BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23365_g1_i2 len=838 path=[816:0-109 926:110-225 1042:226-237
1054:238-343 1160:344-389 1206:390-496 1313:497-511 1328:512-837]

Length=838
                                                                      Score     E

gb|AEK84226.1|  cysteine protease inhibitor                           70.5    5e-12   
prf||2203261A  Cys protease inhibitor                                 68.6    2e-11
ref|XP_006362733.1|  PREDICTED: cysteine proteinase inhibitor-like    67.0    8e-11   
ref|XP_009759630.1|  PREDICTED: cysteine proteinase inhibitor A-like  67.0    8e-11   
ref|XP_009609320.1|  PREDICTED: cysteine proteinase inhibitor A-like  67.0    1e-10   
ref|XP_009605348.1|  PREDICTED: cysteine proteinase inhibitor A-like  66.6    1e-10   
ref|XP_011080491.1|  PREDICTED: cysteine proteinase inhibitor A-like  66.2    1e-10   
ref|XP_003543365.1|  PREDICTED: cysteine proteinase inhibitor         66.2    1e-10   
gb|AAL56612.1|AF454396_1  cystatin                                    65.9    2e-10   Vigna radiata [mung bean]
gb|AAL79831.1|AF469485_1  cystatin                                    66.2    2e-10   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AAA97905.1|  cysteine proteinase inhibitor                         65.9    2e-10   Glycine max [soybeans]
ref|XP_002298154.1|  cysteine protease inhibitor family protein       65.9    3e-10   Populus trichocarpa [western balsam poplar]
ref|NP_001239817.1|  cysteine proteinase inhibitor                    65.9    3e-10   
ref|XP_004228480.1|  PREDICTED: cysteine proteinase inhibitor A       65.5    3e-10   
gb|KHN35444.1|  Cysteine proteinase inhibitor                         65.5    3e-10   
gb|AAF23128.1|AF198390_1  multicystatin                               66.6    4e-10   Solanum lycopersicum
ref|XP_011042012.1|  PREDICTED: cysteine proteinase inhibitor-like    65.1    4e-10   
ref|XP_002314231.1|  hypothetical protein POPTR_0009s02740g           65.1    4e-10   Populus trichocarpa [western balsam poplar]
gb|ACU19157.1|  unknown                                               64.7    5e-10   Glycine max [soybeans]
ref|XP_004144108.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  65.1    6e-10   
emb|CAD21441.1|  putative cysteine proteinase inhibitor               64.7    6e-10   Rumex obtusifolius
ref|XP_007146172.1|  hypothetical protein PHAVU_006G018600g           64.7    7e-10   
sp|Q06445.1|CYTI_VIGUN  RecName: Full=Cysteine proteinase inhibit...  64.3    8e-10   Vigna unguiculata
ref|XP_008451048.1|  PREDICTED: cysteine proteinase inhibitor A-like  64.3    1e-09   
ref|XP_010096012.1|  Cysteine proteinase inhibitor 12                 66.6    1e-09   
sp|Q10992.1|CYTA_HELAN  RecName: Full=Cysteine proteinase inhibit...  63.5    1e-09   Helianthus annuus
ref|XP_010906414.1|  PREDICTED: cysteine proteinase inhibitor 12-...  65.9    1e-09   
pdb|4N6T|A  Chain A, Adhiron: A Stable And Versatile Peptide Disp...  63.2    1e-09   
gb|ACN85343.1|  cystatin                                              63.5    2e-09   Camellia sinensis [black tea]
gb|AAF23127.1|AF198389_1  cystatin                                    63.2    2e-09   Solanum lycopersicum
ref|XP_002523225.1|  Cysteine proteinase inhibitor, putative          63.2    3e-09   Ricinus communis
gb|AAA32672.1|  cystatin proteinase inhibitor                         62.8    3e-09   Ambrosia artemisiifolia [annual ragweed]
ref|XP_011011604.1|  PREDICTED: cysteine proteinase inhibitor-like    62.8    4e-09   
emb|CAN78115.1|  hypothetical protein VITISV_031522                   62.0    6e-09   Vitis vinifera
gb|AAC32853.1|  cysteine protease inhibitor                           64.7    7e-09   Solanum lycopersicum
ref|XP_002268378.1|  PREDICTED: cysteine proteinase inhibitor A       62.4    7e-09   Vitis vinifera
gb|AGX28142.1|  cysteine protease inhibitor                           61.6    9e-09   
ref|XP_004308672.1|  PREDICTED: cysteine proteinase inhibitor 6-like  62.8    9e-09   
ref|XP_008455746.1|  PREDICTED: cysteine proteinase inhibitor A       62.0    1e-08   
ref|XP_008788566.1|  PREDICTED: cysteine proteinase inhibitor A-like  61.6    1e-08   
gb|EYU46147.1|  hypothetical protein MIMGU_mgv1a017070mg              61.2    1e-08   
dbj|BAH47556.1|  cystatin                                             60.8    2e-08   Spinacia oleracea
gb|AAK30004.1|  cysteine proteinase inhibitor                         60.5    2e-08   Dianthus caryophyllus [carnation]
emb|CAA11899.1|  cystatin                                             60.1    3e-08   Castanea sativa
emb|CAH57553.1|  cysteine protease inhibitor                          60.8    4e-08   Populus tremula [European aspen]
gb|AAF72202.1|AF265551_1  cysteine protease inhibitor                 59.7    4e-08   Manihot esculenta [manioc]
gb|AAS21216.1|  cysteine proteinase inhibitor                         59.7    4e-08   Aegiceras corniculatum
emb|CAG38123.2|  cystatin Hv-CPI2                                     60.5    5e-08   Hordeum vulgare [barley]
emb|CAH57560.1|  cysteine protease inhibitor                          60.5    5e-08   Populus tremula [European aspen]
ref|XP_006644859.1|  PREDICTED: cysteine proteinase inhibitor 1-like  60.5    5e-08   
gb|AAY57859.1|  cysteine proteinase inhibitor                         60.1    5e-08   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008786873.1|  PREDICTED: cysteine proteinase inhibitor 12-...  61.2    6e-08   
gb|AIY68266.1|  oryzacystatin I                                       60.1    7e-08   
ref|XP_006836222.1|  hypothetical protein AMTR_s00101p00100170        60.8    7e-08   
gb|AFK41117.1|  unknown                                               58.9    9e-08   
gb|ACU24145.1|  unknown                                               61.2    9e-08   Glycine max [soybeans]
emb|CAH57559.1|  cysteine protease inhibitor                          59.7    1e-07   Populus tremula [European aspen]
gb|ADB02894.1|  multicystatin/cysteine protease inhibitor             58.9    1e-07   
gb|ACZ02398.1|  latex cystatin                                        58.5    1e-07   
gb|AGX28141.1|  cysteine protease inhibitor                           58.5    1e-07   
pdb|4LZI|A  Chain A, Characterization Of Solanum Tuberosum Multic...  61.6    1e-07   
gb|ACO39782.1|  cysteine inhibitor 1                                  58.9    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39758.1|  cysteine inhibitor 1                                  58.9    1e-07   Populus balsamifera [balsam poplar]
ref|XP_004147084.1|  PREDICTED: cysteine proteinase inhibitor 12-...  60.8    1e-07   
gb|AAY57867.1|  cysteine proteinase inhibitor                         58.9    2e-07   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAY57857.1|  cysteine proteinase inhibitor                         58.9    2e-07   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CEJ09687.1|  Cystatin protein                                     58.9    2e-07   
ref|XP_008445944.1|  PREDICTED: cysteine proteinase inhibitor 12      60.5    2e-07   
emb|CAH57539.1|  cysteine protease inhibitor                          58.5    2e-07   Populus tremula [European aspen]
gb|KHN11196.1|  Cysteine proteinase inhibitor 12                      60.5    2e-07   
ref|NP_001237734.1|  cysteine proteinase inhibitor precursor          60.5    2e-07   
sp|Q9LEI7.1|CYT1_HORVU  RecName: Full=Cysteine proteinase inhibit...  58.2    2e-07   Hordeum vulgare [barley]
ref|XP_006361154.1|  PREDICTED: multicystatin-like                    61.6    2e-07   
sp|P37842.1|CYTM_SOLTU  RecName: Full=Multicystatin; Short=MC         61.6    2e-07   Solanum tuberosum [potatoes]
dbj|BAB18768.1|  cysteine proteinase inhibitor                        58.2    2e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564419.1|  PREDICTED: cysteine proteinase inhibitor-like    58.5    2e-07   
ref|XP_010520100.1|  PREDICTED: cysteine proteinase inhibitor 6       59.3    3e-07   
gb|ABG81097.1|  cysteine proteinase inhibitor                         57.4    3e-07   
ref|XP_010031687.1|  PREDICTED: cysteine proteinase inhibitor A-like  57.4    3e-07   
emb|CAH57537.1|  cysteine protease inhibitor                          58.2    3e-07   Populus tremula [European aspen]
gb|AAY41807.1|  cysteine proteinase inhibitor                         58.2    3e-07   Populus tomentosa [Chinese white poplar]
emb|CAH57547.1|  cysteine protease inhibitor                          58.2    3e-07   Populus tremula [European aspen]
emb|CAH57567.1|  cysteine protease inhibitor                          58.2    3e-07   Populus tremula [European aspen]
emb|CAH57541.1|  cysteine protease inhibitor                          58.2    3e-07   Populus tremula [European aspen]
ref|XP_006471323.1|  PREDICTED: cysteine proteinase inhibitor 12-...  59.7    3e-07   
emb|CEJ09684.1|  Cystatin protein                                     57.8    3e-07   
emb|CAD60537.1|  cystatin                                             57.4    3e-07   Hordeum vulgare [barley]
emb|CDY35433.1|  BnaA03g19270D                                        57.0    3e-07   
ref|NP_001044550.1|  Os01g0803200                                     58.2    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AEQ54767.1|  cysteine proteinase inhibitor CPI-2                   57.4    4e-07   
emb|CAH57564.1|  cysteine protease inhibitor                          58.2    4e-07   Populus tremula [European aspen]
ref|XP_003568198.2|  PREDICTED: cysteine proteinase inhibitor-like    58.2    4e-07   
gb|KDO66413.1|  hypothetical protein CISIN_1g034261mg                 57.4    4e-07   
ref|XP_010244435.1|  PREDICTED: cysteine proteinase inhibitor 12-...  59.3    4e-07   
emb|CAH57538.1|  cysteine protease inhibitor                          57.8    4e-07   Populus tremula [European aspen]
ref|XP_009385315.1|  PREDICTED: cysteine proteinase inhibitor 6-like  57.0    4e-07   
ref|XP_008245515.1|  PREDICTED: cysteine proteinase inhibitor 6-like  57.0    4e-07   
emb|CAA60610.1|  cysteine proteinase inhibitor                        57.8    4e-07   Zea mays [maize]
ref|XP_010931548.1|  PREDICTED: cysteine proteinase inhibitor 12-...  58.9    4e-07   
gb|AGX28139.1|  cysteine protease inhibitor                           57.0    4e-07   
dbj|BAA09666.1|  cysteine proteinase inhibitor                        57.8    4e-07   Zea mays [maize]
ref|XP_010689648.1|  PREDICTED: cysteine proteinase inhibitor 6-like  58.9    4e-07   
emb|CAH57531.1|  cysteine protease inhibitor                          57.8    4e-07   Populus tremula [European aspen]
emb|CAH57532.1|  cysteine protease inhibitor                          57.8    5e-07   Populus tremula [European aspen]
ref|XP_004253396.2|  PREDICTED: multicystatin                         60.5    5e-07   
gb|ACO39793.1|  cysteine inhibitor 1                                  57.4    5e-07   Populus balsamifera [balsam poplar]
ref|XP_002303955.1|  cysteine proteinase inhibitor                    58.9    5e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011090213.1|  PREDICTED: cysteine proteinase inhibitor A-like  56.6    5e-07   
gb|AAM88397.1|AF525880_1  cysteine proteinase inhibitor               58.5    5e-07   Colocasia esculenta [cocoyam]
dbj|BAA95416.1|  multicystatin                                        59.7    5e-07   Helianthus annuus
gb|KHN37731.1|  Cysteine proteinase inhibitor 12                      59.3    6e-07   
ref|XP_006446360.1|  hypothetical protein CICLE_v10017285mg           56.6    6e-07   
ref|XP_006470502.1|  PREDICTED: cysteine proteinase inhibitor-like    56.6    6e-07   
ref|XP_010245150.1|  PREDICTED: cysteine proteinase inhibitor 12-...  58.5    6e-07   
ref|XP_009394087.1|  PREDICTED: cysteine proteinase inhibitor-like    57.4    6e-07   
pdb|1EQK|A  Chain A, Solution Structure Of Oryzacystatin-I, A Cys...  56.6    6e-07   
ref|XP_006432368.1|  hypothetical protein CICLE_v10002346mg           58.9    6e-07   
ref|XP_007010774.1|  Cysteine proteinase inhibitor 12                 58.9    6e-07   
gb|EPS68642.1|  cysteine proteinase inhibitor                         56.2    6e-07   
gb|ABQ32295.1|  cysteine protease inhibitor                           57.0    6e-07   Zea mays [maize]
gb|ABQ32296.1|  cysteine protease inhibitor                           57.4    7e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAK03799.1|  predicted protein                                    57.8    7e-07   
gb|AAB71505.1|  cysteine protease inhibitor                           56.2    7e-07   Pyrus communis
ref|XP_004165517.1|  PREDICTED: cysteine proteinase inhibitor 12-...  58.2    7e-07   
ref|XP_002879896.1|  FL3-27                                           57.0    7e-07   
emb|CAH57571.1|  cysteine protease inhibitor                          57.0    8e-07   Populus tremula [European aspen]
gb|KFK38602.1|  hypothetical protein AALP_AA3G134900                  57.8    8e-07   
ref|XP_007220494.1|  hypothetical protein PRUPE_ppa013935mg           56.2    8e-07   
dbj|BAB18766.1|  cysteine proteinase inhibitor                        57.0    8e-07   Triticum aestivum [Canadian hard winter wheat]
gb|ABB80379.1|  cystatin WC-1                                         57.0    9e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010244436.1|  PREDICTED: cysteine proteinase inhibitor A-like  57.0    9e-07   
gb|EMT09912.1|  Cysteine proteinase inhibitor                         56.2    9e-07   
ref|XP_002283400.1|  PREDICTED: cysteine proteinase inhibitor 12-...  58.2    9e-07   Vitis vinifera
emb|CAH57554.1|  cysteine protease inhibitor                          57.0    9e-07   Populus tremula [European aspen]
gb|AAB24011.1|  oryzacystatin=cysteine protease inhibitor             55.8    1e-06   
gb|AAZ98791.1|  cystatin                                              55.8    1e-06   Medicago sativa [alfalfa]
emb|CBX19819.1|  cystein proteinase inhibitor                         55.8    1e-06   
ref|XP_008801966.1|  PREDICTED: protein GAMETE EXPRESSED 3            59.7    1e-06   
ref|XP_010045098.1|  PREDICTED: cysteine proteinase inhibitor-like    55.8    1e-06   
gb|ADD51191.1|  cystatin                                              57.8    1e-06   Vitis cinerea var. helleri x Vitis riparia
ref|XP_010670580.1|  PREDICTED: cysteine proteinase inhibitor 6       58.2    1e-06   
gb|ADD69946.1|  cysteine protease inhibitor                           55.8    1e-06   Knorringia sibirica
gb|KDP40574.1|  hypothetical protein JCGZ_24573                       57.4    1e-06   
gb|ABK23526.1|  unknown                                               56.2    1e-06   Picea sitchensis
emb|CAH57551.1|  cysteine protease inhibitor                          56.2    1e-06   Populus tremula [European aspen]
ref|XP_011020467.1|  PREDICTED: cysteine proteinase inhibitor 6-like  57.8    1e-06   
gb|ABG89856.1|  cystatin                                              57.8    1e-06   Amaranthus hypochondriacus [prince's feather]
ref|XP_010938907.1|  PREDICTED: cysteine proteinase inhibitor 12-...  57.0    1e-06   
ref|XP_004493324.1|  PREDICTED: cysteine proteinase inhibitor 12-...  57.8    2e-06   
ref|XP_010499025.1|  PREDICTED: cysteine proteinase inhibitor 6-like  57.8    2e-06   
ref|NP_001237443.1|  uncharacterized protein LOC100499887 precursor   57.8    2e-06   
ref|XP_010465015.1|  PREDICTED: cysteine proteinase inhibitor 6       57.8    2e-06   
emb|CDM82757.1|  unnamed protein product                              57.8    2e-06   
gb|ACM43995.1|  cysteine proteinase inhibitor                         55.5    2e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AAY57864.1|  cysteine proteinase inhibitor                         55.8    2e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_007133641.1|  hypothetical protein PHAVU_011G196600g           57.8    2e-06   
gb|AAC69278.1|  cysteine proteinase inhibitor                         55.1    2e-06   Dianthus caryophyllus [carnation]
ref|XP_009361915.1|  PREDICTED: cysteine proteinase inhibitor A-like  55.1    2e-06   
gb|AFK41721.1|  unknown                                               57.4    2e-06   
ref|XP_010673809.1|  PREDICTED: cysteine proteinase inhibitor A-like  55.1    2e-06   
emb|CAH57540.1|  cysteine protease inhibitor                          55.8    2e-06   Populus tremula [European aspen]
pdb|3IMA|B  Chain B, Complex Strcuture Of Tarocystatin And Papain     55.1    2e-06   
ref|XP_010486966.1|  PREDICTED: cysteine proteinase inhibitor 6-like  57.4    2e-06   
emb|CDY08429.1|  BnaA05g26650D                                        57.4    2e-06   
gb|ACG37686.1|  cysteine proteinase inhibitor 2                       55.8    2e-06   Zea mays [maize]
ref|XP_008346621.1|  PREDICTED: cysteine proteinase inhibitor A-like  55.1    2e-06   
emb|CAH57549.1|  cysteine protease inhibitor                          55.8    2e-06   Populus tremula [European aspen]
emb|CAH57550.1|  cysteine protease inhibitor                          55.8    2e-06   Populus tremula [European aspen]
dbj|BAD81175.1|  putative cysteine proteinase inhibitor               56.6    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHG15686.1|  hypothetical protein F383_23695                       57.4    2e-06   
emb|CAH57534.1|  cysteine protease inhibitor                          55.5    3e-06   Populus tremula [European aspen]
emb|CAA60634.1|  cysteine proteinase inhibitor                        55.5    3e-06   Sorghum bicolor [broomcorn]
emb|CCC55944.1|  cystatin                                             54.7    3e-06   
gb|ABK22677.1|  unknown                                               55.5    3e-06   Picea sitchensis
gb|AFK38009.1|  unknown                                               57.0    3e-06   
emb|CAH57557.1|  cysteine protease inhibitor                          55.5    3e-06   Populus tremula [European aspen]
gb|AAU21498.1|  cysteine proteinase inhibitor                         54.7    3e-06   Arachis hypogaea [goober]
gb|AAA97907.1|  cysteine proteinase inhibitor                         54.7    3e-06   Glycine max [soybeans]
gb|ACU13141.1|  unknown                                               54.7    3e-06   Glycine max [soybeans]
gb|ADP50760.1|  cysteine proteinase inhibitor TrcC-4                  55.5    3e-06   
gb|ABW03251.1|  cysteine proteinase inhibitor                         54.3    3e-06   Sonneratia caseolaris
ref|NP_001042702.1|  Os01g0270100                                     57.0    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AFK35558.1|  unknown                                               54.7    3e-06   
ref|NP_001105295.1|  cystatin-1 precursor                             55.1    3e-06   Zea mays [maize]
emb|CAH57573.1|  cysteine protease inhibitor                          55.1    3e-06   Populus tremula [European aspen]
ref|NP_001106013.1|  cystatin2 precursor                              55.1    4e-06   Zea mays [maize]
emb|CAG38130.1|  cystatin Hv-CPI4                                     56.6    4e-06   Hordeum vulgare [barley]
gb|ACG31524.1|  cysteine proteinase inhibitor 2                       54.7    4e-06   Zea mays [maize]
gb|ABK22339.1|  unknown                                               56.6    4e-06   Picea sitchensis
dbj|BAK03203.1|  predicted protein                                    56.6    4e-06   
ref|XP_009384360.1|  PREDICTED: cysteine proteinase inhibitor A-like  54.3    4e-06   
gb|ABK26812.1|  unknown                                               56.2    4e-06   Picea sitchensis
ref|XP_006411355.1|  hypothetical protein EUTSA_v10017418mg           54.7    4e-06   
ref|XP_008649811.1|  PREDICTED: cysteine proteinase inhibitor         54.3    4e-06   
dbj|BAE92726.1|  multidomain cystatin                                 56.6    4e-06   Triticum aestivum [Canadian hard winter wheat]
gb|KCW89988.1|  hypothetical protein EUGRSUZ_A02187                   55.1    4e-06   
ref|XP_002267841.1|  PREDICTED: cysteine proteinase inhibitor 12      55.8    5e-06   Vitis vinifera
emb|CBI32827.3|  unnamed protein product                              55.8    5e-06   
ref|XP_010055538.1|  PREDICTED: cysteine proteinase inhibitor-like    54.7    5e-06   
ref|XP_010557894.1|  PREDICTED: cysteine proteinase inhibitor 6-like  56.2    5e-06   
ref|XP_010055569.1|  PREDICTED: cysteine proteinase inhibitor-like    54.7    6e-06   
gb|ACF49366.1|  cystatin                                              56.2    6e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010909027.1|  PREDICTED: cysteine proteinase inhibitor 6-like  55.8    7e-06   
gb|ABK20186.1|  cysteine protease inhibitor                           54.3    7e-06   Populus tomentosa [Chinese white poplar]
ref|XP_004970285.1|  PREDICTED: cystatin-1-like                       54.3    7e-06   
ref|NP_181620.1|  cysteine proteinase inhibitor 3                     53.9    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040719.1|  PREDICTED: cysteine proteinase inhibitor A-l...  53.5    8e-06   
gb|ABK23250.1|  unknown                                               55.5    8e-06   Picea sitchensis
gb|ABR16995.1|  unknown                                               55.5    8e-06   Picea sitchensis
gb|ABB89766.1|  At3g12490-like protein                                55.5    8e-06   Boechera stricta
ref|XP_008375329.1|  PREDICTED: cysteine proteinase inhibitor A-like  53.5    8e-06   
gb|AGF33489.1|  cysteine proteinase inhibitor                         53.9    9e-06   
ref|XP_009120653.1|  PREDICTED: cysteine proteinase inhibitor 6-like  55.5    9e-06   
emb|CAH57545.1|  cysteine protease inhibitor                          53.9    9e-06   Populus tremula [European aspen]
gb|ACN40125.1|  unknown                                               55.5    9e-06   Picea sitchensis
gb|AHA85335.1|  cysteine protease inhibitor                           55.5    9e-06   
ref|XP_010508791.1|  PREDICTED: cysteine proteinase inhibitor 3       53.5    9e-06   
emb|CAH57562.1|  cysteine protease inhibitor                          53.9    1e-05   Populus tremula [European aspen]
gb|ABK20187.1|  cysteine protease inhibitor                           53.9    1e-05   Populus tomentosa [Chinese white poplar]
ref|XP_011040718.1|  PREDICTED: cysteine proteinase inhibitor-lik...  54.3    1e-05   
ref|NP_850570.2|  cysteine proteinase inhibitor 6                     55.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505846.1|  PREDICTED: cysteine proteinase inhibitor 3-like  53.5    1e-05   
gb|ABK94227.1|  unknown                                               53.5    1e-05   Populus trichocarpa [western balsam poplar]
gb|ABK20185.1|  cysteine protease inhibitor                           53.5    1e-05   Populus tomentosa [Chinese white poplar]
emb|CAA89697.1|  cysteine proteinase inhibitor                        54.7    1e-05   Ricinus communis
emb|CAH57546.1|  cysteine protease inhibitor                          53.9    1e-05   Populus tremula [European aspen]
ref|XP_009141947.1|  PREDICTED: cysteine proteinase inhibitor 3-like  53.5    1e-05   
gb|AAL86314.1|  putative cysteine proteinase inhibitor cystatin B     53.5    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHG00945.1|  Cysteinease inhibitor                                 53.5    1e-05   
ref|XP_006295236.1|  hypothetical protein CARUB_v10024323mg           53.5    1e-05   
ref|XP_006644042.1|  PREDICTED: cysteine proteinase inhibitor 12-...  55.5    1e-05   
ref|XP_004511090.1|  PREDICTED: cysteine proteinase inhibitor 12-...  55.5    1e-05   
gb|AAN65082.1|  cysteine proteinase inhibitor, putative 1             54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566425.1|  cysteine proteinase inhibitor 6                     54.7    1e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17683.1|  cysteine proteinase inhibitor homolog                52.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795132.1|  PREDICTED: cysteine proteinase inhibitor 12      55.1    1e-05   
gb|ABN42208.1|  proteinase inhibitor                                  54.7    1e-05   Cakile maritima [European sea-rocket]
emb|CDY06956.1|  BnaA04g23590D                                        53.5    1e-05   
ref|XP_006298448.1|  hypothetical protein CARUB_v10014520mg           55.1    1e-05   
gb|KCW50301.1|  hypothetical protein EUGRSUZ_J00085                   54.7    1e-05   
ref|XP_007015329.1|  Cystatin B                                       52.8    1e-05   
gb|AFW97773.1|  cysteine protease inhibitor                           54.3    1e-05   
pdb|3UL5|A  Chain A, Saccharum Officinarum Canecystatin-1 In Spac...  53.5    1e-05   
gb|AAM78598.1|  cystatin                                              52.8    1e-05   Saccharum officinarum [noble cane]
ref|XP_002525552.1|  cysteine protease inhibitor, putative            55.1    1e-05   Ricinus communis
ref|XP_002299179.1|  cysteine protease inhibitor family protein       54.3    2e-05   Populus trichocarpa [western balsam poplar]
gb|AAC37479.1|  cysteine proteinase inhibitor                         54.3    2e-05   Brassica rapa
dbj|BAO79365.1|  cysteine proteinase inhibitor                        52.8    2e-05   
ref|XP_006407331.1|  hypothetical protein EUTSA_v10021442mg           54.7    2e-05   
dbj|BAB21558.1|  cystatin                                             53.1    2e-05   Coix lacryma-jobi
ref|XP_004961644.1|  PREDICTED: cysteine proteinase inhibitor 2-like  52.4    2e-05   
emb|CAJ20023.1|  putative cystatin                                    52.8    2e-05   Zea mays [maize]
emb|CEJ09683.1|  Cystatin protein                                     52.8    2e-05   
ref|XP_008673426.1|  PREDICTED: cystatin-1 isoform X1                 52.8    2e-05   
gb|KHN18133.1|  Cysteine proteinase inhibitor                         52.4    2e-05   
pdb|2W9P|A  Chain A, Crystal Structure Of Potato Multicystatin        52.0    2e-05   
ref|XP_004513212.1|  PREDICTED: multicystatin-like                    53.9    2e-05   
ref|XP_003551904.1|  PREDICTED: cysteine proteinase inhibitor-lik...  52.4    2e-05   
emb|CAA50437.1|  cysteine proteinase inhibitor (cystatin)             52.4    2e-05   Carica papaya [mamon]
gb|AFW79583.1|  hypothetical protein ZEAMMB73_655229                  54.3    2e-05   
ref|XP_008245488.1|  PREDICTED: cysteine proteinase inhibitor A-like  52.8    2e-05   
ref|XP_002526201.1|  cysteine protease inhibitor, putative            53.9    2e-05   Ricinus communis
ref|XP_006602228.1|  PREDICTED: cysteine proteinase inhibitor-lik...  52.4    3e-05   
ref|XP_006602229.1|  PREDICTED: cysteine proteinase inhibitor-lik...  52.4    3e-05   
ref|XP_006602230.1|  PREDICTED: cysteine proteinase inhibitor-lik...  52.4    3e-05   
ref|XP_010031030.1|  PREDICTED: cysteine proteinase inhibitor 12      54.3    3e-05   
ref|XP_006380966.1|  hypothetical protein POPTR_0006s03170g           53.5    3e-05   
ref|XP_002884906.1|  hypothetical protein ARALYDRAFT_897457           53.5    3e-05   
ref|XP_006602231.1|  PREDICTED: cysteine proteinase inhibitor-lik...  52.0    3e-05   
emb|CAH57533.1|  cysteine protease inhibitor                          52.4    3e-05   Populus tremula [European aspen]
emb|CDY42150.1|  BnaC05g40690D                                        53.1    4e-05   
emb|CDP06249.1|  unnamed protein product                              52.4    4e-05   
emb|CDY14750.1|  BnaC04g47470D                                        52.0    4e-05   
ref|XP_006373685.1|  hypothetical protein POPTR_0016s03070g           53.5    4e-05   
dbj|BAB18769.1|  cysteine proteinase inhibitor                        51.2    4e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003545443.2|  PREDICTED: multicystatin isoform 2               54.3    4e-05   
emb|CDY14748.1|  BnaC04g47450D                                        51.2    4e-05   
gb|ABB80381.1|  cystatin WC-4                                         52.0    4e-05   Triticum aestivum [Canadian hard winter wheat]
dbj|BAB18767.1|  cysteine proteinase inhibitor                        52.0    4e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002441309.1|  hypothetical protein SORBIDRAFT_09g024230        52.0    5e-05   
gb|AAG31653.1|  PRLI-interacting factor M                             52.8    5e-05   
ref|XP_007220532.1|  hypothetical protein PRUPE_ppa010412mg           53.1    6e-05   
gb|ACG33316.1|  multidomain cystatin                                  53.1    6e-05   
emb|CAJ20026.1|  putative cystatin                                    53.1    6e-05   
gb|KFK36955.1|  hypothetical protein AALP_AA4G194100                  50.8    7e-05   
gb|KDO66412.1|  hypothetical protein CISIN_1g034261mg                 50.4    7e-05   
tpe|CAG29024.1|  TPA: putative cystatin                               53.1    7e-05   
ref|XP_008655485.1|  PREDICTED: cysteine proteinase inhibitor 12      52.8    8e-05   
ref|NP_001288858.1|  cysteine proteinase inhibitor 6-like             52.4    8e-05   
gb|AAQ62561.1|  multicystatin                                         53.1    8e-05   
ref|XP_006654587.1|  PREDICTED: cysteine proteinase inhibitor 2-l...  50.8    8e-05   
ref|XP_006430494.1|  hypothetical protein CICLE_v10012693mg           52.4    9e-05   
ref|XP_002457629.1|  hypothetical protein SORBIDRAFT_03g010730        52.8    1e-04   
ref|XP_004144107.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  50.4    1e-04   
ref|XP_009361917.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  52.8    1e-04   
gb|ABK21379.1|  unknown                                               50.8    1e-04   
ref|XP_009361916.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  52.8    1e-04   
gb|EMT09480.1|  Cysteine proteinase inhibitor 1                       50.8    1e-04   
gb|AFK34375.1|  unknown                                               52.4    1e-04   
ref|XP_003628013.1|  Cysteine proteinase inhibitor                    52.4    1e-04   
ref|XP_010536153.1|  PREDICTED: cysteine proteinase inhibitor 1       50.1    1e-04   
dbj|BAB18765.1|  cysteine proteinase inhibitor                        50.1    1e-04   
gb|AHZ92270.1|  cystatin 4                                            52.0    2e-04   
ref|XP_008375332.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  52.0    2e-04   
gb|AAA96316.1|  cysteine proteinase inhibitor                         51.2    2e-04   
ref|XP_008375331.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  52.0    2e-04   
ref|XP_011041371.1|  PREDICTED: cysteine proteinase inhibitor 6-like  51.6    2e-04   
ref|XP_008364740.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  52.0    2e-04   
ref|XP_008364741.1|  PREDICTED: cysteine proteinase inhibitor 6-l...  52.0    2e-04   
ref|XP_008245514.1|  PREDICTED: cysteine proteinase inhibitor 12-...  52.0    2e-04   
ref|XP_006361155.1|  PREDICTED: multicystatin-like                    52.4    2e-04   
ref|XP_011034690.1|  PREDICTED: cysteine proteinase inhibitor 12-...  51.2    2e-04   
gb|AFW77984.1|  putative cystatin                                     50.1    2e-04   
ref|XP_006482025.1|  PREDICTED: cysteine proteinase inhibitor 6-like  51.2    2e-04   
emb|CAH60163.1|  cystatin CPI-1                                       51.2    2e-04   
gb|AHZ31431.1|  cysteine proteinase inhibitor                         48.5    2e-04   
emb|CDX97171.1|  BnaC09g44540D                                        49.3    2e-04   
ref|XP_003617185.1|  Cysteine proteinase inhibitor                    49.3    2e-04   
gb|AAQ14319.1|  protease inhibitor                                    50.8    3e-04   
gb|AFI57926.1|  cystatin 3                                            51.6    3e-04   
emb|CDP04913.1|  unnamed protein product                              50.8    3e-04   
ref|XP_010111219.1|  Cysteine proteinase inhibitor 6                  50.8    3e-04   
ref|XP_009383251.1|  PREDICTED: cysteine proteinase inhibitor A-like  49.3    3e-04   
gb|AAO19652.1|  cysteine protease inhibitor cystatin                  51.2    3e-04   
gb|AHZ92269.1|  cystatin 3                                            51.2    3e-04   
pdb|2L4V|A  Chain A, Three Dimensional Structure Of Pineapple Cys...  49.3    3e-04   
ref|XP_008354847.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.8    4e-04   
ref|XP_008647964.1|  PREDICTED: multicystatin isoform X2              49.7    4e-04   
ref|XP_008346634.1|  PREDICTED: cysteine proteinase inhibitor 6-like  50.8    4e-04   
ref|XP_008647963.1|  PREDICTED: multicystatin isoform X1              49.7    4e-04   
gb|KDO57435.1|  hypothetical protein CISIN_1g027502mg                 50.4    4e-04   
gb|AAL85883.1|AF480168_1  putative cystatin                           48.1    5e-04   
ref|XP_004967724.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.4    5e-04   
gb|AAD33907.1|AF143677_1  cysteine proteinase inhibitor               48.1    5e-04   
ref|XP_004307210.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.4    5e-04   
ref|XP_004307209.1|  PREDICTED: cysteine proteinase inhibitor 12-...  50.4    5e-04   
emb|CBY78064.1|  cystein proteinase inhibitor                         48.1    6e-04   
ref|XP_011070081.1|  PREDICTED: cysteine proteinase inhibitor iso...  48.9    6e-04   
gb|ABQ41938.1|  cysteine proteinase inhibitor                         47.4    7e-04   
gb|EAY98538.1|  hypothetical protein OsI_20451                        48.1    7e-04   
gb|ACL14375.1|  AE-rich cystatin bromelain inhibitor                  49.3    7e-04   
gb|KCW50299.1|  hypothetical protein EUGRSUZ_J00085                   50.1    7e-04   
gb|ABK23108.1|  unknown                                               48.5    7e-04   
ref|XP_010106322.1|  Cysteine proteinase inhibitor 1                  47.8    7e-04   
sp|P20907.3|CYT2_ORYSJ  RecName: Full=Cysteine proteinase inhibit...  48.5    8e-04   
gb|AAA33911.1|  oryzacystatin-II                                      47.8    8e-04   
gb|AFK41943.1|  unknown                                               47.8    9e-04   
ref|XP_007028256.1|  Cystatin, putative                               49.3    9e-04   
gb|AAA68150.1|  cysteine protenase inhibitor                          47.4    0.001   



