BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23351_g2_i2 len=1741 path=[5951:0-275 5938:276-287 5950:288-451
6388:452-613 2234:614-649 3284:650-750 8534:751-768 8552:769-783
7307:784-871 2492:872-880 2501:881-907 4389:908-1740]

Length=1741
                                                                      Score     E

gb|EYU29614.1|  hypothetical protein MIMGU_mgv1a020128mg                634   0.0      
ref|XP_010069335.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    634   0.0      
gb|EYU36740.1|  hypothetical protein MIMGU_mgv1a007434mg                635   0.0      
ref|XP_010069334.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    634   0.0      
ref|XP_010650476.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    634   0.0      
ref|XP_011073909.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    634   0.0      
ref|XP_010069333.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    633   0.0      
ref|XP_010650477.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    630   0.0      
ref|NP_001239619.1|  PTI1-like tyrosine-protein kinase 3-like           630   0.0      
ref|XP_007142635.1|  hypothetical protein PHAVU_007G004200g             628   0.0      
gb|KHN37277.1|  PTI1-like tyrosine-protein kinase 3                     628   0.0      
ref|XP_011073910.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    627   0.0      
ref|XP_007034044.1|  Serine/threonine-protein kinase PBS1 isoform 1     629   0.0      
ref|XP_004296735.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    627   0.0      
ref|XP_006443111.1|  hypothetical protein CICLE_v10020458mg             628   0.0      
gb|AES63081.2|  Pti1-like kinase                                        628   0.0      
ref|XP_006372939.1|  hypothetical protein POPTR_0017s06410g             626   0.0      
ref|XP_003592830.1|  Protein kinase Pti1                                629   0.0      
ref|XP_006443112.1|  hypothetical protein CICLE_v10020458mg             626   0.0      
ref|XP_008372070.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    627   0.0      
gb|KEH44543.1|  Pti1-like kinase                                        625   0.0      
gb|ACM89531.1|  serine/threonine protein kinase                         624   0.0      Glycine max [soybeans]
ref|NP_001237256.1|  protein kinase Pti1                                623   0.0      
ref|XP_011037027.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    625   0.0      
ref|XP_008372071.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    623   0.0      
ref|XP_011037028.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    624   0.0      
ref|XP_007034045.1|  Kinase superfamily protein isoform 2               622   0.0      
gb|KDP42853.1|  hypothetical protein JCGZ_23795                         623   0.0      
ref|XP_004497390.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    622   0.0      
ref|XP_009794542.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    622   0.0      
ref|XP_004252961.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    622   0.0      
gb|KHG27735.1|  PTI1-like tyrosine-protein kinase 3                     619   0.0      
ref|XP_009589549.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    620   0.0      
ref|XP_006349879.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    620   0.0      
ref|XP_009794543.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    618   0.0      
ref|XP_010097495.1|  PTI1-like tyrosine-protein kinase 3                619   0.0      
ref|XP_004497391.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    618   0.0      
gb|ACU22698.1|  unknown                                                 617   0.0      Glycine max [soybeans]
ref|XP_004252962.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    617   0.0      
ref|XP_002530551.1|  Serine/threonine-protein kinase PBS1, putative     618   0.0      Ricinus communis
ref|XP_009589550.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    616   0.0      
ref|XP_006349880.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    615   0.0      
ref|XP_008222614.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    616   0.0      
ref|XP_010056915.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    615   0.0      
ref|XP_010056802.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    616   0.0      
ref|XP_002309825.1|  serine/threonine protein kinase                    614   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009345628.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    615   0.0      
ref|XP_010246423.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    615   0.0      
ref|XP_010246424.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    615   0.0      
ref|XP_010258610.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    613   0.0      
ref|XP_011026367.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     611   0.0      
ref|XP_009345629.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    610   0.0      
ref|XP_010258611.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    610   0.0      
ref|XP_008222616.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    610   0.0      
ref|XP_010246425.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    608   0.0      
ref|XP_007222085.1|  hypothetical protein PRUPE_ppa007573mg             608   0.0      
gb|KGN53103.1|  hypothetical protein Csa_4G016420                       611   0.0      
ref|XP_004152286.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    610   0.0      
ref|XP_010557159.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    605   0.0      
ref|XP_004140871.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    604   0.0      
ref|XP_008445692.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    605   0.0      
ref|XP_009768835.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    605   0.0      
ref|XP_008453953.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    604   0.0      
ref|XP_004160815.1|  PREDICTED: LOW QUALITY PROTEIN: PTI1-like ty...    602   0.0      
ref|XP_009768836.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    602   0.0      
ref|XP_008445693.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    602   0.0      
ref|XP_009337466.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     601   0.0      
ref|XP_009363662.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     600   0.0      
ref|XP_010557160.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    600   0.0      
ref|XP_010912131.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    600   0.0      
gb|KHG02625.1|  PTI1-like tyrosine-protein kinase 3                     599   0.0      
ref|XP_008790659.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     599   0.0      
ref|XP_008453954.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    598   0.0      
ref|XP_006397487.1|  hypothetical protein EUTSA_v10001469mg             599   0.0      
ref|XP_008802372.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     595   0.0      
ref|XP_002876497.1|  hypothetical protein ARALYDRAFT_486400             593   0.0      
ref|XP_002880033.1|  hypothetical protein ARALYDRAFT_483429             593   0.0      
ref|XP_010512186.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    593   0.0      
ref|XP_010413706.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    593   0.0      
ref|XP_010930922.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     591   0.0      
ref|XP_010524132.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    592   0.0      
emb|CAB91605.1|  protein kinase-like protein                            592   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858642.1|  hypothetical protein AMTR_s00066p00048730          592   0.0      
ref|NP_567082.2|  PTI1-like tyrosine-protein kinase 3                   592   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512187.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    590   0.0      
ref|XP_010413708.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    590   0.0      
ref|NP_565995.1|  putative protein kinase                               591   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189740.1|  putative protein kinase                            592   0.0      
ref|XP_010524133.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    589   0.0      
gb|KHG05761.1|  PTI1-like tyrosine-protein kinase 3                     589   0.0      
ref|NP_850720.1|  PTI1-like tyrosine-protein kinase 3                   589   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294330.1|  hypothetical protein CARUB_v10023337mg             590   0.0      
ref|XP_006291084.1|  hypothetical protein CARUB_v10017200mg             587   0.0      
ref|XP_010517880.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     588   0.0      
ref|XP_009393524.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     587   0.0      
ref|XP_010508455.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     588   0.0      
ref|XP_006291083.1|  hypothetical protein CARUB_v10017200mg             590   0.0      
ref|XP_010506183.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     587   0.0      
ref|XP_006402698.1|  hypothetical protein EUTSA_v10006024mg             587   0.0      
ref|XP_010522046.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     583   0.0      
ref|XP_009116593.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    585   0.0      
emb|CDY00615.1|  BnaC04g23100D                                          584   0.0      
ref|XP_009116595.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    581   0.0      
ref|XP_009138918.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    583   0.0      
ref|XP_009383811.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     582   0.0      
emb|CDY06011.1|  BnaA09g37690D                                          582   0.0      
emb|CDY57492.1|  BnaC08g48860D                                          582   0.0      
ref|XP_010695320.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    582   0.0      
ref|XP_009138919.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    580   0.0      
ref|XP_010695321.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    580   0.0      
gb|KFK37162.1|  hypothetical protein AALP_AA4G221200                    581   0.0      
emb|CDX89020.1|  BnaA04g01660D                                          581   0.0      
ref|XP_009386960.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    577   0.0      
ref|XP_009386959.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    577   0.0      
emb|CDY17940.1|  BnaC04g02790D                                          574   0.0      
ref|XP_006417891.1|  hypothetical protein EUTSA_v10007987mg             572   0.0      
ref|XP_009385464.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     572   0.0      
ref|XP_009142919.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     573   0.0      
emb|CDX79833.1|  BnaA05g03230D                                          572   0.0      
ref|XP_009386962.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    570   0.0      
ref|XP_006305151.1|  hypothetical protein CARUB_v10009518mg             570   0.0      
emb|CDY06223.1|  BnaA09g49800D                                          569   0.0      
ref|XP_009118489.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    568   0.0      
emb|CDX98366.1|  BnaC06g17270D                                          568   0.0      
ref|XP_009118488.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    567   0.0      
emb|CDX67793.1|  BnaA07g18330D                                          567   0.0      
ref|XP_009104201.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    567   0.0      
ref|XP_009630699.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     565   0.0      
ref|XP_009104200.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    566   0.0      
ref|XP_010056837.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    565   0.0      
ref|XP_010414222.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     564   0.0      
ref|XP_010510290.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     563   0.0      
emb|CDY23345.1|  BnaC04g48730D                                          565   0.0      
ref|XP_006294474.1|  hypothetical protein CARUB_v10023490mg             563   0.0      
ref|XP_009142178.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     564   0.0      
ref|XP_010912132.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    561   0.0      
dbj|BAH20354.1|  AT3G59350                                              561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_172155.1|  PTI1-like tyrosine-protein kinase 1                   561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892354.1|  hypothetical protein ARALYDRAFT_887872             560   0.0      
gb|AAK44075.1|AF370260_1  putative protein kinase interactor            560   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486484.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     559   0.0      
ref|XP_009414666.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     559   0.0      
ref|XP_010457811.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     558   0.0      
emb|CDY09961.1|  BnaC08g44900D                                          558   0.0      
gb|ABR16274.1|  unknown                                                 557   0.0      Picea sitchensis
ref|NP_180632.1|  PTI1-like tyrosine-protein kinase 2                   557   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDP20710.1|  unnamed protein product                                554   0.0      
ref|XP_006410175.1|  hypothetical protein EUTSA_v10016840mg             555   0.0      
ref|XP_010525876.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    555   0.0      
ref|XP_010525868.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    555   0.0      
ref|XP_004956066.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    551   0.0      
ref|XP_004956065.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    551   0.0      
emb|CDY10754.1|  BnaA05g11820D                                          550   0.0      
ref|XP_002879278.1|  hypothetical protein ARALYDRAFT_902068             550   0.0      
ref|XP_004970920.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    548   0.0      
ref|XP_004970919.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    548   0.0      
ref|XP_009144277.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    546   0.0      
emb|CDY47124.1|  BnaC04g13810D                                          545   0.0      
ref|NP_001141426.1|  uncharacterized LOC100273536                       546   0.0      Zea mays [maize]
ref|XP_004970923.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    545   0.0      
ref|XP_008651094.1|  PREDICTED: uncharacterized LOC100273536 isof...    545   0.0      
ref|NP_001045098.1|  Os01g0899000                                       543   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAF63147.1|AC011001_17  Putative protein kinase                      543   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002461902.1|  hypothetical protein SORBIDRAFT_02g010180          543   0.0      Sorghum bicolor [broomcorn]
ref|XP_009144276.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    542   0.0      
gb|EEC71964.1|  hypothetical protein OsI_04798                          541   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006645177.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    540   0.0      
dbj|BAJ84876.1|  predicted protein                                      540   0.0      
ref|XP_006650884.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    540   0.0      
ref|XP_008674700.1|  PREDICTED: LOW QUALITY PROTEIN: PTI1-like ty...    539   0.0      
emb|CDY29646.1|  BnaA04g17810D                                          538   0.0      
ref|XP_008666980.1|  PREDICTED: putative Pti1-like kinase isoform X1    538   0.0      
ref|XP_009141095.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    537   0.0      
ref|XP_009141096.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    536   0.0      
ref|XP_008651852.1|  PREDICTED: salt-inducible putative protein s...    536   0.0      
ref|NP_001051870.1|  Os03g0844100                                       536   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003578428.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     536   0.0      
emb|CDX97800.1|  BnaC04g41390D                                          536   0.0      
ref|NP_001105273.1|  salt-inducible putative protein serine/threo...    535   0.0      Zea mays [maize]
emb|CDY06658.1|  BnaA10g04370D                                          536   0.0      
dbj|BAD34419.1|  putative Pto kinase interactor 1                       535   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ACL54553.1|  unknown                                                 534   0.0      Zea mays [maize]
ref|XP_006660839.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    533   0.0      
ref|XP_004957330.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    533   0.0      
gb|AFU92323.1|  PTI1                                                    533   0.0      
ref|NP_001105958.1|  putative Pti1-like kinase                          533   0.0      Zea mays [maize]
ref|XP_009119040.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    533   0.0      
emb|CDY10217.1|  BnaC05g04600D                                          532   0.0      
ref|NP_001167677.1|  uncharacterized protein LOC100381338               532   0.0      Zea mays [maize]
ref|XP_003562475.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     531   0.0      
dbj|BAJ96290.1|  predicted protein                                      530   0.0      
gb|ABG36851.1|  putative Pti1-like kinase                               530   0.0      Zea mays [maize]
ref|XP_009119041.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    530   0.0      
emb|CDM85329.1|  unnamed protein product                                530   0.0      
gb|EEC84875.1|  hypothetical protein OsI_32021                          528   3e-180   Oryza sativa Indica Group [Indian rice]
ref|XP_009132750.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     525   4e-180   
dbj|BAJ97816.1|  predicted protein                                      526   4e-180   
emb|CDX84819.1|  BnaA03g14110D                                          525   7e-180   
emb|CDY23984.1|  BnaC03g17070D                                          524   1e-179   
gb|EAZ12767.1|  hypothetical protein OsJ_02684                          522   4e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002879277.1|  predicted protein                                  519   9e-178   
gb|EMS55178.1|  PTI1-like tyrosine-protein kinase 3                     516   5e-177   
ref|XP_008664425.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     516   1e-176   
gb|EMS48873.1|  PTI1-like tyrosine-protein kinase 3                     516   1e-176   
ref|XP_002445776.1|  hypothetical protein SORBIDRAFT_07g025590          514   5e-176   Sorghum bicolor [broomcorn]
ref|XP_004970349.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    514   5e-176   
tpg|DAA56330.1|  TPA: putative protein kinase superfamily protein       513   1e-175   
tpg|DAA48308.1|  TPA: putative protein kinase superfamily protein       513   2e-175   
gb|EMT05387.1|  Serine/threonine-protein kinase PBS1                    516   2e-175   
ref|XP_003574855.1|  PREDICTED: PTI1-like tyrosine-protein kinase 3     511   2e-174   
dbj|BAF79941.1|  receptor-like kinase                                   506   2e-172   Marchantia polymorpha
ref|XP_010276544.1|  PREDICTED: pto-interacting protein 1-like          504   8e-172   
ref|XP_006294520.1|  hypothetical protein CARUB_v10023553mg             503   9e-172   
ref|XP_006492834.1|  PREDICTED: probable protein kinase At2g41970...    503   3e-171   
ref|XP_006429911.1|  hypothetical protein CICLE_v10013472mg             502   4e-171   
ref|XP_006849729.1|  hypothetical protein AMTR_s00024p00246360          502   4e-171   
tpg|DAA62261.1|  TPA: putative protein kinase superfamily protein       498   3e-170   
ref|XP_004970345.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    501   5e-170   
ref|XP_010270968.1|  PREDICTED: pto-interacting protein 1               499   8e-170   
ref|XP_009604049.1|  PREDICTED: probable protein kinase At2g41970       499   9e-170   
emb|CAE55203.1|  protein kinase 1                                       498   2e-169   Nicotiana tabacum [American tobacco]
ref|XP_002974370.1|  hypothetical protein SELMODRAFT_149642             497   3e-169   
gb|KDP24647.1|  hypothetical protein JCGZ_25563                         497   5e-169   
ref|XP_006840315.1|  hypothetical protein AMTR_s00045p00078520          496   7e-169   
ref|XP_010510296.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     495   2e-168   
ref|XP_010257509.1|  PREDICTED: probable protein kinase At2g41970...    494   7e-168   
ref|XP_010036502.1|  PREDICTED: probable protein kinase At2g41970       494   7e-168   
ref|XP_010257510.1|  PREDICTED: probable protein kinase At2g41970...    494   7e-168   
ref|XP_009767643.1|  PREDICTED: probable protein kinase At2g41970...    494   7e-168   
ref|XP_001766765.1|  predicted protein                                  493   1e-167   
gb|ADE77381.1|  unknown                                                 492   3e-167   
gb|AFV46209.1|  hypothetical protein                                    489   3e-167   
ref|XP_010257506.1|  PREDICTED: probable protein kinase At2g41970...    493   4e-167   
ref|XP_006351354.1|  PREDICTED: probable protein kinase At2g41970...    492   5e-167   
ref|XP_002534374.1|  Serine/threonine-protein kinase PBS1, putative     491   1e-166   Ricinus communis
gb|ADE75753.1|  unknown                                                 490   3e-166   
ref|XP_010312154.1|  PREDICTED: probable protein kinase At2g41970       489   5e-166   
ref|XP_010111379.1|  putative protein kinase                            489   7e-166   
ref|XP_007202089.1|  hypothetical protein PRUPE_ppa007444mg             489   8e-166   
ref|XP_010943700.1|  PREDICTED: pto-interacting protein 1-like          488   1e-165   
ref|XP_002308358.1|  kinase family protein                              487   3e-165   Populus trichocarpa [western balsam poplar]
ref|NP_180631.1|  putative protein tyrosine kinase                      486   3e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790478.1|  PREDICTED: pto-interacting protein 1-like          487   3e-165   
