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCI +YPV IPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWDDCIDRYPVFIPEIVKL  496



>ref|XP_006363119.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
 gb|ACF17125.1| CER6 [Solanum tuberosum]
Length=496

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCI +YPV IPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWDDCIDRYPVFIPEIVKL  496



>gb|ACT21783.1| CER6 [Solanum lycopersicum]
Length=496

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW DCI +YPV IPE++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWDDCIDRYPVFIPEIVKL  496



>ref|XP_006415873.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
 gb|ESQ34226.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
Length=496

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK+P  + PW+DCI +YPV IPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKSP-TEGPWSDCIDRYPVFIPEVVKL  496



>ref|XP_010265150.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNS VWKCNR+I+ PV DSPW++CIH+YPV IP+V+K+
Sbjct  456  SGFKCNSVVWKCNRNIRPPV-DSPWSECIHRYPVKIPDVVKI  496



>ref|XP_004238922.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=494

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVAD-SPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCN++IK PV D +PWADCI +YPV IP+V++L
Sbjct  452  SGFKCNSAVWKCNKTIKLPVDDHNPWADCIDRYPVDIPDVVRL  494



>ref|XP_010460377.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like isoform X2 [Camelina 
sativa]
Length=294

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  254  SGFKCNSAVWKCIRTIKTPT-DGPWSDCIERYPVFIPEVVKL  294



>ref|XP_010460376.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like isoform X1 [Camelina 
sativa]
Length=294

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  254  SGFKCNSAVWKCIRTIKTPT-DGPWSDCIERYPVFIPEVVKL  294



>ref|XP_003558474.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
Length=497

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P  D PW DCIH+YPV +PEV+KL
Sbjct  457  SGFKCNSAVWKCLRTVKTP-TDGPWDDCIHRYPVEVPEVVKL  497



>ref|XP_002890689.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66948.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D  W+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-TDGAWSDCIERYPVFIPEVVKL  492



>ref|NP_173916.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
 sp|Q9C6L5.1|KCS5_ARATH RecName: Full=3-ketoacyl-CoA synthase 5; Short=KCS-5; AltName: 
Full=Very long-chain fatty acid condensing enzyme 5; Short=VLCFA 
condensing enzyme 5 [Arabidopsis thaliana]
 gb|AAG50800.1|AC079281_2 fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
 gb|AEE30626.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
Length=492

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D  W+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-TDGAWSDCIERYPVFIPEVVKL  492



>ref|XP_006842379.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
 gb|ERN04054.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
Length=462

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNS VWKCNRSIKA  AD PWADCI QYPVH  E +KL
Sbjct  420  SGFKCNSLVWKCNRSIKAE-ADGPWADCIDQYPVHTVEAVKL  460



>gb|AAM67234.1| fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
Length=492

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D  W+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-TDGAWSDCIERYPVFIPEVVKL  492



>gb|AAO42223.1| putative fatty acid condensing enzyme CUT1 [Arabidopsis thaliana]
Length=492

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D  W+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKTP-TDGAWSDCIERYPVFIPEVVKL  492



>ref|XP_006346917.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=496

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW  CI +YPVHIP+++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTP-TDGPWQHCIDKYPVHIPDIVKL  496



>ref|XP_009414779.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK PV D PW DCI +YPV IPE++KL
Sbjct  451  SGFKCNSAVWKCLRTIKGPV-DGPWTDCIDRYPVDIPEIVKL  491



>gb|EMS60006.1| 3-ketoacyl-CoA synthase 6 [Triticum urartu]
Length=445

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P  D PW DCI +YPVHIP+V+KL
Sbjct  405  SGFKCNSAVWKCLRTVKTP-TDGPWEDCIQRYPVHIPDVVKL  445



>emb|CDP00615.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IKAP    PW DCI +YP +IPEV+KL
Sbjct  452  SGFKCNSAVWKCNRTIKAP-TKGPWEDCIDRYPFYIPEVVKL  492



>ref|XP_008775195.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 6-like 
[Phoenix dactylifera]
Length=496

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK PV D PW DCIH YPV IPEV++L
Sbjct  456  SGFKCNSAVWKCIRTIKTPV-DGPWFDCIHHYPVPIPEVVQL  496



>ref|XP_010477925.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Camelina sativa]
Length=492

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCIRTIKTP-TDGPWSDCIERYPVFIPEVVKL  492



>ref|XP_010499108.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Camelina sativa]
Length=492

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCIRTIKTP-TDGPWSDCIERYPVFIPEVVKL  492



>gb|AIE57499.1| KCS6 [Camelina sativa]
Length=492

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+IK P  D PW+DCI +YPV IPEV+KL
Sbjct  452  SGFKCNSAVWKCIRTIKTP-TDGPWSDCIERYPVFIPEVVKL  492



>ref|XP_006651174.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=526

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++KAP    PW DCIH+YPV IPEV+KL
Sbjct  486  SGFKCNSAVWKCLRTVKAPTG-GPWDDCIHRYPVDIPEVVKL  526



>ref|XP_002465630.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
 gb|EER92628.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
Length=494

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC RSIK P  + PW DCIH+YPV +PEV+KL
Sbjct  454  SGFKCNSAVWKCLRSIKTP-TNGPWDDCIHRYPVDVPEVVKL  494



>ref|XP_010551269.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Tarenaya hassleriana]
Length=490

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK P  D PW+D I +YPV+IPE++KL
Sbjct  450  SGFKCNSAVWKCNRTIKVP-TDGPWSDSIDRYPVYIPEIVKL  490



>ref|NP_001130497.1| uncharacterized protein LOC100191595 [Zea mays]
 gb|ACF78737.1| unknown [Zea mays]
Length=494

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC RSIK P  + PW DCIH+YPV +PEV+KL
Sbjct  454  SGFKCNSAVWKCLRSIKTP-TNGPWDDCIHRYPVDVPEVVKL  494