>gb|AEK84226.1| cysteine protease inhibitor [Cucurbita maxima]
Length=101

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFD-----------KVIYNITIVASEGGHKKVYEAKVSVN  283
            ++ELARFA+ E+NKKANA L F              +Y+IT+ AS+GG KKVYEAK+ V 
Sbjct  19   TDELARFAVDEHNKKANALLEFSKVVKVKEQVVSGAMYHITLEASDGGQKKVYEAKIWVK  78

Query  284  ESKNIKELQEFKVVGN  331
              +N K+LQEFK+VG+
Sbjct  79   VWENFKQLQEFKLVGD  94



>prf||2203261A Cys protease inhibitor
Length=100

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 56/96 (58%), Gaps = 13/96 (14%)
 Frame = +2

Query  83   PTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITI  229
            P L  +R V      ++ +EELARFA+ E+NKKAN  L F +V+           Y IT+
Sbjct  1    PLLGGVRDVPDH--NSAETEELARFAVQEHNKKANTRLEFSRVVKAKEQVVAGTMYYITL  58

Query  230  VASEGGHKKVYEAKVSVNESKNIKELQEFKVVGNET  337
               E G KK+YEAKV V   +N KELQEFK VG+ +
Sbjct  59   EVVEAGQKKIYEAKVWVKLWENFKELQEFKPVGDSS  94



>ref|XP_006362733.1| PREDICTED: cysteine proteinase inhibitor-like [Solanum tuberosum]
Length=98

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 12/94 (13%)
 Frame = +2

Query  83   PTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITI  229
             TL  +R    S     I++ LARFA+ E+NKK NA L F KV+           Y IT+
Sbjct  2    ATLGGIREAGGSENSVEIND-LARFAVDEHNKKQNALLEFGKVVNVKEQVVAGTMYYITL  60

Query  230  VASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
             A+EGG KK YEAKV V + +N K++++FK++G+
Sbjct  61   EATEGGKKKAYEAKVWVKQWQNFKQVEDFKLIGD  94



>ref|XP_009759630.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana sylvestris]
 gb|AHX74042.1| cystein protease inhibitor 1 [Nicotiana tabacum]
 gb|AIE76378.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=98

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R    S     I++ LARFA+ E+NKK NA L F KV+           Y IT+ 
Sbjct  3    TLGGIREAGGSENSLEIND-LARFAVDEHNKKQNALLEFGKVVNVKEQVVAGTMYYITLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A+EGG KK YEAKV V   +N K+L++FK++G+
Sbjct  62   ATEGGKKKAYEAKVWVKPWQNFKQLEDFKLIGD  94



>ref|XP_009609320.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana tomentosiformis]
Length=98

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%), Gaps = 12/95 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R    S     I++ LARFA+ E+NKK NA L F KV+           Y IT+ 
Sbjct  3    TLGGIREAGGSENSLEIND-LARFAVDEHNKKQNALLEFGKVVNVKEQVVAGTMYYITLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGNET  337
            A+EGG KK YEAKV V   +N K++++FK++G+ T
Sbjct  62   ATEGGKKKAYEAKVWVKPWQNFKQVEDFKLIGDAT  96



>ref|XP_009605348.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana tomentosiformis]
 ref|XP_009605349.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana tomentosiformis]
 ref|XP_009605350.1| PREDICTED: cysteine proteinase inhibitor A-like [Nicotiana tomentosiformis]
 gb|AHX74043.1| cystein protease inhibitor 2 [Nicotiana tabacum]
 gb|AIE76379.1| cysteine protease inhibitor [Nicotiana tabacum]
Length=98

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFD-----------KVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFAI +YNKK NA L F              IY IT+ A EGG KKVYEAK+ V  
Sbjct  20   DDLARFAIQDYNKKQNALLEFGKVVNVKQQVVAGTIYYITLEAIEGGKKKVYEAKIWVKP  79

Query  287  SKNIKELQEFKVVGN  331
             +N KE+QEFK+VG+
Sbjct  80   WENFKEVQEFKLVGD  94



>ref|XP_011080491.1| PREDICTED: cysteine proteinase inhibitor A-like [Sesamum indicum]
Length=94

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E+LARFA+ +YNKK N  L   KV           +Y IT+ A+EGG KKVYEAKV V  
Sbjct  19   EDLARFAVDDYNKKQNGLLELKKVTNVKEQVVAGTMYYITLEAAEGGQKKVYEAKVWVKP  78

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK++G+
Sbjct  79   WMNFKEVQEFKLLGD  93



>ref|XP_003543365.1| PREDICTED: cysteine proteinase inhibitor [Glycine max]
 gb|KHN30799.1| Cysteine proteinase inhibitor [Glycine soja]
Length=97

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 12/88 (14%)
 Frame = +2

Query  101  RVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGG  247
            R VA S     I + LARFA+ E+NKK NA L F+KV+           Y IT+ A +GG
Sbjct  8    RDVAGSQNSLEI-DGLARFAVEEHNKKQNALLEFEKVVSAKQQVVSGTLYTITLEAKDGG  66

Query  248  HKKVYEAKVSVNESKNIKELQEFKVVGN  331
             KKVYEAKV      N KE+QEFK+VG+
Sbjct  67   QKKVYEAKVWEKAWLNFKEVQEFKLVGD  94