emb|CDP10167.1|  unnamed protein product                                488   3e-165   
ref|XP_010243367.1|  PREDICTED: probable protein kinase At2g41970...    486   5e-165   
ref|XP_011005288.1|  PREDICTED: probable protein kinase At2g41970       486   6e-165   
ref|XP_010653876.1|  PREDICTED: probable protein kinase At2g41970...    486   7e-165   
ref|XP_010676583.1|  PREDICTED: pto-interacting protein 1-like          485   2e-164   
ref|XP_009411601.1|  PREDICTED: pto-interacting protein 1-like          485   2e-164   
ref|XP_004136558.1|  PREDICTED: probable protein kinase At2g41970...    485   2e-164   
ref|XP_002275867.1|  PREDICTED: probable protein kinase At2g41970...    484   4e-164   Vitis vinifera
ref|XP_007029038.1|  Kinase superfamily protein                         484   4e-164   
ref|XP_010937000.1|  PREDICTED: probable protein kinase At2g41970       484   4e-164   
ref|XP_010058297.1|  PREDICTED: probable protein kinase At2g41970...    484   5e-164   
ref|XP_008443027.1|  PREDICTED: probable protein kinase At2g41970       484   6e-164   
ref|XP_009590606.1|  PREDICTED: probable protein kinase At2g41970       484   7e-164   
ref|XP_010058289.1|  PREDICTED: probable protein kinase At2g41970...    484   7e-164   
ref|XP_010312070.1|  PREDICTED: probable protein kinase At2g41970       484   9e-164   
ref|XP_009776353.1|  PREDICTED: probable protein kinase At2g41970       483   1e-163   
ref|XP_006362209.1|  PREDICTED: probable protein kinase At2g41970...    483   1e-163   
ref|XP_003567563.1|  PREDICTED: pto-interacting protein 1-like          483   1e-163   
ref|XP_010907905.1|  PREDICTED: pto-interacting protein 1-like          483   2e-163   
ref|XP_009771072.1|  PREDICTED: probable protein kinase At2g41970       483   2e-163   
ref|XP_008240899.1|  PREDICTED: probable protein kinase At2g41970       483   2e-163   
ref|XP_007162348.1|  hypothetical protein PHAVU_001G144200g             483   2e-163   
ref|XP_003553436.1|  PREDICTED: probable protein kinase At2g41970...    482   2e-163   
ref|XP_008779063.1|  PREDICTED: pto-interacting protein 1-like          482   3e-163   
gb|KCW90327.1|  hypothetical protein EUGRSUZ_A02469                     481   3e-163   
ref|XP_002323330.1|  hypothetical protein POPTR_0016s05960g             482   3e-163   Populus trichocarpa [western balsam poplar]
ref|XP_011075094.1|  PREDICTED: probable protein kinase At2g41970...    482   4e-163   
ref|XP_009794703.1|  PREDICTED: pto-interacting protein 1-like          481   4e-163   
ref|XP_011075095.1|  PREDICTED: probable protein kinase At2g41970...    481   5e-163   
ref|XP_004495871.1|  PREDICTED: probable receptor-like protein ki...    481   5e-163   
ref|XP_010939954.1|  PREDICTED: probable protein kinase At2g41970       481   5e-163   
ref|XP_009382463.1|  PREDICTED: pto-interacting protein 1-like          481   6e-163   
ref|NP_001054576.1|  Os05g0135800                                       481   6e-163   Oryza sativa Japonica Group [Japonica rice]
gb|AEZ00865.1|  putative pto kinase interactor protein                  481   6e-163   
gb|EMT17432.1|  Serine/threonine-protein kinase PBS1                    481   7e-163   
ref|XP_011039472.1|  PREDICTED: probable protein kinase At2g41970       481   1e-162   
ref|XP_006654810.1|  PREDICTED: pto-interacting protein 1-like is...    480   1e-162   
ref|XP_002515200.1|  Serine/threonine-protein kinase PBS1, putative     480   2e-162   
ref|XP_006444596.1|  hypothetical protein CICLE_v10020776mg             479   2e-162   
ref|XP_003568986.1|  PREDICTED: pto-interacting protein 1               479   3e-162   
ref|XP_009594543.1|  PREDICTED: probable protein kinase At2g41970       479   3e-162   
ref|XP_010317884.1|  PREDICTED: probable protein kinase At2g41970...    479   5e-162   
ref|NP_001237620.1|  serine/threonine protein kinase                    479   5e-162   
ref|XP_011071327.1|  PREDICTED: pto-interacting protein 1 isoform X2    479   5e-162   
ref|XP_004967612.1|  PREDICTED: pto-interacting protein 1-like is...    478   6e-162   
gb|KDP28325.1|  hypothetical protein JCGZ_14096                         479   7e-162   
ref|XP_004967611.1|  PREDICTED: pto-interacting protein 1-like is...    478   7e-162   
ref|XP_006654019.1|  PREDICTED: pto-interacting protein 1-like          478   7e-162   
ref|XP_009631147.1|  PREDICTED: pto-interacting protein 1-like          478   8e-162   
gb|ACR07972.1|  Pti1-like S/T protein kinase                            478   8e-162   
emb|CAE55204.1|  protein kinase 2                                       478   1e-161   
ref|XP_003591321.1|  Pto kinase interactor                              478   1e-161   
ref|XP_006342302.1|  PREDICTED: probable protein kinase At2g41970...    478   2e-161   
ref|XP_008810334.1|  PREDICTED: pto-interacting protein 1-like          477   2e-161   
ref|XP_003521614.1|  PREDICTED: probable receptor-like protein ki...    477   2e-161   
ref|XP_006411468.1|  hypothetical protein EUTSA_v10016836mg             477   2e-161   
ref|XP_002301545.2|  serine/threonine protein kinase                    477   2e-161   
gb|AGT17267.1|  pto kinase interactor                                   478   2e-161   
ref|XP_010317883.1|  PREDICTED: probable protein kinase At2g41970...    478   2e-161   
ref|XP_004234864.1|  PREDICTED: probable protein kinase At2g41970...    478   3e-161   
ref|XP_004960413.1|  PREDICTED: probable receptor-like protein ki...    477   3e-161   
gb|KHG15738.1|  Pto-interacting 1                                       476   4e-161   
ref|XP_007051259.1|  Kinase superfamily protein                         478   4e-161   
ref|XP_004166296.1|  PREDICTED: probable protein kinase At2g41970...    477   4e-161   
ref|XP_010045701.1|  PREDICTED: pto-interacting protein 1               476   4e-161   
ref|XP_010317882.1|  PREDICTED: probable protein kinase At2g41970...    477   5e-161   
ref|XP_002439236.1|  hypothetical protein SORBIDRAFT_09g002850          476   5e-161   
ref|XP_009142030.1|  PREDICTED: probable protein kinase At2g41970       476   5e-161   
gb|EMT15917.1|  Serine/threonine-protein kinase PBS1                    476   5e-161   
ref|XP_011015824.1|  PREDICTED: pto-interacting protein 1-like          476   7e-161   
ref|XP_007163227.1|  hypothetical protein PHAVU_001G216800g             476   7e-161   
ref|XP_010941479.1|  PREDICTED: pto-interacting protein 1-like          476   7e-161   
ref|XP_004239890.1|  PREDICTED: pto-interacting protein 1-like is...    476   8e-161   
ref|XP_011071326.1|  PREDICTED: pto-interacting protein 1 isoform X1    478   1e-160   
gb|EMS58862.1|  PTI1-like tyrosine-protein kinase 3                     475   1e-160   
ref|XP_003591322.1|  Pto kinase interactor                              479   1e-160   
ref|XP_011078816.1|  PREDICTED: probable protein kinase At2g41970...    475   1e-160   
gb|ABK24686.1|  unknown                                                 475   2e-160   
ref|XP_010551111.1|  PREDICTED: pto-interacting protein 1-like          475   2e-160   
ref|NP_181728.1|  putative protein kinase                               475   2e-160   
gb|EMS68085.1|  Pto-interacting protein 1                               477   2e-160   
ref|XP_006355716.1|  PREDICTED: pto-interacting protein 1-like is...    475   2e-160   
ref|XP_002881812.1|  hypothetical protein ARALYDRAFT_483285             475   2e-160   
ref|XP_009409111.1|  PREDICTED: probable protein kinase At2g41970       474   2e-160   
gb|ACN58182.1|  putative Pto kinase interactor 1                        474   2e-160   
ref|XP_007145108.1|  hypothetical protein PHAVU_007G210500g             474   2e-160   
ref|XP_008390363.1|  PREDICTED: pto-interacting protein 1               474   2e-160   
ref|XP_004305532.1|  PREDICTED: probable protein kinase At2g41970...    474   3e-160   
emb|CDY06890.1|  BnaA04g24250D                                          474   3e-160   
ref|XP_008661276.1|  PREDICTED: putative Pti1-like kinase isoform X1    474   3e-160   
gb|KGN59283.1|  hypothetical protein Csa_3G800660                       477   4e-160   
ref|XP_011005941.1|  PREDICTED: pto-interacting protein 1-like          474   5e-160   
ref|NP_001147736.1|  pto kinase interactor 1                            473   5e-160   
ref|XP_010672629.1|  PREDICTED: probable protein kinase At2g41970       474   6e-160   
ref|XP_010914764.1|  PREDICTED: pto-interacting protein 1-like          474   6e-160   
gb|ACN33916.1|  unknown                                                 473   6e-160   
gb|KHN00234.1|  Pto-interacting protein 1                               473   6e-160   
ref|XP_009390863.1|  PREDICTED: probable protein kinase At2g41970       473   7e-160   
emb|CDY14807.1|  BnaC04g48040D                                          473   8e-160   
ref|XP_006574465.1|  PREDICTED: pto-interacting protein 1-like is...    473   9e-160   
ref|XP_011078813.1|  PREDICTED: probable protein kinase At2g41970...    473   9e-160   
ref|XP_010321417.1|  PREDICTED: pto-interacting protein 1-like is...    475   9e-160   
ref|XP_009625427.1|  PREDICTED: pto-interacting protein 1 isoform X1    473   1e-159   
ref|XP_009772907.1|  PREDICTED: pto-interacting protein 1 isoform X1    473   1e-159   
ref|XP_006587202.1|  PREDICTED: probable protein kinase At2g41970...    473   1e-159   
ref|XP_009625428.1|  PREDICTED: pto-interacting protein 1 isoform X2    471   1e-159   
ref|XP_008798938.1|  PREDICTED: probable protein kinase At2g41970       473   1e-159   
ref|XP_009369324.1|  PREDICTED: probable protein kinase At2g41970       473   1e-159   
ref|NP_001233803.1|  pto-interacting protein 1                          472   1e-159   
emb|CDY37782.1|  BnaC04g00430D                                          473   2e-159   
ref|XP_010672613.1|  PREDICTED: pto-interacting protein 1               473   2e-159   
gb|KHG29865.1|  hypothetical protein F383_02991                         472   2e-159   
ref|XP_008223490.1|  PREDICTED: pto-interacting protein 1               472   2e-159   
ref|NP_001241285.1|  pto-interacting protein 1-like                     472   2e-159   
gb|ACB30366.1|  Pto kinase interactor 1                                 472   3e-159   
ref|XP_006295481.1|  hypothetical protein CARUB_v10024584mg             472   3e-159   
ref|XP_003520542.1|  PREDICTED: probable protein kinase At2g41970...    472   3e-159   
ref|XP_010517703.1|  PREDICTED: probable protein kinase At2g41970       471   4e-159   
gb|KHN15995.1|  Hypothetical protein glysoja_047593                     471   5e-159   
ref|NP_001106001.1|  putative protein kinase                            471   6e-159   
ref|XP_008654612.1|  PREDICTED: uncharacterized LOC100273920 isof...    471   6e-159   
ref|XP_006349862.1|  PREDICTED: pto-interacting protein 1-like is...    471   6e-159   
ref|XP_009142569.1|  PREDICTED: probable receptor-like protein ki...    471   6e-159   
gb|KHN00314.1|  Pto-interacting protein 1                               471   6e-159   
ref|NP_001141784.1|  uncharacterized LOC100273920                       471   6e-159   
ref|NP_001239908.1|  pto-interacting protein 1-like                     470   6e-159   
ref|XP_010508637.1|  PREDICTED: probable protein kinase At2g41970       471   7e-159   
ref|XP_007145704.1|  hypothetical protein PHAVU_007G261200g             471   7e-159   
ref|XP_007222172.1|  hypothetical protein PRUPE_ppa007758mg             471   7e-159   
ref|XP_004493611.1|  PREDICTED: probable protein kinase At2g41970...    471   9e-159   
ref|XP_009353417.1|  PREDICTED: pto-interacting protein 1-like          470   9e-159   
ref|XP_002454029.1|  hypothetical protein SORBIDRAFT_04g023390          471   9e-159   
ref|XP_010506730.1|  PREDICTED: probable receptor-like protein ki...    470   1e-158   
emb|CDY64576.1|  BnaCnng44120D                                          470   2e-158   
ref|XP_004952726.1|  PREDICTED: probable protein kinase At2g41970...    470   2e-158   
gb|EYU20686.1|  hypothetical protein MIMGU_mgv1a008548mg                470   2e-158   
ref|XP_010235569.1|  PREDICTED: probable protein kinase At2g41970       469   2e-158   
emb|CDX79897.1|  BnaA05g02590D                                          469   3e-158   
ref|XP_008654611.1|  PREDICTED: uncharacterized LOC100273920 isof...    471   3e-158   
ref|XP_010554885.1|  PREDICTED: probable protein kinase At2g41970       469   3e-158   
dbj|BAK06802.1|  predicted protein                                      469   3e-158   
ref|XP_004981580.1|  PREDICTED: probable protein kinase At2g41970...    469   3e-158   
ref|XP_010505997.1|  PREDICTED: probable protein kinase At2g41970       469   4e-158   
ref|NP_001140282.1|  uncharacterized LOC100272326                       469   5e-158   
ref|XP_002320946.1|  hypothetical protein POPTR_0014s10950g             469   5e-158   
ref|XP_004288351.1|  PREDICTED: pto-interacting protein 1-like          469   5e-158   
ref|XP_008654610.1|  PREDICTED: uncharacterized LOC100273920 isof...    470   5e-158   
ref|XP_008367128.1|  PREDICTED: pto-interacting protein 1-like          468   6e-158   
gb|AGG38003.1|  serine/threonine protein kinase                         468   6e-158   
ref|XP_006294329.1|  hypothetical protein CARUB_v10023336mg             470   7e-158   
ref|XP_007035973.1|  Receptor-like protein kinase                       477   9e-158   
ref|XP_002971759.1|  hypothetical protein SELMODRAFT_95982              467   9e-158   
ref|NP_001105957.1|  putative Pti1-like kinase                          468   1e-157   
ref|XP_002882104.1|  hypothetical protein ARALYDRAFT_483882             468   1e-157   
ref|XP_001766763.1|  predicted protein                                  467   1e-157   
ref|XP_010523887.1|  PREDICTED: probable receptor-like protein ki...    468   1e-157   
emb|CDP17028.1|  unnamed protein product                                467   2e-157   
ref|XP_002280340.1|  PREDICTED: pto-interacting protein 1               467   2e-157   
ref|XP_009146015.1|  PREDICTED: pto-interacting protein 1-like is...    467   2e-157   
ref|XP_002963810.1|  hypothetical protein SELMODRAFT_80006              466   2e-157   
ref|XP_006397896.1|  hypothetical protein EUTSA_v10001465mg             469   2e-157   
ref|XP_010559168.1|  PREDICTED: probable receptor-like protein ki...    467   2e-157   
ref|XP_009341511.1|  PREDICTED: pto-interacting protein 1               467   2e-157   
ref|XP_008343207.1|  PREDICTED: pto-interacting protein 1               467   3e-157   
gb|KHG28409.1|  hypothetical protein F383_08547                         467   3e-157   
ref|NP_001132431.1|  uncharacterized LOC100193882                       467   3e-157   
ref|XP_010505348.1|  PREDICTED: pto-interacting protein 1-like          467   3e-157   
ref|XP_010465789.1|  PREDICTED: pto-interacting protein 1-like is...    467   3e-157   
gb|EPS68734.1|  protein kinase 2                                        466   3e-157   
ref|XP_007221560.1|  hypothetical protein PRUPE_ppa007570mg             466   3e-157   
ref|XP_009363079.1|  PREDICTED: pto-interacting protein 1-like          466   4e-157   
ref|XP_009146014.1|  PREDICTED: pto-interacting protein 1-like is...    467   4e-157   
ref|XP_010487622.1|  PREDICTED: pto-interacting protein 1-like          466   4e-157   
ref|XP_008461382.1|  PREDICTED: probable receptor-like protein ki...    466   4e-157   
ref|XP_008227795.1|  PREDICTED: pto-interacting protein 1               466   5e-157   
ref|XP_004497880.1|  PREDICTED: probable protein kinase At2g41970...    466   5e-157   
ref|XP_002267003.1|  PREDICTED: pto-interacting protein 1 isoform X1    466   6e-157   
ref|XP_009142796.1|  PREDICTED: probable protein kinase At2g41970       466   9e-157   
ref|XP_011079485.1|  PREDICTED: pto-interacting protein 1               465   1e-156   
ref|XP_006406733.1|  hypothetical protein EUTSA_v10020994mg             465   1e-156   
ref|NP_182229.1|  Pto-interacting 1-4                                   465   1e-156   
ref|XP_009114060.1|  PREDICTED: pto-interacting protein 1-like          465   2e-156   
ref|XP_009133525.1|  PREDICTED: probable protein kinase At2g41970       465   2e-156   
emb|CDX82369.1|  BnaA03g34520D                                          465   2e-156   
ref|XP_006648758.1|  PREDICTED: probable protein kinase At2g41970...    465   2e-156   
ref|XP_004297082.1|  PREDICTED: pto-interacting protein 1-like          464   2e-156   
emb|CDO98701.1|  unnamed protein product                                464   3e-156   
ref|XP_004136137.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    464   3e-156   
ref|XP_011040487.1|  PREDICTED: pto-interacting protein 1-like          464   5e-156   
emb|CDY63018.1|  BnaA01g36930D                                          463   6e-156   
ref|XP_010649678.1|  PREDICTED: pto-interacting protein 1 isoform X2    461   9e-156   
ref|XP_010518396.1|  PREDICTED: probable receptor-like protein ki...    463   1e-155   
emb|CDY22548.1|  BnaC03g23580D                                          463   1e-155   
ref|XP_004168957.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    465   1e-155   
emb|CDY35391.1|  BnaA03g19690D                                          462   2e-155   
ref|NP_001047167.1|  Os02g0565500                                       462   2e-155   
gb|EEC73429.1|  hypothetical protein OsI_07708                          462   2e-155   
ref|XP_010091414.1|  Pto-interacting protein 1                          473   2e-155   
emb|CDY48695.1|  BnaCnng16720D                                          462   3e-155   
ref|XP_009135528.1|  PREDICTED: pto-interacting protein 1-like          461   4e-155   
ref|XP_009359779.1|  PREDICTED: pto-interacting protein 1-like          461   4e-155   
emb|CDX95854.1|  BnaC05g36050D                                          465   5e-155   
ref|XP_010930444.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1     464   5e-155   
gb|AFW57511.1|  putative protein kinase superfamily protein             462   6e-155   
ref|NP_188367.2|  putative serine/threonine protein kinase              461   7e-155   
emb|CDX92130.1|  BnaA05g22770D                                          463   1e-154   
ref|XP_006488743.1|  PREDICTED: pto-interacting protein 1-like is...    459   2e-154   
ref|XP_006297985.1|  hypothetical protein CARUB_v10014027mg             459   3e-154   
gb|KHG06281.1|  Pto-interacting 1                                       459   3e-154   
ref|NP_001042895.1|  Os01g0323100                                       459   3e-154   
ref|XP_003625296.1|  Protein kinase                                     459   4e-154   
ref|XP_002883060.1|  hypothetical protein ARALYDRAFT_479217             459   4e-154   
gb|AES81514.2|  tyrosine kinase family protein                          459   4e-154   
ref|XP_004968655.1|  PREDICTED: pto-interacting protein 1-like is...    459   5e-154   
ref|NP_001105753.1|  Pti1 protein                                       458   7e-154   
ref|NP_001235115.1|  Pti1 kinase-like protein                           457   9e-154   
emb|CDX75915.1|  BnaC03g39980D                                          457   1e-153   
gb|KHN28180.1|  Pto-interacting protein 1                               457   1e-153   
gb|ACF87582.1|  unknown                                                 457   2e-153   
ref|XP_002991142.1|  hypothetical protein SELMODRAFT_236205             457   2e-153   
gb|KDO41321.1|  hypothetical protein CISIN_1g0206413mg                  452   2e-153   
ref|NP_001235129.1|  Pti1 kinase-like protein                           457   2e-153   
ref|XP_002970919.1|  hypothetical protein SELMODRAFT_231705             457   3e-153   
gb|EAY73772.1|  hypothetical protein OsI_01646                          457   3e-153   
ref|XP_006419246.1|  hypothetical protein CICLE_v10005284mg             456   4e-153   
ref|XP_010243369.1|  PREDICTED: probable protein kinase At2g41970...    455   6e-153   
ref|XP_003565722.1|  PREDICTED: pto-interacting protein 1               456   8e-153   
ref|XP_004508088.1|  PREDICTED: pto-interacting protein 1-like is...    455   1e-152   
ref|NP_191781.1|  protein kinase-domain containing protein              455   1e-152   
ref|XP_010500342.1|  PREDICTED: pto-interacting protein 1-like is...    454   4e-152   
ref|XP_010479236.1|  PREDICTED: pto-interacting protein 1-like          454   4e-152   
ref|XP_004148576.1|  PREDICTED: pto-interacting protein 1-like          453   6e-152   
ref|XP_003609868.1|  Pto kinase interactor                              452   8e-152   
ref|XP_002457764.1|  hypothetical protein SORBIDRAFT_03g013140          453   9e-152   
gb|AAT57906.1|  putative PTI1-like kinase                               453   1e-151   
ref|XP_006393466.1|  hypothetical protein EUTSA_v10011595mg             452   1e-151   
ref|XP_008461875.1|  PREDICTED: pto-interacting protein 1-like          452   2e-151   
ref|XP_010091290.1|  Pto-interacting protein 1                          453   2e-151   
gb|AAT57905.1|  putative PTI1-like kinase                               452   2e-151   
ref|XP_008804206.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     456   2e-151   
emb|CDM83007.1|  unnamed protein product                                452   2e-151   
ref|XP_006303675.1|  hypothetical protein CARUB_v10011747mg             452   2e-151   
gb|AFI71840.1|  Pto kinase interactor 1 protein                         452   3e-151   
ref|XP_010257508.1|  PREDICTED: probable protein kinase At2g41970...    452   3e-151   
ref|XP_003609869.1|  Pto kinase interactor                              452   3e-151   
ref|XP_002878443.1|  hypothetical protein ARALYDRAFT_324657             451   3e-151   
ref|XP_003609867.1|  Pto kinase interactor                              451   3e-151   
ref|XP_007154456.1|  hypothetical protein PHAVU_003G120800g             451   5e-151   
ref|XP_010461627.1|  PREDICTED: pto-interacting protein 1-like is...    451   6e-151   
ref|NP_175255.1|  serine/threonine protein kinase                       450   1e-150   
ref|NP_001031553.1|  Pto-interacting 1-4                                451   2e-150   
ref|XP_009767644.1|  PREDICTED: probable protein kinase At2g41970...    448   3e-150   
ref|XP_010500340.1|  PREDICTED: pto-interacting protein 1-like is...    449   3e-150   
ref|XP_010243370.1|  PREDICTED: probable protein kinase At2g41970...    447   5e-150   
ref|XP_002463974.1|  hypothetical protein SORBIDRAFT_01g009910          447   5e-150   
gb|AAK96869.1|  similar to Pto kinase interactor 1 gb|AAC61805.1        448   7e-150   
ref|XP_006291206.1|  hypothetical protein CARUB_v10017335mg             449   1e-149   