>ref|XP_008668455.1| PREDICTED: uncharacterized protein LOC100191595 isoform X1 [Zea 
mays]
 gb|ACF87925.1| unknown [Zea mays]
 gb|ACN34702.1| unknown [Zea mays]
 tpg|DAA44124.1| TPA: hypothetical protein ZEAMMB73_292233 [Zea mays]
Length=494

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC RSIK P  + PW DCIH+YPV +PEV+KL
Sbjct  454  SGFKCNSAVWKCLRSIKTP-TNGPWDDCIHRYPVDVPEVVKL  494



>ref|XP_008801160.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Phoenix dactylifera]
Length=528

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+I  PV D PW+  IH+YPVHIPEV+KL
Sbjct  487  SGFKCNSAVWKCLRTITTPV-DGPWSSSIHRYPVHIPEVVKL  527



>emb|CDP00616.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC +SI+ P  D PW+DCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKCIKSIEIP-TDGPWSDCIDRYPVHIPEVVKL  496



>ref|XP_006391129.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
 gb|ESQ28415.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
Length=497

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK    D PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKCNRTIKT-TNDGPWSDCIDRYPVFIPEVVKL  497



>gb|ABG35744.1| putative very long chain fatty acid condensing enzyme CUT1;3 
[Hordeum vulgare]
Length=501

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++  P  D PW DCI +YPVHIPEV+KL
Sbjct  461  SGFKCNSAVWKCLRTVNTP-TDGPWDDCIQRYPVHIPEVVKL  501



>ref|XP_010527537.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Tarenaya hassleriana]
Length=494

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNS VWKCNR+IK  + D PW DCI +YPV+IPE++KL
Sbjct  454  SGFKCNSVVWKCNRTIKG-LTDGPWTDCIDRYPVYIPEIVKL  494



>gb|AFV30025.1| CUT1-like protein, partial [Senecio vulgaris]
Length=231

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWKCNR+IK    D PWADCI +YPV+IPEV
Sbjct  194  SGFKCNSAVWKCNRNIKTST-DGPWADCIDRYPVYIPEV  231



>ref|XP_010910111.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=498

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R+I+ PV + PW+  IH+YPVHIPEV+KL
Sbjct  457  SGFKCNSAVWKCLRTIRTPV-EGPWSGSIHRYPVHIPEVVKL  497



>gb|AFV30023.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30024.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=254

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWKCNR+IK    D PWADCI +YPV+IPEV
Sbjct  217  SGFKCNSAVWKCNRNIKTS-TDGPWADCIDRYPVYIPEV  254



>gb|AFV29977.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29978.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29985.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29986.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV30021.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30022.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWKCNR+IK    D PWADCI +YPV+IPEV
Sbjct  218  SGFKCNSAVWKCNRNIKTS-TDGPWADCIDRYPVYIPEV  255



>gb|AFV29979.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29980.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29981.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29982.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29983.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29984.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29987.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29988.1| CUT1-like protein, partial [Senecio aethnensis]
 gb|AFV29989.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29990.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29991.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29992.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29993.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29994.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29995.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29996.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29997.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29998.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV29999.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30000.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30001.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30002.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30003.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30004.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30005.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30006.1| CUT1-like protein, partial [Senecio chrysanthemifolius]
 gb|AFV30007.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30008.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30009.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30010.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30011.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30012.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30013.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30014.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30015.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30016.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30017.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30018.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30019.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
 gb|AFV30020.1| CUT1-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius]
Length=255

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWKCNR+IK    D PWADCI +YPV+IPEV
Sbjct  218  SGFKCNSAVWKCNRNIKTS-TDGPWADCIDRYPVYIPEV  255



>ref|XP_009390849.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K PV D PW+DCI +YPV IPE+++L
Sbjct  456  SGFKCNSAVWKCLRTVKTPV-DGPWSDCIDRYPVDIPEIVRL  496



>ref|XP_009115318.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Brassica rapa]
Length=497

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK NR+IK P  + PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKSNRTIKTP-TEGPWSDCIDRYPVFIPEVVKL  497



>emb|CDY42109.1| BnaA09g28510D [Brassica napus]
Length=497

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK NR+IK P  + PW+DCI +YPV IPEV+KL
Sbjct  457  SGFKCNSAVWKSNRTIKTP-TEGPWSDCIDRYPVFIPEVVKL  497



>gb|EYU26766.1| hypothetical protein MIMGU_mgv1a005018mg [Erythranthe guttata]
Length=500

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVAD-SPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR++     D  PWADCI  YPV+IPEV+KL
Sbjct  458  SGFKCNSAVWKCNRTVDPTAEDGGPWADCIDNYPVYIPEVVKL  500



>ref|XP_009391408.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Musa acuminata subsp. malaccensis]
Length=499

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  R++  PV D PW+D IH+YPVHIPEV+KL
Sbjct  458  SGFKCNSAVWRSLRTVATPV-DGPWSDSIHRYPVHIPEVVKL  498



>ref|XP_004985167.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Setaria italica]
Length=494

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC RSIK P  + PW DCI +YPV IPEV+KL
Sbjct  454  SGFKCNSAVWKCLRSIKTP-TNGPWDDCIDRYPVDIPEVVKL  494



>ref|XP_009784659.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana sylvestris]
Length=496

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK    D PW DCI +YPV IP+++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTG-TDGPWEDCIDRYPVFIPKIVKL  496



>gb|AHX25585.1| 3-ketoacyl-CoA synthase 6 [Nicotiana tabacum]
Length=497

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK    D PW DCI +YPV IP+++KL
Sbjct  457  SGFKCNSAVWKCNRTIKTG-TDGPWEDCIDRYPVFIPKIVKL  497