>gb|AAL56612.1|AF454396_1 cystatin [Vigna radiata]
 emb|CAM92312.1| cystatin [Vigna radiata]
 emb|CAN84531.1| cystatin [Vigna radiata]
 emb|CAN84532.1| cystatin [Vigna radiata]
 emb|CAN84533.1| cystatin [Vigna radiata]
Length=88

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 11/72 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK NA L F +V+           Y IT+ A +GG KKVYEAKV      
Sbjct  13   LARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWL  72

Query  293  NIKELQEFKVVG  328
            N KELQEFK+VG
Sbjct  73   NFKELQEFKLVG  84



>gb|AAL79831.1|AF469485_1 cystatin [Sandersonia aurantiaca]
Length=110

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 11/93 (12%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL + R V +    ++  EELARFA+AE+NKK NA L F +V+           +++T+ 
Sbjct  3    TLGAPRDVPAGGENSADVEELARFAVAEHNKKENALLEFGRVVKAKEQVVAGTLHHLTVE  62

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A + G+KK+YEAKV V    N KELQEF+  G+
Sbjct  63   AIDAGNKKLYEAKVWVKPWLNFKELQEFRHAGD  95



>gb|AAA97905.1| cysteine proteinase inhibitor [Glycine max]
Length=92

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 52/88 (59%), Gaps = 12/88 (14%)
 Frame = +2

Query  101  RVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGG  247
            R V  S     I + LARFA+ E+NKK NA L F+KV+           Y IT+ A +GG
Sbjct  3    RDVTGSQNSVEI-DALARFAVEEHNKKQNALLEFEKVVTAKQQVVSGTLYTITLEAKDGG  61

Query  248  HKKVYEAKVSVNESKNIKELQEFKVVGN  331
             KKVYEAKV      N KE+QEFK+VG+
Sbjct  62   QKKVYEAKVWEKSWLNFKEVQEFKLVGD  89



>ref|XP_002298154.1| cysteine protease inhibitor family protein [Populus trichocarpa]
 gb|EEE82959.1| cysteine protease inhibitor family protein [Populus trichocarpa]
Length=101

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ +YNKK N+ L F +V           IY IT   +EGGHKKVYEAKV V  
Sbjct  20   DSLARFAVDDYNKKQNSVLEFKRVLNAKQQVVAGTIYYITFEVTEGGHKKVYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK+V +
Sbjct  80   WLNFKEVQEFKLVAD  94



>ref|NP_001239817.1| cysteine proteinase inhibitor [Glycine max]
 gb|ACU14290.1| unknown [Glycine max]
Length=97

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK NA L F+KV+           Y IT+ A +GG KKVYEAKV      
Sbjct  22   LARFAVEEHNKKQNALLEFEKVVTAKQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKSWL  81

Query  293  NIKELQEFKVVGN  331
            N KE+QEFK+VG+
Sbjct  82   NFKEVQEFKLVGD  94



>ref|XP_004228480.1| PREDICTED: cysteine proteinase inhibitor A [Solanum lycopersicum]
Length=98

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R    S     I++ LARFA+ E+NKK NA L F KV+           Y IT+ 
Sbjct  3    TLGGIREAGGSENSLEIND-LARFAVDEHNKKQNALLEFGKVVNVKEQVVAGTMYYITLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A+EGG KK YEAKV V   +N K++++FK++G+
Sbjct  62   ATEGGKKKAYEAKVWVKPWQNFKQVEDFKLIGD  94



>gb|KHN35444.1| Cysteine proteinase inhibitor [Glycine soja]
Length=97

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK NA L F+KV+           Y IT+ A +GG KKVYEAKV      
Sbjct  22   LARFAVEEHNKKQNALLEFEKVVTAKQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKAWL  81

Query  293  NIKELQEFKVVGN  331
            N KE+QEFK+VG+
Sbjct  82   NFKEVQEFKLVGD  94



>gb|AAF23128.1|AF198390_1 multicystatin [Solanum lycopersicum]
Length=156

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 11/76 (14%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNES  289
            +LARFA+ +YNKK NA+L F             +IY IT+VA++ G KK+YE K+ V   
Sbjct  80   DLARFAVQDYNKKENAHLEFVENLNVKEQVVAGIIYYITLVATDAGKKKIYETKILVKGW  139

Query  290  KNIKELQEFKVVGNET  337
            +N KE+QEFK+VG+ T
Sbjct  140  ENFKEVQEFKLVGDAT  155



>ref|XP_011042012.1| PREDICTED: cysteine proteinase inhibitor-like [Populus euphratica]
Length=101

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ +YNKK N+ L F +V+           Y IT   ++GGH+KVYEAKV    
Sbjct  20   ESLARFAVDDYNKKQNSLLEFKRVVNTKQQVVSGTMYYITFEVTDGGHRKVYEAKVWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK+VG+
Sbjct  80   WMNFKEVQEFKLVGD  94



>ref|XP_002314231.1| hypothetical protein POPTR_0009s02740g [Populus trichocarpa]
 gb|EEE88186.1| hypothetical protein POPTR_0009s02740g [Populus trichocarpa]
Length=100

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ +YNKK N+ L F +V+           Y IT   ++GGH+KVYEAKV    
Sbjct  19   ESLARFAVDDYNKKQNSLLEFKRVVKTKQQVVSGTMYYITFEVTDGGHRKVYEAKVWEKP  78

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK+VG+
Sbjct  79   WMNFKEVQEFKLVGD  93



>gb|ACU19157.1| unknown [Glycine max]
Length=97

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 52/88 (59%), Gaps = 12/88 (14%)
 Frame = +2

Query  101  RVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGG  247
            R VA S     I + LARFA+ E+NKK NA L F+KV+           Y IT+ A  GG
Sbjct  8    RDVAGSQNSLEI-DGLARFAVEEHNKKQNALLEFEKVVSAKQQVVSGTLYTITLEAKGGG  66

Query  248  HKKVYEAKVSVNESKNIKELQEFKVVGN  331
             KKVYEAKV      N KE+QEFK+VG+
Sbjct  67   QKKVYEAKVWEKAWLNFKEVQEFKLVGD  94



>ref|XP_004144108.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159336.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform 2 [Cucumis 
sativus]
Length=101

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKK N+ L F K            +Y IT+  +EGG KKVYEAK+ V +
Sbjct  20   DELARFAVDEHNKKENSLLEFSKVVKVKEQVVAGTVYYITVEVTEGGQKKVYEAKIWVKQ  79

Query  287  SKNIKELQEFKVVGN  331
             +N K+LQEFK+ G+
Sbjct  80   WQNFKQLQEFKLAGD  94



>emb|CAD21441.1| putative cysteine proteinase inhibitor [Rumex obtusifolius]
Length=99

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LA+FA+ ++NKK NA L F KV+           Y IT+ A++GG KKVYEAKV V  
Sbjct  20   ESLAKFAVEDHNKKQNAMLEFSKVVNTKEQVVAGTMYYITLEATDGGKKKVYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGNE  334
              N K++QEFK++G++
Sbjct  80   WMNFKQVQEFKLLGDQ  95



>ref|XP_007146172.1| hypothetical protein PHAVU_006G018600g [Phaseolus vulgaris]
 gb|ESW18166.1| hypothetical protein PHAVU_006G018600g [Phaseolus vulgaris]
Length=97

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 51/88 (58%), Gaps = 12/88 (14%)
 Frame = +2

Query  101  RVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGG  247
            R VA S     I + LARFA+ E+NKK NA L F KV+           Y IT+ A +G 
Sbjct  8    RDVAGSQNSVEI-DSLARFAVEEHNKKQNALLEFGKVVGAKQQVVSGTLYTITLEAKDGA  66

Query  248  HKKVYEAKVSVNESKNIKELQEFKVVGN  331
             KKVYEAK+      N KELQEFK+VG+
Sbjct  67   QKKVYEAKIWEKAWLNFKELQEFKLVGD  94



>sp|Q06445.1|CYTI_VIGUN RecName: Full=Cysteine proteinase inhibitor; AltName: Full=Cystatin 
[Vigna unguiculata]
 emb|CAA79954.1| cysteine proteinase inhibitor [Vigna unguiculata]
Length=97

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 51/88 (58%), Gaps = 12/88 (14%)
 Frame = +2

Query  101  RVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGG  247
            R VA +     I + LARFA+ E+NKK NA L F +V+           Y IT+ A +GG
Sbjct  8    RDVAGNQNSLEI-DSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGG  66

Query  248  HKKVYEAKVSVNESKNIKELQEFKVVGN  331
             KKVYEAKV      N KELQEFK VG+
Sbjct  67   QKKVYEAKVWEKPWLNFKELQEFKHVGD  94



>ref|XP_008451048.1| PREDICTED: cysteine proteinase inhibitor A-like [Cucumis melo]
Length=100

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+AE+NKK N+ L F K            +Y IT+  +EGG KKVYEAK+ V  
Sbjct  20   DELARFAVAEHNKKENSLLEFSKVVKVKQQVVAGTVYYITVEVTEGGQKKVYEAKIWVKH  79

Query  287  SKNIKELQEFKVV  325
             +N K+LQEFK+V
Sbjct  80   WENFKQLQEFKLV  92



>ref|XP_010096012.1| Cysteine proteinase inhibitor 12 [Morus notabilis]
 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis]
Length=239

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 12/99 (12%)
 Frame = +2

Query  68   TTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------  214
            + +N  TL  +R        A + E+LARFA+ E+NKK NA L F +V+           
Sbjct  32   SQSNMATLGGVRQSRGCENSADV-EDLARFAVQEHNKKENALLEFARVVKAEEQVVAGTL  90

Query  215  YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            +++T+ A EGG KK+YEAKV V    N KELQEFK  G+
Sbjct  91   HHLTLEAIEGGKKKIYEAKVWVKPWLNFKELQEFKHTGD  129



>sp|Q10992.1|CYTA_HELAN RecName: Full=Cysteine proteinase inhibitor A; AltName: Full=Cystatin-A; 
AltName: Full=SCA [Helianthus annuus]
Length=82

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 47/77 (61%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKK NA L F KV+           Y IT+ A+ GG KK YEAKV V  
Sbjct  5    DELARFAVDEHNKKQNALLEFGKVVNTKEQVVAGKMYYITLEATNGGVKKTYEAKVWVKP  64

Query  287  SKNIKELQEFKVVGNET  337
             +N KELQEFK V   T
Sbjct  65   WENFKELQEFKPVDAAT  81



>ref|XP_010906414.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=202

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKKAN  L F +V           IY ITI AS+GG KK+YEAKV V  
Sbjct  20   EELARFAVEEHNKKANTLLEFGRVVKVKEQVVSGIIYYITIEASDGGKKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
                KELQEF  +G+
Sbjct  80   WMKFKELQEFIPLGD  94



>pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Full Length Adhiron
 pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold 
- Truncated Adhiron
Length=79

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKK NA L F +V+           Y +T+ A +GG KK+YEAKV V  
Sbjct  7    EELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLYEAKVWVKP  66

Query  287  SKNIKELQEFKVV  325
             +N KELQEFK V
Sbjct  67   WENFKELQEFKPV  79



>gb|ACN85343.1| cystatin [Camellia sinensis]
 gb|ACN85344.1| cystatin [Camellia sinensis]
Length=101

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F K            +Y IT+ A+ GG KK YEAKV V  
Sbjct  20   DSLARFAVDEHNKKENACLEFSKVVNVKQQVVSGTVYYITLEATNGGQKKAYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK +G+
Sbjct  80   WMNFKELQEFKPIGD  94



>gb|AAF23127.1|AF198389_1 cystatin [Solanum lycopersicum]
Length=94

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 11/74 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +LARFA+ E+NKK NA L F KV+           Y IT+ A+EGG KK YEAKV V   
Sbjct  17   DLARFAVDEHNKKQNALLEFGKVVNVKEQVVAGTMYYITLEATEGGKKKAYEAKVWVKPW  76

Query  290  KNIKELQEFKVVGN  331
            +N K++++FK++G+
Sbjct  77   QNFKQVEDFKLIGD  90



>ref|XP_002523225.1| Cysteine proteinase inhibitor, putative [Ricinus communis]
 gb|EEF39146.1| Cysteine proteinase inhibitor, putative [Ricinus communis]
Length=101

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ +YNKK NA L + KV+           Y IT+   +GGHKKVYEAK+    
Sbjct  20   DSLARFAVDDYNKKQNALLEYKKVVNAKQQVVAGTMYYITLEVMDGGHKKVYEAKIWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK++G+
Sbjct  80   WLNFKEVQEFKLIGD  94



>gb|AAA32672.1| cystatin proteinase inhibitor [Ambrosia artemisiifolia]
Length=92

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 47/73 (64%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELA+FAIAE+NKK NA L F KVI           Y I + A++GG KK YEAKV V  
Sbjct  20   DELAKFAIAEHNKKENAALEFGKVIEKKQQAVQGTMYYIKVEANDGGEKKTYEAKVWVKL  79

Query  287  SKNIKELQEFKVV  325
             +N KELQE K+V
Sbjct  80   WENFKELQELKLV  92



>ref|XP_011011604.1| PREDICTED: cysteine proteinase inhibitor-like [Populus euphratica]
Length=101

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ +YNKK N+ L F +V           IY IT   ++GGHKKVYEAKV V  
Sbjct  20   DNLARFAVDDYNKKHNSVLEFKRVLNAKQQVVAGTIYYITFEVTDGGHKKVYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              + KE+QEFK+V +
Sbjct  80   WLDFKEVQEFKLVAD  94



>emb|CAN78115.1| hypothetical protein VITISV_031522 [Vitis vinifera]
 emb|CBI24312.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK N  L F+ V           IY IT+ A++GG K  YEAK+ V  
Sbjct  20   ENLARFAVDEHNKKQNTLLEFNGVVKVRQQVVAGTIYYITLDATDGGKKNKYEAKIWVKP  79

Query  287  SKNIKELQEFKVVGNE  334
              N KELQEFK +G+E
Sbjct  80   WLNFKELQEFKPIGDE  95



>gb|AAC32853.1| cysteine protease inhibitor [Solanum lycopersicum]
Length=254

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 50/74 (68%), Gaps = 11/74 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNES  289
            +LARFA+ +YNKK NA+L F +           +IY IT+VA++ G KK+YE K+ V   
Sbjct  178  DLARFAVQDYNKKENAHLEFVENLNVKEQVVAGIIYYITLVATDAGKKKIYETKILVKGW  237

Query  290  KNIKELQEFKVVGN  331
            +N KE+Q+FK+VG+
Sbjct  238  ENFKEVQDFKLVGD  251


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 51/77 (66%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNK  NA+L + +            +Y IT+VA++ G KK+YE K+ V E
Sbjct  83   QDLARFAVQDYNKAQNAHLEYVENLNVKEQLVAGTLYYITLVATDAGKKKIYETKIWVKE  142

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++ EFK+VG+++
Sbjct  143  WEDFKKVVEFKLVGDDS  159



>ref|XP_002268378.1| PREDICTED: cysteine proteinase inhibitor A [Vitis vinifera]
 ref|XP_003632227.1| PREDICTED: cysteine proteinase inhibitor A [Vitis vinifera]
Length=124

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK N  L F+ V           IY IT+ A++GG K  YEAK+ V  
Sbjct  43   ENLARFAVDEHNKKQNTLLEFNGVVKVRQQVVAGTIYYITLDATDGGKKNKYEAKIWVKP  102

Query  287  SKNIKELQEFKVVGNE  334
              N KELQEFK +G+E
Sbjct  103  WLNFKELQEFKPIGDE  118



>gb|AGX28142.1| cysteine protease inhibitor, partial [Populus euphratica]
Length=107

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  3    TLGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            ASE G KK+YEAKV V    N KEL EFK  G+
Sbjct  62   ASEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  94



>ref|XP_004308672.1| PREDICTED: cysteine proteinase inhibitor 6-like [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ELARFA+ E+NKK NA L F +V+           Y +TI A++GG KK++EAKV V 
Sbjct  95   TDELARFAVQEHNKKENALLEFVRVVKTKEQVVSGTVYYLTIEATDGGQKKLFEAKVWVK  154

Query  284  ESKNIKELQEFKVVGN  331
               N KE+QEFK V +
Sbjct  155  PWLNFKEVQEFKPVAD  170



>ref|XP_008455746.1| PREDICTED: cysteine proteinase inhibitor A [Cucumis melo]
Length=122

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+N K N  L FD+V+           Y++T+ A +GG KKVYEAKV V  
Sbjct  49   ESLARFAVQEHNNKENGLLEFDRVLKAKEQVVAGKLYHLTLEAIDGGKKKVYEAKVWVKP  108

Query  287  SKNIKELQEFKVV  325
              N K+LQEFK+ 
Sbjct  109  WMNFKQLQEFKLC  121



>ref|XP_008788566.1| PREDICTED: cysteine proteinase inhibitor A-like [Phoenix dactylifera]
Length=105

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ EY+KKANA L F +V+           Y ITI   +GG KK+YEAKV V  
Sbjct  20   EELARFAVEEYDKKANALLEFVRVVKVKEQVVAGIVYYITIEVIDGGKKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
                KELQEF  +G 
Sbjct  80   WMKFKELQEFSPLGG  94



>gb|EYU46147.1| hypothetical protein MIMGU_mgv1a017070mg [Erythranthe guttata]
Length=94

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
             +LA+FA+ ++N K NA L F KV           +Y+IT+ A++G H KVYEAKV V  
Sbjct  19   HDLAKFAVDDHNTKQNALLQFKKVTNVKEQVVAGTMYHITLEAADGEHHKVYEAKVWVKP  78

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK VG+
Sbjct  79   WMNFKEVQEFKHVGD  93



>dbj|BAH47556.1| cystatin [Spinacia oleracea]
Length=104

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E LA+FAI E+NKK NA L F +V           IY IT+ A++G  KK+YEAK+ V  
Sbjct  20   ETLAQFAIDEHNKKENALLEFHRVVNTKEQVVAGTIYYITLEATDGDKKKIYEAKIWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK VG+
Sbjct  80   WANFKEVQEFKYVGD  94



>gb|AAK30004.1| cysteine proteinase inhibitor [Dianthus caryophyllus]
Length=98

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            +ELA+FA+  YN K NA L F +V           IY IT+ A++GG KK+YEAKV V  
Sbjct  21   DELAKFAVDHYNSKENALLEFQRVVNTKEQVVAGTIYYITLEATDGGVKKLYEAKVWVKP  80

Query  287  SKNIKELQEFKVVGN  331
              N KE+Q+FK VG+
Sbjct  81   WVNFKEVQDFKYVGD  95



>emb|CAA11899.1| cystatin [Castanea sativa]
Length=102

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ ++NKKAN  L F KV           IY +T+   +GG KKVYEAK+    
Sbjct  21   DDLARFAVDDHNKKANTLLQFKKVVNAKQQVVSGTIYILTLEVEDGGKKKVYEAKIWEKP  80

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK++G+
Sbjct  81   WLNFKEVQEFKLIGD  95



>emb|CAH57553.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKPKEQVFAGPMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV VN   N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVNPWLNFKELHEFKDAGD  129



>gb|AAF72202.1|AF265551_1 cysteine protease inhibitor [Manihot esculenta]
Length=101

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 12/92 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  ++ V  S     I + LARFA+ +YNKK NA L F +V+           Y IT+ 
Sbjct  3    TLGGIKEVEESANSVEI-DNLARFAVDDYNKKQNALLEFKRVVSTKQQVVAGTMYYITLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVG  328
             ++GG  KVYEAKV      N KE+QEFK +G
Sbjct  62   VADGGQTKVYEAKVWEKPWLNFKEVQEFKPIG  93



>gb|AAS21216.1| cysteine proteinase inhibitor [Aegiceras corniculatum]
Length=95

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ ++NKK NA L F KV+           Y IT+ A+ GG KK+YEAKV V  
Sbjct  20   DELARFAVDQHNKKQNALLEFVKVVNVKEQVVSGTLYYITLEATGGGQKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQ+F++  +
Sbjct  80   WMNFKELQDFQLASD  94



>emb|CAG38123.2| cystatin Hv-CPI2 [Hordeum vulgare subsp. vulgare]
Length=140

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA++E+NKKANA L F+ V+           Y ITI  +EGG KK+YEAKV     +
Sbjct  64   LARFAVSEHNKKANALLEFENVVKLKKQTVAGTMYYITIRVTEGGTKKLYEAKVWEKLWE  123