>gb|EYU29614.1| hypothetical protein MIMGU_mgv1a020128mg, partial [Erythranthe 
guttata]
Length=386

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/371 (85%), Positives = 343/371 (92%), Gaps = 4/371 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +++RMR+WLCCTC VEESY  +E+E LK P N+ADG    +++G+K + PVK EVQ+A
Sbjct  16    LKKRTRMRRWLCCTCHVEESYQQNENEHLKSPRNNADG----HQRGSKTSAPVKPEVQRA  71

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             +P IEVP LSL+ELKE+TENFGSKALIGEGSYGRVYFA L+DGK VAVKKLDVSSE DSN
Sbjct  72    VPPIEVPSLSLEELKEKTENFGSKALIGEGSYGRVYFAQLSDGKEVAVKKLDVSSEPDSN  131

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKH+NLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  132   VEFLTQVSMVSRLKHDNLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  191

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRV+IAVDAA+GLEYLHEK QP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPD
Sbjct  192   VLDWMQRVKIAVDAARGLEYLHEKSQPSMIHRDIRSSNVLLFEDYKAKIADFNLSNQAPD  251

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  252   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  311

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYP K VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  312   LVTWATPRLSEDKVKQCVDPKLKGEYPAKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  371

Query  1245  PLLKSSAPAPE  1277
             PLLKS  PAPE
Sbjct  372   PLLKSVVPAPE  382



>ref|XP_010069335.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X3 [Eucalyptus 
grandis]
 gb|KCW57659.1| hypothetical protein EUGRSUZ_H00423 [Eucalyptus grandis]
Length=385

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/373 (85%), Positives = 342/373 (92%), Gaps = 4/373 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ RMR+WLCCTCQVEESYPS + E LK P + ADG    Y KG+K + P+K EVQKA
Sbjct  14    LRKRDRMRRWLCCTCQVEESYPSRDDELLKSPRHHADG----YPKGSKASVPIKPEVQKA  69

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+A+L+ GK VAVKKLDVSSEQ+SN
Sbjct  70    PPPIEVPALSLDELKEKTDNFGSKALIGEGSYGRVYYASLDSGKVVAVKKLDVSSEQESN  129

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS+VS+LKHEN VELLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  130   IEFLTQVSVVSRLKHENFVELLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPGP  189

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  190   TLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  249

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  250   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  309

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  310   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  369

Query  1245  PLLKSSAPAPESP  1283
             PLLK++ P    P
Sbjct  370   PLLKTAVPPAAPP  382



>gb|EYU36740.1| hypothetical protein MIMGU_mgv1a007434mg [Erythranthe guttata]
Length=407

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/371 (85%), Positives = 343/371 (92%), Gaps = 4/371 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +++RMR+WLCCTC VEESY  +E+E LK P N+ADG    +++G+K + PVK EVQ+A
Sbjct  37    LKKRTRMRRWLCCTCHVEESYQQNENEHLKSPRNNADG----HQRGSKTSAPVKPEVQRA  92

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             +P IEVP LSL+ELKE+TENFGSKALIGEGSYGRVYFA L+DGK VAVKKLDVSSE DSN
Sbjct  93    VPPIEVPSLSLEELKEKTENFGSKALIGEGSYGRVYFAQLSDGKEVAVKKLDVSSEPDSN  152

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKH+NLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  153   VEFLTQVSMVSRLKHDNLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  212

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRV+IAVDAA+GLEYLHEK QP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPD
Sbjct  213   VLDWMQRVKIAVDAARGLEYLHEKSQPSMIHRDIRSSNVLLFEDYKAKIADFNLSNQAPD  272

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  273   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  332

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYP K VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  333   LVTWATPRLSEDKVKQCVDPKLKGEYPAKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  392

Query  1245  PLLKSSAPAPE  1277
             PLLKS  PAPE
Sbjct  393   PLLKSVVPAPE  403



>ref|XP_010069334.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Eucalyptus 
grandis]
Length=395

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/373 (85%), Positives = 342/373 (92%), Gaps = 4/373 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ RMR+WLCCTCQVEESYPS + E LK P + ADG    Y KG+K + P+K EVQKA
Sbjct  24    LRKRDRMRRWLCCTCQVEESYPSRDDELLKSPRHHADG----YPKGSKASVPIKPEVQKA  79

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+A+L+ GK VAVKKLDVSSEQ+SN
Sbjct  80    PPPIEVPALSLDELKEKTDNFGSKALIGEGSYGRVYYASLDSGKVVAVKKLDVSSEQESN  139

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS+VS+LKHEN VELLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  140   IEFLTQVSVVSRLKHENFVELLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPGP  199

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  200   TLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  259

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  260   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  319

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  320   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  379

Query  1245  PLLKSSAPAPESP  1283
             PLLK++ P    P
Sbjct  380   PLLKTAVPPAAPP  392



>ref|XP_010650476.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Vitis 
vinifera]
 emb|CBI39170.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/371 (86%), Positives = 346/371 (93%), Gaps = 4/371 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             ++++ RMR+WLCCTC VEE Y S+ESE LK P N  DG      KG+KV+ PV++EVQK 
Sbjct  34    VTKRGRMRRWLCCTCHVEEPYQSNESELLKSPRNHTDGN----PKGSKVSAPVRSEVQKT  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVPELSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LN+GK+VAVKKLDVSSE ++ 
Sbjct  90    APPIEVPELSLEELKEKTDNFGSKALIGEGSYGRVYYASLNNGKAVAVKKLDVSSEPETP  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   VEFLTQVSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  210   VLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389

Query  1245  PLLKSSAPAPE  1277
             PLLK++APAPE
Sbjct  390   PLLKAAAPAPE  400



>ref|XP_011073909.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Sesamum 
indicum]
Length=402

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/372 (86%), Positives = 338/372 (91%), Gaps = 5/372 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +++RMR+WLCCTCQVEESY  HE E LK P N  DG       G K   PVK EVQK 
Sbjct  36    LRKRTRMRRWLCCTCQVEESYQPHEHEHLKSPRNRTDG-----HPGGKPPAPVKPEVQKT  90

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             +P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVYFA LN G  VAVKKLDVSSE DSN
Sbjct  91    VPPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYFAQLNSGNEVAVKKLDVSSEPDSN  150

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  151   VEFLTQVSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  210

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAAKGLEYLHEKVQP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPD
Sbjct  211   VLDWMQRVRIAVDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDYKAKIADFNLSNQAPD  270

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  271   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  330

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  331   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  390

Query  1245  PLLKSSAPAPES  1280
             PLLKS+ PAPE+
Sbjct  391   PLLKSTVPAPET  402



>ref|XP_010069333.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57658.1| hypothetical protein EUGRSUZ_H00423 [Eucalyptus grandis]
Length=405

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/373 (85%), Positives = 342/373 (92%), Gaps = 4/373 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ RMR+WLCCTCQVEESYPS + E LK P + ADG    Y KG+K + P+K EVQKA
Sbjct  34    LRKRDRMRRWLCCTCQVEESYPSRDDELLKSPRHHADG----YPKGSKASVPIKPEVQKA  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+A+L+ GK VAVKKLDVSSEQ+SN
Sbjct  90    PPPIEVPALSLDELKEKTDNFGSKALIGEGSYGRVYYASLDSGKVVAVKKLDVSSEQESN  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS+VS+LKHEN VELLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  150   IEFLTQVSVVSRLKHENFVELLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  210   TLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389

Query  1245  PLLKSSAPAPESP  1283
             PLLK++ P    P
Sbjct  390   PLLKTAVPPAAPP  402



>ref|XP_010650477.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Vitis 
vinifera]
 ref|XP_010650478.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Vitis 
vinifera]
Length=362

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/365 (87%), Positives = 341/365 (93%), Gaps = 4/365 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTC VEE Y S+ESE LK P N  DG      KG+KV+ PV++EVQK  P IEV
Sbjct  1     MRRWLCCTCHVEEPYQSNESELLKSPRNHTDGN----PKGSKVSAPVRSEVQKTAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LN+GK+VAVKKLDVSSE ++  EFLTQ
Sbjct  57    PELSLEELKEKTDNFGSKALIGEGSYGRVYYASLNNGKAVAVKKLDVSSEPETPVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK++
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKAA  356

Query  1263  APAPE  1277
             APAPE
Sbjct  357   APAPE  361



>ref|NP_001239619.1| PTI1-like tyrosine-protein kinase 3-like [Glycine max]
 ref|XP_006588444.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X1 
[Glycine max]
 gb|ACM89512.1| protein kinase Pti1 [Glycine max]
 gb|ACU19471.1| unknown [Glycine max]
Length=363

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/367 (87%), Positives = 341/367 (93%), Gaps = 5/367 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P N  DG     +KG+KV+ PVK E QKA P IE 
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRNYGDGN----QKGSKVSAPVKPETQKAPPPIEA  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK+ N VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKNGNFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVL+FE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLIFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLKS 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKSP  356

Query  1263  AP-APES  1280
             AP APES
Sbjct  357   APAAPES  363



>ref|XP_007142635.1| hypothetical protein PHAVU_007G004200g [Phaseolus vulgaris]
 ref|XP_007142636.1| hypothetical protein PHAVU_007G004200g [Phaseolus vulgaris]
 gb|ESW14629.1| hypothetical protein PHAVU_007G004200g [Phaseolus vulgaris]
 gb|ESW14630.1| hypothetical protein PHAVU_007G004200g [Phaseolus vulgaris]
Length=364

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/368 (87%), Positives = 341/368 (93%), Gaps = 5/368 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P N  D      +KG+KV  PVK E QKA P IE 
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRNYGDSN----QKGSKVLPPVKPETQKAPPPIEA  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK++N VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKNDNFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVL+FEE+KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLIFEEYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK+ 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKTP  356

Query  1263  APAPESPE  1286
             APAP +PE
Sbjct  357   APAP-APE  363



>gb|KHN37277.1| PTI1-like tyrosine-protein kinase 3 [Glycine soja]
Length=363

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/367 (87%), Positives = 341/367 (93%), Gaps = 5/367 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTC+VEESYPS+E+E LK P N  DG     +KG+KV+ PVK E QKA P IE 
Sbjct  1     MRRWLCCTCEVEESYPSNENEHLKSPRNYGDGN----QKGSKVSAPVKPETQKAPPPIEA  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK+ N VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKNGNFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVL+FE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLIFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLKS 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKSP  356

Query  1263  AP-APES  1280
             AP APES
Sbjct  357   APAAPES  363



>ref|XP_011073910.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Sesamum 
indicum]
 ref|XP_011073911.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Sesamum 
indicum]
Length=361

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/366 (87%), Positives = 333/366 (91%), Gaps = 5/366 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESY  HE E LK P N  DG       G K   PVK EVQK +P IEV
Sbjct  1     MRRWLCCTCQVEESYQPHEHEHLKSPRNRTDG-----HPGGKPPAPVKPEVQKTVPPIEV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVYFA LN G  VAVKKLDVSSE DSN EFLTQ
Sbjct  56    PALSLEELKEKTDNFGSKALIGEGSYGRVYFAQLNSGNEVAVKKLDVSSEPDSNVEFLTQ  115

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  116   VSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  175

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEKVQP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLH
Sbjct  176   RVRIAVDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLH  235

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  236   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  295

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLKS+
Sbjct  296   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKST  355

Query  1263  APAPES  1280
              PAPE+
Sbjct  356   VPAPET  361



>ref|XP_007034044.1| Serine/threonine-protein kinase PBS1 isoform 1 [Theobroma cacao]
 gb|EOY04970.1| Serine/threonine-protein kinase PBS1 isoform 1 [Theobroma cacao]
Length=398

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/364 (87%), Positives = 340/364 (93%), Gaps = 4/364 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +++RMR+WLCC+CQVEE+Y SHE+E LK P +  DG    ++K +KVA P K EVQK+
Sbjct  27    LKKRTRMRRWLCCSCQVEENYQSHENELLKSPKHHTDG----HQKNSKVAAPAKLEVQKS  82

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+ANLN+GK+VAVKKLDVSSE +SN
Sbjct  83    APPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYANLNNGKAVAVKKLDVSSEPESN  142

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKH+NLVEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  143   VEFLTQVSMVSRLKHDNLVELQGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  202

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  203   VLDWMQRVRIAVDAARGLEYLHEKVQPSVIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  262

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  263   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  322

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  323   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  382

Query  1245  PLLK  1256
             PLLK
Sbjct  383   PLLK  386



>ref|XP_004296735.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Fragaria 
vesca subsp. vesca]
Length=362

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/366 (86%), Positives = 342/366 (93%), Gaps = 4/366 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+C V+ESYPSHESE LK P + ADG      KG+K   P+K ++QKA P IEV
Sbjct  1     MRRWLCCSCHVDESYPSHESEHLKSPGSYADGN----HKGSKAPAPMKPDIQKAAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSK+LIGEGSYGRVY+A+++DGK+VAVKKLDV+SE +SN EFLTQ
Sbjct  57    PPLSLEELKEKTDNFGSKSLIGEGSYGRVYYASMDDGKAVAVKKLDVASEPESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+L+H+NLVELLGYCVEG+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLRHDNLVELLGYCVEGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK  
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPP  356

Query  1263  APAPES  1280
             APA ES
Sbjct  357   APALES  362



>ref|XP_006443111.1| hypothetical protein CICLE_v10020458mg [Citrus clementina]
 ref|XP_006478854.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X1 
[Citrus sinensis]
 gb|ESR56351.1| hypothetical protein CICLE_v10020458mg [Citrus clementina]
Length=401

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/369 (86%), Positives = 337/369 (91%), Gaps = 6/369 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ +MR+WLCCTCQVEESYPSHE+E LK P N  DG         KV  PVK EVQKA
Sbjct  33    LKKRVKMRRWLCCTCQVEESYPSHENERLKSPKNYPDGHH------KKVPAPVKPEVQKA  86

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP L LDELKE+T+NFGSKALIGEGSYGRVY+ANL +GK+VAVKKLDVSSE +SN
Sbjct  87    APPIEVPALPLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESN  146

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS+VS+LKHENLVELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  147   VEFLTQVSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  206

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW  RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  207   VLDWMTRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  266

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  267   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  326

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  327   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  386

Query  1245  PLLKSSAPA  1271
             PLLKS  PA
Sbjct  387   PLLKSPPPA  395



>gb|AES63081.2| Pti1-like kinase [Medicago truncatula]
Length=403

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/368 (86%), Positives = 341/368 (93%), Gaps = 4/368 (1%)
 Frame = +3

Query  177   SRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSI  356
             +RMR+WLCCTCQVEESYPS+E+E LK P +  DG      KG++   PVK E QKA P I
Sbjct  40    TRMRRWLCCTCQVEESYPSNENEHLKSPRSYGDGN----PKGSRAPAPVKPETQKAPPPI  95

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             EVP LSLDELKE+T+NFGSKALIGEGSYGRVY+A LNDGK+VAVKKLDVS+E +SN EFL
Sbjct  96    EVPALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNDGKAVAVKKLDVSTEPESNNEFL  155

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
             TQVSMVS+LK+EN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W
Sbjct  156   TQVSMVSRLKNENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLNW  215

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVL+FE++KAK+ADFNLSNQAPDMAAR
Sbjct  216   MQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLIFEDYKAKVADFNLSNQAPDMAAR  275

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW
Sbjct  276   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  335

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  336   ATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  395

Query  1257  SSAPAPES  1280
             + APAPE+
Sbjct  396   APAPAPET  403



>ref|XP_006372939.1| hypothetical protein POPTR_0017s06410g [Populus trichocarpa]
 gb|ABK95481.1| unknown [Populus trichocarpa]
 gb|ERP50736.1| hypothetical protein POPTR_0017s06410g [Populus trichocarpa]
Length=363

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/367 (86%), Positives = 342/367 (93%), Gaps = 5/367 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYP +ESE L+ P N  DG    Y KG+KVA PVK E+QK  P IEV
Sbjct  1     MRRWLCCTCQVEESYPPYESERLRSPRNYGDG----YPKGSKVAAPVKAELQKEAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+L +GK+VAVKKLDV+SE ++N EFLTQ
Sbjct  57    PALSLEELKEKTDNFGSKALIGEGSYGRVYYASLENGKAVAVKKLDVASEPETNFEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK+EN+VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSRLKNENVVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAA+GLEYLHEK+QP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVKIAVDAARGLEYLHEKLQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAK+AAVAALCVQYE+EFRPNM+IVVKALQPLLKS 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKMAAVAALCVQYESEFRPNMSIVVKALQPLLKSV  356

Query  1263  AP-APES  1280
             AP APE+
Sbjct  357   APAAPET  363



>ref|XP_003592830.1| Protein kinase Pti1 [Medicago truncatula]
Length=435

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/368 (86%), Positives = 341/368 (93%), Gaps = 4/368 (1%)
 Frame = +3

Query  177   SRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSI  356
             +RMR+WLCCTCQVEESYPS+E+E LK P +  DG      KG++   PVK E QKA P I
Sbjct  72    TRMRRWLCCTCQVEESYPSNENEHLKSPRSYGDGN----PKGSRAPAPVKPETQKAPPPI  127

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             EVP LSLDELKE+T+NFGSKALIGEGSYGRVY+A LNDGK+VAVKKLDVS+E +SN EFL
Sbjct  128   EVPALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNDGKAVAVKKLDVSTEPESNNEFL  187

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
             TQVSMVS+LK+EN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W
Sbjct  188   TQVSMVSRLKNENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLNW  247

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVL+FE++KAK+ADFNLSNQAPDMAAR
Sbjct  248   MQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLIFEDYKAKVADFNLSNQAPDMAAR  307

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW
Sbjct  308   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  367

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  368   ATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  427

Query  1257  SSAPAPES  1280
             + APAPE+
Sbjct  428   APAPAPET  435



>ref|XP_006443112.1| hypothetical protein CICLE_v10020458mg [Citrus clementina]
 ref|XP_006478855.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X2 
[Citrus sinensis]
 gb|ESR56352.1| hypothetical protein CICLE_v10020458mg [Citrus clementina]
Length=363

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/363 (88%), Positives = 333/363 (92%), Gaps = 6/363 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPSHE+E LK P N  DG         KV  PVK EVQKA P IEV
Sbjct  1     MRRWLCCTCQVEESYPSHENERLKSPKNYPDGHH------KKVPAPVKPEVQKAAPPIEV  54

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P L LDELKE+T+NFGSKALIGEGSYGRVY+ANL +GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  55    PALPLDELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVSSEPESNVEFLTQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHENLVELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW  
Sbjct  115   VSVVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMT  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  175   RVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLKS 
Sbjct  295   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKSP  354

Query  1263  APA  1271
              PA
Sbjct  355   PPA  357



>ref|XP_008372070.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Malus 
domestica]
Length=401

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/372 (85%), Positives = 346/372 (93%), Gaps = 5/372 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +K RMR+WLCC C VEESYPS+E+E LK P +  DG     +KG+KV+ PVK+EVQKA
Sbjct  35    LRKKVRMRRWLCCACHVEESYPSNENERLKSPNHYGDGN----QKGSKVSAPVKSEVQKA  90

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP+LS++ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE ++N
Sbjct  91    APPIEVPQLSVEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPETN  150

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  151   VEFLTQVSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  210

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAV+AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  211   TLDWMQRVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  270

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  271   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  330

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLK +YP KGVAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  331   LVTWATPRLSEDKVKQCVDPKLK-DYPAKGVAKLAAVAALCVQYESEFRPNMSIVVKALQ  389