>ref|XP_009597817.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana tomentosiformis]
Length=496

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK    D PW DCI +YPV IP+++KL
Sbjct  456  SGFKCNSAVWKCNRTIKTG-TDGPWEDCIDRYPVFIPKIVKL  496



>gb|AEW08011.1| hypothetical protein 0_16976_02, partial [Pinus radiata]
 gb|AFG50669.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50670.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50671.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50672.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50673.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50674.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50675.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50676.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50677.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50678.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50679.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50680.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50681.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50682.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50683.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50684.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
Length=73

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC R++K P    PW+DCI +YPV IP+V+K+
Sbjct  33   SGFKCNSAVWKCLRTVKTP-TQGPWSDCILRYPVVIPDVVKM  73



>ref|XP_009356710.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK N +IK   +D PW DCI +YPVHIPEV+KL
Sbjct  456  SGFKCNSAVWKGNGAIKT-ASDGPWVDCIDRYPVHIPEVVKL  496



>ref|XP_002271250.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=492

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I  P  D PW DCI +YPV I +VL L
Sbjct  452  SGFKCNSAVWKCNRTITTP-TDGPWLDCIGRYPVSISQVLDL  492



>emb|CAN63425.1| hypothetical protein VITISV_040442 [Vitis vinifera]
Length=492

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+I  P  D PW DCI +YPV I +VL L
Sbjct  452  SGFKCNSAVWKCNRTITTP-TDGPWLDCIGRYPVSISQVLDL  492



>ref|XP_008660394.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Zea mays]
 gb|AFW89171.1| hypothetical protein ZEAMMB73_058916 [Zea mays]
Length=494

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC RS+  P +  PW DCIH+YPV +PEV+ L
Sbjct  454  SGFKCNSAVWKCLRSVNTPTS-GPWDDCIHRYPVDVPEVVSL  494



>ref|NP_001146356.1| uncharacterized protein LOC100279934 [Zea mays]
 ref|XP_008643503.1| PREDICTED: uncharacterized protein LOC100279934 isoform X1 [Zea 
mays]
 gb|ACL53765.1| unknown [Zea mays]
 gb|ACN28136.1| unknown [Zea mays]
Length=493

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A  AD PWA+CIH+YPVHIP+VLK
Sbjct  454  SGFKCNSAAWECIR--PAANADGPWANCIHRYPVHIPDVLK  492



>ref|XP_004953823.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Setaria italica]
Length=484

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A  AD PWA+CIH+YPVHIP+VLK
Sbjct  445  SGFKCNSAAWECIR--PAANADGPWANCIHRYPVHIPDVLK  483



>ref|XP_009380079.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSAVWKC R+++  V D PWADCI++YPV IP+V+K
Sbjct  456  SGFKCNSAVWKCLRTVETLV-DGPWADCINRYPVDIPDVVK  495



>gb|KFK44525.1| hypothetical protein AALP_AA1G267900 [Arabis alpina]
Length=495

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKCNR+IK   + + W+DCI +YPV IPEV+KL
Sbjct  456  SGFKCNSAVWKCNRTIKP--STNAWSDCIDRYPVFIPEVVKL  495



>emb|CBI33657.3| unnamed protein product [Vitis vinifera]
Length=191

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +2

Query  8    FKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            F   SAVWKCNR+I  P  D PWADCI +YPV+IPE++KL
Sbjct  153  FGNTSAVWKCNRTITTP-TDGPWADCIDRYPVYIPEIVKL  191



>gb|ACO72624.1| g14a [Zea mays]
Length=485

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A   D PWA+CIH+YPVHIP+VLK
Sbjct  445  SGFKCNSAAWECIRP-AANADDGPWANCIHRYPVHIPDVLK  484



>ref|NP_001130638.1| g14A [Zea mays]
 gb|ACF78938.1| unknown [Zea mays]
 gb|ACF84285.1| unknown [Zea mays]
 gb|AFW63814.1| g14A [Zea mays]
Length=485

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A   D PWA+CIH+YPVHIP+VLK
Sbjct  445  SGFKCNSAAWECIRP-AANADDGPWANCIHRYPVHIPDVLK  484



>ref|XP_001753229.1| predicted protein [Physcomitrella patens]
 gb|EDQ81858.1| predicted protein [Physcomitrella patens]
Length=532

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL*FT  136
            SGFKCNSAVW+  RSIK P   SPWA CI QYPVHI EV K+ +T
Sbjct  488  SGFKCNSAVWQALRSIKPP-KQSPWAHCIDQYPVHIDEVEKIKYT  531



>gb|ACO72625.1| g14a [Zea mays]
Length=485

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A   D PWA+CIH+YPVHIP+VLK
Sbjct  445  SGFKCNSAAWECIRP-AANADDGPWANCIHRYPVHIPDVLK  484



>gb|ACO72623.1| g14a [Zea mays]
Length=485

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A   D PWA+CIH+YPVHIP+VLK
Sbjct  445  SGFKCNSAAWECIRP-AANADDGPWANCIHRYPVHIPDVLK  484



>gb|EMS49285.1| 3-ketoacyl-CoA synthase 6 [Triticum urartu]
Length=686

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVA-DSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C     APVA D PWA C+H+YP+ +P+VLK
Sbjct  646  SGFKCNSAAWECIHP--APVAADGPWATCVHRYPIDVPDVLK  685



>gb|EMS55369.1| 3-ketoacyl-CoA synthase 6 [Triticum urartu]
Length=368

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPV-ADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   AP  AD PWA C+H+YPV IP+VLK
Sbjct  326  SGFKCNSAAWECIRPPAAPGGADGPWAACVHRYPVDIPDVLK  367



>dbj|BAK06985.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPV-ADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   AP  AD PWA C+H+YPV IP+VLK
Sbjct  442  SGFKCNSAAWECIRPPAAPGGADGPWAACVHRYPVDIPDVLK  483