Query  293  NIKELQEFKVVGN  331
            N K+L+EFK V +
Sbjct  124  NFKQLEEFKPVQD  136



>emb|CAH57560.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57572.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 17/108 (16%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI--  214
            S  F +++ TT     L  +    SS   A I + LARFA+ E+NKK NA L F +V+  
Sbjct  28   SGGFCQEKMTT-----LGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKA  81

Query  215  ---------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
                     +++TI A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  82   KEQVVAGTMHHLTIEAIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>ref|XP_006644859.1| PREDICTED: cysteine proteinase inhibitor 1-like [Oryza brachyantha]
Length=142

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 13/96 (14%)
 Frame = +2

Query  71   TNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------Y  217
            T+  P +  +  V +   +  +  +LARFA+ E+NKKANA L F+K++           Y
Sbjct  43   TDGGPVVGGVEPVGNENDLHLV--DLARFAVTEHNKKANALLEFEKLVKVKQQVVAGTLY  100

Query  218  NITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
              TI  +EGG KK+YEAKV      + KELQEFK V
Sbjct  101  YFTIEVNEGGAKKLYEAKVWEKPWMDFKELQEFKPV  136



>gb|AAY57859.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLS-LRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-  214
            S+   ++    NNT TL+  ++ V  S     + +ELARFA+ E+NKKANA L F+K++ 
Sbjct  23   STRNAQEDSMANNTGTLVGGIQDVPGSENDLHL-QELARFAVDEHNKKANALLGFEKLVK  81

Query  215  ----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                      Y +TI   +G  KK+YEAKV     +N KELQEFK V
Sbjct  82   AKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENFKELQEFKPV  128



>ref|XP_008786873.1| PREDICTED: cysteine proteinase inhibitor 12-like [Phoenix dactylifera]
Length=202

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKKAN  L F +V           IY ITI A EGG KK+YEAKV V  
Sbjct  20   EELARFAVEEHNKKANTLLEFVRVVKVKEQVVAGIIYYITIEAIEGGKKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
                KELQEF  + +
Sbjct  80   WMKFKELQEFSPLDD  94



>gb|AIY68266.1| oryzacystatin I [Oryza sativa Indica Group]
 gb|AIY68267.1| oryzacystatin I [Oryza sativa Indica Group]
Length=140

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +2

Query  56   KQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-------  214
            +++ +++  P L  L  V +   +  +  +LARFA+ E+NKKAN+ L F+K++       
Sbjct  36   EEKMSSDGGPVLGGLEPVGNENDLHLV--DLARFAVTEHNKKANSLLEFEKLVSVKQQVV  93

Query  215  ----YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                Y  TI   EG  KK+YEAKV      + KELQEFK V
Sbjct  94   AGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPV  134



>ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda]
Length=206

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 11/95 (12%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  L+ V  S   ++  EELARFA+ E+NKK+N+ L F +V+           Y++T+ 
Sbjct  3    TLGGLKDVTGSNQNSAEIEELARFAVQEHNKKSNSLLEFARVVKAKEQVVAGTLYHLTLE  62

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGNET  337
            A + G  K+YEAKV +   +N KEL+EF  VG+ +
Sbjct  63   AIDAGKNKLYEAKVWLKPWENFKELKEFNHVGDSS  97



>gb|AFK41117.1| unknown [Lotus japonicus]
Length=98

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK N  L F KV+           Y I + A++GG K+VYEAK+    
Sbjct  20   ENLARFAVEEHNKKQNTLLEFGKVVSATQQVVAGTLYKIKLEANDGGKKQVYEAKIWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEF +VG+
Sbjct  80   WLNFKELQEFNLVGD  94



>gb|ACU24145.1| unknown [Glycine max]
Length=245

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 14/112 (13%)
 Frame = +2

Query  35   LLSSSFIKQRCTTNNTP--TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDK  208
            L SSS        ++TP  T+  LR    S      +E LARFA+ E+NKK N+ L F +
Sbjct  28   LRSSSGGCSEYHHHHTPMATIGGLRDSQGSQNSVQ-TEALARFAVDEHNKKQNSLLEFSR  86

Query  209  VI-----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            V+           +++T+ A E G KK+YEAKV V    N KELQEFK  G+
Sbjct  87   VVRTQEQVVAGTLHHLTLEAIEAGEKKLYEAKVWVKPWLNFKELQEFKPAGD  138



>emb|CAH57559.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 58/108 (54%), Gaps = 17/108 (16%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI--  214
            S  F +++ TT     L  +    SS   A I + LARFA+ E+NKK NA L F +V+  
Sbjct  28   SGGFCQEKMTT-----LGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKP  81

Query  215  ---------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
                     +++TI A E G KK+ EAKV VN   N KEL EFK  G+
Sbjct  82   KDQVFAGPMHHLTIEAIEAGKKKLNEAKVWVNPWLNFKELHEFKDAGD  129



>gb|ADB02894.1| multicystatin/cysteine protease inhibitor [Jatropha curcas]
 gb|KDP34555.1| hypothetical protein JCGZ_11105 [Jatropha curcas]
Length=106

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ +YNKK NA L + +V           IY IT+   +GG KKVYEAK+      
Sbjct  22   LARFAVDDYNKKQNALLEYKRVVNAKQQVVAGTIYYITLEVEDGGQKKVYEAKIWEKPWL  81

Query  293  NIKELQEFKVVGN  331
            N K++QEFK++G+
Sbjct  82   NFKDVQEFKLIGD  94



>gb|ACZ02398.1| latex cystatin [Hevea brasiliensis]
Length=101

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNESK  292
            LAR+A+ +YN+K NA L F KV           IY IT+   +GG KKVYEAKV      
Sbjct  22   LARYAVDDYNQKQNALLEFKKVVNAKQQVVAGTIYYITLEVIDGGQKKVYEAKVWEKPWL  81

Query  293  NIKELQEFKVVGN  331
            N KE+QEFK++G+
Sbjct  82   NFKEVQEFKLIGD  94



>gb|AGX28141.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28143.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28144.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28145.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28146.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28147.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28148.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28149.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28150.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28151.1| cysteine protease inhibitor, partial [Populus pruinosa]
 gb|AGX28152.1| cysteine protease inhibitor, partial [Populus pruinosa]
Length=107

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  3    TLGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  62   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  94



>pdb|4LZI|A Chain A, Characterization Of Solanum Tuberosum Multicystatin 
And Significance Of Core Domains
Length=282

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 52/77 (68%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNKK NA+L F             ++Y IT+VA + G KK+YEAK+ V E
Sbjct  113  QDLARFAVQDYNKKENAHLEFVENLNVKEQLVAGMLYYITLVAIDAGKKKIYEAKIWVKE  172

Query  287  SKNIKELQEFKVVGNET  337
             +N K++ EFK++G+++
Sbjct  173  WENFKKVIEFKLIGDDS  189


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 52/76 (68%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNKK NA+L +             +IY IT+VA++ G KK+YEAK+ V E
Sbjct  207  QDLARFAVQDYNKKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGKKKIYEAKIWVKE  266

Query  287  SKNIKELQEFKVVGNE  334
             ++ K++ EFK+VG++
Sbjct  267  WEDFKKVVEFKLVGDD  282


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++L RFA+ +YNK  NA+L F             ++Y IT  A++GG KK+YE K+ V  
Sbjct  19   QDLTRFAVHQYNKDQNAHLEFVENLNVKKQVVAGMLYYITFAATDGGKKKIYETKIWVKV  78

Query  287  SKNIKELQEFKVVGNET  337
             +N K++ EFK+VG+++
Sbjct  79   WENFKKVVEFKLVGDDS  95



>gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39783.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39803.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  22   TLGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  80

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  81   AVEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  113



>gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39759.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39760.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39761.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39762.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39763.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39764.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39765.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39766.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39767.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39768.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39769.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39770.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39771.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39772.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39773.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39774.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39775.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39776.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39777.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39778.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39779.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39780.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39781.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39784.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39785.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39786.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39787.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39788.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39789.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39790.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39791.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39792.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39794.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39795.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39796.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39797.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39798.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39799.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39800.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39801.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39802.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39804.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39805.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39806.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39807.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39808.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39809.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39810.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39811.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39812.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39813.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39814.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39815.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39816.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39817.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39818.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39819.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39820.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39821.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39822.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39823.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39824.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39825.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39826.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39827.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39828.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39829.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39830.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39831.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39832.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39833.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39834.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39835.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39836.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39837.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39838.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39839.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39840.1| cysteine inhibitor 1 [Populus balsamifera]
 gb|ACO39841.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  22   TLGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  80

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  81   AVEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  113



>ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus]
 gb|KGN51606.1| hypothetical protein Csa_5G583360 [Cucumis sativus]
Length=249

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 17/105 (16%)
 Frame = +2

Query  65   CTTNNTP-----TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----  214
            C   + P     TL  +R    +   A + +ELARFA+ E+NKK N+ L F +V+     
Sbjct  39   CADQDDPLLMASTLGDVRDSQGASNSADV-DELARFAVEEHNKKENSLLEFVRVVKAKEQ  97

Query  215  ------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
                  +++T+   E G KK+YEAKV V    N KELQEFK  G+
Sbjct  98   VVAGTLHHLTVEVVEAGKKKLYEAKVWVKSWMNFKELQEFKHAGD  142



>gb|AAY57867.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLS-LRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-  214
            S+   ++    NNT TL+  ++ V  S     + +ELARFA+ E+NKKANA L F+K++ 
Sbjct  23   STRNAQEDSMANNTGTLVGGIQDVPGSENDLHL-QELARFAVDEHNKKANALLGFEKLVK  81

Query  215  ----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                      Y +TI   +G  KK+YEAKV     +N+K LQEFK V
Sbjct  82   VKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENLKGLQEFKPV  128



>gb|AAY57857.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57858.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57860.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57861.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57862.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57863.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57866.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 emb|CDL74704.1| Cystatin protein [Zea mays subsp. mays]
 gb|AHG97965.1| cystatin II [Zea mays]
 emb|CEJ09686.1| Cystatin protein [Zea mays]
Length=134

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLS-LRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-  214
            S+   ++    NNT TL+  ++ V  S     + +ELARFA+ E+NKKANA L F+K++ 
Sbjct  23   STRNAQEDSMANNTGTLVGGIQDVPGSENDLHL-QELARFAVDEHNKKANALLGFEKLVK  81

Query  215  ----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                      Y +TI   +G  KK+YEAKV     +N+K LQEFK V
Sbjct  82   AKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENLKGLQEFKPV  128



>emb|CEJ09687.1| Cystatin protein [Zea mays]
Length=134

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 13/107 (12%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLS-LRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-  214
            S+   ++    NNT TL+  ++ V  S     + +ELARFA+ E+NKKANA L F+K++ 
Sbjct  23   STRNAQEDSMANNTGTLVGGIQDVPGSENDLHL-QELARFAVDEHNKKANALLGFEKLVK  81

Query  215  ----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                      Y +TI   +G  KK+YEAKV     +N+K LQEFK V
Sbjct  82   AKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENLKGLQEFKPV  128



>ref|XP_008445944.1| PREDICTED: cysteine proteinase inhibitor 12 [Cucumis melo]
Length=250

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 15/104 (14%)
 Frame = +2

Query  65   CTTNNTPTLL--SLRVVASSLTMASISE--ELARFAIAEYNKKANANLVFDKVI------  214
            C   + P L+  +L  V  S   ++ ++  ELARFA+ E+NKK N+ L F +V+      
Sbjct  40   CAEQDDPLLMASTLGGVHDSQGASNSTDVDELARFAVEEHNKKENSLLEFVRVVKAKEQV  99

Query  215  -----YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
                 +++T+   E G KK+YEAKV V    N KELQEFK  G+
Sbjct  100  VAGTLHHLTVEVVEAGKKKLYEAKVWVKSWMNFKELQEFKHAGD  143



>emb|CAH57539.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFAI E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAIDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja]
Length=245

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ E+NKK N+ L F +V+           +++T+ A E G KK+YEAKV V 
Sbjct  63   TEALARFAVDEHNKKQNSLLEFSRVVRTQEQVVAGTLHHLTLEAIEAGEKKLYEAKVWVK  122

Query  284  ESKNIKELQEFKVVGN  331
               N KELQEFK  G+
Sbjct  123  PWLNFKELQEFKPAGD  138



>ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max]
 dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max]
 dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max]
Length=245

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ E+NKK N+ L F +V+           +++T+ A E G KK+YEAKV V 
Sbjct  63   TEALARFAVDEHNKKQNSLLEFSRVVRTQEQVVAGTLHHLTLEAIEAGEKKLYEAKVWVK  122

Query  284  ESKNIKELQEFKVVGN  331
               N KELQEFK  G+
Sbjct  123  PWLNFKELQEFKPAGD  138



>sp|Q9LEI7.1|CYT1_HORVU RecName: Full=Cysteine proteinase inhibitor; AltName: Full=Cystatin; 
AltName: Full=Hv-CPI [Hordeum vulgare]
 emb|CAA72790.1| cysteine proteinase inhibitor [Hordeum vulgare subsp. vulgare]
Length=107

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            ELARFA+AE+N KANA L F+K++           +  TI   EGG KK+YEAKV     
Sbjct  35   ELARFAVAEHNAKANALLEFEKLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAW  94

Query  290  KNIKELQEFK  319
            +N K+LQEFK
Sbjct  95   ENFKQLQEFK  104



>ref|XP_006361154.1| PREDICTED: multicystatin-like [Solanum tuberosum]
Length=557

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 13/78 (17%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-------------DKVIYNITIVASEGGHKKVYEAKVSV  280
            +ELARFAI +YNKK NA+L F               ++Y IT+ A + G KK+YEAK+ V
Sbjct  113  QELARFAIQDYNKKQNAHLEFVENLNVKEQQQIVAGIMYYITLAAIDAGKKKIYEAKIWV  172

Query  281  NESKNIKELQEFKVVGNE  334
             E ++ K++ EFK+VG++
Sbjct  173  KEWEDFKKVVEFKLVGDD  190


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 53/77 (69%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YN+K +++L F KV+           Y IT  A+EGG+KK YEAK+ + +
Sbjct  19   DDLARFAVQDYNQKNDSSLEFKKVLNVKQQIVAGIMYYITFEATEGGNKKEYEAKILLRK  78

Query  287  SKNIKELQEFKVVGNET  337
             +++K++  FK+VG+++
Sbjct  79   WEDLKKVVGFKLVGDDS  95


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFAI  YNKK N +L F             ++Y IT+ A + G KK+YE K+ V E
Sbjct  209  QDLARFAIQVYNKKENVHLEFVENLNVKQQVVAGMMYYITLAAIDAGKKKIYETKIWVKE  268

Query  287  SKNIKELQEFKVV  325
             ++ K++ EFK+V
Sbjct  269  WEDFKKVVEFKLV  281



>sp|P37842.1|CYTM_SOLTU RecName: Full=Multicystatin; Short=MC [Solanum tuberosum]
 gb|AAA16120.1| multicystatin [Solanum tuberosum]
Length=756

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 53/77 (69%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNKK NA+L +             +IY IT+VA++ G KK+YEAK+ V E
Sbjct  585  QDLARFAVQDYNKKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGKKKIYEAKIWVKE  644

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++ EFK+VG+++
Sbjct  645  WEDFKKVVEFKLVGDDS  661


 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 52/77 (68%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNKK NA+L F             ++Y IT+VA + G KK+YEAK+ V E
Sbjct  491  QDLARFAVQDYNKKENAHLEFVENLNVKEQLVAGMLYYITLVAIDAGKKKIYEAKIWVKE  550

Query  287  SKNIKELQEFKVVGNET  337
             +N K++ EFK++G+++
Sbjct  551  WENFKKVIEFKLIGDDS  567


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (64%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ ++NKK N +L F             ++Y IT+ A++   K++YE K+ V E
Sbjct  679  QDLARFAVQDFNKKENGHLEFVENLNVKEQVVAGMMYYITLAATDARKKEIYETKILVKE  738

Query  287  SKNIKELQEFKVVGNET  337
             +N KE+QEFK+VG+ T
Sbjct  739  WENFKEVQEFKLVGDAT  755


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 53/77 (69%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YN+K +++L F KV+           Y IT  A+EGG+KK YEAK+ + +
Sbjct  19   DDLARFAVQDYNQKNDSSLEFKKVLNVKQQIVAGIMYYITFEATEGGNKKEYEAKILLRK  78

Query  287  SKNIKELQEFKVVGNET  337
             +++K++  FK+VG+++
Sbjct  79   WEDLKKVVGFKLVGDDS  95


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 12/77 (16%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASE-GGHKKVYEAKVSVN  283
            +ELARFAI +YNKK NA+L F             ++Y IT+ A++  G KK+Y+AK+ V 
Sbjct  113  QELARFAIQDYNKKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVK  172

Query  284  ESKNIKELQEFKVVGNE  334
            E ++ K++ EFK+VG++
Sbjct  173  EWEDFKKVVEFKLVGDD  189


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 50/77 (65%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YN   NA+L F             ++Y IT+ A++ G+KK YEAK+ V E
Sbjct  302  QDLARFAVQDYNNTQNAHLEFVENLNVKEQLVSGMMYYITLAATDAGNKKEYEAKIWVKE  361

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++ +FK+VGN++
Sbjct  362  WEDFKKVIDFKLVGNDS  378


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++L RFA+ +YNK  NA+L F             ++Y IT  A++GG KK+YE K+ V  
Sbjct  397  QDLTRFAVHQYNKDQNAHLEFVENLNVKKQVVAGMLYYITFAATDGGKKKIYETKIWVKV  456

Query  287  SKNIKELQEFKVVGNET  337
             +N K++ EFK+VG+++
Sbjct  457  WENFKKVVEFKLVGDDS  473


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFAI  YNKK N +L F             ++Y IT+ A + G KK+YE K+ V E
Sbjct  208  QDLARFAIQVYNKKENVHLEFVENLNVKQQVVAGMMYYITLAAIDAGKKKIYETKIWVKE  267

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++ EFK+VG+++
Sbjct  268  WEDFKKVVEFKLVGDDS  284



>dbj|BAB18768.1| cysteine proteinase inhibitor [Triticum aestivum]
Length=125

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA++E+N KANA L F+ V+           + ITI  +EGG KK+YEAKV     +
Sbjct  49   LARFAVSEHNNKANALLEFENVVKLKKQTVAGTMHYITIRVTEGGAKKLYEAKVWEKPWE  108

Query  293  NIKELQEFKVV  325
            N K+LQEFK V
Sbjct  109  NFKQLQEFKPV  119



>ref|XP_003564419.1| PREDICTED: cysteine proteinase inhibitor-like [Brachypodium distachyon]
Length=136

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 11/70 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +LARFA++E+NK+AN  L FDKV+           Y  TI  +EGG KK+YEAKV     
Sbjct  59   DLARFAVSEHNKQANGLLEFDKVVKVREQTVAGTMYYFTIQVNEGGAKKLYEAKVWEKVW  118

Query  290  KNIKELQEFK  319
            +N K+L+EFK
Sbjct  119  ENFKKLEEFK  128



>ref|XP_010520100.1| PREDICTED: cysteine proteinase inhibitor 6 [Tarenaya hassleriana]
Length=201

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R  + S   + + E LARFA+ E+NKK NA L F +V+           +++T+ 
Sbjct  3    TLGGVRDSSGSQNSSEV-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
              E G KK+YEAKV V    N KELQEFK  G+
Sbjct  62   VIEAGKKKLYEAKVWVKPWMNFKELQEFKHAGD  94



>gb|ABG81097.1| cysteine proteinase inhibitor [Pelargonium x hortorum]
Length=98

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK N  L F  V+           Y IT+ A +G  KK+YEAKV    
Sbjct  20   DALARFAVDEHNKKQNTLLQFGGVVSVKQQVVAGTMYYITLEAMDGDKKKLYEAKVWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK VG+
Sbjct  80   WMNFKELQEFKPVGD  94



>ref|XP_010031687.1| PREDICTED: cysteine proteinase inhibitor A-like [Eucalyptus grandis]
 ref|XP_010031688.1| PREDICTED: cysteine proteinase inhibitor A-like [Eucalyptus grandis]
 gb|KCW51051.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
 gb|KCW51052.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
 gb|KCW51053.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
 gb|KCW51054.1| hypothetical protein EUGRSUZ_J00666 [Eucalyptus grandis]
Length=101