Query  1245  PLLKSSAPAPES  1280
             PLLK  A APES
Sbjct  390   PLLKPPAAAPES  401



>gb|KEH44543.1| Pti1-like kinase [Medicago truncatula]
Length=362

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/366 (86%), Positives = 339/366 (93%), Gaps = 4/366 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P +  DG      KG++   PVK E QKA P IEV
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRSYGDGN----PKGSRAPAPVKPETQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LNDGK+VAVKKLDVS+E +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNDGKAVAVKKLDVSTEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK+EN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W Q
Sbjct  117   VSMVSRLKNENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLNWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVL+FE++KAK+ADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLIFEDYKAKVADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK+ 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKAP  356

Query  1263  APAPES  1280
             APAPE+
Sbjct  357   APAPET  362



>gb|ACM89531.1| serine/threonine protein kinase [Glycine max]
Length=366

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/359 (87%), Positives = 334/359 (93%), Gaps = 4/359 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P N  DG     +KG+KV+ PVK E QKA P IE 
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRNYGDGN----QKGSKVSAPVKPETQKAPPPIEA  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK +N VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKDDNFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVL+FE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLIFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             PRLSEDKVKQCVDPKLKGEYPPKGVAKL AVAALCVQYEAEFRPNM+IVVKALQPLLKS
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLGAVAALCVQYEAEFRPNMSIVVKALQPLLKS  355



>ref|NP_001237256.1| protein kinase Pti1 [Glycine max]
 gb|AAO92595.1| protein kinase Pti1 [Glycine max]
Length=366

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/359 (87%), Positives = 334/359 (93%), Gaps = 4/359 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P N  DG     +KG+KV+ PVK E QKA P IE 
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRNYGDGN----QKGSKVSAPVKPETQKAPPPIEA  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK +N VE+ GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKDDNFVEMHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVL+FE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLIFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             PRLSEDKVKQCVDPKLKGEYPPKGVAKL AVAALCVQYEAEFRPNM+IVVKALQPLLKS
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLGAVAALCVQYEAEFRPNMSIVVKALQPLLKS  355



>ref|XP_011037027.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Populus 
euphratica]
Length=406

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/371 (85%), Positives = 345/371 (93%), Gaps = 5/371 (1%)
 Frame = +3

Query  171   EKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIP  350
             +K +MR+WLCCTCQVEESYP +ESE L+ P N  DG    Y KG+KVA PVK E+QK  P
Sbjct  40    KKDKMRRWLCCTCQVEESYPPYESERLRSPGNYGDG----YPKGSKVAAPVKAELQKEAP  95

Query  351   SIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAE  530
              IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+L +GK+VAVKKLDV+SE ++N E
Sbjct  96    PIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYASLENGKAVAVKKLDVASEPETNFE  155

Query  531   FLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTL  710
             FLTQVSMVS+LK+EN+VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP L
Sbjct  156   FLTQVSMVSRLKNENVVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVL  215

Query  711   DWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMA  890
             DW QRV+IAVDAA+GLEYLHEK+QP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMA
Sbjct  216   DWIQRVKIAVDAARGLEYLHEKLQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMA  275

Query  891   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  1070
             ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV
Sbjct  276   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  335

Query  1071  TWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPL  1250
             TWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYE+EFRPNM+IVVKALQPL
Sbjct  336   TWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYESEFRPNMSIVVKALQPL  395

Query  1251  LKSSAP-APES  1280
             LKS AP APE+
Sbjct  396   LKSVAPAAPET  406



>ref|XP_008372071.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Malus 
domestica]
Length=361

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/366 (85%), Positives = 342/366 (93%), Gaps = 5/366 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEESYPS+E+E LK P +  DG     +KG+KV+ PVK+EVQKA P IEV
Sbjct  1     MRRWLCCACHVEESYPSNENERLKSPNHYGDGN----QKGSKVSAPVKSEVQKAAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P+LS++ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE ++N EFLTQ
Sbjct  57    PQLSVEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPETNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLK +YP KGVAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK  
Sbjct  297   PRLSEDKVKQCVDPKLK-DYPAKGVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPP  355

Query  1263  APAPES  1280
             A APES
Sbjct  356   AAAPES  361



>ref|XP_011037028.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Populus 
euphratica]
Length=402

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/371 (85%), Positives = 345/371 (93%), Gaps = 5/371 (1%)
 Frame = +3

Query  171   EKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIP  350
             +K +MR+WLCCTCQVEESYP +ESE L+ P N  DG    Y KG+KVA PVK E+QK  P
Sbjct  36    KKDKMRRWLCCTCQVEESYPPYESERLRSPGNYGDG----YPKGSKVAAPVKAELQKEAP  91

Query  351   SIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAE  530
              IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+L +GK+VAVKKLDV+SE ++N E
Sbjct  92    PIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYASLENGKAVAVKKLDVASEPETNFE  151

Query  531   FLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTL  710
             FLTQVSMVS+LK+EN+VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP L
Sbjct  152   FLTQVSMVSRLKNENVVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVL  211

Query  711   DWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMA  890
             DW QRV+IAVDAA+GLEYLHEK+QP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMA
Sbjct  212   DWIQRVKIAVDAARGLEYLHEKLQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMA  271

Query  891   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  1070
             ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV
Sbjct  272   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  331

Query  1071  TWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPL  1250
             TWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYE+EFRPNM+IVVKALQPL
Sbjct  332   TWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYESEFRPNMSIVVKALQPL  391

Query  1251  LKSSAP-APES  1280
             LKS AP APE+
Sbjct  392   LKSVAPAAPET  402



>ref|XP_007034045.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 ref|XP_007034046.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY04971.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY04972.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=366

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/358 (87%), Positives = 335/358 (94%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQVEE+Y SHE+E LK P +  DG    ++K +KVA P K EVQK+ P IEV
Sbjct  1     MRRWLCCSCQVEENYQSHENELLKSPKHHTDG----HQKNSKVAAPAKLEVQKSAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+ANLN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLEELKEKTDNFGSKALIGEGSYGRVYYANLNNGKAVAVKKLDVSSEPESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKH+NLVEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSRLKHDNLVELQGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSVIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  354



>gb|KDP42853.1| hypothetical protein JCGZ_23795 [Jatropha curcas]
Length=407

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/360 (87%), Positives = 335/360 (93%), Gaps = 3/360 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L  + +MR+WLCCTCQVEESYPS E+E L+ P +  DG      KG KVA PVK+EVQK 
Sbjct  33    LRRRDKMRRWLCCTCQVEESYPSRENEHLRSPKHYPDGN---PTKGPKVAAPVKSEVQKE  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLDELKE+TENFGSKALIGEGSYGRVY+ANL +GK+VAVKKLDV+SEQ+SN
Sbjct  90    APPIEVPALSLDELKEKTENFGSKALIGEGSYGRVYYANLENGKAVAVKKLDVASEQESN  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHEN+VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   VEFLTQVSMVSRLKHENVVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAK+ADFNLSNQAPD
Sbjct  210   TLDWMQRVRIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKVADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389



>ref|XP_004497390.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X1 
[Cicer arietinum]
Length=404

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/373 (84%), Positives = 345/373 (92%), Gaps = 5/373 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +++RMR+WLCCTCQVEESYPS+E+E LK P +  DG      KG++++ PVK E QKA
Sbjct  36    LRKRTRMRRWLCCTCQVEESYPSNENEHLKSPRSYGDGN----PKGSRMSAPVKPETQKA  91

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP +SLDELKE+T+NFGSKALIGEGSYGRVYFA LN+GK+VAVKKLDVSSE +SN
Sbjct  92    PPPIEVPAISLDELKEKTDNFGSKALIGEGSYGRVYFATLNNGKAVAVKKLDVSSEPESN  151

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LK+EN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  152   NEFLTQVSMVSRLKNENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  211

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TL+W QRVRIAVDAA+GLE+LHEK QP +IHRDIRSSNVL+FE+++AKIADFNLSNQAPD
Sbjct  212   TLNWMQRVRIAVDAARGLEFLHEKFQPSIIHRDIRSSNVLIFEDYRAKIADFNLSNQAPD  271

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  272   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  331

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  332   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  391

Query  1245  PLLKS-SAPAPES  1280
             PLLK+  APAPE+
Sbjct  392   PLLKAPPAPAPET  404



>ref|XP_009794542.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Nicotiana 
sylvestris]
Length=405

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/364 (85%), Positives = 340/364 (93%), Gaps = 5/364 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ RMR+WLCCT QVEES PSHE+E  K P N+ DG    Y+KG+K + P K EVQKA
Sbjct  35    LRKRGRMRRWLCCTGQVEESDPSHENELHKSPKNNVDG----YQKGSKASVPAKAEVQKA  90

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             IP+IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+ANLN+GK+VAVKKLDVSSE ++N
Sbjct  91    IPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLNNGKAVAVKKLDVSSEPETN  150

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FL+QVSMVS+LKHENLV+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  151   VDFLSQVSMVSRLKHENLVDLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  210

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRV+IAVDAA+GLEYLHEKVQPP+IHRDIRSSNVLLFE++KAKIADFNLSNQ+PD
Sbjct  211   TLDWMQRVKIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLLFEDYKAKIADFNLSNQSPD  270

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  271   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  330

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLK + P KGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  331   LVTWATPRLSEDKVKQCVDPKLK-DVPAKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389

Query  1245  PLLK  1256
             PLLK
Sbjct  390   PLLK  393



>ref|XP_004252961.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Solanum 
lycopersicum]
Length=403

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/405 (79%), Positives = 357/405 (88%), Gaps = 12/405 (3%)
 Frame = +3

Query  78    GNYHLSDL----PGTCVSSWLLFTIGEHKLIF*LSEKSRMRKWLCCTCQVEESYPSHESE  245
             GNYH   L    P     S L     E  L   L ++ RMR+WLCCTCQVEESYPSHE+E
Sbjct  5     GNYHRQGLVAHAPPPGYFSRLENRRAEDDLY--LRKRVRMRRWLCCTCQVEESYPSHETE  62

Query  246   ALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALI  425
              LK P + ADG    Y+KG++V+ P++ E  KA+P+IEVP LSLDELK++T+NFGSKALI
Sbjct  63    HLKHPASHADG----YQKGSRVSDPIRAEADKAVPTIEVPALSLDELKQETDNFGSKALI  118

Query  426   GEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVE  605
             GEGSYGRVY+ANL++GK+VAVKKLDVSSE ++N +FL QV+ VS+LKH+NLVELLGYCVE
Sbjct  119   GEGSYGRVYYANLSNGKAVAVKKLDVSSEPETNVDFLNQVARVSRLKHDNLVELLGYCVE  178

Query  606   GNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQP  785
             GN+R+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W QRVRIAVDAA+GLEYLHEKVQP
Sbjct  179   GNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLEWVQRVRIAVDAARGLEYLHEKVQP  238

Query  786   PVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL  965
              VIHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL
Sbjct  239   SVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL  298

Query  966   TQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYp  1145
             TQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKV+QCVDPKLKG  P
Sbjct  299   TQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKG-CP  357

Query  1146  pkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-SAPAPE  1277
             PK VAK+AAVAALCVQYEAEFRPNM+IVVKALQPLL++ +APAPE
Sbjct  358   PKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAPAAPAPE  402



>gb|KHG27735.1| PTI1-like tyrosine-protein kinase 3 [Gossypium arboreum]
Length=364

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/368 (84%), Positives = 338/368 (92%), Gaps = 5/368 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQ EESY +HE+E LK P +  DG      + ++VA PVK EVQK+ P IEV
Sbjct  1     MRRWLCCSCQAEESYQAHENEHLKAPKDHTDGN----HRNSRVAAPVKPEVQKSPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LN+GK+VAVKKLDVS+E +SN EFLTQ
Sbjct  57    PALSLEELKEKTDNFGSKALIGEGSYGRVYYASLNNGKAVAVKKLDVSTESESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKH+N VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSRLKHDNFVELQGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK+ 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKAP  356

Query  1263  APAPESPE  1286
              PAP +PE
Sbjct  357   VPAP-APE  363



>ref|XP_009589549.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=405

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/364 (85%), Positives = 340/364 (93%), Gaps = 5/364 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ RMR+WLCCTCQVEES PS+E+E  K P N+ DG    Y+KG+K + P K EVQKA
Sbjct  35    LRKRGRMRRWLCCTCQVEESDPSYENELHKSPKNNVDG----YQKGSKASVPAKAEVQKA  90

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             IP+IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+ANLN+GK+VAVKKLDVSSE ++N
Sbjct  91    IPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLNNGKAVAVKKLDVSSEPETN  150

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FL+Q+SMVS+LKHENLV+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  151   VDFLSQISMVSRLKHENLVDLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  210

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRV+IAVDAA+GLEYLHE+VQPP+IHRDIRSSNVLLFE++KAKIADFNL NQ+PD
Sbjct  211   TLDWMQRVKIAVDAARGLEYLHERVQPPIIHRDIRSSNVLLFEDYKAKIADFNLLNQSPD  270

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  271   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  330

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLK + P KGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  331   LVTWATPRLSEDKVKQCVDPKLK-DVPAKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389

Query  1245  PLLK  1256
             PLLK
Sbjct  390   PLLK  393



>ref|XP_006349879.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X1 
[Solanum tuberosum]
Length=403

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/405 (79%), Positives = 356/405 (88%), Gaps = 12/405 (3%)
 Frame = +3

Query  78    GNYHLSDL----PGTCVSSWLLFTIGEHKLIF*LSEKSRMRKWLCCTCQVEESYPSHESE  245
             GNYH   L    P     S L     E  L   L ++ RMR+WLCCTCQVEESYPSHE+E
Sbjct  5     GNYHRQGLVAHAPPPGYFSRLENRRAEDDLY--LRKRVRMRRWLCCTCQVEESYPSHETE  62

Query  246   ALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALI  425
              LK P + ADG    Y+KG++V+ P++ E  KA+P+IEVP LS DELK++T+NFGSKALI
Sbjct  63    HLKHPASHADG----YQKGSRVSDPIRAEADKAVPTIEVPALSFDELKQETDNFGSKALI  118

Query  426   GEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVE  605
             GEGSYGRVY+ANL++GK+VAVKKLDVSSE ++N +FL QV+ VS+LKH+NLVELLGYCVE
Sbjct  119   GEGSYGRVYYANLSNGKAVAVKKLDVSSEPETNVDFLNQVARVSRLKHDNLVELLGYCVE  178

Query  606   GNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQP  785
             GN+R+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W QRVRIAVDAA+GLEYLHEKVQP
Sbjct  179   GNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLEWVQRVRIAVDAARGLEYLHEKVQP  238

Query  786   PVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL  965
              VIHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL
Sbjct  239   SVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL  298

Query  966   TQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYp  1145
             TQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKV+QCVDPKLKG  P
Sbjct  299   TQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKG-CP  357

Query  1146  pkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-SAPAPE  1277
             PK VAK+AAVAALCVQYEAEFRPNM+IVVKALQPLL++ +APAPE
Sbjct  358   PKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAPAAPAPE  402



>ref|XP_009794543.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Nicotiana 
sylvestris]
Length=365

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/358 (86%), Positives = 336/358 (94%), Gaps = 5/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCT QVEES PSHE+E  K P N+ DG    Y+KG+K + P K EVQKAIP+IEV
Sbjct  1     MRRWLCCTGQVEESDPSHENELHKSPKNNVDG----YQKGSKASVPAKAEVQKAIPTIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+ANLN+GK+VAVKKLDVSSE ++N +FL+Q
Sbjct  57    PALSLDELKEETDNFGSKALIGEGSYGRVYYANLNNGKAVAVKKLDVSSEPETNVDFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLV+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVDLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAA+GLEYLHEKVQPP+IHRDIRSSNVLLFE++KAKIADFNLSNQ+PDMAARLH
Sbjct  177   RVKIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLLFEDYKAKIADFNLSNQSPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLK + P KGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLK-DVPAKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  353



>ref|XP_010097495.1| PTI1-like tyrosine-protein kinase 3 [Morus notabilis]
 gb|EXB68686.1| PTI1-like tyrosine-protein kinase 3 [Morus notabilis]
Length=405

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/361 (87%), Positives = 338/361 (94%), Gaps = 5/361 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQK-  341
             L ++ RMR+WLCCTCQVEESYPS+E+E LK P N +DG     + G++VA P K EVQK 
Sbjct  35    LRKRVRMRRWLCCTCQVEESYPSNENEHLKSPRNYSDGN----KNGSRVAAPAKPEVQKS  90

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
             A P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LN+GK+VAVKKLDVSSE ++
Sbjct  91    APPPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYASLNNGKAVAVKKLDVSSEPET  150

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVSMVS+LKHENLVELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  151   NVEFLTQVSMVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPG  210

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTLDW QRVRIAVDAA+GL+YLHEKVQP +IHRDIRSSNVLLFEEFKAK+ADFNLSNQAP
Sbjct  211   PTLDWMQRVRIAVDAARGLDYLHEKVQPSIIHRDIRSSNVLLFEEFKAKVADFNLSNQAP  270

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  271   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  330

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  331   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKAL  390

Query  1242  Q  1244
             Q
Sbjct  391   Q  391



>ref|XP_004497391.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X2 
[Cicer arietinum]
 ref|XP_004497392.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X3 
[Cicer arietinum]
Length=363

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/367 (85%), Positives = 340/367 (93%), Gaps = 5/367 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P +  DG      KG++++ PVK E QKA P IEV
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRSYGDGN----PKGSRMSAPVKPETQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P +SLDELKE+T+NFGSKALIGEGSYGRVYFA LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PAISLDELKEKTDNFGSKALIGEGSYGRVYFATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LK+EN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W Q
Sbjct  117   VSMVSRLKNENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLNWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLE+LHEK QP +IHRDIRSSNVL+FE+++AKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEFLHEKFQPSIIHRDIRSSNVLIFEDYRAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-  1259
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK+ 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKAP  356

Query  1260  SAPAPES  1280
              APAPE+
Sbjct  357   PAPAPET  363



>gb|ACU22698.1| unknown [Glycine max]
Length=366

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/359 (87%), Positives = 332/359 (92%), Gaps = 4/359 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P N  DG     +KG+KV+ PVK E QKA P IE 
Sbjct  1     MRRWLCCTCQVEESYPSNENEHLKSPRNYGDGN----QKGSKVSAPVKPETQKAPPPIEA  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNNGKAVAVKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS LK +N VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSGLKDDNFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDI+SSNVL+FE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPPIIHRDIQSSNVLIFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             PRLSE KVKQCVDPKLKGEYPPKGVAKL AVAALCVQYEAEFRPNM+IVVKALQPLLKS
Sbjct  297   PRLSEGKVKQCVDPKLKGEYPPKGVAKLGAVAALCVQYEAEFRPNMSIVVKALQPLLKS  355



>ref|XP_004252962.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Solanum 
lycopersicum]
Length=362

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/366 (84%), Positives = 343/366 (94%), Gaps = 6/366 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPSHE+E LK P + ADG    Y+KG++V+ P++ E  KA+P+IEV
Sbjct  1     MRRWLCCTCQVEESYPSHETEHLKHPASHADG----YQKGSRVSDPIRAEADKAVPTIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELK++T+NFGSKALIGEGSYGRVY+ANL++GK+VAVKKLDVSSE ++N +FL Q
Sbjct  57    PALSLDELKQETDNFGSKALIGEGSYGRVYYANLSNGKAVAVKKLDVSSEPETNVDFLNQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             V+ VS+LKH+NLVELLGYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W Q
Sbjct  117   VARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLEWVQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-  1259
             PRLSEDKV+QCVDPKLKG  PPK VAK+AAVAALCVQYEAEFRPNM+IVVKALQPLL++ 
Sbjct  297   PRLSEDKVQQCVDPKLKG-CPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAP  355

Query  1260  SAPAPE  1277
             +APAPE
Sbjct  356   AAPAPE  361



>ref|XP_002530551.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF31842.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=406

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/360 (86%), Positives = 338/360 (94%), Gaps = 3/360 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ +MR+WLCCTCQVEESYPS E++ L+ P + ADG      KG+KV+ PV++EVQK 
Sbjct  33    LRKRDKMRRWLCCTCQVEESYPSRENDHLRSPKHYADGN---PVKGSKVSAPVRSEVQKE  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+ANL++GK+VAVKKLDV+SEQ+SN
Sbjct  90    APPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYANLDNGKAVAVKKLDVASEQESN  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKH+N+VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   VEFLTQVSMVSRLKHDNVVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRV+IAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  210   TLDWMQRVKIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389