>gb|EAY87408.1| hypothetical protein OsI_08814 [Oryza sativa Indica Group]
Length=442

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A  AD PWA CIH+YPV IP+VLK
Sbjct  403  SGFKCNSAAWECIR--PAANADGPWATCIHRYPVDIPDVLK  441



>ref|NP_001048023.2| Os02g0731900 [Oryza sativa Japonica Group]
 dbj|BAD15940.1| putative very-long-chain fatty acid condensing enzyme CUT1 [Oryza 
sativa Japonica Group]
 dbj|BAD16133.1| putative very-long-chain fatty acid condensing enzyme CUT1 [Oryza 
sativa Japonica Group]
 gb|EAZ24509.1| hypothetical protein OsJ_08270 [Oryza sativa Japonica Group]
 dbj|BAH00996.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF09937.2| Os02g0731900 [Oryza sativa Japonica Group]
Length=485

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A  AD PWA CIH+YPV IP+VLK
Sbjct  446  SGFKCNSAAWECIR--PAANADGPWATCIHRYPVDIPDVLK  484



>gb|EAY87409.1| hypothetical protein OsI_08815 [Oryza sativa Indica Group]
Length=404

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C R   A  AD PWA CIH+YPV IP+VLK
Sbjct  365  SGFKCNSAAWECIR--PAANADGPWATCIHRYPVDIPDVLK  403



>ref|XP_006647846.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=485

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 4/42 (10%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPV-ADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C   I+ P  AD PWA CIH+YPV IP+VLK
Sbjct  446  SGFKCNSAAWEC---IRPPANADGPWATCIHRYPVDIPDVLK  484



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+IKA     PWADCI Q+PV IPEV
Sbjct  493  SGFKCNSAVWRALRTIKAS-EKGPWADCIDQFPVAIPEV  530



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+IKA     PWADCI Q+PV IPEV
Sbjct  493  SGFKCNSAVWRALRTIKAS-EKGPWADCIDQFPVAIPEV  530



>gb|EMT10755.1| 3-ketoacyl-CoA synthase 6 [Aegilops tauschii]
Length=516

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C    +   A  PWADC+ +YPVHIPEVLK
Sbjct  477  SGFKCNSAAWECIEPARD--AQGPWADCVSRYPVHIPEVLK  515



>gb|AFG67884.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67885.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67886.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67887.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67888.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67889.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67890.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67891.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67892.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67893.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67894.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67895.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67896.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67897.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67898.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67899.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
Length=54

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  R++K    + PW DC+ +YPV IP+V K+
Sbjct  14   SGFKCNSAVWKTLRTVKRSTKN-PWLDCVDRYPVEIPDVQKV  54



>ref|XP_004498007.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Cicer arietinum]
Length=502

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  ++I      SPW D IH++PVH+P+V K+
Sbjct  459  SGFKCNSAVWKALKTINPEKEKSPWIDEIHEFPVHVPQVAKI  500



>ref|XP_001753137.1| predicted protein [Physcomitrella patens]
 gb|EDQ82178.1| predicted protein [Physcomitrella patens]
Length=519

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  R+IK P   SPWA CIH+YP H+ E+ K 
Sbjct  478  SGFKCNSAVWQALRNIKPP-EKSPWAHCIHEYPQHLDEIQKF  518



>dbj|BAJ90995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C +  +      PWADC+ +YPVHIPEVLK
Sbjct  452  SGFKCNSAAWECIQPAR-DAQQGPWADCVSRYPVHIPEVLK  491



>dbj|BAJ89275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C +  +      PWADC+ +YPVHIPEVLK
Sbjct  452  SGFKCNSAAWECIQPAR-DAQQGPWADCVSRYPVHIPEVLK  491



>dbj|BAD94049.1| beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
Length=80

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  45   SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  78



>ref|XP_002979460.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
 gb|EFJ19349.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
Length=510

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  RSIK P +  PW DCI +YPV IP+ +++
Sbjct  470  SGFKCNSAVWRALRSIKPP-SHGPWEDCIDKYPVRIPDAVEI  510



>ref|XP_002977865.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
 gb|EFJ21203.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
Length=510

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  RSIK P +  PW DCI +YPV IP+ +++
Sbjct  470  SGFKCNSAVWRALRSIKPP-SHGPWEDCIDKYPVRIPDAVEI  510



>ref|XP_009406296.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNSAVW+  RS+K P  D PW DCIH+YPV I
Sbjct  475  SGFKCNSAVWQALRSVK-PSPDGPWEDCIHRYPVEI  509



>gb|ABK24632.1| unknown [Picea sitchensis]
Length=530

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  R++K    + PW DC+ +YPV IP+V K+
Sbjct  490  SGFKCNSAVWKTLRTVKRSTKN-PWLDCVDRYPVEIPDVQKM  530



>ref|XP_010522508.1| PREDICTED: 3-ketoacyl-CoA synthase 19 [Tarenaya hassleriana]
Length=528

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++      +PW D IHQ+PVH+P++
Sbjct  486  SGFKCNSAVWKALRTVDPTKEKNPWIDEIHQFPVHVPKI  524



>ref|XP_002438192.1| hypothetical protein SORBIDRAFT_10g009410 [Sorghum bicolor]
 gb|EER89559.1| hypothetical protein SORBIDRAFT_10g009410 [Sorghum bicolor]
Length=490

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C     A  A+ PWA  IH+YPVHIP+V+K
Sbjct  451  SGFKCNSAAWECIE--PARTAEGPWATSIHRYPVHIPDVMK  489



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  R++K P A  PW  CI  YPV IPEV K 
Sbjct  487  SGFKCNSAVWQAVRTLKPP-ARGPWTHCIDSYPVKIPEVYKF  527