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L + KV+           Y ITI A +G  KK+YEAKV V  
Sbjct  20   EGLARFAVEEHNKKDNAMLQYVKVVKAKEQVVAGTVYYITIEAKDGDAKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVV  325
              N KE+QEFK+V
Sbjct  80   WMNFKEVQEFKLV  92



>emb|CAH57537.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKPKEQVFAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa]
Length=143

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>emb|CAH57547.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57548.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGPMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>emb|CAH57567.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57568.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVFAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>emb|CAH57541.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57542.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-like [Citrus sinensis]
Length=235

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NKK NA L F KV+           +++T+ A + G KK+YEAKV V  
Sbjct  54   ESLARFAIEEHNKKENALLEFVKVVKAQEQVVAGTMHHLTVEAIDAGRKKLYEAKVWVKP  113

Query  287  SKNIKELQEFKVVGN  331
              N K+LQEFK VG+
Sbjct  114  WLNFKDLQEFKHVGD  128



>emb|CEJ09684.1| Cystatin protein [Zea mays]
Length=134

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +2

Query  41   SSSFIKQRCTTNNT-PTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-  214
            S+   ++    NNT P +  ++ V  S     + +ELARFA+ E+NKKANA L F+K++ 
Sbjct  23   STRNAQEDSMANNTGPLVGGIQDVPGSENDLHL-QELARFAVDEHNKKANALLGFEKLVK  81

Query  215  ----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                      Y +TI   +G  KK+YEAKV     +N+K LQEFK V
Sbjct  82   AKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENLKGLQEFKPV  128



>emb|CAD60537.1| cystatin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95162.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99512.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=107

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            ELARFA+AE+N KANA L F++++           +  TI   EGG KK+YEAKV     
Sbjct  35   ELARFAVAEHNAKANALLEFERLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAW  94

Query  290  KNIKELQEFK  319
            +N K+LQEFK
Sbjct  95   ENFKQLQEFK  104



>emb|CDY35433.1| BnaA03g19270D [Brassica napus]
Length=94

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 15/86 (17%)
 Frame = +2

Query  95   SLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASE  241
             LRV  SS  ++S    LARFAI E+N + N  L F K++           Y++T+ ASE
Sbjct  9    DLRVNHSSGVISS----LARFAIQEHNNRENKVLAFKKIVKAREQVVAGTMYHLTLEASE  64

Query  242  GGHKKVYEAKVSVNESKNIKELQEFK  319
            GG  K +EAKV V    N K+LQEFK
Sbjct  65   GGKSKNFEAKVWVKPWMNFKQLQEFK  90



>ref|NP_001044550.1| Os01g0803200 [Oryza sativa Japonica Group]
 sp|P09229.2|CYT1_ORYSJ RecName: Full=Cysteine proteinase inhibitor 1; AltName: Full=Oryzacystatin 
I; Short=OC-I; AltName: Full=Oryzacystatin-1; 
AltName: Full=OsCP1; AltName: Full=SPOC-I; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAF06464.1| Os01g0803200 [Oryza sativa Japonica Group]
 gb|EAY76178.1| hypothetical protein OsI_04110 [Oryza sativa Indica Group]
 gb|EAZ13861.1| hypothetical protein OsJ_03784 [Oryza sativa Japonica Group]
 dbj|BAG88102.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIY68265.1| oryzacystatin I [Oryza sativa Indica Group]
Length=140

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 13/101 (13%)
 Frame = +2

Query  56   KQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-------  214
            +++ +++  P L  +  V +   +  +  +LARFA+ E+NKKAN+ L F+K++       
Sbjct  36   EEKMSSDGGPVLGGVEPVGNENDLHLV--DLARFAVTEHNKKANSLLEFEKLVSVKQQVV  93

Query  215  ----YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                Y  TI   EG  KK+YEAKV      + KELQEFK V
Sbjct  94   AGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPV  134



>gb|AEQ54767.1| cysteine proteinase inhibitor CPI-2 [Coffea canephora]
 emb|CDP09706.1| unnamed protein product [Coffea canephora]
Length=98

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LA+FA+ +YNKK NA L F KVI           Y +TI   +G  KK+YEAKV V  
Sbjct  20   ESLAKFAVDDYNKKQNALLEFQKVINSKEQVVAGTVYYLTIEVKDGNEKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGNET  337
              N KE+QEFK    +T
Sbjct  80   WLNFKEVQEFKPAAGDT  96



>emb|CAH57564.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVFAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>ref|XP_003568198.2| PREDICTED: cysteine proteinase inhibitor-like [Brachypodium distachyon]
Length=142

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            ELARFA+AE+N KANA L F++++           ++ TI   EGG KK YEAKV     
Sbjct  70   ELARFAVAEHNSKANAVLEFERLVKVRQQLVSGLMHHFTIEVKEGGAKKTYEAKVWEKAW  129

Query  290  KNIKELQEFK  319
            +N K+LQ+FK
Sbjct  130  ENFKQLQDFK  139



>gb|KDO66413.1| hypothetical protein CISIN_1g034261mg [Citrus sinensis]
 gb|KDO66414.1| hypothetical protein CISIN_1g034261mg [Citrus sinensis]
 gb|KDO66415.1| hypothetical protein CISIN_1g034261mg [Citrus sinensis]
 gb|KDO66416.1| hypothetical protein CISIN_1g034261mg [Citrus sinensis]
Length=100

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK N+NL F KV+           Y+IT+ A EGG KK++EAKV      
Sbjct  22   LARFAVDEHNKKQNSNLQFVKVVSAKQQVVSGTLYDITLEAVEGGQKKLFEAKVWEKPWM  81

Query  293  NIKELQEFKVV  325
              KEL+EF  V
Sbjct  82   QFKELKEFNTV  92



>ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera]
Length=239

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +++           +++T+   E G KK+YEAKV V  
Sbjct  58   ESLARFAVDEHNKKQNALLEFARIVKAKEQVVAGTLHHLTLEVIEAGKKKIYEAKVWVKP  117

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK VG+
Sbjct  118  WLNFKELQEFKPVGD  132



>emb|CAH57538.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57543.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57544.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57558.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57563.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>ref|XP_009385315.1| PREDICTED: cysteine proteinase inhibitor 6-like [Musa acuminata 
subsp. malaccensis]
Length=96

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 11/72 (15%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E+LARFA+ E+NKK NA L F +V+           +++T+ A + G KKVYEAKV V 
Sbjct  19   TEQLARFAVDEHNKKENALLEFVRVVEAKEQVVAGTLHHLTVEAVDAGKKKVYEAKVWVK  78

Query  284  ESKNIKELQEFK  319
               N KELQEF+
Sbjct  79   PWLNFKELQEFR  90



>ref|XP_008245515.1| PREDICTED: cysteine proteinase inhibitor 6-like [Prunus mume]
 ref|XP_008245658.1| PREDICTED: cysteine proteinase inhibitor 6-like [Prunus mume]
Length=95

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ EYNKK NA L F +V+           + +TI  S+ G KK++EAKV V 
Sbjct  19   TESLARFAVEEYNKKENALLEFVRVVNEKVQVVSGTLHYLTIEVSDAGKKKLFEAKVWVK  78

Query  284  ESKNIKELQEFKVVGN  331
               N KE+QEFK V +
Sbjct  79   PWANFKEVQEFKPVAD  94



>emb|CAA60610.1| cysteine proteinase inhibitor [Zea mays]
Length=134

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKKANA L F+K++           Y +TI   +G  KK+YEAKV    
Sbjct  56   QELARFAVDEHNKKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKP  115

Query  287  SKNIKELQEFKVV  325
             +N KELQEFK V
Sbjct  116  WENFKELQEFKPV  128



>ref|XP_010931548.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=202

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 42/70 (60%), Gaps = 11/70 (16%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E NKKAN  L F +V           IY ITI A +GG KK+YEAKV V  
Sbjct  20   EELARFAVEEQNKKANTLLEFVRVVKVKEQVVSGIIYYITIEAIDGGEKKLYEAKVWVKP  79

Query  287  SKNIKELQEF  316
                KELQEF
Sbjct  80   WMKFKELQEF  89



>gb|AGX28139.1| cysteine protease inhibitor, partial [Populus euphratica]
 gb|AGX28140.1| cysteine protease inhibitor, partial [Populus euphratica]
Length=107

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           +++TI A E G KK+YEAKV V  
Sbjct  20   DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KEL EFK  G+
Sbjct  80   WLNFKELHEFKDAGD  94



>dbj|BAA09666.1| cysteine proteinase inhibitor [Zea mays]
 gb|AAY57865.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 emb|CAJ20024.1| putative cystatin [Zea mays]
 gb|AFW84824.1| cystatin2 [Zea mays]
 emb|CEJ09685.1| Cystatin protein [Zea mays]
Length=134

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKKANA L F+K++           Y +TI   +G  KK+YEAKV    
Sbjct  56   QELARFAVDEHNKKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKP  115

Query  287  SKNIKELQEFKVV  325
             +N KELQEFK V
Sbjct  116  WENFKELQEFKPV  128



>ref|XP_010689648.1| PREDICTED: cysteine proteinase inhibitor 6-like [Beta vulgaris 
subsp. vulgaris]
Length=213

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  LR    +   A I E LARFA+ E+NKK NA L F +V+           ++ TI 
Sbjct  48   TLGGLRESQGASNDAEI-ESLARFAVEEHNKKENALLEFARVVKAKEQVVAGTLHHFTIE  106

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+Y+AKV V    N KELQEFK
Sbjct  107  AIEAGKKKLYDAKVWVKPWMNFKELQEFK  135



>emb|CAH57531.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  ++   SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVQDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVRVKPWLNFKELHEFK  125



>emb|CAH57532.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANL-----------VFDKVIYNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L           VF   ++++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARLVKAKDQVFAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV VN   N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVNPWLNFKELHEFK  125



>ref|XP_004253396.2| PREDICTED: multicystatin, partial [Solanum lycopersicum]
Length=741

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YN+K  ++L F+KV+           Y IT   +EGG KK YEAK+ V E
Sbjct  19   DDLARFAVKDYNQKNGSSLEFEKVLKVKKQIVAGIMYYITFEGTEGGKKKEYEAKIWVKE  78

Query  287  SKNIKELQEFKVVGNE  334
            S+N K++  FK+VG++
Sbjct  79   SENFKKVVGFKLVGDD  94


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 50/77 (65%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNK  NA+L +              +Y IT+VA++ G KK+YE K+ V E
Sbjct  583  QDLARFAVQDYNKAQNAHLEYVENLNVKEQLVAGTLYYITLVATDAGKKKIYETKIWVKE  642

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++ EFK+VG+++
Sbjct  643  WEDFKKVVEFKLVGDDS  659


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 51/77 (66%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ +YNK  NA+L F +V+           Y IT+VA++ G+KK YEAK+ V E
Sbjct  301  QDLARFAVNDYNKSQNAHLEFVEVLNVKEQVVSGMMYYITLVATDDGNKKDYEAKIWVKE  360

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++  FK+VG ++
Sbjct  361  WEDFKKVISFKLVGKDS  377


 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++L RFAI +YNKK NA+L F             ++Y IT  A++ G K +YE K+ V E
Sbjct  395  QDLTRFAIQDYNKKENAHLEFVENLNVKKQVVAGMLYYITFAATDAGKKNIYETKIWVKE  454

Query  287  SKNIKELQEFKVVGNE  334
             ++ K++ EFK+VG++
Sbjct  455  WEDFKKVVEFKLVGDD  470


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ +YN+K   +L F             ++Y IT+ A++ G KK+YEAK+ V E
Sbjct  113  QELARFAVQDYNEKQKTHLEFVENLNVKEQVVAGMMYYITLAATDAGIKKIYEAKIWVKE  172

Query  287  SKNIKELQEFKVVGNE  334
             +N K++ EFK+ G++
Sbjct  173  WENFKKVVEFKLSGDD  188


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 49/77 (64%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVF-----------DKVIYNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFAI +YN+K  A+L F             ++Y IT+ A++ G KK+YE K+ V E
Sbjct  207  QKLARFAIQDYNEKEKAHLEFVENLNVKEQVVAGMMYYITLAATDAGKKKIYETKIWVKE  266

Query  287  SKNIKELQEFKVVGNET  337
             ++ K++ EFK+VG+ +
Sbjct  267  WEDFKKVVEFKLVGDNS  283



>gb|ACO39793.1| cysteine inhibitor 1 [Populus balsamifera]
Length=127

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  22   TLGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  80

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    + KEL EFK  G+
Sbjct  81   AVEAGKKKLYEAKVWVKPWLHFKELHEFKDAGD  113



>ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trichocarpa]
 gb|EEE78934.1| cysteine proteinase inhibitor [Populus trichocarpa]
Length=235

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 17/108 (16%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI--  214
            S  F +++  T     L  +    SS   A I + LARFA+ E+NKK NA L F +V+  
Sbjct  28   SGGFCQEKMAT-----LGGVHDSQSSQNSAEI-DSLARFAVDEHNKKENAILEFARVVKA  81

Query  215  ---------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
                     +++TI A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  82   KEQVVAGTMHHLTIEAVEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>ref|XP_011090213.1| PREDICTED: cysteine proteinase inhibitor A-like [Sesamum indicum]
Length=97

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +LARFA+ E  KK N  L F KV+           Y IT+ A EGG  KVYEAKV V   
Sbjct  23   DLARFAVNEQQKKENTLLEFKKVLSAKEQVVAGTMYYITLEAVEGGKSKVYEAKVWVKPW  82

Query  290  KNIKELQEFKVVGN  331
             N KE++EFK++G+
Sbjct  83   MNFKEVEEFKLIGD  96



>gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta]
Length=205

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKK NA L F +           +++++T+   EGG KKVYEAKV V  
Sbjct  20   EELARFAVDEHNKKENALLQFSRLVKAKQQVVSGIMHHLTVEVIEGGKKKVYEAKVWVQA  79

Query  287  SKNIKELQEFKVVGNET  337
              N K+L EF  +G+ +
Sbjct  80   WLNSKKLHEFSPIGDSS  96



>dbj|BAA95416.1| multicystatin [Helianthus annuus]
Length=282

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            ++LARFA+ EYNKK N  L F KV+           Y IT+ A+ GG  K YEAKV V +
Sbjct  20   DDLARFAVDEYNKKQNTLLEFRKVLNAKEQIVSGTLYYITLDAANGGIIKTYEAKVWVKK  79

Query  287  SKNIKELQEFKVVGNET  337
             +N+KELQEFK V   T
Sbjct  80   WENLKELQEFKPVDAAT  96


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 46/77 (60%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E+LARFA+ E+NKK N  L F KV+             IT+ A++GG KK YEAKV V  
Sbjct  115  EDLARFAVDEHNKKQNTLLEFGKVLNAKEQIVAGKLCYITLEATDGGVKKTYEAKVWVKP  174

Query  287  SKNIKELQEFKVVGNET  337
             +N KELQEFK V   T
Sbjct  175  WENFKELQEFKPVDAAT  191



>gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja]
Length=245

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ E+NKK N+ L F +V+           +++T+ A E G KK+YEAKV V 
Sbjct  63   TEALARFAVDEHNKKQNSLLEFARVVRAQEQVVAGTLHHLTLEAIEAGEKKLYEAKVWVK  122

Query  284  ESKNIKELQEFKVVGN  331
               N KELQEFK  G+
Sbjct  123  PWLNFKELQEFKPAGD  138



>ref|XP_006446360.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446361.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446362.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 ref|XP_006446363.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59600.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59601.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59602.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
 gb|ESR59603.1| hypothetical protein CICLE_v10017285mg [Citrus clementina]
Length=100

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK N+NL F KV+           Y+IT+ A EGG KK++EAKV      
Sbjct  22   LARFAVDEHNKKQNSNLQFVKVVSAKQQVVSGTLYDITLEAVEGGQKKLFEAKVWEKPWM  81

Query  293  NIKELQEFKVV  325
              KEL+EF  V
Sbjct  82   QFKELKEFNPV  92



>ref|XP_006470502.1| PREDICTED: cysteine proteinase inhibitor-like [Citrus sinensis]
Length=100

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK N+NL F KV+           Y+IT+ A EGG KK++EAKV      
Sbjct  22   LARFAVDEHNKKQNSNLQFVKVVSAKQQVVSGTLYDITLEAVEGGQKKLFEAKVWEKPWM  81

Query  293  NIKELQEFKVV  325
              KEL+EF  V
Sbjct  82   QFKELKEFNPV  92



>ref|XP_010245150.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera]
Length=204

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E L RFA+ EYNKK NA L F +V+           +++T+  +E G KK+YEAKV V  
Sbjct  23   ESLGRFAVDEYNKKQNALLEFGRVVEAKEQLVAGTLHHLTLEVTEAGMKKLYEAKVWVKP  82

Query  287  SKNIKELQEFKVVGNET  337
              N KELQEF  V ++ 
Sbjct  83   WLNFKELQEFTPVSDDP  99



>ref|XP_009394087.1| PREDICTED: cysteine proteinase inhibitor-like [Musa acuminata 
subsp. malaccensis]
Length=147

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKK NA L F +V+           +++T+ A + G KK+YEAKV V  
Sbjct  52   EELARFAVDEHNKKENALLEFARVVKAKEQVVTGTLHHLTVEAIDAGKKKLYEAKVWVKP  111

Query  287  SKNIKELQEFKVVGN  331
              + KELQ+FK V +
Sbjct  112  WLHFKELQDFKHVAD  126



>pdb|1EQK|A Chain A, Solution Structure Of Oryzacystatin-I, A Cysteine Proteinase 
Inhibitor Of The Rice, Oryza Sativa L. Japonica
 gb|AAL30830.1|AF435976_1 cystatin [Oryza sativa Japonica Group]
 gb|AAA33903.1| oryzacystatin [Oryza sativa]
 gb|AAA33912.1| oryzastatin [Oryza sativa]
 gb|AAB24010.1| oryzacystatin [Oryza]
 gb|AAB66355.1| oryzacystatin [Oryza sativa]
 dbj|BAB86438.1| cystatin [Oryza sativa Japonica Group]
 dbj|BAB92242.1| cystatin [Oryza sativa Japonica Group]
Length=102

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 13/97 (13%)
 Frame = +2

Query  68   TTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------  214
            +++  P L  +  V +   +  +  +LARFA+ E+NKKAN+ L F+K++           
Sbjct  2    SSDGGPVLGGVEPVGNENDLHLV--DLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTL  59

Query  215  YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
            Y  TI   EG  KK+YEAKV      + KELQEFK V
Sbjct  60   YYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPV  96



>ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citrus clementina]
 gb|ESR45608.1| hypothetical protein CICLE_v10002346mg [Citrus clementina]
Length=235

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NKK NA L F KV+           +++T+ A + G KK+YEAKV V  
Sbjct  54   ESLARFAIEEHNKKENALLEFVKVVKAQEQVVAGTMHHLTVEAIDAGTKKLYEAKVWVKP  113

Query  287  SKNIKELQEFKVVGN  331
              N K+LQEFK VG+
Sbjct  114  WLNFKDLQEFKHVGD  128



>ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma cacao]
 gb|EOY19584.1| Cysteine proteinase inhibitor 12 [Theobroma cacao]
Length=239

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 54/100 (54%), Gaps = 12/100 (12%)
 Frame = +2

Query  65   CTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI----------  214
            C+     TL  +     S   A + E LARFA+ E+NKK NA + F +V+          
Sbjct  31   CSEPMATTLGGVHPSHGSQNSAEL-ENLARFAVDEHNKKENAMVEFVRVVKATEQVVAGT  89

Query  215  -YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
             +++T+ A + G KK+YEAKV V    N KELQEFK  G+
Sbjct  90   LHHLTVEAIDAGKKKLYEAKVWVKPWMNFKELQEFKHAGD  129



>gb|EPS68642.1| cysteine proteinase inhibitor, partial [Genlisea aurea]
Length=79

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E L RFAI E+NK  NA L F +V+           Y++T+ A +GG K+VYEAKV V  
Sbjct  7    ESLGRFAIQEHNKNQNAALEFTRVVKAEQQVVSGKLYHLTVEAVDGGQKQVYEAKVWVKP  66

Query  287  SKNIKELQEFK  319
              N K+L EFK
Sbjct  67   WLNFKQLNEFK  77



>gb|ABQ32295.1| cysteine protease inhibitor [Zea mays]
Length=134

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 60/107 (56%), Gaps = 13/107 (12%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLS-LRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-  214
            S+   ++    NNT TL+  ++ V  S     + +ELARFA+ E NKKANA L F+K++ 
Sbjct  23   STRNAQEDSMANNTGTLVGGIQDVPGSENDLHL-QELARFAVDERNKKANALLGFEKLVK  81