>ref|XP_009589550.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/358 (85%), Positives = 336/358 (94%), Gaps = 5/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEES PS+E+E  K P N+ DG    Y+KG+K + P K EVQKAIP+IEV
Sbjct  1     MRRWLCCTCQVEESDPSYENELHKSPKNNVDG----YQKGSKASVPAKAEVQKAIPTIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+ANLN+GK+VAVKKLDVSSE ++N +FL+Q
Sbjct  57    PALSLDELKEETDNFGSKALIGEGSYGRVYYANLNNGKAVAVKKLDVSSEPETNVDFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             +SMVS+LKHENLV+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   ISMVSRLKHENLVDLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAA+GLEYLHE+VQPP+IHRDIRSSNVLLFE++KAKIADFNL NQ+PDMAARLH
Sbjct  177   RVKIAVDAARGLEYLHERVQPPIIHRDIRSSNVLLFEDYKAKIADFNLLNQSPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLK + P KGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLK-DVPAKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  353



>ref|XP_006349880.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X2 
[Solanum tuberosum]
Length=362

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/366 (84%), Positives = 342/366 (93%), Gaps = 6/366 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPSHE+E LK P + ADG    Y+KG++V+ P++ E  KA+P+IEV
Sbjct  1     MRRWLCCTCQVEESYPSHETEHLKHPASHADG----YQKGSRVSDPIRAEADKAVPTIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS DELK++T+NFGSKALIGEGSYGRVY+ANL++GK+VAVKKLDVSSE ++N +FL Q
Sbjct  57    PALSFDELKQETDNFGSKALIGEGSYGRVYYANLSNGKAVAVKKLDVSSEPETNVDFLNQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             V+ VS+LKH+NLVELLGYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQPGPTL+W Q
Sbjct  117   VARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLEWVQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-  1259
             PRLSEDKV+QCVDPKLKG  PPK VAK+AAVAALCVQYEAEFRPNM+IVVKALQPLL++ 
Sbjct  297   PRLSEDKVQQCVDPKLKG-CPPKAVAKMAAVAALCVQYEAEFRPNMSIVVKALQPLLRAP  355

Query  1260  SAPAPE  1277
             +APAPE
Sbjct  356   AAPAPE  361



>ref|XP_008222614.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Prunus 
mume]
Length=393

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/357 (87%), Positives = 335/357 (94%), Gaps = 4/357 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +K RMRKWLCCTC VEESYPS+E+E LK P + ADG     +KG KV+ PVK++VQKA
Sbjct  25    LRKKVRMRKWLCCTCHVEESYPSNENEHLKSPKHYADGN----QKGNKVSAPVKSDVQKA  80

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSL+ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE +SN
Sbjct  81    PPPIEVPPLSLEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPESN  140

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHENLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  141   GEFLTQVSMVSRLKHENLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  200

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  201   TLDWLQRVRIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  260

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  261   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  320

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             LVTWATPRLSEDKVKQCVDPKLKG+YP KGVAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  321   LVTWATPRLSEDKVKQCVDPKLKGDYPAKGVAKLAAVAALCVQYEAEFRPNMSIVVK  377



>ref|XP_010056915.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010056989.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X3 [Eucalyptus 
grandis]
 gb|KCW87849.1| hypothetical protein EUGRSUZ_A00250 [Eucalyptus grandis]
Length=364

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/363 (84%), Positives = 336/363 (93%), Gaps = 4/363 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESY +++ E LK P N   G     +K +K++ PVK EVQK+ P IEV
Sbjct  1     MRRWLCCTCQVEESYAANDDELLKSPRNHVHGP----QKNSKLSAPVKPEVQKSAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSK+LIGEGSYGRVY+ANL+ GK+VAVKKLD SSE +S+ EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKSLIGEGSYGRVYYANLDSGKAVAVKKLDNSSEAESDVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN V+LLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPGP LDWTQ
Sbjct  117   VSMVSRLKHENFVQLLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWTQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKA+IADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKARIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDP+L G+YPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKA+QPLLK++
Sbjct  297   PRLSEDKVKQCVDPRLNGDYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKAMQPLLKAA  356

Query  1263  APA  1271
             APA
Sbjct  357   APA  359



>ref|XP_010056802.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Eucalyptus 
grandis]
Length=407

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/373 (82%), Positives = 340/373 (91%), Gaps = 4/373 (1%)
 Frame = +3

Query  153   LIF*LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTE  332
             L+   S   +MR+WLCCTCQVEESY +++ E LK P N   G     +K +K++ PVK E
Sbjct  34    LLLKKSPSKKMRRWLCCTCQVEESYAANDDELLKSPRNHVHGP----QKNSKLSAPVKPE  89

Query  333   VQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSE  512
             VQK+ P IEVP LSLDELKE+T+NFGSK+LIGEGSYGRVY+ANL+ GK+VAVKKLD SSE
Sbjct  90    VQKSAPPIEVPALSLDELKEKTDNFGSKSLIGEGSYGRVYYANLDSGKAVAVKKLDNSSE  149

Query  513   QDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGA  692
              +S+ EFLTQVSMVS+LKHEN V+LLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGA
Sbjct  150   AESDVEFLTQVSMVSRLKHENFVQLLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGA  209

Query  693   QPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSN  872
             QPGP LDWTQRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKA+IADFNLSN
Sbjct  210   QPGPVLDWTQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKARIADFNLSN  269

Query  873   QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR  1052
             QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR
Sbjct  270   QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR  329

Query  1053  GQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVV  1232
             GQQSLVTWATPRLSEDKVKQCVDP+L G+YPPKGVAKLAAVAALCVQYEAEFRPNM+IVV
Sbjct  330   GQQSLVTWATPRLSEDKVKQCVDPRLNGDYPPKGVAKLAAVAALCVQYEAEFRPNMSIVV  389

Query  1233  KALQPLLKSSAPA  1271
             KA+QPLLK++APA
Sbjct  390   KAMQPLLKAAAPA  402



>ref|XP_002309825.1| serine/threonine protein kinase [Populus trichocarpa]
 gb|EEE90275.1| serine/threonine protein kinase [Populus trichocarpa]
Length=368

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/358 (86%), Positives = 331/358 (92%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESY  HE+E ++   N  DG    Y KG+KV+ P K EVQK  P +EV
Sbjct  1     MRRWLCCTCQVEESYQEHENERIRSTGNFGDG----YPKGSKVSAPAKAEVQKEAPPVEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+ANL +GK+VA+KKLDV+SE ++N EFLTQ
Sbjct  57    PVLSLEELKEKTDNFGSKALIGEGSYGRVYYANLENGKAVAIKKLDVASEPETNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSRLKHENFVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+G+EYLHEKVQP VIHRD+RSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGMEYLHEKVQPAVIHRDVRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  354



>ref|XP_009345628.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345630.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Pyrus 
x bretschneideri]
Length=401

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/360 (86%), Positives = 340/360 (94%), Gaps = 5/360 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L +K RMR+WLCCTC VEESYPS+E+E LK P + ADG     +KG+KV+ PVK+EVQKA
Sbjct  35    LRKKVRMRRWLCCTCHVEESYPSNENEHLKSPKHYADGN----QKGSKVSAPVKSEVQKA  90

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP+LS++ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE ++N
Sbjct  91    APPIEVPQLSVEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPETN  150

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHENLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  151   VEFLTQVSMVSRLKHENLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  210

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRV+IAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  211   TLDWMQRVKIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  270

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  271   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  330

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLK EYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  331   LVTWATPRLSEDKVKQCVDPKLK-EYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389



>ref|XP_010246423.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Nelumbo 
nucifera]
Length=406

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/363 (85%), Positives = 332/363 (91%), Gaps = 4/363 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L  K RMR+WLCCTC VEE+Y S+E+E LK P N  DG      K +KV+ P KTEVQKA
Sbjct  31    LRRKGRMRRWLCCTCHVEETYQSNETELLKSPRNHTDGN----HKSSKVSAPSKTEVQKA  86

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLD+LKE+T+NFGSK+LIGEGSYGRVY+A LN G++VAVKKLDVSSE +SN
Sbjct  87    PPPIEVPALSLDDLKEKTDNFGSKSLIGEGSYGRVYYATLNSGQTVAVKKLDVSSEPESN  146

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FLTQVSMVS+LKH+NL+ELLGYCVEGN R+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  147   VDFLTQVSMVSRLKHDNLIELLGYCVEGNQRVLAYEFATMGSLHDILHGRKGVQGAQPGP  206

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAV AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  207   VLDWMQRVRIAVGAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  266

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  267   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  326

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  327   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  386

Query  1245  PLL  1253
             PLL
Sbjct  387   PLL  389



>ref|XP_010246424.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Nelumbo 
nucifera]
Length=400

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/363 (85%), Positives = 332/363 (91%), Gaps = 4/363 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L  K RMR+WLCCTC VEE+Y S+E+E LK P N  DG      K +KV+ P KTEVQKA
Sbjct  25    LRRKGRMRRWLCCTCHVEETYQSNETELLKSPRNHTDGN----HKSSKVSAPSKTEVQKA  80

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLD+LKE+T+NFGSK+LIGEGSYGRVY+A LN G++VAVKKLDVSSE +SN
Sbjct  81    PPPIEVPALSLDDLKEKTDNFGSKSLIGEGSYGRVYYATLNSGQTVAVKKLDVSSEPESN  140

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FLTQVSMVS+LKH+NL+ELLGYCVEGN R+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  141   VDFLTQVSMVSRLKHDNLIELLGYCVEGNQRVLAYEFATMGSLHDILHGRKGVQGAQPGP  200

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAV AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  201   VLDWMQRVRIAVGAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  260

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  261   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  320

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  321   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  380

Query  1245  PLL  1253
             PLL
Sbjct  381   PLL  383



>ref|XP_010258610.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Nelumbo 
nucifera]
Length=400

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/375 (83%), Positives = 336/375 (90%), Gaps = 5/375 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L+ K R+R+WLCCTC VEE+Y S+E E LK P N  +       K +K + P KTEVQK 
Sbjct  31    LTMKGRVRRWLCCTCNVEETYESNEDELLKSPRNHTNVN----HKSSKASAPAKTEVQKT  86

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLDELKE+TE+FGSK+LIGEGSYGRVY+A LN G++VA+KKLD+SSE + N
Sbjct  87    PPPIEVPALSLDELKEKTESFGSKSLIGEGSYGRVYYATLNSGQAVAIKKLDISSEPEPN  146

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS+LKHENLVELLGYCVEGN R+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  147   DEFLTQVSMVSRLKHENLVELLGYCVEGNERVLAYEFATMGSLHDILHGRKGVQGAQPGP  206

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  207   VLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  266

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  267   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  326

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  327   LVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPNMSIVVKALQ  386

Query  1245  PLLKSSAPAPESPEI  1289
             PLL    PAP +PEI
Sbjct  387   PLLTQKQPAP-APEI  400



>ref|XP_011026367.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Populus euphratica]
Length=368

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/358 (85%), Positives = 331/358 (92%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESY  HE+E ++   N  DG    Y KG+KV+ P K EVQK  P +EV
Sbjct  1     MRRWLCCTCQVEESYQEHENERIRSTGNFGDG----YPKGSKVSAPAKAEVQKEAPPVEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+L +GK+VA+KKLDV+SE ++N EFLTQ
Sbjct  57    PVLSLEELKEKTDNFGSKALIGEGSYGRVYYASLENGKAVAIKKLDVASEPETNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSIVSRLKHENFVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRD+RSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAVIHRDVRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  354



>ref|XP_009345629.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009345631.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Pyrus 
x bretschneideri]
Length=361

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/354 (87%), Positives = 336/354 (95%), Gaps = 5/354 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTC VEESYPS+E+E LK P + ADG     +KG+KV+ PVK+EVQKA P IEV
Sbjct  1     MRRWLCCTCHVEESYPSNENEHLKSPKHYADGN----QKGSKVSAPVKSEVQKAAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P+LS++ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE ++N EFLTQ
Sbjct  57    PQLSVEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPETNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVKIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             PRLSEDKVKQCVDPKLK EYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  297   PRLSEDKVKQCVDPKLK-EYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  349



>ref|XP_010258611.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010258612.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010258613.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010258615.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010258616.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Nelumbo 
nucifera]
Length=368

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/372 (83%), Positives = 334/372 (90%), Gaps = 5/372 (1%)
 Frame = +3

Query  174   KSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPS  353
             K R+R+WLCCTC VEE+Y S+E E LK P N  +       K +K + P KTEVQK  P 
Sbjct  2     KGRVRRWLCCTCNVEETYESNEDELLKSPRNHTNVN----HKSSKASAPAKTEVQKTPPP  57

Query  354   IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEF  533
             IEVP LSLDELKE+TE+FGSK+LIGEGSYGRVY+A LN G++VA+KKLD+SSE + N EF
Sbjct  58    IEVPALSLDELKEKTESFGSKSLIGEGSYGRVYYATLNSGQAVAIKKLDISSEPEPNDEF  117

Query  534   LTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLD  713
             LTQVSMVS+LKHENLVELLGYCVEGN R+LAYEFATMGSLHDILHGRKGVQGAQPGP LD
Sbjct  118   LTQVSMVSRLKHENLVELLGYCVEGNERVLAYEFATMGSLHDILHGRKGVQGAQPGPVLD  177

Query  714   WTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAA  893
             W QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAA
Sbjct  178   WMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAA  237

Query  894   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  1073
             RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT
Sbjct  238   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  297

Query  1074  WATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             WATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL
Sbjct  298   WATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPNMSIVVKALQPLL  357

Query  1254  KSSAPAPESPEI  1289
                 PAP +PEI
Sbjct  358   TQKQPAP-APEI  368



>ref|XP_008222616.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Prunus 
mume]
Length=363

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/351 (87%), Positives = 331/351 (94%), Gaps = 4/351 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCCTC VEESYPS+E+E LK P + ADG     +KG KV+ PVK++VQKA P IEV
Sbjct  1     MRKWLCCTCHVEESYPSNENEHLKSPKHYADGN----QKGNKVSAPVKSDVQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE +SN EFLTQ
Sbjct  57    PPLSLEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPESNGEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             PRLSEDKVKQCVDPKLKG+YP KGVAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  297   PRLSEDKVKQCVDPKLKGDYPAKGVAKLAAVAALCVQYEAEFRPNMSIVVK  347



>ref|XP_010246425.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X3 [Nelumbo 
nucifera]
Length=370

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/357 (86%), Positives = 329/357 (92%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTC VEE+Y S+E+E LK P N  DG      K +KV+ P KTEVQKA P IEV
Sbjct  1     MRRWLCCTCHVEETYQSNETELLKSPRNHTDGN----HKSSKVSAPSKTEVQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLD+LKE+T+NFGSK+LIGEGSYGRVY+A LN G++VAVKKLDVSSE +SN +FLTQ
Sbjct  57    PALSLDDLKEKTDNFGSKSLIGEGSYGRVYYATLNSGQTVAVKKLDVSSEPESNVDFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKH+NL+ELLGYCVEGN R+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSRLKHDNLIELLGYCVEGNQRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVGAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLL
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLL  353



>ref|XP_007222085.1| hypothetical protein PRUPE_ppa007573mg [Prunus persica]
 gb|EMJ23284.1| hypothetical protein PRUPE_ppa007573mg [Prunus persica]
Length=363

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/351 (87%), Positives = 330/351 (94%), Gaps = 4/351 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCCTC VEESYPS+E+E LK P +  DG     +KG KV+ PVK++VQKA P IEV
Sbjct  1     MRKWLCCTCHVEESYPSNENEHLKSPKHYTDGN----QKGNKVSAPVKSDVQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE +SN EFLTQ
Sbjct  57    PPLSLEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPESNGEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             PRLSEDKVKQCVDPKLKG+YP KGVAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  297   PRLSEDKVKQCVDPKLKGDYPAKGVAKLAAVAALCVQYEAEFRPNMSIVVK  347



>gb|KGN53103.1| hypothetical protein Csa_4G016420 [Cucumis sativus]
Length=480

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/364 (85%), Positives = 331/364 (91%), Gaps = 5/364 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             LS+K RMR+WLCCTCQ+EE+YPS ESE LK P +  DG   R E  T      K+E  K 
Sbjct  112   LSKKDRMRRWLCCTCQIEEAYPSAESEHLKSPRSYGDGHVQRKEAAT-----FKSEAPKT  166

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LNDGK+VAVKKLDVSSE DS+
Sbjct  167   PPPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYASLNDGKAVAVKKLDVSSEPDSS  226

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FLTQVS VS+LKHEN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  227   VDFLTQVSTVSRLKHENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  286

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP +IHRD+RSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  287   VLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDVRSSNVLLFEDFKAKIADFNLSNQAPD  346

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  347   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  406

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  407   LVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  466

Query  1245  PLLK  1256
             PLLK
Sbjct  467   PLLK  470



>ref|XP_004152286.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Cucumis 
sativus]
 ref|XP_004161602.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Cucumis 
sativus]
Length=471

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/364 (85%), Positives = 331/364 (91%), Gaps = 5/364 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             LS+K RMR+WLCCTCQ+EE+YPS ESE LK P +  DG   R E  T      K+E  K 
Sbjct  103   LSKKDRMRRWLCCTCQIEEAYPSAESEHLKSPRSYGDGHVQRKEAAT-----FKSEAPKT  157

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LNDGK+VAVKKLDVSSE DS+
Sbjct  158   PPPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYASLNDGKAVAVKKLDVSSEPDSS  217

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FLTQVS VS+LKHEN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  218   VDFLTQVSTVSRLKHENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  277

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP +IHRD+RSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  278   VLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDVRSSNVLLFEDFKAKIADFNLSNQAPD  337

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  338   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  397

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  398   LVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  457

Query  1245  PLLK  1256
             PLLK
Sbjct  458   PLLK  461



>ref|XP_010557159.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Tarenaya 
hassleriana]
Length=386

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/372 (81%), Positives = 334/372 (90%), Gaps = 4/372 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + +++RMRKW CCTCQ+E+S P +E E LK P + +DG    Y+K  K +   K E+QK 
Sbjct  19    VKKRTRMRKWFCCTCQMEDSNPLNEEENLKSPRHQSDG----YQKNQKPSATAKPEMQKE  74

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+A +NDGK VA+KKLDVS E +++
Sbjct  75    APPIEVPALSLDELKEKTDNFGSKALIGEGSYGRVYYATINDGKVVALKKLDVSPEAETD  134

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFL+QVSMVS+LKHENL++LLGYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  135   VEFLSQVSMVSRLKHENLIQLLGYCVDVNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  194

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW  RVRIAV+AA+GLEYLHEK Q PVIHRDIRSSN+LLFE+FKAKIADFNLSNQAPD
Sbjct  195   TLDWITRVRIAVEAARGLEYLHEKAQSPVIHRDIRSSNILLFEDFKAKIADFNLSNQAPD  254

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
              AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  255   NAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  314

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  315   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  374

Query  1245  PLLKSSAPAPES  1280
             PLLK  AP+PES
Sbjct  375   PLLKPPAPSPES  386



>ref|XP_004140871.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Cucumis 
sativus]
 gb|KGN45983.1| hypothetical protein Csa_6G041190 [Cucumis sativus]
Length=366

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/358 (85%), Positives = 326/358 (91%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCC CQVEE+  S E+E LK P+N  DG      + +KV   VK E QKA   IEV
Sbjct  1     MRKWLCCFCQVEETNQSTENEHLKSPSNFGDGHL----RASKVPAVVKAEAQKAALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE DSN EFLTQ
Sbjct  57    PTLSLEELKEKTDNFGSKALIGEGSYGRVYYATLNNGKNVAVKKLDVSSEPDSNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VS+LKHENLVELLGYCVEGN+R+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   VSTVSRLKHENLVELLGYCVEGNIRVLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVD+AKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAK+ADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDSAKGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKVADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVA LCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVATLCVQYEAEFRPNMSIVVKALQPLLK  354



>ref|XP_008445692.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Cucumis 
melo]
Length=395

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/362 (85%), Positives = 330/362 (91%), Gaps = 4/362 (1%)
 Frame = +3