>ref|XP_004245214.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
 ref|XP_010325133.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=505

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  RSI      +PW D IHQ+PV +P+V ++
Sbjct  464  SGFKCNSAVWKALRSINPDKEKNPWMDEIHQFPVDVPKVARI  505



>ref|XP_003555524.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P+V
Sbjct  474  SGFKCNSAVWRALRTINPAKEKNPWMDEIHEFPVHVPKV  512



>gb|AFK39024.1| unknown [Medicago truncatula]
Length=521

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  ++I      +PW D IH++PVH+P+V K+
Sbjct  477  SGFKCNSAVWKALKTINPAKEKNPWIDEIHEFPVHVPKVSKV  518



>ref|XP_003637542.1| Beta-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH41035.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=521

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  ++I      +PW D IH++PVH+P+V K+
Sbjct  477  SGFKCNSAVWKALKTINPAKEKNPWIDEIHEFPVHVPKVSKV  518



>ref|XP_003519009.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
 gb|KHN15393.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=521

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P+V
Sbjct  478  SGFKCNSAVWRALRTINPAKEKNPWMDEIHEFPVHVPKV  516



>ref|XP_007013801.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY31420.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=505

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I      SPW D IHQ+PV +P+V
Sbjct  464  SGFKCNSAVWKALRTINPAKERSPWMDEIHQFPVDVPKV  502



>ref|XP_010227774.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
 ref|XP_010227775.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
 ref|XP_010227776.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
Length=488

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSI-KAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+C RS        +PWAD IHQYPV+IP V
Sbjct  448  SGFKCNSAVWECIRSAGNNTTIGAPWADSIHQYPVNIPAV  487



>gb|KHN05051.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=471

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P+V
Sbjct  428  SGFKCNSAVWRALRTINPAKEKNPWMDEIHEFPVHVPKV  466



>ref|XP_006663015.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Oryza brachyantha]
Length=349

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVAD--SPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I AP AD  +PWAD IH +PV +P+V
Sbjct  303  SGFKCNSAVWKALRTI-APAADDRNPWADEIHNFPVEVPKV  342



>ref|XP_007143888.1| hypothetical protein PHAVU_007G110500g [Phaseolus vulgaris]
 gb|ESW15882.1| hypothetical protein PHAVU_007G110500g [Phaseolus vulgaris]
Length=516

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P+V
Sbjct  473  SGFKCNSAVWRALRTINPAKEKNPWMDEIHEFPVHVPKV  511



>ref|XP_003536202.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Glycine max]
 gb|KHN30556.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=517

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P+V
Sbjct  474  SGFKCNSAVWRALRTINPAKEKNPWMDEIHEFPVHVPKV  512



>ref|XP_006378068.1| hypothetical protein POPTR_0010s01630g [Populus trichocarpa]
 gb|ERP55865.1| hypothetical protein POPTR_0010s01630g [Populus trichocarpa]
Length=175

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWKC  +  A +A+  W D IH+YPV IP+++K+
Sbjct  134  SGFKCNSAVWKCIYNEGADIAN-IWEDEIHRYPVEIPDIMKI  174



>gb|KHN10089.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=433

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I     ++PW D IH +PVH+P+V
Sbjct  390  SGFKCNSAVWRALRTINPAKENNPWMDEIHDFPVHVPKV  428



>gb|KDP40263.1| hypothetical protein JCGZ_02261 [Jatropha curcas]
Length=527

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  ++I      SPW D IH++PVH+P+V+ +
Sbjct  482  SGFKCNSAVWQALKTINPAKEKSPWIDEIHEFPVHVPKVVSI  523



>ref|XP_003536489.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]
Length=517

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I     ++PW D IH +PVH+P+V
Sbjct  474  SGFKCNSAVWRALRTINPAKENNPWMDEIHDFPVHVPKV  512



>ref|XP_009792392.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
 ref|XP_009792393.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=511

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  R+I      +PW D IHQ+PV +P+V ++
Sbjct  470  SGFKCNSAVWKALRTINPAEEKNPWMDEIHQFPVDVPKVARI  511



>ref|NP_001057331.2| Os06g0263400 [Oryza sativa Japonica Group]
 dbj|BAD54091.1| putative very-long-chain fatty acid condensing enzyme CUT1 [Oryza 
sativa Japonica Group]
 dbj|BAD54353.1| putative very-long-chain fatty acid condensing enzyme CUT1 [Oryza 
sativa Japonica Group]
 gb|EAZ36552.1| hypothetical protein OsJ_20891 [Oryza sativa Japonica Group]
 dbj|BAF19245.2| Os06g0263400 [Oryza sativa Japonica Group]
Length=504

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSA W+C  S+ A  AD PWAD IHQYPV I    K+
Sbjct  463  SGFKCNSAAWECI-SLPARDADGPWADSIHQYPVAITTTTKM  503



>gb|KDP32347.1| hypothetical protein JCGZ_13272 [Jatropha curcas]
Length=511

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I      SPW D IHQ+PV +P V
Sbjct  470  SGFKCNSAVWKALRTINPAKEKSPWMDEIHQFPVDVPRV  508



>ref|XP_003637030.1| Beta-ketoacyl-CoA synthase [Medicago truncatula]
Length=565

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  ++I      +PW D IH++PVH+P+V K+
Sbjct  521  SGFKCNSAVWKALKTINPAKEKNPWIDEIHEFPVHVPKVSKV  562



>ref|XP_008368384.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Malus domestica]
Length=521

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  R++K     +PW D IH++PV +P+V  L
Sbjct  478  SGFKCNSAVWKALRTVKPAKEKNPWIDEIHEFPVEVPKVAAL  519



>gb|KCW57450.1| hypothetical protein EUGRSUZ_H00229 [Eucalyptus grandis]
Length=483