Query  215  ----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                      Y +TI   +G  KK+YEAKV     +N+K LQEFK V
Sbjct  82   AKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENLKGLQEFKPV  128



>gb|ABQ32296.1| cysteine protease inhibitor [Oryza sativa Indica Group]
Length=140

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 13/101 (13%)
 Frame = +2

Query  56   KQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDK---------  208
            +++ +++  P L  L  V +   +  +  +LARFA+ E+NKKAN+   F+K         
Sbjct  36   EEKMSSDGGPVLGGLEPVGNENDLHLV--DLARFAVTEHNKKANSLFEFEKRVSVKQQVV  93

Query  209  --VIYNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
               +Y  TI   EG  KK+YEAKV      + KELQEFK V
Sbjct  94   AGTLYYFTIEVKEGEAKKLYEAKVWEKPWMDFKELQEFKPV  134



>dbj|BAK03799.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            ELARFA+AE+N KANA L F++++           +  TI   EGG KK+YEAKV     
Sbjct  97   ELARFAVAEHNAKANALLEFERLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAW  156

Query  290  KNIKELQEFK  319
            +N K+LQEFK
Sbjct  157  ENFKQLQEFK  166



>gb|AAB71505.1| cysteine protease inhibitor [Pyrus communis]
Length=95

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVF-----DKV------IYNITIVASEGGHKKVYEAKVSVN  283
            +E LAR+A+ E+NKK N  L F     DKV      ++ + I A+EGG KKVYEAKV V 
Sbjct  19   TESLARYAVDEHNKKENDLLEFVRVLDDKVQVVSGTMHYLKIEATEGGKKKVYEAKVWVK  78

Query  284  ESKNIKELQEFKVVGN  331
              +N K++QEFK V +
Sbjct  79   PWENFKQVQEFKPVSD  94



>ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus]
Length=202

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R    +   A + +ELARFA+ E+NKK N+ L F +V+           +++T+ 
Sbjct  4    TLGDVRDSQGASNSADV-DELARFAVEEHNKKENSLLEFVRVVKAKEQVVAGTLHHLTVE  62

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
              E G KK+YEAKV V    N KELQEFK  G+
Sbjct  63   VVEAGKKKLYEAKVWVKSWMNFKELQEFKHAGD  95



>ref|XP_002879896.1| FL3-27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56155.1| FL3-27 [Arabidopsis lyrata subsp. lyrata]
Length=125

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG H K +EAKV V  
Sbjct  51   ESLARFAIQEHNKQQNKVLEFKKIVKAREQVVSGTMYHLTLEAKEGDHTKNFEAKVWVKP  110

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  111  WMNFKQLQEFK  121



>emb|CAH57571.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 57/108 (53%), Gaps = 17/108 (16%)
 Frame = +2

Query  41   SSSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI--  214
            S  F +++ TT     L  +    SS   A I + LAR A+ E+NKK NA L F +V+  
Sbjct  28   SGGFCQEKMTT-----LGGVHDSQSSQNSAEI-DGLARLAVDEHNKKENAILEFARVVKA  81

Query  215  ---------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
                     +++TI A E G K++YEAKV V    N KEL EFK  G+
Sbjct  82   KEQVVAGTMHHLTIEAIEAGKKRLYEAKVWVKPWLNFKELHEFKDAGD  129



>gb|KFK38602.1| hypothetical protein AALP_AA3G134900 [Arabis alpina]
Length=201

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R V ++     + E LARFA+ E+NKK NA L F +V+           +++T+ 
Sbjct  3    TLGGIRDVPANQNSGEV-ESLARFAVDEHNKKENALLEFGRVVKAKEQVVAGTVHHLTLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
              E G KK+YEAKV V    N KELQEFK
Sbjct  62   IIEAGEKKLYEAKVWVKSWLNFKELQEFK  90



>ref|XP_007220494.1| hypothetical protein PRUPE_ppa013935mg [Prunus persica]
 gb|EMJ21693.1| hypothetical protein PRUPE_ppa013935mg [Prunus persica]
Length=95

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ EYNKK NA L F +V+           + +TI  ++ G KK++EAKV V 
Sbjct  19   TESLARFAVEEYNKKENALLEFVRVVNEKVQVVSGTLHYLTIEVTDAGKKKLFEAKVWVK  78

Query  284  ESKNIKELQEFKVVGN  331
               N KE+QEFK V +
Sbjct  79   PWANFKEVQEFKPVAD  94



>dbj|BAB18766.1| cysteine proteinase inhibitor [Triticum aestivum]
 gb|ADP50759.1| cysteine proteinase inhibitor TrcC-1 [Secale cereale x Triticum 
aestivum]
Length=142

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA++E+N KANA L F+ V+           + ITI  +EGG KK+YEAKV     +
Sbjct  66   LARFAVSEHNNKANALLEFENVVKVKKQTVAGTMHYITIRVTEGGAKKLYEAKVWEKPWE  125

Query  293  NIKELQEFKVV  325
            N K+L+EFK+V
Sbjct  126  NFKKLEEFKLV  136



>gb|ABB80379.1| cystatin WC-1 [Triticum aestivum]
 gb|ABB80380.1| cystatin WC-1 [Triticum aestivum]
Length=142

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA++E+N KANA L F+ V+           + ITI  +EGG KK+YEAKV     +
Sbjct  66   LARFAVSEHNNKANALLEFENVVKVKKQTVAGTMHYITIRVTEGGAKKLYEAKVWEKPWE  125

Query  293  NIKELQEFKVV  325
            N K+L+EFK+V
Sbjct  126  NFKKLEEFKLV  136



>ref|XP_010244436.1| PREDICTED: cysteine proteinase inhibitor A-like [Nelumbo nucifera]
Length=148

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E+LARFA+ E+NKK NA L F +V+           +++T+   E G KK+ EAKV V  
Sbjct  59   EDLARFAVDEHNKKQNALLEFGRVVMAKEQVVAGMMHHLTLEVIEAGKKKLCEAKVWVKP  118

Query  287  SKNIKELQEFKVVGN  331
              N KEL EF++VG+
Sbjct  119  WMNFKELHEFRLVGD  133



>gb|EMT09912.1| Cysteine proteinase inhibitor [Aegilops tauschii]
Length=107

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            ELARFA+AE+N KANA L F++++           +  TI   EGG KK+YEAKV     
Sbjct  35   ELARFAVAEHNTKANALLEFERLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAW  94

Query  290  KNIKELQEFK  319
            +N K+LQ+FK
Sbjct  95   ENFKQLQDFK  104



>ref|XP_002283400.1| PREDICTED: cysteine proteinase inhibitor 12-like [Vitis vinifera]
Length=234

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 53/103 (51%), Gaps = 15/103 (15%)
 Frame = +2

Query  44   SSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKV----  211
             SFI+   T N    L  +R        A I E +ARFA+ E+NK  NA L F KV    
Sbjct  25   DSFIRMPKTMN---LLGGVRDCGGIQNSAEI-ESIARFAVQEHNKNQNALLEFAKVLKAK  80

Query  212  -------IYNITIVASEGGHKKVYEAKVSVNESKNIKELQEFK  319
                   IY +T+ A + G KK+YEAKV V    N KELQEFK
Sbjct  81   EQVVAGKIYYLTLEAIDAGKKKIYEAKVWVKPWMNFKELQEFK  123



>emb|CAH57554.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +++           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARLVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KEL EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFKDAGD  129



>gb|AAB24011.1| oryzacystatin=cysteine protease inhibitor [Oryza=rice, Peptide 
Recombinant, 90 aa]
Length=90

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +LARFA+ E+NKKAN+ L F+K++           Y  TI   EG  KK+YEAKV     
Sbjct  13   DLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPW  72

Query  290  KNIKELQEFKVV  325
             + KELQEFK V
Sbjct  73   MDFKELQEFKPV  84



>gb|AAZ98791.1| cystatin [Medicago sativa]
Length=98

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 53/91 (58%), Gaps = 12/91 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +R V  +    +I + LARFA+ E+NKK NA L F +VI           ++IT+ 
Sbjct  3    TLGGVRDVPGNQNSLAI-DGLARFAVEEHNKKQNALLEFSRVISAKEQVVAGTIHHITLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
              +G +KKVYEAKV      N KE+QEFK+V
Sbjct  62   VKDGVNKKVYEAKVWEKSWMNFKEVQEFKLV  92



>emb|CBX19819.1| cystein proteinase inhibitor [Arachis hypogaea]
Length=98

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +VI           ++IT+ A+ G  K VYEAKV    
Sbjct  20   DSLARFAVDEHNKKQNALLEFKRVISAKQQVVAGTLHHITLEAASGDSKNVYEAKVWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK+ G+
Sbjct  80   WMNFKEVQEFKLAGD  94



>ref|XP_008801966.1| PREDICTED: protein GAMETE EXPRESSED 3 [Phoenix dactylifera]
Length=817

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EEL RFA+ E+NKK NA L F +V+           +++T+   E G KK+YE KV V  
Sbjct  61   EELGRFAVQEHNKKENALLEFVRVVKAKEQVVAGALHHLTLEVMEAGKKKLYEVKVWVKP  120

Query  287  SKNIKELQEFKVVGNET  337
              N KELQEFK +G+ +
Sbjct  121  RLNFKELQEFKHLGDSS  137



>ref|XP_010045098.1| PREDICTED: cysteine proteinase inhibitor-like [Eucalyptus grandis]
 gb|KCW87251.1| hypothetical protein EUGRSUZ_B03762 [Eucalyptus grandis]
Length=101

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = +2

Query  95   SLRVVASSLTMASISEELARFAIAEYNKKANANLVF-----------DKVIYNITIVASE  241
             +R +A +     I + LARFA+ E NKK N  L               ++Y +T+ A++
Sbjct  6    GIRQIAGNQNSVEI-DGLARFAVNEQNKKQNGLLELRKVVNVKQQVVSGIMYYVTLEAAD  64

Query  242  GGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            GG KKVY+AK+ V    N K LQEFK+VG+
Sbjct  65   GGVKKVYDAKIWVKPWMNFKSLQEFKIVGD  94



>gb|ADD51191.1| cystatin [Vitis cinerea var. helleri x Vitis riparia]
Length=234

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 53/103 (51%), Gaps = 15/103 (15%)
 Frame = +2

Query  44   SSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKV----  211
             SFI+   T N    L  +R        A I E +ARFA+ E+NK  NA L F KV    
Sbjct  25   DSFIRMPKTMN---LLGGVRDCGGIQNSAEI-ESIARFAVQEHNKNQNALLEFAKVLKAK  80

Query  212  -------IYNITIVASEGGHKKVYEAKVSVNESKNIKELQEFK  319
                   IY +T+ A + G KK+YEAKV V    N KELQEFK
Sbjct  81   EQVVASKIYYLTLEAIDAGKKKIYEAKVWVKPWMNFKELQEFK  123



>ref|XP_010670580.1| PREDICTED: cysteine proteinase inhibitor 6 [Beta vulgaris subsp. 
vulgaris]
Length=250

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  LR    +   A I E LARFA+ E+NKK NA L F +V+           ++ TI 
Sbjct  48   TLGGLRESQGASNDAEI-ESLARFAVEEHNKKENALLEFARVVKAKEQVVAGTLHHFTIE  106

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+Y+AKV V    N KELQEFK
Sbjct  107  AIEAGKKKLYDAKVWVKPWMNFKELQEFK  135



>gb|ADD69946.1| cysteine protease inhibitor [Knorringia sibirica]
Length=111

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 14/95 (15%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  ++ V  S     I E LA+FA+ ++NKK NA L   KV+           Y IT+ 
Sbjct  3    TLGGIKPVEGSANSLEI-ESLAKFAVEDHNKKENAMLELSKVVSSKEQVVAGTMYYITLE  61

Query  233  ASEGG--HKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A++ G   KKVYEAKV V    N KE+QEFK +G+
Sbjct  62   ATDAGGKKKKVYEAKVWVKPWMNFKEVQEFKFLGD  96



>gb|KDP40574.1| hypothetical protein JCGZ_24573 [Jatropha curcas]
Length=205

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+NKK NA L F +V+           +++TI A E G KK+YEAK+ V    
Sbjct  20   LARFAVEEHNKKENALLEFARVVKAKEQVVAGTLHHLTIEAIEAGKKKLYEAKIWVKPWL  79

Query  293  NIKELQEFKVVGN  331
            N KELQEFK  G+
Sbjct  80   NFKELQEFKHAGD  92



>gb|ABK23526.1| unknown [Picea sitchensis]
 gb|ABK24580.1| unknown [Picea sitchensis]
 gb|ABK25596.1| unknown [Picea sitchensis]
 gb|ABK26416.1| unknown [Picea sitchensis]
 gb|ABR16656.1| unknown [Picea sitchensis]
 gb|ACN40019.1| unknown [Picea sitchensis]
 gb|ACN40233.1| unknown [Picea sitchensis]
 gb|ACN40884.1| unknown [Picea sitchensis]
 gb|ACN41060.1| unknown [Picea sitchensis]
Length=141

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDITFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>emb|CAH57551.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAMLEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>ref|XP_011020467.1| PREDICTED: cysteine proteinase inhibitor 6-like [Populus euphratica]
Length=235

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           +++TI A E G KK+YEAKV V  
Sbjct  55   DSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLYEAKVWVKP  114

Query  287  SKNIKELQEFKVVGN  331
              N KEL EFK  G+
Sbjct  115  WLNFKELHEFKDAGD  129



>gb|ABG89856.1| cystatin [Amaranthus hypochondriacus]
Length=247

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  LR    +   A I E LARFA+ E+NKK NA L F +V+           ++ TI 
Sbjct  44   TLGGLRESQGAANDAEI-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHFTIE  102

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A + G KK+Y+AKV V    N KELQEFK
Sbjct  103  AIDAGKKKLYDAKVWVKPWMNFKELQEFK  131



>ref|XP_010938907.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis]
Length=200

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EEL RFA+ E+NKK NA L F +V+           +++T+   E G KK+ EAKV V  
Sbjct  20   EELGRFAVREHNKKENALLEFGRVVKAKEQVVAGTLHHLTLEVMEAGKKKICEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK  G+
Sbjct  80   WLNFKELQEFKHAGD  94



>ref|XP_004493324.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum]
Length=230

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 14/100 (14%)
 Frame = +2

Query  65   CTTNNTPTLLSLRVVASSLT--MASISEELARFAIAEYNKKANANLVFDKV---------  211
            CT  +   ++ +++ A   T  +A I E LARFA+ ++N K N  L F KV         
Sbjct  23   CTQQHPNKIIIMKMGADEDTPKVAEI-ESLARFAVQQHNNKENTLLEFVKVLKAKEQVVA  81

Query  212  --IYNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
              IY +T+ A + G KK+YEAK+ V    N K+LQEFK+V
Sbjct  82   GKIYYLTLEAVDAGKKKIYEAKIWVKPWMNFKQLQEFKLV  121



>ref|XP_010499025.1| PREDICTED: cysteine proteinase inhibitor 6-like [Camelina sativa]
Length=232

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 54/101 (53%), Gaps = 12/101 (12%)
 Frame = +2

Query  68   TTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------  214
              ++   L  +R V S+     + E LARFA+ E+NKK NA L F +V+           
Sbjct  31   CDDDMALLGGVRDVPSNQNSGEV-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTL  89

Query  215  YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGNET  337
            +++T+   E G KK+YEAKV V    N KELQEFK   N T
Sbjct  90   HHLTLEILEAGEKKLYEAKVWVKPWLNFKELQEFKPASNIT  130



>ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max]
 gb|ACU14063.1| unknown [Glycine max]
Length=245

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ E+NKK N+ L F +V+           +++T+ A E G KK+YEAK  V 
Sbjct  63   TEALARFAVDEHNKKQNSLLEFARVVRAQEQVVAGTLHHLTLEAIEAGEKKLYEAKAWVK  122

Query  284  ESKNIKELQEFKVVGN  331
               N KELQEFK  G+
Sbjct  123  PWLNFKELQEFKPAGD  138



>ref|XP_010465015.1| PREDICTED: cysteine proteinase inhibitor 6 [Camelina sativa]
Length=230

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 54/101 (53%), Gaps = 12/101 (12%)
 Frame = +2

Query  68   TTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------  214
              ++   L  +R V S+     + E LARFA+ E+NKK NA L F +V+           
Sbjct  29   CNDDMALLGGVRDVPSNQNSGEV-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTL  87

Query  215  YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGNET  337
            +++T+   E G KK+YEAKV V    N KELQEFK   N T
Sbjct  88   HHLTLEILEAGEKKLYEAKVWVKPWLNFKELQEFKPASNIT  128



>emb|CDM82757.1| unnamed protein product [Triticum aestivum]
 emb|CDM82761.1| unnamed protein product [Triticum aestivum]
 emb|CDM82767.1| unnamed protein product [Triticum aestivum]
Length=243

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KKVYEAKV V 
Sbjct  56   TDGLARFAVDEHNKRENALLEFVRVVEAKEQTVAGTLHHLTLEALEAGRKKVYEAKVWVK  115

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  116  PWLDFKELQEFRHTGDAT  133



>gb|ACM43995.1| cysteine proteinase inhibitor [Triticum aestivum]
Length=102

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 11/71 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA++E+N KANA L F+ V+           + ITI  +EGG KK+YEAKV     +
Sbjct  26   LARFAVSEHNNKANALLEFENVVKLKKQTVAGTMHYITIRVTEGGAKKLYEAKVWEKPWE  85

Query  293  NIKELQEFKVV  325
            N K+L+EFK V
Sbjct  86   NFKKLEEFKPV  96



>gb|AAY57864.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
 gb|AAY57868.1| cysteine proteinase inhibitor [Zea mays subsp. parviglumis]
Length=134

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKKANA L F+K++           Y +TI   +G  KK+YEAKV    
Sbjct  56   QELARFAVDEHNKKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKP  115

Query  287  SKNIKELQEFKVV  325
             +N+K LQEFK V
Sbjct  116  WENLKGLQEFKPV  128



>ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris]
 gb|ESW05635.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris]
Length=246

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            +E LARFA+ E+NKK N+ L F  V+           +++T+ A E G KK+YEAKV V 
Sbjct  64   TESLARFAVDEHNKKQNSLLEFAGVVRAQEQVVSGTLHHLTLEAVEAGEKKLYEAKVWVK  123

Query  284  ESKNIKELQEFKVVG  328
               N KELQEFK  G
Sbjct  124  PWLNFKELQEFKPAG  138



>gb|AAC69278.1| cysteine proteinase inhibitor [Dianthus caryophyllus]
Length=98

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            +ELA+FA+  YN   NA L F +V           IY IT+ A++GG KK+YEA V V  
Sbjct  21   DELAKFAVDHYNSIENALLEFPRVVNTKEQVVAGTIYYITLEATDGGVKKLYEANVWVKP  80

Query  287  SKNIKELQEFKVVGN  331
              N KE+Q FK VG+
Sbjct  81   GVNFKEVQVFKYVGD  95



>ref|XP_009361915.1| PREDICTED: cysteine proteinase inhibitor A-like [Pyrus x bretschneideri]
Length=95

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVF-----DKV------IYNITIVASEGGHKKVYEAKVSVN  283
            +E LAR+A+ E+NKK N  L F     DKV      ++ + I A++GG KKVYEAKV V 
Sbjct  19   TENLARYAVDEHNKKENDLLEFVRVLDDKVQVVSGTMHYLKIEATDGGKKKVYEAKVWVK  78

Query  284  ESKNIKELQEFKVVGN  331
              +N K++QEFK V +
Sbjct  79   PWENFKQVQEFKPVSD  94



>gb|AFK41721.1| unknown [Lotus japonicus]
Length=237

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA+ E+N K NA L F +V+           +++T+ A +GG KK+YEAKV V    
Sbjct  57   LARFAVDEHNNKQNALLEFGRVVKAQEQVVAGSMHHLTLEAIDGGEKKIYEAKVWVKSWL  116

Query  293  NIKELQEFKVVGNET  337
            N KELQEFK V  + 
Sbjct  117  NFKELQEFKEVAGDA  131



>ref|XP_010673809.1| PREDICTED: cysteine proteinase inhibitor A-like [Beta vulgaris 
subsp. vulgaris]
Length=104