Query  171   EKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIP  350
             +K RMRKWLCC CQVEE+  S E+E LK P+N  DG      + +KV   VK E QKA  
Sbjct  26    KKVRMRKWLCCFCQVEETNQSTENEHLKNPSNFGDGHL----RDSKVPALVKAEAQKAAL  81

Query  351   SIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAE  530
              IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE DSN E
Sbjct  82    PIEVPTLSLEELKEKTDNFGSKALIGEGSYGRVYYATLNNGKNVAVKKLDVSSEPDSNVE  141

Query  531   FLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTL  710
             FLTQVS VS+LKHENLVELLGYCVEGNLR+LAYE+ATMGSLHD+LHGRKGVQGAQPGP L
Sbjct  142   FLTQVSTVSRLKHENLVELLGYCVEGNLRVLAYEYATMGSLHDVLHGRKGVQGAQPGPVL  201

Query  711   DWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMA  890
             DW QRVRIAVD+AKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAK+ADFNLSNQAPDMA
Sbjct  202   DWMQRVRIAVDSAKGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKVADFNLSNQAPDMA  261

Query  891   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  1070
             ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV
Sbjct  262   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  321

Query  1071  TWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPL  1250
             TWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPL
Sbjct  322   TWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPL  381

Query  1251  LK  1256
             LK
Sbjct  382   LK  383



>ref|XP_009768835.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Nicotiana 
sylvestris]
Length=401

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/372 (83%), Positives = 343/372 (92%), Gaps = 6/372 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             L ++ RMR+WLCCTCQVEESYPS+E+E LK P   ADG    Y+ G++V  P K E +KA
Sbjct  34    LRKRVRMRRWLCCTCQVEESYPSNETEHLKNPATHADG----YQNGSRVPAPAKAEAEKA  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             IP+IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+ANL++ K+VAVKKLDVSSE ++N
Sbjct  90    IPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETN  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FLTQ++ VS+LKH+NLVELLGYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   VDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRV+IAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPD
Sbjct  210   TLDWMQRVKIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDYKAKIADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKV+QCVDPKLKG YP K VAK+AAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVQQCVDPKLKG-YPQKAVAKMAAVAALCVQYESEFRPNMSIVVKALQ  388

Query  1245  PLLKS-SAPAPE  1277
             PLLK+  APAPE
Sbjct  389   PLLKAPPAPAPE  400



>ref|XP_008453953.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Cucumis 
melo]
Length=403

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/360 (85%), Positives = 328/360 (91%), Gaps = 5/360 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             LS++ RMR+WLCCTCQVEE+YPS ESE LK P +  DG   R E     A PVK E  K 
Sbjct  35    LSKRDRMRRWLCCTCQVEEAYPSAESEHLKSPRSYGDGHVQRKE-----AAPVKPEAPKT  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P IEVP LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LNDGK+VAVKKLDVSSE DS+
Sbjct  90    PPPIEVPALSLEELKEKTDNFGSKALIGEGSYGRVYYASLNDGKAVAVKKLDVSSEPDSS  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              +FLTQVS VS+LKHEN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   VDFLTQVSTVSRLKHENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP +IHRD+RSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  210   VLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDVRSSNVLLFEDFKAKIADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  389



>ref|XP_004160815.1| PREDICTED: LOW QUALITY PROTEIN: PTI1-like tyrosine-protein kinase 
3-like [Cucumis sativus]
Length=366

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/358 (85%), Positives = 327/358 (91%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCC CQVEE+  S E+E LK P+N  DG      + +KV   VK E QKA   IEV
Sbjct  1     MRKWLCCXCQVEETNQSTENEHLKSPSNFGDGHL----RASKVPAVVKAEAQKAALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE DSN EFLTQ
Sbjct  57    PTLSLEELKEKTDNFGSKALIGEGSYGRVYYATLNNGKNVAVKKLDVSSEPDSNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VS+LKHENLVELLGYCVEGN+R+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   VSTVSRLKHENLVELLGYCVEGNIRVLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVD+AKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAK+ADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDSAKGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKVADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  354



>ref|XP_009768836.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Nicotiana 
sylvestris]
Length=362

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/366 (84%), Positives = 339/366 (93%), Gaps = 6/366 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEESYPS+E+E LK P   ADG    Y+ G++V  P K E +KAIP+IEV
Sbjct  1     MRRWLCCTCQVEESYPSNETEHLKNPATHADG----YQNGSRVPAPAKAEAEKAIPTIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+ANL++ K+VAVKKLDVSSE ++N +FLTQ
Sbjct  57    PALSLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             ++ VS+LKH+NLVELLGYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   LARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLH
Sbjct  177   RVKIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-  1259
             PRLSEDKV+QCVDPKLKG YP K VAK+AAVAALCVQYE+EFRPNM+IVVKALQPLLK+ 
Sbjct  297   PRLSEDKVQQCVDPKLKG-YPQKAVAKMAAVAALCVQYESEFRPNMSIVVKALQPLLKAP  355

Query  1260  SAPAPE  1277
              APAPE
Sbjct  356   PAPAPE  361



>ref|XP_008445693.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Cucumis 
melo]
 ref|XP_008445694.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Cucumis 
melo]
Length=366

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/358 (85%), Positives = 327/358 (91%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCC CQVEE+  S E+E LK P+N  DG      + +KV   VK E QKA   IEV
Sbjct  1     MRKWLCCFCQVEETNQSTENEHLKNPSNFGDGHL----RDSKVPALVKAEAQKAALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A LN+GK+VAVKKLDVSSE DSN EFLTQ
Sbjct  57    PTLSLEELKEKTDNFGSKALIGEGSYGRVYYATLNNGKNVAVKKLDVSSEPDSNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VS+LKHENLVELLGYCVEGNLR+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   VSTVSRLKHENLVELLGYCVEGNLRVLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVD+AKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAK+ADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVDSAKGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKVADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  354



>ref|XP_009337466.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Pyrus x bretschneideri]
 ref|XP_009337468.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Pyrus x bretschneideri]
 ref|XP_009337469.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Pyrus x bretschneideri]
Length=361

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/351 (85%), Positives = 330/351 (94%), Gaps = 5/351 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEESYPS+E+E LK P +  DG     +KG+KV+ PVK+EVQKA P IEV
Sbjct  1     MRRWLCCACHVEESYPSNENERLKSPNHYGDGN----QKGSKVSAPVKSEVQKAAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P+LS++ELKE+T+NFGSK+LIGEGSYGRVY+A+LNDGK+VAVKKLDV+SE ++N EFLTQ
Sbjct  57    PQLSVEELKEKTDNFGSKSLIGEGSYGRVYYASLNDGKAVAVKKLDVASEPETNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             PRLSEDKVKQCVDPKLK +YP KGVAKLAAVAALCVQYE+EFRPNM+IVVK
Sbjct  297   PRLSEDKVKQCVDPKLK-DYPAKGVAKLAAVAALCVQYESEFRPNMSIVVK  346



>ref|XP_009363662.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Pyrus x bretschneideri]
Length=361

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/351 (85%), Positives = 330/351 (94%), Gaps = 5/351 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCC C VEESYPS+E+E LK P +  DG     +KG+KV+ PVK+EVQKA P IEV
Sbjct  1     MRKWLCCACHVEESYPSNENERLKSPNHYGDGN----QKGSKVSAPVKSEVQKAAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P+LS++ELKE+T+NFGSK+LIGEGSYGRVY+A+L+DGK+VAVKKLDV+SE ++N EFLTQ
Sbjct  57    PQLSVEELKEKTDNFGSKSLIGEGSYGRVYYASLDDGKAVAVKKLDVASEPETNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLVELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSMVSRLKHENLVELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAVEAARGLEYLHEKVQPAIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             PRLSEDKVKQCVDPKLK +YP KGVAKLAAVAALCVQYE+EFRPNM+IVVK
Sbjct  297   PRLSEDKVKQCVDPKLK-DYPAKGVAKLAAVAALCVQYESEFRPNMSIVVK  346



>ref|XP_010557160.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Tarenaya 
hassleriana]
Length=362

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/366 (82%), Positives = 329/366 (90%), Gaps = 4/366 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW CCTCQ+E+S P +E E LK P + +DG    Y+K  K +   K E+QK  P IEV
Sbjct  1     MRKWFCCTCQMEDSNPLNEEENLKSPRHQSDG----YQKNQKPSATAKPEMQKEAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A +NDGK VA+KKLDVS E +++ EFL+Q
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATINDGKVVALKKLDVSPEAETDVEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLGYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLLGYCVDVNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEK Q PVIHRDIRSSN+LLFE+FKAKIADFNLSNQAPD AARLH
Sbjct  177   RVRIAVEAARGLEYLHEKAQSPVIHRDIRSSNILLFEDFKAKIADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK  
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPP  356

Query  1263  APAPES  1280
             AP+PES
Sbjct  357   APSPES  362



>ref|XP_010912131.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Elaeis 
guineensis]
Length=375

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/357 (84%), Positives = 329/357 (92%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQV+E Y +HE+E LK  T+  DG     +KG+K++   K+E QKA P IEV
Sbjct  1     MRRWLCCSCQVDEPYNAHENEYLKSSTDHTDG----MQKGSKLSAVAKSETQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+TENFGSK L+GEGSYGRVYFA L++GK VA+KKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTENFGSKFLVGEGSYGRVYFATLSNGKQVALKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVSKLKHEN++E+LGYCV+GNLR+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSKLKHENVLEMLGYCVQGNLRLLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIA+DAAKGLEYLHEKVQP +IHRDIRSSNVLLFE+F+AKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAIDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFRAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL  353



>gb|KHG02625.1| PTI1-like tyrosine-protein kinase 3 [Gossypium arboreum]
Length=363

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/358 (84%), Positives = 330/358 (92%), Gaps = 5/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+C VE++Y SHE+E L+ P  + +G     +K +K A P K EVQK+ P IEV
Sbjct  1     MRRWLCCSCLVEDTYQSHENEHLRSPNYNTEGN----QKNSKAAAPPKAEVQKSAPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+ANL++GK+VAVKKLD SS+ +SN EFLTQ
Sbjct  57    PALSLEELKEKTDNFGSKALIGEGSYGRVYYANLDNGKAVAVKKLD-SSDAESNVEFLTQ  115

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKH+N VEL GYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  116   VSMVSRLKHDNFVELQGYCVEGNLRMLAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  175

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  176   RVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  235

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  236   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  295

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  296   PRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  353



>ref|XP_008790659.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Phoenix dactylifera]
Length=370

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/362 (82%), Positives = 332/362 (92%), Gaps = 4/362 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQ++E Y +HE+E LK P++  DG     +KG+K++   K+E Q+A P IEV
Sbjct  1     MRRWLCCSCQMDEPYHAHENEYLKSPSDHIDG----MQKGSKLSAVAKSEPQRAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSK L+GEGSYGRVYFA LN+GK VA+KKLDV+SE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKFLVGEGSYGRVYFATLNNGKQVALKKLDVASEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMV+KLKHEN++E+LGYCVEGNLR+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVTKLKHENVLEMLGYCVEGNLRLLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIA+DAAKGLEYLHEKVQP +IHRDIRSSNVLLFE+F+AKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAIDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFRAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL + 
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLINK  356

Query  1263  AP  1268
              P
Sbjct  357   QP  358



>ref|XP_008453954.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Cucumis 
melo]
 ref|XP_008453955.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Cucumis 
melo]
Length=363

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 323/354 (91%), Gaps = 5/354 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCCTCQVEE+YPS ESE LK P +  DG   R E     A PVK E  K  P IEV
Sbjct  1     MRRWLCCTCQVEEAYPSAESEHLKSPRSYGDGHVQRKE-----AAPVKPEAPKTPPPIEV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGSKALIGEGSYGRVY+A+LNDGK+VAVKKLDVSSE DS+ +FLTQ
Sbjct  56    PALSLEELKEKTDNFGSKALIGEGSYGRVYYASLNDGKAVAVKKLDVSSEPDSSVDFLTQ  115

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VS+LKHEN VEL GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  116   VSTVSRLKHENFVELHGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWMQ  175

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP +IHRD+RSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  176   RVRIAVDAARGLEYLHEKVQPSIIHRDVRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  235

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  236   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  295

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  296   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  349



>ref|XP_006397487.1| hypothetical protein EUTSA_v10001469mg [Eutrema salsugineum]
 gb|ESQ38940.1| hypothetical protein EUTSA_v10001469mg [Eutrema salsugineum]
Length=408

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/374 (82%), Positives = 334/374 (89%), Gaps = 5/374 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C V+ESYPS E   LK P T   D  +GR  K  K   PVK  V K
Sbjct  35    IGKRGKMRRWLCCSCHVKESYPSSEHNRLKSPPTRHHD--YGRNNK--KPPAPVKPSVLK  90

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SLDEL+E+T+NFGSKALIGEGSYGRVY+ANLNDGK+VAVKKLD SSE ++
Sbjct  91    EPPPIDVPAMSLDELREKTDNFGSKALIGEGSYGRVYYANLNDGKAVAVKKLDNSSEPET  150

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N V+LLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  151   NVEFLTQVSKVSRLKNDNFVQLLGYCVQGNLRVLAYEFATMGSLHDILHGRKGVQGAQPG  210

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE+F+AKIADFNLSNQAP
Sbjct  211   PTLEWMQRVRVAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEDFEAKIADFNLSNQAP  270

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  271   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  330

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  331   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  390

Query  1242  QPLLKSSAPAPESP  1283
             QPLL+SS  A   P
Sbjct  391   QPLLRSSGTASAHP  404



>ref|XP_008802372.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Phoenix dactylifera]
 ref|XP_008802373.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Phoenix dactylifera]
Length=370

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/357 (83%), Positives = 328/357 (92%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQV+E Y +HE+E LK  T+  DG     +KG+K++   K+E QKA P IEV
Sbjct  1     MRRWLCCSCQVDEPYDAHENEYLKNSTDHTDG----MQKGSKLSAVAKSETQKAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+TENFGSK L+GEGSYGRVY A LN+GK VA+KKLDVSSE +SN EFLTQ
Sbjct  57    PALSLDELKEKTENFGSKFLVGEGSYGRVYLAILNNGKQVALKKLDVSSEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVSKLKHEN++E++GYCV+GNLR+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   VSMVSKLKHENVLEMVGYCVQGNLRLLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIA+DAAKGL+YLHEKVQP +IHRDIRSSNVLLFE+F+AKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAIDAAKGLDYLHEKVQPSIIHRDIRSSNVLLFEDFRAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL  353



>ref|XP_002876497.1| hypothetical protein ARALYDRAFT_486400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52756.1| hypothetical protein ARALYDRAFT_486400 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/369 (82%), Positives = 327/369 (89%), Gaps = 4/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P +  D  FG + +  + A  VK +  K 
Sbjct  34    IGKREKMRRWLCCACHVEEPYHSSENEHLRSPKHHND--FGHHTRKPQAA--VKPDALKE  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD S+E +SN
Sbjct  90    PPSIDVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNSAEPESN  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   VEFLTQVSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  210   TLDWIQRVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  389

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  390   PLLRSSTAA  398



>ref|XP_002880033.1| hypothetical protein ARALYDRAFT_483429 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56292.1| hypothetical protein ARALYDRAFT_483429 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/374 (81%), Positives = 334/374 (89%), Gaps = 6/374 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C+V+ESYP+ E   LK P T   D  +GR  K  K   PVK  V K
Sbjct  34    IGKRGKMRRWLCCSCRVQESYPTAEHNRLKTPPTRHYD--YGRNNK--KAPAPVKPPVLK  89

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SL ELKE+T+NFGSKALIGEGSYGRVY+AN NDGK+VAVKKLD SSE ++
Sbjct  90    EPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNSSEPET  149

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK +N V+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  150   NVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPG  209

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQPPVIHRDIRSSNVL+FE+FKAKIADFNLSNQAP
Sbjct  210   PTLEWMQRVRVAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLIFEDFKAKIADFNLSNQAP  269

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  270   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  329

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  330   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  389

Query  1242  QPLLKS-SAPAPES  1280
             QPLL+S +A AP +
Sbjct  390   QPLLRSATAVAPPT  403



>ref|XP_010512186.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Camelina 
sativa]
Length=408

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/369 (81%), Positives = 329/369 (89%), Gaps = 4/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P ++ D  +G + + T+ A  VK +  K 
Sbjct  37    IGKREKMRRWLCCACHVEEPYHSPENEHLRIPKHNHD--YGNHNRKTQAA--VKPDALKE  92

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  93    PPSIDVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNTAEPESN  152

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  153   VEFLTQVSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGP  212

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  213   TLDWIQRVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  272

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  273   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  332

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  333   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  392

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  393   PLLRSSTTA  401



>ref|XP_010413706.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Camelina 
sativa]
 ref|XP_010469344.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Camelina 
sativa]
Length=408

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/369 (82%), Positives = 328/369 (89%), Gaps = 4/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P ++ D  +G + + T  A  VK +  K 
Sbjct  37    IGKREKMRRWLCCACHVEEPYHSPENEHLRIPKHNHD--YGNHNRKTPAA--VKPDALKE  92

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD S+E +SN
Sbjct  93    PPSIDVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNSAEPESN  152

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  153   VEFLTQVSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGP  212

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  213   TLDWIQRVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  272

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  273   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  332

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  333   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  392

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  393   PLLRSSTTA  401



>ref|XP_010930922.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Elaeis guineensis]
Length=369

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/357 (82%), Positives = 327/357 (92%), Gaps = 4/357 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQ++E Y +H++E LK P++  DG     +KG+K++   K+E Q+A P IEV
Sbjct  1     MRRWLCCSCQMDEPYHAHDNEYLKSPSDHIDG----MQKGSKLSAVAKSETQRAPPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSK L+GEGSYGRVYFA LN GK VA+KKLD +SE +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKFLVGEGSYGRVYFATLNSGKQVALKKLDAASEPESNNEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             +S VSK+KHEN++E+LGYCVEGNLR+LAYE+ATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  117   ISTVSKVKHENVLEMLGYCVEGNLRLLAYEYATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIA+DAAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  177   RVRIAIDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PL+
Sbjct  297   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLV  353



>ref|XP_010524132.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Tarenaya 
hassleriana]
Length=402

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/406 (75%), Positives = 342/406 (84%), Gaps = 11/406 (3%)
 Frame = +3

Query  78    GNYHLSDLPGTCVSSWLLFTIGEHKLI--F*LSEKSRMRKWLCCTCQVEESYPSHESEAL  251
             G+YH   L     S      + + + +    + ++ +MR+WLCC   +EE Y S E E+L
Sbjct  3     GDYHRRGLVANERSPTYFVRLDKPRAVDDLYIGKREKMRRWLCCARHIEEPYHSAEHESL  62

Query  252   KGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGE  431
             K P +  DG + R     K   PVK +V K  P I+VP+LSLDELKE+T+NFGSKALIGE
Sbjct  63    KSPRHHNDG-YAR-----KPPAPVKPDVLKEPPPIDVPKLSLDELKEKTDNFGSKALIGE  116

Query  432   GSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGN  611
             GSYGRVY+ANL+D K+VAVKKLD S+E +SN EFLTQ+S VSKLKHEN V+LLGYCVEGN
Sbjct  117   GSYGRVYYANLDDAKAVAVKKLDNSAEPESNVEFLTQISRVSKLKHENCVQLLGYCVEGN  176

Query  612   LRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPV  791
              R+L YEFATMGSLHDILHGRKGVQGAQPGPTL+W QRVRIAVDAA+GLEYLHEKVQPP+
Sbjct  177   NRVLVYEFATMGSLHDILHGRKGVQGAQPGPTLEWMQRVRIAVDAARGLEYLHEKVQPPI  236

Query  792   IHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQ  971
             IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQ
Sbjct  237   IHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQ  296

Query  972   KSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppk  1151
             KSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKL+G YPPK
Sbjct  297   KSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLQGNYPPK  356

Query  1152  gvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK---SSAPAPES  1280
              V+KLAAVAALCVQYEAEFRPNM+IVVKALQPLL+   ++ PAPE+
Sbjct  357   AVSKLAAVAALCVQYEAEFRPNMSIVVKALQPLLRPPSTAVPAPET  402



>emb|CAB91605.1| protein kinase-like protein [Arabidopsis thaliana]
Length=403

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 327/369 (89%), Gaps = 4/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P +  D  FG + +  + A  VK +  K 
Sbjct  32    IGKREKMRRWLCCACHVEEPYHSSENEHLRSPKHHND--FGHHTRKPQAA--VKPDALKE  87