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  R+I      +PW D IH++PVH+P+ + +
Sbjct  437  SGFKCNSAVWKALRTIDPAKEKNPWMDKIHEFPVHVPKAVSI  478



>ref|XP_001758798.1| predicted protein [Physcomitrella patens]
 gb|EDQ76304.1| predicted protein [Physcomitrella patens]
Length=519

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  R+IK P   SPWA CI++YP H+ E+ K 
Sbjct  478  SGFKCNSAVWQALRNIK-PSQRSPWAHCINEYPQHVDEIQKF  518



>gb|EMT13637.1| hypothetical protein F775_42822 [Aegilops tauschii]
Length=464

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 4/42 (10%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVA-DSPWADCIHQYPVHIPEVLK  124
            SG KCNSA W+C   I+ P A D PWA C+H+YPV +P+VLK
Sbjct  425  SGVKCNSAAWEC---IRPPAALDGPWASCVHRYPVDVPDVLK  463



>ref|XP_009348991.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Pyrus x bretschneideri]
Length=521

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  R++K     +PW D IH++PV +P+V  L
Sbjct  478  SGFKCNSAVWKALRTVKPAKEKNPWIDEIHEFPVEVPKVAAL  519



>gb|EMT11185.1| 3-ketoacyl-CoA synthase 5 [Aegilops tauschii]
Length=487

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+C RS       +PWAD IH YP++I EV
Sbjct  448  SGFKCNSAVWQCIRSPGNTTVGAPWADSIHLYPLNISEV  486



>gb|KFK32520.1| hypothetical protein AALP_AA6G253600 [Arabis alpina]
Length=547

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  512  SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  545



>ref|XP_004495403.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Cicer arietinum]
Length=514

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R++      +PW D IHQ+PVH+P+V
Sbjct  472  SGFKCNSAVWRALRTVDPLQEINPWMDEIHQFPVHVPKV  510



>ref|XP_006293899.1| hypothetical protein CARUB_v10022892mg, partial [Capsella rubella]
 gb|EOA26797.1| hypothetical protein CARUB_v10022892mg, partial [Capsella rubella]
Length=579

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  544  SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  577



>gb|KDP33633.1| hypothetical protein JCGZ_07204 [Jatropha curcas]
Length=343

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIP  112
            SGFKCNSAVW+  R+IK     +PW D IHQ+PV +P
Sbjct  302  SGFKCNSAVWRALRTIKPATEKNPWMDEIHQFPVDVP  338



>gb|AAF73979.1|AF214502_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  548



>gb|EAZ12187.1| hypothetical protein OsJ_02069 [Oryza sativa Japonica Group]
Length=294

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            +GF CNS  W+C +   AP AD PW DCIH+YPV +PE+
Sbjct  257  AGFDCNSVAWECVK--PAPDADGPWVDCIHRYPVQLPEI  293



>gb|AAF73980.1|AF214504_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  548



>gb|AAF73976.1|AF214496_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  548



>ref|XP_011081914.1| PREDICTED: 3-ketoacyl-CoA synthase 11 [Sesamum indicum]
Length=511

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I      +PW D IHQ+PV +P+V
Sbjct  470  SGFKCNSAVWKALRTINPAKEKNPWMDEIHQFPVEVPKV  508



>ref|NP_180193.1| 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana]
 sp|Q570B4.2|KCS10_ARATH RecName: Full=3-ketoacyl-CoA synthase 10; Short=KCS-10; AltName: 
Full=Protein FIDDLEHEAD; AltName: Full=Very long-chain fatty 
acid condensing enzyme 10; Short=VLCFA condensing enzyme 
10 [Arabidopsis thaliana]
 gb|AAF73973.1|AF214490_1 fiddlehead protein [Arabidopsis thaliana]
 gb|AAG60062.1|AF337910_1 putative beta-ketoacyl-CoA synthase FIDDLEHEAD [Arabidopsis thaliana]
 gb|AAC14526.1| beta-ketoacyl-CoA synthase (FIDDLEHEAD) [Arabidopsis thaliana]
 emb|CAA09311.1| fiddlehead protein [Arabidopsis thaliana]
 gb|AAK62618.1| At2g26250/T1D16.11 [Arabidopsis thaliana]
 gb|AAN31115.1| At2g26250/T1D16.11 [Arabidopsis thaliana]
 gb|AAN86193.1| putative beta-ketoacyl-CoA synthase FIDDLEHEAD [Arabidopsis thaliana]
 gb|AEC07813.1| 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana]
Length=550

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYPV  548



>gb|KEH42797.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=516

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R++      +PW D IH++PVH+P+V
Sbjct  471  SGFKCNSAVWRALRTVDPAKEKNPWMDEIHEFPVHVPKV  509



>ref|XP_010098974.1| 3-ketoacyl-CoA synthase 11 [Morus notabilis]
 gb|EXB76276.1| 3-ketoacyl-CoA synthase 11 [Morus notabilis]
Length=514

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I      +PW D IHQ+PV +P+V
Sbjct  473  SGFKCNSAVWKALRTINPAKEKNPWMDEIHQFPVEVPKV  511



>emb|CDX77038.1| BnaC04g38330D [Brassica napus]
Length=532

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  R +K P  ++PW DCI++YPV +
Sbjct  497  SGFKCNSVVWKAMRKVKKPARNNPWVDCINRYPVAL  532



>ref|XP_006408788.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
 gb|ESQ50241.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
Length=421

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  386  SGFKCNSVVWKAMRKVKKPARNNPWVDCINRYPV  419



>gb|EYU21941.1| hypothetical protein MIMGU_mgv1a004813mg [Erythranthe guttata]
Length=509

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  RSI      SPW + IHQ+PV +P+V
Sbjct  468  SGFKCNSAVWKALRSIDPAKEKSPWMNEIHQFPVEVPKV  506