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 11/73 (15%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LA+FA+  +N K NA L F +V+           Y IT+ A++G  KKVYEAKV V    
Sbjct  22   LAKFAVDHHNTKENALLEFHRVVNTKEQVVAGTMYYITLEATDGDKKKVYEAKVWVKPWM  81

Query  293  NIKELQEFKVVGN  331
            N KE+Q+FK VG+
Sbjct  82   NFKEVQDFKYVGD  94



>emb|CAH57540.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 12/93 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  ++   SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVQDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVFAGPMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            A E G KK+YEAKV V    N KE  EFK  G+
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKESHEFKDAGD  129



>pdb|3IMA|B Chain B, Complex Strcuture Of Tarocystatin And Papain
 pdb|3IMA|D Chain D, Complex Strcuture Of Tarocystatin And Papain
Length=91

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 11/70 (16%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKK NA L F +           +++++T+   EGG KKVYEAKV V  
Sbjct  19   EELARFAVDEHNKKENALLQFSRLVKAKQQVVSGIMHHLTVEVIEGGKKKVYEAKVWVQA  78

Query  287  SKNIKELQEF  316
              N K+L EF
Sbjct  79   WLNSKKLHEF  88



>ref|XP_010486966.1| PREDICTED: cysteine proteinase inhibitor 6-like [Camelina sativa]
Length=232

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 12/99 (12%)
 Frame = +2

Query  68   TTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------  214
              ++   L  +R V S+     + E LARFA+ E+NKK NA L F +V+           
Sbjct  31   CNDDMALLGGVRDVPSNQNSGEV-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTL  89

Query  215  YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
            +++T+   E G KK+YEAKV V    N KELQEFK   N
Sbjct  90   HHLTLEILEAGEKKLYEAKVWVKPWLNFKELQEFKPASN  128



>emb|CDY08429.1| BnaA05g26650D [Brassica napus]
Length=229

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 12/96 (13%)
 Frame = +2

Query  65   CTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI----------  214
            C   +   L  +R V ++     + E LARFA+ E+NKK N+ L F +V+          
Sbjct  22   CNDEDMALLGGVRDVPANQNSGEV-ESLARFAVDEHNKKENSLLEFARVVKAKEQVVAGT  80

Query  215  -YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFK  319
             +++T+   E G KK+YEAKV V    N KELQEFK
Sbjct  81   MHHLTLEIVEAGKKKLYEAKVWVKPWLNFKELQEFK  116



>gb|ACG37686.1| cysteine proteinase inhibitor 2 [Zea mays]
Length=157

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-------------YNITIVASEGGHKKVYEAKVSVN  283
            ELARFA+AE+N K NA L F++++             + + +  + GG KK+YEAKV   
Sbjct  78   ELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTLHHFTVEVKEAGGGEKKLYEAKVWEK  137

Query  284  ESKNIKELQEFKVVGN  331
              +N K+LQ F++VG+
Sbjct  138  AWENFKQLQSFELVGD  153



>ref|XP_008346621.1| PREDICTED: cysteine proteinase inhibitor A-like [Malus domestica]
Length=95

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 11/74 (15%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVIY-----------NITIVASEGGHKKVYEAKVSVN  283
            +E L RFA+ E+NKK NA L F +V++           ++ I A++GG K VYEA V V 
Sbjct  19   TESLXRFAVDEHNKKENALLEFVRVVHEKVQVVSGSLHHLKIEATDGGTKNVYEAXVWVK  78

Query  284  ESKNIKELQEFKVV  325
              +N K++QEFK+V
Sbjct  79   PXENFKQVQEFKLV  92



>emb|CAH57549.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57570.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGPMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>emb|CAH57550.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57555.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57574.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVFAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>dbj|BAD81175.1| putative cysteine proteinase inhibitor [Oryza sativa Japonica 
Group]
 gb|EEE54304.1| hypothetical protein OsJ_01243 [Oryza sativa Japonica Group]
Length=208

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KKVYEAKV V 
Sbjct  21   TDALARFAVDEHNKRENALLEFVRVVEAKEQVVAGTLHHLTLEALEAGRKKVYEAKVWVK  80

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  81   PWLDFKELQEFRNTGDAT  98



>gb|KHG15686.1| hypothetical protein F383_23695 [Gossypium arboreum]
Length=241

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA + F +V+           +++T+ A + G KK+YEAKV V  
Sbjct  57   ENLARFAVDEHNKKENAMVEFVRVVKASEQVVAGTLHHLTVEAVDAGKKKLYEAKVWVKP  116

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK  G+
Sbjct  117  WMNFKELQEFKHAGD  131



>emb|CAH57534.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57535.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57536.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57552.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57556.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57561.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57565.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57566.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57569.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57575.1| cysteine protease inhibitor [Populus tremula]
 emb|CAH57576.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>emb|CAA60634.1| cysteine proteinase inhibitor [Sorghum bicolor]
Length=130

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKKANA L ++K++           Y +T+   +G  KK+YEAKV    
Sbjct  52   QELARFAVDEHNKKANALLGYEKLVKAKTQVVAGTMYYLTVEVKDGEVKKLYEAKVWEKP  111

Query  287  SKNIKELQEFKVV  325
             +N KELQEFK V
Sbjct  112  WENFKELQEFKPV  124



>emb|CCC55944.1| cystatin [Arachis hypogaea]
Length=98

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK N  L F +VI           ++IT+ A+ G  K VYEAKV    
Sbjct  20   DSLARFAVDEHNKKQNGLLEFKRVISAKQQVVAGTLHHITLEAARGDSKNVYEAKVWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK+ G+
Sbjct  80   WMNFKEVQEFKLAGD  94



>gb|ABK22677.1| unknown [Picea sitchensis]
 gb|ABK25151.1| unknown [Picea sitchensis]
 gb|ABK26069.1| unknown [Picea sitchensis]
 gb|ABR17453.1| unknown [Picea sitchensis]
 gb|ACN40099.1| unknown [Picea sitchensis]
 gb|ACN40953.1| unknown [Picea sitchensis]
Length=141

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDISFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>gb|AFK38009.1| unknown [Lotus japonicus]
Length=233

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V           IY +T+ A +GG KK+YEAK+ V  
Sbjct  52   ENLARFAVHEHNKKENALLEFARVLKTKEQVIAGKIYYLTLEAIDGGKKKIYEAKIWVKP  111

Query  287  SKNIKELQEFKV  322
              N  +LQEFK+
Sbjct  112  WMNFIQLQEFKL  123



>emb|CAH57557.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>gb|AAU21498.1| cysteine proteinase inhibitor [Arachis hypogaea]
 gb|ACE06994.1| cystatin [Arachis diogoi]
 emb|CBL59465.1| cystatin [Arachis hypogaea]
 emb|CCC55943.1| cystatin [Arachis hypogaea]
 emb|CCD17863.1| cystatin [Arachis hypogaea]
Length=98

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK N  L F +VI           ++IT+ A+ G  K VYEAKV    
Sbjct  20   DSLARFAVDEHNKKQNGLLEFKRVISAKQQVVAGTLHHITLEAASGDSKNVYEAKVWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KE+QEFK+ G+
Sbjct  80   WMNFKEVQEFKLAGD  94



>gb|AAA97907.1| cysteine proteinase inhibitor [Glycine max]
Length=100

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +VI           Y IT+ A++G  KKVYE KV    
Sbjct  17   ENLARFAVDEHNKKENAVLEFVRVISAKKQVVSGTLYYITLEANDGVTKKVYETKVLEKP  76

Query  287  SKNIKELQEFKVV  325
              NIKE+QEFK +
Sbjct  77   WLNIKEVQEFKPI  89



>gb|ACU13141.1| unknown [Glycine max]
 gb|KHN26001.1| Cysteine proteinase inhibitor [Glycine soja]
Length=103

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +VI           Y IT+ A++G  KKVYE KV    
Sbjct  20   ENLARFAVDEHNKKENAVLEFVRVISAKKQVVSGTLYYITLEANDGVTKKVYETKVLEKP  79

Query  287  SKNIKELQEFKVV  325
              NIKE+QEFK +
Sbjct  80   WLNIKEVQEFKPI  92



>gb|ADP50760.1| cysteine proteinase inhibitor TrcC-4 [Secale cereale x Triticum 
aestivum]
Length=147

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 11/69 (16%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            LARFA++E+NK+AN  L FDKV+           Y ITI   EGG KK+YEA+V      
Sbjct  70   LARFAVSEHNKEANTRLEFDKVVKVKEQAVAGRLYYITIQVDEGGAKKLYEAEVLEQLWL  129

Query  293  NIKELQEFK  319
            ++K+L EFK
Sbjct  130  DVKKLLEFK  138



>gb|ABW03251.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03252.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03253.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03254.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03255.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03256.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03257.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
 gb|ABW03258.1| cysteine proteinase inhibitor [Sonneratia caseolaris]
Length=74

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 11/68 (16%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK N+ L F KV+           Y IT+ A++GG KK+YEAKV V  
Sbjct  7    EALARFAVDEHNKKENSLLQFGKVVKAKQQVVAGTVYYITVEATDGGVKKLYEAKVWVKP  66

Query  287  SKNIKELQ  310
              + KELQ
Sbjct  67   WMDFKELQ  74



>ref|NP_001042702.1| Os01g0270100 [Oryza sativa Japonica Group]
 sp|Q0JNR2.1|CYT12_ORYSJ RecName: Full=Cysteine proteinase inhibitor 12; AltName: Full=Oryzacystatin 
XII; Short=OC-XII; AltName: Full=Oryzacystatin-12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF04616.1| Os01g0270100 [Oryza sativa Japonica Group]
 dbj|BAG99665.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KKVYEAKV V 
Sbjct  63   TDALARFAVDEHNKRENALLEFVRVVEAKEQVVAGTLHHLTLEALEAGRKKVYEAKVWVK  122

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  123  PWLDFKELQEFRNTGDAT  140



>gb|AFK35558.1| unknown [Medicago truncatula]
 gb|AFK44667.1| unknown [Medicago truncatula]
 gb|AES69961.2| cysteine protease inhibitor cystatin [Medicago truncatula]
Length=98

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 12/91 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            T+  +R V+ +    +I + LARFA+ E+NKK NA L F +VI           ++IT+ 
Sbjct  3    TVGGVRDVSGNQNSLAI-DGLARFAVEEHNKKQNALLEFSRVISAKEQVVAGTIHHITLE  61

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
              +G +KKVYEAKV      N KE+QEFK+V
Sbjct  62   VKDGVNKKVYEAKVWEKSWMNFKEVQEFKLV  92



>ref|NP_001105295.1| cystatin-1 precursor [Zea mays]
 sp|P31726.1|CYT1_MAIZE RecName: Full=Cystatin-1; AltName: Full=Corn kernel cysteine 
proteinase inhibitor; AltName: Full=Cystatin I; Flags: Precursor 
[Zea mays]
 dbj|BAA01472.1| corn cystatin I [Zea mays]
Length=135

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+N+KANA L F+K++           Y +TI   +G  KK+YEAKV    
Sbjct  57   QELARFAVNEHNQKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKP  116

Query  287  SKNIKELQEFKVV  325
             +N K+LQEFK V
Sbjct  117  WENFKQLQEFKPV  129



>emb|CAH57573.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           +++TI A E G KK+YEAKV V  
Sbjct  55   DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLYEAKVWVKP  114

Query  287  SKNIKELQEFK  319
              N KEL EFK
Sbjct  115  WLNFKELHEFK  125



>ref|NP_001106013.1| cystatin2 precursor [Zea mays]
 dbj|BAA07327.1| cystatin II [Zea mays]
Length=134

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKKANA L F+K++           Y +TI   +G  KK+YEAKV    
Sbjct  56   QELARFAVDEHNKKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKP  115

Query  287  SKNIKELQEFKVV  325
             +  KELQEFK V
Sbjct  116  WEKFKELQEFKPV  128



>emb|CAG38130.1| cystatin Hv-CPI4 [Hordeum vulgare subsp. vulgare]
 dbj|BAK02986.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96693.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KKVYEAKV V 
Sbjct  56   TDGLARFAVDEHNKRENALLEFVRVVEAKEQTVAGTLHHLTLEALEAGRKKVYEAKVWVK  115

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  116  PWLDSKELQEFRHTGDAT  133



>gb|ACG31524.1| cysteine proteinase inhibitor 2 [Zea mays]
Length=109

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-------------YNITIVASEGGHKKVYEAKVSVN  283
            ELARFA+AE+N K NA L F++++             + + +  + GG KK+YEAKV   
Sbjct  30   ELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTLHHFTVEVKEAGGGEKKLYEAKVWEK  89

Query  284  ESKNIKELQEFKVVGN  331
              +N K+LQ F++VG+
Sbjct  90   AWENFKQLQSFELVGD  105



>gb|ABK22339.1| unknown [Picea sitchensis]
Length=231

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDITFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>dbj|BAK03203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=242

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KKVYEAKV V 
Sbjct  55   TDGLARFAVDEHNKRENALLEFVRVVEAKEQTVAGTLHHLTLEALEAGRKKVYEAKVWVK  114

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  115  PWLDSKELQEFRHTGDAT  132



>ref|XP_009384360.1| PREDICTED: cysteine proteinase inhibitor A-like [Musa acuminata 
subsp. malaccensis]
Length=99

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 12/76 (16%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEG-GHKKVYEAKVSVN  283
            EELARFAI E+NKKANA L    V+           Y +T+ A E  G KK+YEAK+ V 
Sbjct  20   EELARFAIDEHNKKANATLELVGVVKVKEQVVAGQMYYLTLEAKESNGEKKLYEAKIWVK  79

Query  284  ESKNIKELQEFKVVGN  331
               + KELQEFK + +
Sbjct  80   PWMDFKELQEFKELDD  95



>gb|ABK26812.1| unknown [Picea sitchensis]
Length=231

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDITFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>ref|XP_006411355.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
 gb|ESQ52808.1| hypothetical protein EUTSA_v10017418mg [Eutrema salsugineum]
Length=127

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+N + N  L F K++           Y++T+ A+EGG  K +EAKV V  
Sbjct  53   ESLARFAIQEHNNRQNKVLEFKKIVKAREQVVAGTMYHLTLEANEGGQAKNFEAKVWVKP  112

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  113  WMNFKQLQEFK  123



>ref|XP_008649811.1| PREDICTED: cysteine proteinase inhibitor [Zea mays]
 tpe|CAG29023.1| TPA: putative cystatin [Zea mays]
 gb|ACR34008.1| unknown [Zea mays]
 gb|AFW78506.1| hypothetical protein ZEAMMB73_750938 [Zea mays]
Length=110

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 13/76 (17%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-------------YNITIVASEGGHKKVYEAKVSVN  283
            ELARFA+AE+N K NA L F++++             + + +  + GG KK+YEAKV   
Sbjct  31   ELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTLHHFTVEVKEAGGGEKKLYEAKVWEK  90

Query  284  ESKNIKELQEFKVVGN  331
              +N K+LQ F++VG+
Sbjct  91   AWENFKQLQSFELVGD  106



>dbj|BAE92726.1| multidomain cystatin [Triticum aestivum]
 gb|AFN42325.1| cysteine proteinase inhibitor [Secale cereale x Triticum aestivum]
Length=243

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KK+YEAKV V 
Sbjct  56   TDGLARFAVDEHNKRENALLEFVRVVEAKEQTVAGTVHHLTLEALEAGRKKLYEAKVWVK  115

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  116  PWLDFKELQEFRHTGDAT  133



>gb|KCW89988.1| hypothetical protein EUGRSUZ_A02187 [Eucalyptus grandis]
Length=161

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NK  NA L F +V+           Y++T+ A + G KK+YEAKV V  
Sbjct  52   EGLARFAVEEHNKNENALLEFARVLKAKEQVVAGTLYHLTLEAVDAGKKKIYEAKVWVKP  111

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  112  WMNFKQLQEFK  122



>ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12 [Vitis vinifera]
Length=201

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           +++T+   + G KK+YEAKV V  
Sbjct  20   DSLARFAVEEHNKKENALLEFARVVKAEEQVVAGTLHHLTLEVIDAGRKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK  G+
Sbjct  80   WMNFKELQEFKHAGD  94



>emb|CBI32827.3| unnamed protein product [Vitis vinifera]
Length=201

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E +ARFA+ E+NK  NA L F KV           IY +T+ A + G KK+YEAKV V  
Sbjct  20   ESIARFAVQEHNKNQNALLEFAKVLKAKEQVVAGKIYYLTLEAIDAGKKKIYEAKVWVKP  79

Query  287  SKNIKELQEFK  319
              N KELQEFK
Sbjct  80   WMNFKELQEFK  90



>ref|XP_010055538.1| PREDICTED: cysteine proteinase inhibitor-like [Eucalyptus grandis]
 gb|KCW89989.1| hypothetical protein EUGRSUZ_A02187 [Eucalyptus grandis]
Length=141

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NK  NA L F +V+           Y++T+ A + G KK+YEAKV V  
Sbjct  52   EGLARFAVEEHNKNENALLEFARVLKAKEQVVAGTLYHLTLEAVDAGKKKIYEAKVWVKP  111

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  112  WMNFKQLQEFK  122



>ref|XP_010557894.1| PREDICTED: cysteine proteinase inhibitor 6-like [Tarenaya hassleriana]
Length=232

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 12/100 (12%)
 Frame = +2

Query  65   CTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI----------  214
            C+ ++  TL      + S     + E LARFA+ E+NKK NA L F +V+          
Sbjct  27   CSDDDMSTLDGAPYSSGSQNSGEV-ESLARFAVDEHNKKENALLEFARVVKAEEQVVAGI  85

Query  215  -YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGN  331
             +++T+   + G KK+YEAKV V       ELQEFK  G+
Sbjct  86   LHHLTLEVIDAGKKKLYEAKVWVKPWMEFNELQEFKHAGD  125



>ref|XP_010055569.1| PREDICTED: cysteine proteinase inhibitor-like [Eucalyptus grandis]
Length=141

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NK  NA L F +V+           Y++T+ A + G KK+YEAKV V  
Sbjct  52   EGLARFAVEEHNKNENALLEFARVLKAKEQVVAGTLYHLTLEAVDAGKKKIYEAKVWVKP  111

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  112  WMNFKQLQEFK  122



>gb|ACF49366.1| cystatin, partial [Triticum aestivum]
Length=243

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T+ A E G KKVYEA+V V 
Sbjct  56   TDGLARFAVDEHNKRENALLEFVRVVEAKEQTVAGTLHHLTLEALEAGRKKVYEAEVWVK  115

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  116  PWLDFKELQEFRHTGDTT  133



>ref|XP_010909027.1| PREDICTED: cysteine proteinase inhibitor 6-like [Elaeis guineensis]
Length=243

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EEL RFA+ E+NKK NA L F +V+           +++T+   E G KK++EAKV V  
Sbjct  59   EELGRFAVQEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEVMEAGKKKLFEAKVWVKP  118

Query  287  SKNIKELQEFKVVGN  331
              N KELQEF  +G+
Sbjct  119  WLNFKELQEFTHLGD  133



>gb|ABK20186.1| cysteine protease inhibitor [Populus tomentosa]
Length=143

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 49/89 (55%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARF + E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DSLARFPVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>ref|XP_004970285.1| PREDICTED: cystatin-1-like [Setaria italica]
Length=136

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 17/103 (17%)
 Frame = +2

Query  68   TTNNTPTLLSLRVVASSLTMASISE------ELARFAIAEYNKKANANLVFDKVI-----  214
            + +  P++     +A  +T     E      E+ARFA+ E NKK NA L +++++     
Sbjct  29   SAHKEPSMADRGTLAGGITDVPQGENDIHLQEIARFAVDENNKKTNALLSYERIVKAKTQ  88

Query  215  ------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVV  325
                  Y +TI   +G  KK+YEAKV     +N KELQEFK V
Sbjct  89   VVAGAMYYLTIEVKDGTAKKLYEAKVWEKSWENFKELQEFKPV  131



>ref|NP_181620.1| cysteine proteinase inhibitor 3 [Arabidopsis thaliana]
 sp|Q41906.2|CYT3_ARATH RecName: Full=Cysteine proteinase inhibitor 3; Short=AtCYS-3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86448.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 gb|AAM61337.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 gb|AAN13009.1| putative cysteine proteinase inhibitor B (cystatin B) [Arabidopsis 
thaliana]
 gb|AEC09892.1| cysteine proteinase inhibitor 3 [Arabidopsis thaliana]
Length=125