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  88    PPSIDVPALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESN  147

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  148   VEFLTQVSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGP  207

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  208   TLDWIQRVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  267

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  268   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  327

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  328   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  387

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  388   PLLRSSTAA  396



>ref|XP_006858642.1| hypothetical protein AMTR_s00066p00048730 [Amborella trichopoda]
 gb|ERN20109.1| hypothetical protein AMTR_s00066p00048730 [Amborella trichopoda]
Length=404

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/368 (80%), Positives = 329/368 (89%), Gaps = 4/368 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             LS+K RMR+WLCCTC +E+SY   +++ LK P +  DG     +KG+K +TP      + 
Sbjct  34    LSKKERMRRWLCCTCSIEDSYKQADNDYLKSPNDLTDGN----QKGSKQSTPANGGDIQK  89

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             +P IEVP L L+ELKE+T+NFGS++LIGEGSYGRVY+A L++GK+VA+KKLDVS+E + N
Sbjct  90    VPPIEVPALPLEELKEKTDNFGSRSLIGEGSYGRVYYATLDNGKAVAIKKLDVSNEPEPN  149

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVSMVS LKH+N+VELLGYCVEGN R+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  150   TEFLTQVSMVSSLKHDNVVELLGYCVEGNFRVLAYEFATMGSLHDILHGRKGVQGAQPGP  209

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFEEFKAKIADFNLSNQAPD
Sbjct  210   VLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  269

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  270   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  329

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYE++FRPNM+IVVKALQ
Sbjct  330   LVTWATPRLSEDKVKQCVDPKLKGEYPPKGVAKLAAVAALCVQYESDFRPNMSIVVKALQ  389

Query  1245  PLLKSSAP  1268
             PLL    P
Sbjct  390   PLLTPKPP  397



>ref|NP_567082.2| PTI1-like tyrosine-protein kinase 3 [Arabidopsis thaliana]
 ref|NP_001030893.1| PTI1-like tyrosine-protein kinase 3 [Arabidopsis thaliana]
 sp|B9DFG5.1|PTI13_ARATH RecName: Full=PTI1-like tyrosine-protein kinase 3; Short=PTI1-3 
[Arabidopsis thaliana]
 dbj|BAH19482.1| AT3G59350 [Arabidopsis thaliana]
 gb|AEE79908.1| PTI1-like tyrosine-protein kinase 3 [Arabidopsis thaliana]
 gb|AEE79910.1| PTI1-like tyrosine-protein kinase 3 [Arabidopsis thaliana]
Length=408

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 327/369 (89%), Gaps = 4/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P +  D  FG + +  + A  VK +  K 
Sbjct  37    IGKREKMRRWLCCACHVEEPYHSSENEHLRSPKHHND--FGHHTRKPQAA--VKPDALKE  92

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  93    PPSIDVPALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESN  152

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  153   VEFLTQVSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGP  212

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  213   TLDWIQRVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  272

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  273   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  332

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  333   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  392

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  393   PLLRSSTAA  401



>ref|XP_010512187.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Camelina 
sativa]
Length=366

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/363 (83%), Positives = 325/363 (90%), Gaps = 4/363 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y S E+E L+ P ++ D  +G + + T+ A  VK +  K  PSI+V
Sbjct  1     MRRWLCCACHVEEPYHSPENEHLRIPKHNHD--YGNHNRKTQAA--VKPDALKEPPSIDV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNTAEPESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+SS
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSS  356

Query  1263  APA  1271
               A
Sbjct  357   TTA  359



>ref|XP_010413708.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Camelina 
sativa]
 ref|XP_010469345.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Camelina 
sativa]
Length=366

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/363 (83%), Positives = 324/363 (89%), Gaps = 4/363 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y S E+E L+ P ++ D  +G + + T  A  VK +  K  PSI+V
Sbjct  1     MRRWLCCACHVEEPYHSPENEHLRIPKHNHD--YGNHNRKTPAA--VKPDALKEPPSIDV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD S+E +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNSAEPESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+SS
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSS  356

Query  1263  APA  1271
               A
Sbjct  357   TTA  359



>ref|NP_565995.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAK96724.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAC64312.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAN15472.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC10232.1| putative protein kinase [Arabidopsis thaliana]
Length=406

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/376 (81%), Positives = 335/376 (89%), Gaps = 6/376 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C+V+ESYPS E+  LK P T   D  +GR  K  K   PVK  V K
Sbjct  34    IGKRGKMRRWLCCSCRVQESYPSAENNRLKTPPTRHYD--YGRNNK--KTPAPVKPPVLK  89

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SL ELKE+T+NFGSKALIGEGSYGRVY+AN NDGK+VAVKKLD +SE ++
Sbjct  90    EPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPET  149

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK +N V+LLGYCVEGNLR+LAYEFATM SLHDILHGRKGVQGAQPG
Sbjct  150   NVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPG  209

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVL+FE+FKAKIADFNLSNQAP
Sbjct  210   PTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAP  269

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  270   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  329

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  330   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  389

Query  1242  QPLLKS-SAPAPESPE  1286
             QPLL+S +A AP +P+
Sbjct  390   QPLLRSATAAAPPTPQ  405



>ref|NP_001189740.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC10233.1| putative protein kinase [Arabidopsis thaliana]
Length=440

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/376 (81%), Positives = 335/376 (89%), Gaps = 6/376 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C+V+ESYPS E+  LK P T   D  +GR  K  K   PVK  V K
Sbjct  68    IGKRGKMRRWLCCSCRVQESYPSAENNRLKTPPTRHYD--YGRNNK--KTPAPVKPPVLK  123

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SL ELKE+T+NFGSKALIGEGSYGRVY+AN NDGK+VAVKKLD +SE ++
Sbjct  124   EPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPET  183

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK +N V+LLGYCVEGNLR+LAYEFATM SLHDILHGRKGVQGAQPG
Sbjct  184   NVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPG  243

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVL+FE+FKAKIADFNLSNQAP
Sbjct  244   PTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAP  303

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  304   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  363

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  364   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  423

Query  1242  QPLLKS-SAPAPESPE  1286
             QPLL+S +A AP +P+
Sbjct  424   QPLLRSATAAAPPTPQ  439



>ref|XP_010524133.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Tarenaya 
hassleriana]
Length=363

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 328/369 (89%), Gaps = 9/369 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC   +EE Y S E E+LK P +  DG + R     K   PVK +V K  P I+V
Sbjct  1     MRRWLCCARHIEEPYHSAEHESLKSPRHHNDG-YAR-----KPPAPVKPDVLKEPPPIDV  54

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P+LSLDELKE+T+NFGSKALIGEGSYGRVY+ANL+D K+VAVKKLD S+E +SN EFLTQ
Sbjct  55    PKLSLDELKEKTDNFGSKALIGEGSYGRVYYANLDDAKAVAVKKLDNSAEPESNVEFLTQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             +S VSKLKHEN V+LLGYCVEGN R+L YEFATMGSLHDILHGRKGVQGAQPGPTL+W Q
Sbjct  115   ISRVSKLKHENCVQLLGYCVEGNNRVLVYEFATMGSLHDILHGRKGVQGAQPGPTLEWMQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQPP+IHRDIRSSNVLLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  175   RVRIAVDAARGLEYLHEKVQPPIIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK--  1256
             PRLSEDKVKQCVDPKL+G YPPK V+KLAAVAALCVQYEAEFRPNM+IVVKALQPLL+  
Sbjct  295   PRLSEDKVKQCVDPKLQGNYPPKAVSKLAAVAALCVQYEAEFRPNMSIVVKALQPLLRPP  354

Query  1257  -SSAPAPES  1280
              ++ PAPE+
Sbjct  355   STAVPAPET  363



>gb|KHG05761.1| PTI1-like tyrosine-protein kinase 3 [Gossypium arboreum]
Length=363

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/363 (81%), Positives = 329/363 (91%), Gaps = 7/363 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+CQVEE+Y S E+E LK     +DG    ++K +KV +P+K E +K+   IEV
Sbjct  1     MRRWLCCSCQVEENYQSRENEHLKC---TSDG----HQKNSKVVSPIKPEERKSSSLIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE+T+NFGS ALIGEGSYGRVY+ANLNDGK++AVKKLDVS+E + N EFLTQ
Sbjct  54    PALSLEELKEKTDNFGSNALIGEGSYGRVYYANLNDGKTLAVKKLDVSAEPEPNVEFLTQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN VEL GYC++GN+R+LAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  114   VSMVSRLKHENFVELQGYCIDGNIRLLAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIA+DAA+GLEYLHE VQP VIHRD+RSSNVL+FEEFKAKIADFN+SNQ+PDMAARLH
Sbjct  174   RVRIAIDAARGLEYLHEMVQPSVIHRDVRSSNVLIFEEFKAKIADFNISNQSPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVK+CVDP LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM IVVKALQPLLK+ 
Sbjct  294   PRLSEDKVKECVDPNLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMGIVVKALQPLLKAQ  353

Query  1263  APA  1271
              PA
Sbjct  354   TPA  356



>ref|NP_850720.1| PTI1-like tyrosine-protein kinase 3 [Arabidopsis thaliana]
 gb|AAK96830.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP37808.1| At3g59350 [Arabidopsis thaliana]
 gb|AEE79909.1| PTI1-like tyrosine-protein kinase 3 [Arabidopsis thaliana]
Length=366

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/363 (82%), Positives = 323/363 (89%), Gaps = 4/363 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y S E+E L+ P +  D  FG + +  + A  VK +  K  PSI+V
Sbjct  1     MRRWLCCACHVEEPYHSSENEHLRSPKHHND--FGHHTRKPQAA--VKPDALKEPPSIDV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+SS
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSS  356

Query  1263  APA  1271
               A
Sbjct  357   TAA  359



>ref|XP_006294330.1| hypothetical protein CARUB_v10023337mg [Capsella rubella]
 gb|EOA27228.1| hypothetical protein CARUB_v10023337mg [Capsella rubella]
Length=406

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/367 (82%), Positives = 331/367 (90%), Gaps = 5/367 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C+V+ESYPS +   L+ P T   D  +GR  K  K   PVK  V K
Sbjct  34    IGKRGKMRRWLCCSCRVQESYPSADHNRLRTPPTRHHD--YGRNNK--KTPAPVKPPVLK  89

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP + L ELKE+TENFGSKALIGEGSYGRVY+A+L+DGK++AVKKLD +SE ++
Sbjct  90    EPPPIDVPAMPLAELKEKTENFGSKALIGEGSYGRVYYASLDDGKAMAVKKLDNASEPET  149

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N VELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  150   NVEFLTQVSKVSRLKNDNFVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPG  209

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE+FKAKIADFNLSNQAP
Sbjct  210   PTLEWMQRVRVAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEDFKAKIADFNLSNQAP  269

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  270   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  329

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  330   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  389

Query  1242  QPLLKSS  1262
             QPLL+SS
Sbjct  390   QPLLRSS  396



>ref|XP_006291084.1| hypothetical protein CARUB_v10017200mg [Capsella rubella]
 gb|EOA23982.1| hypothetical protein CARUB_v10017200mg [Capsella rubella]
Length=366

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/363 (82%), Positives = 323/363 (89%), Gaps = 4/363 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y S E+E L+ P ++    +G + + T  A  VK +  K  PSI+V
Sbjct  1     MRRWLCCACHVEEPYHSPENEHLRSPKHN--NGYGHHNRKTPAA--VKPDALKEPPSIDV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD S+E +SN EFLTQ
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNSAEPESNVEFLTQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  117   VSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  177   RVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+SS
Sbjct  297   PRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSS  356

Query  1263  APA  1271
               A
Sbjct  357   TTA  359



>ref|XP_010517880.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Camelina sativa]
Length=406

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/374 (80%), Positives = 329/374 (88%), Gaps = 5/374 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C V+ESYPS E   L+ P T   D  +GR  K  K   PVK  V K
Sbjct  34    IGKRGKMRRWLCCSCHVQESYPSSEHNRLRTPPTRHQD--YGRNNK--KTPAPVKPPVLK  89

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SL ELKE+TENFGSKALIGEGSYGRVY+A+ NDG ++AVKKLD +SE ++
Sbjct  90    EPPPIDVPAMSLAELKEKTENFGSKALIGEGSYGRVYYASSNDGNAMAVKKLDNASEPET  149

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N V+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  150   NVEFLTQVSKVSRLKNDNFVQLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPG  209

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQAP
Sbjct  210   PTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQAP  269

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHS RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  270   DMAARLHSIRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  329

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  330   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  389

Query  1242  QPLLKSSAPAPESP  1283
             QPLL+SS  A   P
Sbjct  390   QPLLRSSVTAAAPP  403



>ref|XP_009393524.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/357 (82%), Positives = 324/357 (91%), Gaps = 6/357 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+C V+ESY +HE+E LK PTNDADG      KG+K +   K+E  KA P IEV
Sbjct  1     MRRWLCCSCHVDESYQAHENEYLKSPTNDADG-----HKGSKYSAAPKSEAPKAPPPIEV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ L E+T++FGSK+L+GEGSYGRVYFA L++GK VAVKKLD SSE D++AEFLTQ
Sbjct  56    PMLSLEVLNEKTDSFGSKSLVGEGSYGRVYFAVLDNGKQVAVKKLDTSSE-DNSAEFLTQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN VE+LGYCVEGN+R+LAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  115   VSMVSRLKHENFVEMLGYCVEGNMRLLAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEK QP +IHRDIRSSN+LLF++F+AKIADFNL NQAPDMAARLH
Sbjct  175   RVRIAVDAAKGLEYLHEKFQPSIIHRDIRSSNILLFDDFRAKIADFNLLNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRLSEDKVKQCVDP+LKG+YP KGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL
Sbjct  295   PRLSEDKVKQCVDPRLKGDYPAKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL  351



>ref|XP_010508455.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Camelina sativa]
Length=406

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/374 (80%), Positives = 330/374 (88%), Gaps = 5/374 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C V+ESYPS E   L+ P T   D  +GR  K  K   PVK  V K
Sbjct  34    IGKRGKMRRWLCCSCHVQESYPSSEHNRLRTPPTRHQD--YGRNNK--KTPAPVKPPVLK  89

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SL ELKE+T NFGSKALIGEGSYGRVY+A+ NDG ++AVKKLD +SE ++
Sbjct  90    EPPPIDVPAMSLAELKEKTGNFGSKALIGEGSYGRVYYASSNDGNAMAVKKLDNASEPET  149

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N V+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  150   NVEFLTQVSKVSRLKNDNFVQLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPG  209

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQAP
Sbjct  210   PTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQAP  269

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  270   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  329

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  330   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  389

Query  1242  QPLLKSSAPAPESP  1283
             QPLL+SSA A   P
Sbjct  390   QPLLRSSATAVAPP  403



>ref|XP_006291083.1| hypothetical protein CARUB_v10017200mg [Capsella rubella]
 gb|EOA23981.1| hypothetical protein CARUB_v10017200mg [Capsella rubella]
Length=460

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 327/369 (89%), Gaps = 4/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P ++    +G + + T  A  VK +  K 
Sbjct  89    IGKREKMRRWLCCACHVEEPYHSPENEHLRSPKHN--NGYGHHNRKTPAA--VKPDALKE  144

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD S+E +SN
Sbjct  145   PPSIDVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNSAEPESN  204

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  205   VEFLTQVSRVSKLKHDNFVELFGYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGP  264

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  265   TLDWIQRVRIAVDAARGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  324

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  325   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  384

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  385   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  444

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  445   PLLRSSTTA  453



>ref|XP_010506183.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Camelina sativa]
Length=406

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/373 (80%), Positives = 329/373 (88%), Gaps = 3/373 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC+C+V+ES+PS E   L+ P       +GR  K  K   PVK  V K 
Sbjct  34    IGKRGKMRRWLCCSCRVQESHPSSEHNRLRTPPT-LHQDYGRNNK--KTPAPVKPPVLKE  90

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P I+VP +SL ELKE+TENFGSKALIGEGSYGRVY+A+ NDG ++AVKKLD +SE ++N
Sbjct  91    PPPIDVPAMSLAELKEKTENFGSKALIGEGSYGRVYYASSNDGNAMAVKKLDNASEPETN  150

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VS+LK++N V+LLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  151   VEFLTQVSKVSRLKNDNFVQLLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGP  210

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQAPD
Sbjct  211   TLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQAPD  270

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  271   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  330

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  331   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  390

Query  1245  PLLKSSAPAPESP  1283
             PLL+SS  A   P
Sbjct  391   PLLRSSVTAAAPP  403



>ref|XP_006402698.1| hypothetical protein EUTSA_v10006024mg [Eutrema salsugineum]
 gb|ESQ44151.1| hypothetical protein EUTSA_v10006024mg [Eutrema salsugineum]
Length=396

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/369 (81%), Positives = 322/369 (87%), Gaps = 5/369 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P +  D     Y    K    VK +  K 
Sbjct  26    IGKREKMRRWLCCACHVEEPYHSSENEHLRSPKHHND-----YGLNKKPQVAVKPDALKE  80

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DGK+VAVKKLD S+E +SN
Sbjct  81    PPSIDVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGKAVAVKKLDNSAEPESN  140

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKLKH+N VEL GYCVEG+ RILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  141   VEFLTQVSRVSKLKHDNFVELFGYCVEGSFRILAYEFATMGSLHDILHGRKGVQGAQPGP  200

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEK QP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  201   TLDWIQRVRIAVDAARGLEYLHEKAQPGVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  260

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  261   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  320

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  321   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  380

Query  1245  PLLKSSAPA  1271
             PLL+SS  A
Sbjct  381   PLLRSSTAA  389



>ref|XP_010522046.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Tarenaya hassleriana]
 ref|XP_010522047.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Tarenaya hassleriana]
Length=362

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/354 (83%), Positives = 318/354 (90%), Gaps = 4/354 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKWLCCTCQ+E+S PS+E E LK P +  DG    Y+K  K +   K EV    P IEV
Sbjct  1     MRKWLCCTCQIEDSNPSNEEEHLKSPRHQPDG----YQKNQKPSAVAKAEVPNESPPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGRVY+A LNDGK VA+KKLDVS E +++ EFL+Q
Sbjct  57    PALSLDELKEKTDNFGSKALIGEGSYGRVYYATLNDGKVVALKKLDVSPEAETDVEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLE LHEK QP VIHRDIRSSNVLLFE+FKAKIADFNLSNQAPD AARLH
Sbjct  177   RVRIAVEAARGLESLHEKAQPSVIHRDIRSSNVLLFEDFKAKIADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQ
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQ  350



>ref|XP_009116593.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Brassica 
rapa]
Length=402

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/369 (80%), Positives = 324/369 (88%), Gaps = 7/369 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+ P +  D       K  K    VK +V K 
Sbjct  34    IGKRGKMRRWLCCVCHVEEPYHSPENEHLRSPKDYND-------KDKKPQAAVKPDVLKE  86

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P+I+VP LSLDELKE+T+NFGSK LIGEGSYGR Y+A L DGK+VA+KKLD ++E +SN
Sbjct  87    PPAIDVPALSLDELKEKTDNFGSKVLIGEGSYGRAYYATLEDGKAVAIKKLDNAAEPESN  146

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKL++EN V+L GYCVEGNLRILAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  147   FEFLTQVSRVSKLRNENFVQLFGYCVEGNLRILAYEFATMGSLHDVLHGRKGVQGAQPGP  206

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAAKGLEYLHEKVQP VIHRD+RSSNVLLFEEFKAKIADFNLSNQ+PD
Sbjct  207   ALDWIQRVRIAVDAAKGLEYLHEKVQPAVIHRDVRSSNVLLFEEFKAKIADFNLSNQSPD  266

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  267   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  326

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  327   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  386

Query  1245  PLLKSSAPA  1271
             PLL+S+ PA
Sbjct  387   PLLRSATPA  395



>emb|CDY00615.1| BnaC04g23100D [Brassica napus]
Length=407

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/370 (81%), Positives = 326/370 (88%), Gaps = 5/370 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y + E+E L+ P +  D  +G Y K   VA  +K    K 
Sbjct  37    IGKREKMRRWLCCACHVEEPYHASENEHLRSPKHHID--YG-YNKRAPVA--LKPAALKE  91

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  92    PPSIDVPALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESN  151