>gb|EMS60411.1| 3-ketoacyl-CoA synthase 6 [Triticum urartu]
Length=509

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLK  124
            SGFKCNSA W+C    +   A  PWADC+ +YPV IPEVLK
Sbjct  470  SGFKCNSAAWECIEPARD--AQGPWADCVSRYPVDIPEVLK  508



>ref|XP_007145927.1| hypothetical protein PHAVU_007G279500g [Phaseolus vulgaris]
 gb|ESW17921.1| hypothetical protein PHAVU_007G279500g [Phaseolus vulgaris]
Length=519

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH +PVH+P+V
Sbjct  476  SGFKCNSAVWRALRTINPAKEKNPWMDEIHHFPVHVPKV  514



>ref|XP_004241809.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum lycopersicum]
Length=513

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  RSI      SPW D I Q+PV +P V K+
Sbjct  472  SGFKCNSAVWKALRSINPAKEKSPWMDEIDQFPVDVPRVAKI  513



>ref|XP_008391016.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like isoform X1 [Malus 
domestica]
 ref|XP_008391017.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like isoform X2 [Malus 
domestica]
 ref|XP_008360368.1| PREDICTED: 3-ketoacyl-CoA synthase 19-like [Malus domestica]
Length=521

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++K     +PW D IH++PV +P+V
Sbjct  478  SGFKCNSAVWKALRTVKPAKEKNPWIDEIHEFPVEVPKV  516



>ref|XP_006353644.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Solanum tuberosum]
Length=513

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  RSI      SPW D I Q+PV +P V K+
Sbjct  472  SGFKCNSAVWKALRSINPAKEKSPWMDEIDQFPVDVPRVAKI  513



>ref|XP_009337302.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Pyrus x bretschneideri]
Length=550

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++K     +PW D IH++PV +P+V
Sbjct  507  SGFKCNSAVWKALRTVKPAKEKNPWIDEIHEFPVEVPKV  545



>ref|XP_009349773.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Pyrus x bretschneideri]
Length=521

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++K     +PW D IH++PV +P+V
Sbjct  478  SGFKCNSAVWKALRTVKPAKEKNPWIDEIHEFPVEVPKV  516



>ref|XP_007034926.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
 gb|EOY05852.1| 3-ketoacyl-CoA synthase [Theobroma cacao]
Length=524

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  +SI      SPW D I +YPVH+P V
Sbjct  480  SGFKCNSAVWKALKSINPAKEKSPWIDEIDEYPVHVPRV  518



>ref|XP_010527059.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Tarenaya hassleriana]
Length=542

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  + +K P  D+PW DCI +YP  I
Sbjct  507  SGFKCNSVVWKAMKKVKKPARDNPWVDCIDRYPTDI  542



>dbj|BAB91850.1| putative very-long-chain fatty acid condensing enzyme CUT1 [Oryza 
sativa Japonica Group]
Length=478

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            +GF CNS  W+C +   AP AD PW DCIH+YPV +PE+
Sbjct  441  AGFDCNSVAWECVK--PAPDADGPWVDCIHRYPVQLPEI  477



>ref|XP_006408789.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
 gb|ESQ50242.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
Length=547

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  512  SGFKCNSVVWKAMRKVKKPARNNPWVDCINRYPV  545



>dbj|BAJ34066.1| unnamed protein product [Thellungiella halophila]
Length=547

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DCI++YPV
Sbjct  512  SGFKCNSVVWKAMRKVKKPARNNPWVDCINRYPV  545



>dbj|BAF98214.1| CM0216.300.nc [Lotus japonicus]
Length=510

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      SPW D IHQ+PV +P V
Sbjct  469  SGFKCNSAVWRALRTINPAKEKSPWMDEIHQFPVDVPRV  507



>ref|XP_010048253.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW80459.1| hypothetical protein EUGRSUZ_C01804 [Eucalyptus grandis]
Length=511

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++      +PW D IHQ+PV +P+V
Sbjct  470  SGFKCNSAVWKALRTVNPAKEKNPWMDEIHQFPVEVPKV  508



>ref|NP_001043235.1| Os01g0529800 [Oryza sativa Japonica Group]
 dbj|BAF05149.1| Os01g0529800, partial [Oryza sativa Japonica Group]
Length=503

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 2/39 (5%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            +GF CNS  W+C +   AP AD PW DCIH+YPV +PE+
Sbjct  466  AGFDCNSVAWECVK--PAPDADGPWVDCIHRYPVQLPEI  502



>ref|XP_010025862.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Eucalyptus grandis]
 gb|KCW57449.1| hypothetical protein EUGRSUZ_H00227 [Eucalyptus grandis]
Length=541

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P+ + +
Sbjct  495  SGFKCNSAVWRALRTIDPTKEKNPWMDEIHEFPVHVPKAVSI  536



>gb|KDO80368.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=413

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  RSI +    +PW D IH +PV +P+V
Sbjct  372  SGFKCNSAVWKALRSINSAKEKNPWMDEIHHFPVDVPKV  410



>ref|XP_006420077.1| hypothetical protein CICLE_v10004736mg [Citrus clementina]
 gb|ESR33317.1| hypothetical protein CICLE_v10004736mg [Citrus clementina]
Length=522

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVW+  R+I      +PW D IH++PVH+P V
Sbjct  476  SGFKCNSAVWQALRTINPAKEKNPWIDEIHEFPVHVPRV  514



>emb|CDY11498.1| BnaA09g40640D [Brassica napus]
Length=548

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  R +K P  ++PW DCI +YPV +
Sbjct  513  SGFKCNSVVWKAMRKVKKPARNNPWVDCISRYPVAL  548



>ref|XP_010417409.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X3 [Camelina sativa]
Length=550

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DC+++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYPV  548