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG   K +EAKV V  
Sbjct  51   ESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKP  110

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  111  WMNFKQLQEFK  121



>ref|XP_011040719.1| PREDICTED: cysteine proteinase inhibitor A-like isoform X2 [Populus 
euphratica]
Length=105

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+N K NA L F +V+           Y++T+ A++ G+KK+YE KV V  
Sbjct  19   DSLARFAVQEHNTKENALLEFVRVVKAKEQVVAGKLYHLTLEANDAGNKKIYEVKVWVKP  78

Query  287  SKNIKELQEFKVV  325
              N K+LQEFK V
Sbjct  79   WMNFKQLQEFKHV  91



>gb|ABK23250.1| unknown [Picea sitchensis]
 gb|ABR17663.1| unknown [Picea sitchensis]
 gb|ACN40769.1| unknown [Picea sitchensis]
Length=231

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDISFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>gb|ABR16995.1| unknown [Picea sitchensis]
Length=231

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDISFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>gb|ABB89766.1| At3g12490-like protein [Boechera stricta]
Length=231

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 13/95 (14%)
 Frame = +2

Query  71   TNNTPTLLS-LRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------  214
             N+  +LL  +R V ++     + E LARFA+ E+NKK NA L F +V+           
Sbjct  30   CNDDMSLLGGVRDVPANQNSGEV-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTL  88

Query  215  YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            +++T+   E G KK+YEAKV V    N KELQEFK
Sbjct  89   HHLTLEILEAGEKKLYEAKVWVKPWLNFKELQEFK  123



>ref|XP_008375329.1| PREDICTED: cysteine proteinase inhibitor A-like [Malus domestica]
 ref|XP_008375330.1| PREDICTED: cysteine proteinase inhibitor A-like [Malus domestica]
 ref|XP_008356795.1| PREDICTED: cysteine proteinase inhibitor A-like [Malus domestica]
 gb|AHZ92271.1| cystatin 5 [Malus prunifolia]
Length=95

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 11/76 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVF-----DKV------IYNITIVASEGGHKKVYEAKVSVN  283
            +E LAR+A+ E+NKK N  L F     DKV      ++ + I  ++GG KKVYEAKV V 
Sbjct  19   TESLARYAVDEHNKKENTLLEFVRVLDDKVQVVSGTMHYLKIEVTDGGKKKVYEAKVWVK  78

Query  284  ESKNIKELQEFKVVGN  331
              ++ K++QEFK+V +
Sbjct  79   PWEHFKQVQEFKLVSD  94



>gb|AGF33489.1| cysteine proteinase inhibitor [Curcuma alismatifolia]
Length=123

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E+L RFA+ ++NKK NA L F +VI           +++T+   + G KK YEAKV V  
Sbjct  47   EQLGRFAVDQHNKKENALLEFARVIKAREQVVAGTLHHLTVEVIDAGKKKTYEAKVWVKP  106

Query  287  SKNIKELQEFKVVGNET  337
              N KELQEF   G+ +
Sbjct  107  WLNFKELQEFSHAGDSS  123



>ref|XP_009120653.1| PREDICTED: cysteine proteinase inhibitor 6-like [Brassica rapa]
Length=235

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 58/113 (51%), Gaps = 13/113 (12%)
 Frame = +2

Query  29   ATLLSSSFIKQRCTTNNTPTLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDK  208
            + +  S  I   C   +   L  +R V ++     + E LARFA+ E+NKK NA L F +
Sbjct  15   SPIFISPLIATFCN-EDMAMLGGVRDVPANQNSGEV-ESLARFAVDEHNKKENALLEFAR  72

Query  209  VI-----------YNITIVASEGGHKKVYEAKVSVNESKNIKELQEFKVVGNE  334
            V+           +++T+   E G KK+YEAKV V    N KELQEFK   ++
Sbjct  73   VVKAKEQVVAGTMHHLTLEIIEAGKKKLYEAKVWVKPWLNFKELQEFKPASDD  125



>emb|CAH57545.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEVGKKKLYEAKVWVKPWLNFKELHEFK  125



>gb|ACN40125.1| unknown [Picea sitchensis]
Length=225

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 11/72 (15%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNES  289
            +L RFA+ E+NK+ N ++ F +V+           Y++TI A +G H K+Y+AKV V   
Sbjct  54   DLGRFAVDEHNKQQNGDISFRRVVAAQEQVVAGTMYHLTIEAEDGDHPKLYKAKVWVKPW  113

Query  290  KNIKELQEFKVV  325
            +N K L++FK V
Sbjct  114  ENFKRLEDFKPV  125



>gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa]
Length=228

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EELARFA+ E+NKK N  L F +V+           + +T+ A + G KK+YEAKV V  
Sbjct  48   EELARFAVEEHNKKENRLLEFTRVVKAKEQVVAGTLHYLTLEAIDAGKKKLYEAKVWVKP  107

Query  287  SKNIKELQEFKVVGN  331
              + KELQEF+ +G+
Sbjct  108  WLHFKELQEFEHIGD  122



>ref|XP_010508791.1| PREDICTED: cysteine proteinase inhibitor 3 [Camelina sativa]
Length=126

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG   K +EAKV V  
Sbjct  52   ESLARFAIQEHNKQQNMVLEFTKIVRAREQVVAGTMYHLTLEAKEGDLTKSFEAKVWVKP  111

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  112  WMNFKQLQEFK  122



>emb|CAH57562.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 49/89 (55%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +V+           +++TI 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV      N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWAKPWLNFKELHEFK  125



>gb|ABK20187.1| cysteine protease inhibitor [Populus tomentosa]
Length=138

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           Y++T+ A++ G+ K+YE KV V  
Sbjct  52   DSLARFAVQEHNKKENAILEFVRVLKAKEQVVAGKLYHLTLEATDAGNNKMYEVKVWVKP  111

Query  287  SKNIKELQEFKVV  325
              N K+LQEFK V
Sbjct  112  WMNFKQLQEFKHV  124



>ref|XP_011040718.1| PREDICTED: cysteine proteinase inhibitor-like isoform X1 [Populus 
euphratica]
Length=163

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 46/77 (60%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+N K NA L F +V+           Y++T+ A++ G+KK+YE KV V  
Sbjct  19   DSLARFAVQEHNTKENALLEFVRVVKAKEQVVAGKLYHLTLEANDAGNKKIYEVKVWVKP  78

Query  287  SKNIKELQEFKVVGNET  337
              N K+LQEFK V   T
Sbjct  79   WMNFKQLQEFKHVEGGT  95



>ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
 sp|Q8H0X6.2|CYT6_ARATH RecName: Full=Cysteine proteinase inhibitor 6; Short=AtCYS-6; 
AltName: Full=PIP-M; AltName: Full=PRLI-interacting factor 
M; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51028.1|AC069474_27 cysteine proteinase inhibitor, putative; 65918-67271 [Arabidopsis 
thaliana]
 dbj|BAB03156.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana]
 gb|AEE75201.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
Length=234

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  53   ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKP  112

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK   +
Sbjct  113  WLNFKELQEFKPASD  127



>ref|XP_010505846.1| PREDICTED: cysteine proteinase inhibitor 3-like [Camelina sativa]
Length=132

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG   K +EAKV V  
Sbjct  58   ESLARFAIQEHNKQQNMVLEFTKIVRAREQVVAGTMYHLTLEAKEGDQMKNFEAKVWVKP  117

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  118  WMNFKQLQEFK  128



>gb|ABK94227.1| unknown [Populus trichocarpa]
Length=138

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           Y++T+ A++ G+ K+YE KV V  
Sbjct  52   DSLARFAVQEHNKKENAILEFVRVLKAKEQVVAGKLYHLTVEATDAGNNKMYEVKVWVKP  111

Query  287  SKNIKELQEFKVV  325
              N K+LQEFK V
Sbjct  112  WMNFKQLQEFKHV  124



>gb|ABK20185.1| cysteine protease inhibitor [Populus tomentosa]
Length=138

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            + LARFA+ E+NKK NA L F +V+           Y++T+ A++ G+ K+YE KV V  
Sbjct  52   DSLARFAVQEHNKKENAILKFVRVLKAKEQVVAGKLYHLTLEATDAGNNKMYEVKVWVKP  111

Query  287  SKNIKELQEFKVV  325
              N K+LQEFK V
Sbjct  112  WMNFKQLQEFKHV  124



>emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis]
Length=209

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 11/69 (16%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            +ARFA+ E+NKK NA + F +V+           +++TI A E G KK+YEAKV V    
Sbjct  24   IARFAVDEHNKKENAMVEFGRVLKAKEQVVAGTLHHLTIEAIEAGKKKIYEAKVWVKPWL  83

Query  293  NIKELQEFK  319
            N KELQEFK
Sbjct  84   NFKELQEFK  92



>emb|CAH57546.1| cysteine protease inhibitor [Populus tremula]
Length=143

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 50/89 (56%), Gaps = 12/89 (13%)
 Frame = +2

Query  86   TLLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIV  232
            TL  +    SS   A I + LARFA+ E+NKK NA L F +++           +++T+ 
Sbjct  38   TLGGVHDSQSSQNSAEI-DGLARFAVDEHNKKENAILEFARLVKAKEQVVAGTMHHLTVE  96

Query  233  ASEGGHKKVYEAKVSVNESKNIKELQEFK  319
            A E G KK+YEAKV V    N KEL EFK
Sbjct  97   AIEAGKKKLYEAKVWVKPWLNFKELHEFK  125



>ref|XP_009141947.1| PREDICTED: cysteine proteinase inhibitor 3-like [Brassica rapa]
Length=130

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+N + N  L F K++           Y +T+ A+EGG  K +EAKV V  
Sbjct  56   ESLARFAIQEHNNRENMVLEFKKIVKAREQVVAGTMYYLTLEANEGGQAKNFEAKVWVKP  115

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  116  WMNFKQLQEFK  126



>gb|AAL86314.1| putative cysteine proteinase inhibitor cystatin B [Arabidopsis 
thaliana]
Length=116

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG   K +EAKV V  
Sbjct  42   ESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKP  101

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  102  WMNFKQLQEFK  112



>gb|KHG00945.1| Cysteinease inhibitor [Gossypium arboreum]
 gb|KHG25964.1| Cysteinease inhibitor [Gossypium arboreum]
Length=133

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKV-----------IYNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK N  L F KV           +Y IT+ A +G   KVYEAKV    
Sbjct  20   ENLARFAVDEHNKKGNTMLQFKKVTNVKQQVVSGTMYYITLEAMDGDKTKVYEAKVWDKP  79

Query  287  SKNIKELQEFK  319
              + KELQ+FK
Sbjct  80   WMDFKELQDFK  90



>ref|XP_006295236.1| hypothetical protein CARUB_v10024323mg [Capsella rubella]
 gb|EOA28134.1| hypothetical protein CARUB_v10024323mg [Capsella rubella]
Length=125

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG   K +EAKV V  
Sbjct  51   ESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQMKNFEAKVWVKP  110

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  111  WMNFKQLQEFK  121



>ref|XP_006644042.1| PREDICTED: cysteine proteinase inhibitor 12-like [Oryza brachyantha]
Length=250

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 11/78 (14%)
 Frame = +2

Query  137  SEELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVN  283
            ++ LARFA+ E+NK+ NA L F +V+           +++T  A E G KKVYEAKV + 
Sbjct  63   TDALARFAVVEHNKRENALLEFVRVVEAKEQVVAGTLHHLTFEALEAGKKKVYEAKVWIK  122

Query  284  ESKNIKELQEFKVVGNET  337
               + KELQEF+  G+ T
Sbjct  123  PWLDFKELQEFRHAGDAT  140



>ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum]
Length=247

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ ++N K N+ L F +V+           +++T+ A + G KK+YEAKV V  
Sbjct  64   ESLARFAVDQHNTKQNSLLEFARVVKAREQVVAGTLHHLTLEAIDAGEKKIYEAKVWVKP  123

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK  G+
Sbjct  124  WLNFKELQEFKHAGD  138



>gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana]
Length=201

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  20   ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK   +
Sbjct  80   WLNFKELQEFKPASD  94



>ref|NP_566425.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
 gb|AAL38303.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana]
 gb|AAM63160.1| cysteine proteinase inhibitor, putative [Arabidopsis thaliana]
 gb|AEE75202.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana]
Length=201

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  20   ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK   +
Sbjct  80   WLNFKELQEFKPASD  94



>dbj|BAB17683.1| cysteine proteinase inhibitor homolog [Arabidopsis thaliana]
Length=92

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+NK+ N  L F K++           Y++T+ A EG   K +EAKV V  
Sbjct  18   ESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKP  77

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  78   WMNFKQLQEFK  88



>ref|XP_008795132.1| PREDICTED: cysteine proteinase inhibitor 12 [Phoenix dactylifera]
Length=242

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 11/77 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            EEL RFA+ E+NKK NA + F +V+           +++T+   E G KK+ EAKV V  
Sbjct  58   EELGRFAVQEHNKKENALVEFSRVVKAKEQVVAGTLHHLTLEVMEAGKKKLCEAKVWVKP  117

Query  287  SKNIKELQEFKVVGNET  337
              N KELQEF+ +G+ +
Sbjct  118  WLNFKELQEFRHLGDSS  134



>gb|ABN42208.1| proteinase inhibitor [Cakile maritima]
Length=202

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  20   ESLARFAVDEHNKKENALLEFGRVVKAKEQVVAGTLHHLTLEIIEAGKKKLYEAKVWVKP  79

Query  287  SKNIKELQEFK  319
              N KELQEFK
Sbjct  80   WLNFKELQEFK  90



>emb|CDY06956.1| BnaA04g23590D [Brassica napus]
Length=130

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFAI E+N + N  L F K++           Y +T+ A+EGG  K +EAKV V  
Sbjct  56   ESLARFAIQEHNNRENKVLEFKKIVKAREQVVAGTMYYLTLEANEGGQAKNFEAKVWVKP  115

Query  287  SKNIKELQEFK  319
              N K+LQEFK
Sbjct  116  WMNFKQLQEFK  126



>ref|XP_006298448.1| hypothetical protein CARUB_v10014520mg [Capsella rubella]
 gb|EOA31346.1| hypothetical protein CARUB_v10014520mg [Capsella rubella]
Length=236

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  58   ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKP  117

Query  287  SKNIKELQEFK  319
              N KELQEFK
Sbjct  118  WLNFKELQEFK  128



>gb|KCW50301.1| hypothetical protein EUGRSUZ_J00085 [Eucalyptus grandis]
Length=218

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E L RFA+ E+N K N  L F +V+           +++TI A + G KK+YEAK+ V  
Sbjct  58   ESLGRFAVDEHNSKENGLLEFARVVKAHEQVVAGTLHHLTIEAVDAGKKKLYEAKIWVRP  117

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK  G+
Sbjct  118  WMNSKELQEFKHAGD  132



>ref|XP_007015329.1| Cystatin B [Theobroma cacao]
 gb|EOY32948.1| Cystatin B [Theobroma cacao]
Length=102

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDK-----------VIYNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L + K            IY IT+   +G  K++YEAKV    
Sbjct  20   ETLARFAVDEHNKKENAMLEYKKVVNVKQQVVAGTIYYITMEVMDGDKKQIYEAKVWEKP  79

Query  287  SKNIKELQEFKVVGN  331
              N KELQ+FK++G+
Sbjct  80   WINFKELQDFKLIGD  94



>gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea var. italica]
 emb|CDY50343.1| BnaC01g38380D [Brassica napus]
Length=205

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 11/76 (14%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  20   ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLYEAKVWVKP  79

Query  287  SKNIKELQEFKVVGNE  334
              N KELQEFK   ++
Sbjct  80   WLNFKELQEFKPASDD  95



>pdb|3UL5|A Chain A, Saccharum Officinarum Canecystatin-1 In Space Group 
C2221
 pdb|3UL5|B Chain B, Saccharum Officinarum Canecystatin-1 In Space Group 
C2221
 pdb|3UL5|C Chain C, Saccharum Officinarum Canecystatin-1 In Space Group 
C2221
 pdb|3UL5|D Chain D, Saccharum Officinarum Canecystatin-1 In Space Group 
C2221
 pdb|3UL6|A Chain A, Saccharum Officinarum Canecystatin-1 In Space Group 
P6422
 pdb|3UL6|B Chain B, Saccharum Officinarum Canecystatin-1 In Space Group 
P6422
Length=139

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 12/75 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASE-GGHKKVYEAKVSVNE  286
            ELARFA+AE+N K NA L F++++           ++ T+   E GG KK+YEAKV    
Sbjct  64   ELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKV  123

Query  287  SKNIKELQEFKVVGN  331
             +N K+LQ F+ VG+
Sbjct  124  WENFKQLQSFQPVGD  138



>gb|AAM78598.1| cystatin [Saccharum officinarum]
Length=106

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 12/75 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASE-GGHKKVYEAKVSVNE  286
            ELARFA+AE+N K NA L F++++           ++ T+   E GG KK+YEAKV    
Sbjct  31   ELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKV  90

Query  287  SKNIKELQEFKVVGN  331
             +N K+LQ F+ VG+
Sbjct  91   WENFKQLQSFQPVGD  105



>ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricinus communis]
 gb|EEF36811.1| cysteine protease inhibitor, putative [Ricinus communis]
Length=238

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 11/69 (16%)
 Frame = +2

Query  146  LARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNESK  292
            +ARFA+ E+NKK NA + F +V+           +++TI A E G KK+YEAKV V    
Sbjct  53   IARFAVDEHNKKENAMVEFGRVLKAKEQVVAGTLHHLTIEAIEAGKKKIYEAKVWVKPWL  112

Query  293  NIKELQEFK  319
            N KELQEFK
Sbjct  113  NFKELQEFK  121



>ref|XP_002299179.1| cysteine protease inhibitor family protein [Populus trichocarpa]
 gb|ABK93138.1| unknown [Populus trichocarpa]
 gb|EEE83984.1| cysteine protease inhibitor family protein [Populus trichocarpa]
Length=200

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++TI A E G KK+YEA+V V  
Sbjct  20   ENLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKIYEAEVWVKP  79

Query  287  SKNIKELQEFKVVGN  331
              N  EL+EFK  G+
Sbjct  80   WLNFMELKEFKHAGD  94



>gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera]
Length=199

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 12/88 (14%)
 Frame = +2

Query  89   LLSLRVVASSLTMASISEELARFAIAEYNKKANANLVFDKVI-----------YNITIVA  235
            L  +R V S+     + E LARFA+ E+NKK NA L F +V+           +++T+  
Sbjct  4    LGGVRDVPSNENSVEV-ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEI  62

Query  236  SEGGHKKVYEAKVSVNESKNIKELQEFK  319
             E G KK+YEAKV V    N KELQEFK
Sbjct  63   IEAGKKKLYEAKVWVKPWLNFKELQEFK  90



>dbj|BAO79365.1| cysteine proteinase inhibitor [Saccharum officinarum]
Length=109

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 12/75 (16%)
 Frame = +2

Query  143  ELARFAIAEYNKKANANLVFDKVI-----------YNITIVASE-GGHKKVYEAKVSVNE  286
            ELARFA+AE+N K NA L F++++           ++ T+   E GG KK+YEAKV    
Sbjct  31   ELARFAVAEHNSKTNAMLEFERLVKVRHQVVAGTMHHFTVQVKEAGGGKKLYEAKVWEKV  90

Query  287  SKNIKELQEFKVVGN  331
             +N K+LQ F+ VG+
Sbjct  91   WENFKQLQSFQPVGD  105



>ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum]
 dbj|BAJ34340.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48784.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum]
Length=234

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            E LARFA+ E+NKK NA L F +V+           +++T+   E G KK+YEAKV V  
Sbjct  53   ESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEIVEAGKKKLYEAKVWVKP  112

Query  287  SKNIKELQEFKVVGN  331
              N KELQEFK   +
Sbjct  113  WLNFKELQEFKPASD  127



>dbj|BAB21558.1| cystatin [Coix lacryma-jobi]
Length=135

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 11/73 (15%)
 Frame = +2

Query  140  EELARFAIAEYNKKANANLVFDKVI-----------YNITIVASEGGHKKVYEAKVSVNE  286
            +ELARFA+ E+NKKANA L ++K++           Y +TI   +G  KK+YEAKV    
Sbjct  57   QELARFAVDEHNKKANALLGYEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKP  116

Query  287  SKNIKELQEFKVV  325
             +N KEL EFK V
Sbjct  117  WENFKELLEFKPV  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1615139213688