>ref|XP_009389417.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNSAVW+  R++K P  D PW DCIH YPV I
Sbjct  474  SGFKCNSAVWQALRNVK-PSHDGPWEDCIHGYPVEI  508



>ref|XP_010417407.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X1 [Camelina sativa]
 ref|XP_010417408.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X2 [Camelina sativa]
Length=550

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DC+++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYPV  548



>ref|XP_006475774.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Citrus sinensis]
 gb|KDO80367.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=512

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  RSI +    +PW D IH +PV +P+V
Sbjct  471  SGFKCNSAVWKALRSINSAKEKNPWMDEIHHFPVDVPKV  509



>ref|XP_006451013.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
 gb|ESR64253.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
Length=547

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  RSI +    +PW D IH +PV +P+V
Sbjct  506  SGFKCNSAVWKALRSINSAKEKNPWMDEIHHFPVDVPKV  544



>ref|XP_006450506.1| hypothetical protein CICLE_v10008045mg [Citrus clementina]
 gb|ESR63746.1| hypothetical protein CICLE_v10008045mg [Citrus clementina]
Length=511

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I      +PW D IHQ+PV +P+V
Sbjct  470  SGFKCNSAVWKALRTINPAKEKNPWMDEIHQFPVDVPKV  508



>ref|XP_010472653.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Camelina sativa]
Length=550

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DC+++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYPV  548



>ref|XP_010429645.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Camelina sativa]
Length=550

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPV  103
            SGFKCNS VWK  R +K P  ++PW DC+++YPV
Sbjct  515  SGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYPV  548



>gb|AHX25587.1| 3-ketoacyl-CoA synthase 11 [Nicotiana tabacum]
Length=512

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  RSI      +PW D I+Q+PV +P V K+
Sbjct  471  SGFKCNSAVWKALRSINPAKEKNPWMDEINQFPVDVPRVAKI  512



>gb|KDO80366.1| hypothetical protein CISIN_1g008975mg [Citrus sinensis]
Length=547

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  RSI +    +PW D IH +PV +P+V
Sbjct  506  SGFKCNSAVWKALRSINSAKEKNPWMDEIHHFPVDVPKV  544



>ref|XP_006451014.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
 gb|ESR64254.1| hypothetical protein CICLE_v10007916mg [Citrus clementina]
Length=512

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  RSI +    +PW D IH +PV +P+V
Sbjct  471  SGFKCNSAVWKALRSINSAKEKNPWMDEIHHFPVDVPKV  509



>ref|XP_009117027.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Brassica rapa]
Length=547

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  R +K P  ++PW DCI +YPV +
Sbjct  512  SGFKCNSVVWKAMRKVKKPARNNPWVDCISRYPVAL  547



>ref|XP_009140735.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 10-like 
[Brassica rapa]
Length=549

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  R +K P  ++PW DCI +YPV +
Sbjct  514  SGFKCNSVVWKAMRKVKKPARNNPWVDCIDRYPVAL  549



>ref|XP_008219888.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Prunus mume]
Length=515

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++      +PW D IHQ+PV +P+V
Sbjct  474  SGFKCNSAVWKALRTVNPAKEKNPWMDEIHQFPVDVPKV  512



>emb|CDX76724.1| BnaC08g33100D [Brassica napus]
Length=547

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  R +K P  ++PW DCI +YPV +
Sbjct  512  SGFKCNSVVWKAMRKVKKPARNNPWVDCISRYPVAL  547



>emb|CDY35309.1| BnaA04g15380D [Brassica napus]
Length=549

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHI  109
            SGFKCNS VWK  R +K P  ++PW DCI +YPV +
Sbjct  514  SGFKCNSVVWKAMRKVKKPARNNPWVDCIDRYPVAL  549



>ref|XP_006483306.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Citrus sinensis]
 gb|KDO61649.1| hypothetical protein CISIN_1g044260mg [Citrus sinensis]
Length=511

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I      +PW D IHQ+PV +P+V
Sbjct  470  SGFKCNSAVWKALRTINPAKEKNPWMDEIHQFPVDVPKV  508



>ref|XP_009614092.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana tomentosiformis]
Length=510

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVW+  R+I      +PW D IHQ+PV +P+V ++
Sbjct  469  SGFKCNSAVWQALRTINPAEEKNPWMDEIHQFPVDVPKVARI  510



>ref|XP_009607438.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana tomentosiformis]
Length=512

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  RSI      +PW D I+Q+PV +P V K+
Sbjct  471  SGFKCNSAVWKALRSINPAKEKNPWMDEINQFPVDVPRVAKI  512



>ref|XP_007223150.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica]
 gb|EMJ24349.1| hypothetical protein PRUPE_ppa004354mg [Prunus persica]
Length=515

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R++      +PW D IHQ+PV +P+V
Sbjct  474  SGFKCNSAVWKALRTVNPAKEKNPWMDEIHQFPVDVPKV  512



>ref|XP_009801870.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Nicotiana sylvestris]
Length=512

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEVLKL  127
            SGFKCNSAVWK  RSI      +PW D I+Q+PV +P V K+
Sbjct  471  SGFKCNSAVWKALRSINPAKEKNPWMDEINQFPVDVPRVAKI  512



>gb|KHN13761.1| 3-ketoacyl-CoA synthase 11 [Glycine soja]
Length=500

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPEV  118
            SGFKCNSAVWK  R+I +    +PW D IH++PV +P +
Sbjct  459  SGFKCNSAVWKALRTINSAKEKNPWMDEIHKFPVEVPRI  497



>ref|XP_008800772.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=488

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +2

Query  2    SGFKCNSAVWKCNRSIKAPVADSPWADCIHQYPVHIPE  115
            SGFKCNSAVW+C RS+     +  WADCI QYPV + E
Sbjct  447  SGFKCNSAVWRCRRSVGRE-EEEAWADCIDQYPVQVAE  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 801610136576