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKL HEN V+L GYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  152   IEFLTQVSRVSKLHHENFVQLFGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  211

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  212   TLDWIQRVRIAVDAARGLEYLHEKVQPVVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  271

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  272   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  331

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  332   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  391

Query  1245  PLLKSSAPAP  1274
             PLL+SS   P
Sbjct  392   PLLRSSTAVP  401



>ref|XP_009116595.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Brassica 
rapa]
 ref|XP_009116596.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Brassica 
rapa]
 ref|XP_009116597.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Brassica 
rapa]
Length=363

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/363 (81%), Positives = 320/363 (88%), Gaps = 7/363 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y S E+E L+ P +  D       K  K    VK +V K  P+I+V
Sbjct  1     MRRWLCCVCHVEEPYHSPENEHLRSPKDYND-------KDKKPQAAVKPDVLKEPPAIDV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSK LIGEGSYGR Y+A L DGK+VA+KKLD ++E +SN EFLTQ
Sbjct  54    PALSLDELKEKTDNFGSKVLIGEGSYGRAYYATLEDGKAVAIKKLDNAAEPESNFEFLTQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKL++EN V+L GYCVEGNLRILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  114   VSRVSKLRNENFVQLFGYCVEGNLRILAYEFATMGSLHDVLHGRKGVQGAQPGPALDWIQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEKVQP VIHRD+RSSNVLLFEEFKAKIADFNLSNQ+PDMAARLH
Sbjct  174   RVRIAVDAAKGLEYLHEKVQPAVIHRDVRSSNVLLFEEFKAKIADFNLSNQSPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+S+
Sbjct  294   PRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSA  353

Query  1263  APA  1271
              PA
Sbjct  354   TPA  356



>ref|XP_009138918.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Brassica 
rapa]
Length=407

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/370 (80%), Positives = 326/370 (88%), Gaps = 5/370 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y + E+E L+ P +  D  +G Y K   VA  +K    K 
Sbjct  37    IGKREKMRRWLCCACHVEEPYHASENEHLRSPKHHID--YG-YNKRAPVA--LKPAALKE  91

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  92    PPSIDVPALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESN  151

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKL H+N V+L GYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  152   IEFLTQVSRVSKLHHDNFVQLFGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  211

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  212   TLDWIQRVRIAVDAARGLEYLHEKVQPVVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  271

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  272   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  331

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  332   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  391

Query  1245  PLLKSSAPAP  1274
             PLL+SS   P
Sbjct  392   PLLRSSTAVP  401



>ref|XP_009383811.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383812.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383813.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383814.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/357 (81%), Positives = 322/357 (90%), Gaps = 5/357 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+C ++ESY ++E+E  K PTND DG      +G+K +   K+E  KA P IEV
Sbjct  4     MRRWLCCSCHLDESYHAYENEYKKSPTNDTDGP----HRGSKYSAAPKSETAKAPPPIEV  59

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSL+ELKE  +NFGSK+L+GEGSYGRVYFA LN+GK +AVKKLD SSE D++ EFLTQ
Sbjct  60    PALSLEELKETIDNFGSKSLVGEGSYGRVYFAVLNNGKQIAVKKLDTSSE-DNSTEFLTQ  118

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN VE+LGYCVEGN+R+L YEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  119   VSMVSRLKHENFVEILGYCVEGNMRLLGYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  178

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEKV+P ++HRDIRSSNVLLFE+F+AKIADFNLSNQAPDMAARLH
Sbjct  179   RVRIAVDAAKGLEYLHEKVRPSIVHRDIRSSNVLLFEDFRAKIADFNLSNQAPDMAARLH  238

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  239   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  298

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRLSEDKVKQC+DP+LKG+YP KGVAKLAAVAALCVQYEAEFRPNM+IV+KAL PLL
Sbjct  299   PRLSEDKVKQCIDPRLKGDYPSKGVAKLAAVAALCVQYEAEFRPNMSIVMKALSPLL  355



>emb|CDY06011.1| BnaA09g37690D [Brassica napus]
Length=403

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/369 (80%), Positives = 324/369 (88%), Gaps = 6/369 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L+    D +      +K  K    VK +V K 
Sbjct  34    IGKRGKMRRWLCCVCHVEEPYHSPENEHLRRSPKDYN------DKDKKPQAAVKPDVLKE  87

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P+I+VP LSLDELKE+T+NFGSK LIGEGSYGR Y+A L DGK+VA+KKLD ++E +SN
Sbjct  88    PPAIDVPALSLDELKEKTDNFGSKVLIGEGSYGRAYYATLEDGKAVAIKKLDNAAEPESN  147

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKL++EN V+L GYCVEGNLRILAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  148   FEFLTQVSRVSKLRNENFVQLFGYCVEGNLRILAYEFATMGSLHDVLHGRKGVQGAQPGP  207

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAAKGLEYLHEKVQP VIHRD+RSSNVLLFEEFKAKIADFNLSNQ+PD
Sbjct  208   ALDWIQRVRIAVDAAKGLEYLHEKVQPAVIHRDVRSSNVLLFEEFKAKIADFNLSNQSPD  267

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  268   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  327

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  328   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  387

Query  1245  PLLKSSAPA  1271
             PLL+S+ PA
Sbjct  388   PLLRSATPA  396



>emb|CDY57492.1| BnaC08g48860D [Brassica napus]
Length=400

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/374 (79%), Positives = 322/374 (86%), Gaps = 9/374 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y S E+E L  P    D          K    VK +V K 
Sbjct  34    IGKRGKMRRWLCCVCHVEEPYHSPENEHLSSPKRYND---------KKPQAAVKPDVLKE  84

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              P+I+VP LSLDELKE+T NFGSK LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  85    PPAIDVPALSLDELKEKTANFGSKVLIGEGSYGRAYYATLEDGKAVAVKKLDNAAEPESN  144

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKL++EN V+L GYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  145   FEFLTQVSRVSKLRNENFVQLFGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPGP  204

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
              LDW QRVRIAVDAAKGLEYLHEKVQP VIHRD+RSSNVLLFEEFKAKIADFNLSNQ+PD
Sbjct  205   ALDWIQRVRIAVDAAKGLEYLHEKVQPAVIHRDVRSSNVLLFEEFKAKIADFNLSNQSPD  264

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  265   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  324

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  325   LVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  384

Query  1245  PLLKSSAPAPESPE  1286
             PLL+SS PA   P+
Sbjct  385   PLLRSSTPAATPPQ  398



>ref|XP_010695320.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=407

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/361 (83%), Positives = 325/361 (90%), Gaps = 9/361 (2%)
 Frame = +3

Query  177   SRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQK-AIPS  353
             SRMRKWLCCTCQVEESYPS+E E LK P  +      R  K  K  T VK +VQK A P 
Sbjct  38    SRMRKWLCCTCQVEESYPSNE-EPLKSPNTE------RALKSQKSQTLVKEDVQKTAPPP  90

Query  354   IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEF  533
             IEV  LSLDELKE+T+NFGSK+LIGEGSYGRVY+A L +GK+VAVKKLDVS E +SN+EF
Sbjct  91    IEVSALSLDELKEKTDNFGSKSLIGEGSYGRVYYATLENGKAVAVKKLDVSQEPESNSEF  150

Query  534   LTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLD  713
             LTQVS VS+LKHEN+VEL GYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQPGP LD
Sbjct  151   LTQVSRVSRLKHENIVELQGYCVEGNMRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLD  210

Query  714   WTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAA  893
             W QRVRIAVDAA+GLEYLHEK+QP +IHRD+RSSNVLLFE+F+AKIADFNLSNQAPDMAA
Sbjct  211   WMQRVRIAVDAARGLEYLHEKIQPCIIHRDVRSSNVLLFEDFRAKIADFNLSNQAPDMAA  270

Query  894   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  1073
             RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT
Sbjct  271   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  330

Query  1074  WATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             WATPRLSEDKVKQCVDP+LK +YP KGVAKLAAVAALCVQYE EFRPNM+IVVKALQPLL
Sbjct  331   WATPRLSEDKVKQCVDPRLK-DYPAKGVAKLAAVAALCVQYEGEFRPNMSIVVKALQPLL  389

Query  1254  K  1256
             K
Sbjct  390   K  390



>ref|XP_009138919.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Brassica 
rapa]
Length=365

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/364 (82%), Positives = 322/364 (88%), Gaps = 5/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y + E+E L+ P +  D  +G Y K   VA  +K    K  PSI+V
Sbjct  1     MRRWLCCACHVEEPYHASENEHLRSPKHHID--YG-YNKRAPVA--LKPAALKEPPSIDV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN EFLTQ
Sbjct  56    PALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESNIEFLTQ  115

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKL H+N V+L GYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW Q
Sbjct  116   VSRVSKLHHDNFVQLFGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQ  175

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  176   RVRIAVDAARGLEYLHEKVQPVVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  235

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  236   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  295

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+SS
Sbjct  296   PRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSS  355

Query  1263  APAP  1274
                P
Sbjct  356   TAVP  359



>ref|XP_010695321.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695322.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010695323.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=368

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/359 (83%), Positives = 323/359 (90%), Gaps = 9/359 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQK-AIPSIE  359
             MRKWLCCTCQVEESYPS+E E LK P  +      R  K  K  T VK +VQK A P IE
Sbjct  1     MRKWLCCTCQVEESYPSNE-EPLKSPNTE------RALKSQKSQTLVKEDVQKTAPPPIE  53

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             V  LSLDELKE+T+NFGSK+LIGEGSYGRVY+A L +GK+VAVKKLDVS E +SN+EFLT
Sbjct  54    VSALSLDELKEKTDNFGSKSLIGEGSYGRVYYATLENGKAVAVKKLDVSQEPESNSEFLT  113

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVS VS+LKHEN+VEL GYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW 
Sbjct  114   QVSRVSRLKHENIVELQGYCVEGNMRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDWM  173

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRVRIAVDAA+GLEYLHEK+QP +IHRD+RSSNVLLFE+F+AKIADFNLSNQAPDMAARL
Sbjct  174   QRVRIAVDAARGLEYLHEKIQPCIIHRDVRSSNVLLFEDFRAKIADFNLSNQAPDMAARL  233

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  234   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  293

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             TPRLSEDKVKQCVDP+LK +YP KGVAKLAAVAALCVQYE EFRPNM+IVVKALQPLLK
Sbjct  294   TPRLSEDKVKQCVDPRLK-DYPAKGVAKLAAVAALCVQYEGEFRPNMSIVVKALQPLLK  351



>gb|KFK37162.1| hypothetical protein AALP_AA4G221200 [Arabis alpina]
Length=405

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/375 (79%), Positives = 333/375 (89%), Gaps = 7/375 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGP-TNDADGKFGRYEKGTKVATPVKTEVQK  341
             + ++ +MR+WLCC+C+V+ESYPS E   +K P T   D  +GR  K  K   PV   V K
Sbjct  35    IGKRGKMRRWLCCSCRVQESYPSAEQNRVKSPPTRHHD--YGRNNK--KPPAPVNPPVLK  90

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
               P I+VP +SL+ L+ +TENFGSKALIGEGSYGRVY+A LNDGK++AVKKLD +SE ++
Sbjct  91    EPPPIDVPAMSLEVLRGKTENFGSKALIGEGSYGRVYYATLNDGKAMAVKKLDNASEPET  150

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N VELLGYCVEG+LR+LAYEFATMGSLHDILHGRKGVQGAQPG
Sbjct  151   NVEFLTQVSKVSRLKNDNFVELLGYCVEGHLRVLAYEFATMGSLHDILHGRKGVQGAQPG  210

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
              TL+W QRVR+AVDAA+GLEYLHEKVQPPVIHRDIRSSNVL+FE+FKAKIADFNLSNQAP
Sbjct  211   LTLEWMQRVRVAVDAARGLEYLHEKVQPPVIHRDIRSSNVLIFEDFKAKIADFNLSNQAP  270

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  271   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  330

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKAL
Sbjct  331   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL  390

Query  1242  QPLLKSSA--PAPES  1280
             QPLL+S+A  P P++
Sbjct  391   QPLLRSAAVPPPPQA  405



>emb|CDX89020.1| BnaA04g01660D [Brassica napus]
Length=407

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/370 (80%), Positives = 325/370 (88%), Gaps = 5/370 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++ +MR+WLCC C VEE Y + E+E L+ P +  D  +G Y K   VA  +K    K 
Sbjct  37    IGKREKMRRWLCCACHVEEPYHASENEHLRSPKHHID--YG-YNKRAPVA--LKPAALKE  91

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
              PSI+VP LSLDELKE+T+NFGSK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN
Sbjct  92    PPSIDVPALSLDELKEKTDNFGSKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESN  151

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
              EFLTQVS VSKL H+N V+L GYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP
Sbjct  152   IEFLTQVSRVSKLHHDNFVQLFGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  211

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW QRVRIAVDAA+GLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PD
Sbjct  212   TLDWIQRVRIAVDAARGLEYLHEKVQPVVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPD  271

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
             MAARLHSTRVLGTFGYHAPEYAMTGQLT KSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  272   MAARLHSTRVLGTFGYHAPEYAMTGQLTHKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  331

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKG+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  332   LVTWATPRLSEDKVKQCVDPKLKGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQ  391

Query  1245  PLLKSSAPAP  1274
             PLL+SS   P
Sbjct  392   PLLRSSTAVP  401



>ref|XP_009386960.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=383

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 322/369 (87%), Gaps = 7/369 (2%)
 Frame = +3

Query  168   SEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAI  347
             ++KS+M++WLCC   +  SY +HE+E L  PT+DA G   +Y  G K   P      KA 
Sbjct  11    TKKSKMQRWLCCARHLGGSYHAHENEYLTSPTDDAYG-MPKYSAGPKNEPP------KAP  63

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             P IEVP LSLDELK++T+NFGSKAL+GEGSYGRVY A LND K VA+KKLD SSE ++NA
Sbjct  64    PPIEVPALSLDELKDKTDNFGSKALVGEGSYGRVYLAVLNDEKQVALKKLDSSSESETNA  123

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EFL QVS+VS+LKHEN+VE+LGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP 
Sbjct  124   EFLAQVSVVSRLKHENVVEMLGYCVEGNLRLLAYEFATMGSLHDILHGRKGVQGAQPGPP  183

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             LDW QRVRIAVDAAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDM
Sbjct  184   LDWMQRVRIAVDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDM  243

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL
Sbjct  244   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  303

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRLSEDKVKQC+DP++ G+YPPK VAK AAVAALCVQYEAEFRPNM+IVVKAL P
Sbjct  304   VTWATPRLSEDKVKQCIDPRMNGDYPPKAVAKFAAVAALCVQYEAEFRPNMSIVVKALSP  363

Query  1248  LLKSSAPAP  1274
             LL S   AP
Sbjct  364   LLLSKQVAP  372



>ref|XP_009386959.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=396

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 322/369 (87%), Gaps = 7/369 (2%)
 Frame = +3

Query  168   SEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAI  347
             ++KS+M++WLCC   +  SY +HE+E L  PT+DA G   +Y  G K   P      KA 
Sbjct  24    TKKSKMQRWLCCARHLGGSYHAHENEYLTSPTDDAYG-MPKYSAGPKNEPP------KAP  76

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             P IEVP LSLDELK++T+NFGSKAL+GEGSYGRVY A LND K VA+KKLD SSE ++NA
Sbjct  77    PPIEVPALSLDELKDKTDNFGSKALVGEGSYGRVYLAVLNDEKQVALKKLDSSSESETNA  136

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EFL QVS+VS+LKHEN+VE+LGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP 
Sbjct  137   EFLAQVSVVSRLKHENVVEMLGYCVEGNLRLLAYEFATMGSLHDILHGRKGVQGAQPGPP  196

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             LDW QRVRIAVDAAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDM
Sbjct  197   LDWMQRVRIAVDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDM  256

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL
Sbjct  257   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  316

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRLSEDKVKQC+DP++ G+YPPK VAK AAVAALCVQYEAEFRPNM+IVVKAL P
Sbjct  317   VTWATPRLSEDKVKQCIDPRMNGDYPPKAVAKFAAVAALCVQYEAEFRPNMSIVVKALSP  376

Query  1248  LLKSSAPAP  1274
             LL S   AP
Sbjct  377   LLLSKQVAP  385



>emb|CDY17940.1| BnaC04g02790D [Brassica napus]
Length=411

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/370 (79%), Positives = 324/370 (88%), Gaps = 3/370 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEES-YPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQK  341
             + +K +MR+WLCC+C V+ES +PS E    K P       +GR       A      V K
Sbjct  35    IGKKGKMRRWLCCSCHVQESNHPSSEHNRSKTPPTRYQ-DYGR-NNKKPPAPMKPPSVLK  92

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
                +I+VP +SL ELKE+TE+FG+KALIGEGSYGRVY+AN NDGK+VAVKKLD SSE ++
Sbjct  93    EPTTIDVPAMSLSELKEKTESFGTKALIGEGSYGRVYYANFNDGKAVAVKKLDNSSEPET  152

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N V+LLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPG
Sbjct  153   NIEFLTQVSKVSRLKNDNFVQLLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPG  212

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE+FKAK+ADFNLSNQAP
Sbjct  213   PTLEWMQRVRVAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEDFKAKVADFNLSNQAP  272

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  273   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  332

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKAL
Sbjct  333   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKAL  392

Query  1242  QPLLKSSAPA  1271
             QPLL+SS  A
Sbjct  393   QPLLRSSGTA  402



>ref|XP_006417891.1| hypothetical protein EUTSA_v10007987mg [Eutrema salsugineum]
 gb|ESQ36244.1| hypothetical protein EUTSA_v10007987mg [Eutrema salsugineum]
Length=365

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/358 (81%), Positives = 319/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+E+S   +E E LK     +D       K  K A   K EVQK    IEV
Sbjct  1     MRKWICCTCQIEDS---NEEEHLKSSQQQSDAN----HKNPKPAPAAKHEVQKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +S+AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGIAVALKKLDVAPEAESDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLG+CV+GN+R+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLIQLLGFCVDGNVRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  351



>ref|XP_009385464.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/358 (81%), Positives = 321/358 (90%), Gaps = 5/358 (1%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             +MR+WLCC  QV+E Y   E+E  K PTN+ DG      +G+K +T  K+E  K  P IE
Sbjct  3     KMRRWLCCYHQVDEPYHVSENEYRKSPTNNTDGP----HRGSKYSTAPKSEPPKTPPPIE  58

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LSL+ELKE+T+NFGSK+LIGEGSYGRVYFA L++GK VAVKKLD SSE++S  EFLT
Sbjct  59    VPALSLEELKEKTDNFGSKSLIGEGSYGRVYFAVLDNGKQVAVKKLDASSEENSE-EFLT  117

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QV+ VS+LKH N VE+LGYCVEGN+R++AYEFATMGSLHD+LHGRKGVQGAQPGP LDWT
Sbjct  118   QVATVSRLKHANFVEMLGYCVEGNMRMMAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWT  177

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRVRIAVDAAKGLE+LHEKVQP VIHRDIRSSNVLL+E+F AKIADFNLSNQAPDMAARL
Sbjct  178   QRVRIAVDAAKGLEFLHEKVQPSVIHRDIRSSNVLLYEDFTAKIADFNLSNQAPDMAARL  237

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  238   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  297

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             TPRLSEDKVKQC+DP+LKG+YPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL
Sbjct  298   TPRLSEDKVKQCIDPRLKGDYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL  355



>ref|XP_009142919.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Brassica rapa]
Length=412

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/365 (80%), Positives = 320/365 (88%), Gaps = 3/365 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEES-YPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQK  341
             + +K RMR+WLCC+C V+ES +PS E    K P       +GR       A      V K
Sbjct  35    IGKKGRMRRWLCCSCHVQESNHPSSEHNRSKTPPTRYQ-DYGR-NNKKPPAPMKPPSVMK  92

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
                +I+VP +SL ELKE+TENFGSKALIGEGSYGRVY+AN NDGK+VAVKKLD SSE ++
Sbjct  93    EPTTIDVPAMSLSELKEKTENFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNSSEPET  152

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS  S+LK++N V+LLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPG
Sbjct  153   NVEFLTQVSKFSRLKNDNFVQLLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPG  212

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE+FKAK+ADFNLSNQAP
Sbjct  213   PTLEWMQRVRVAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEDFKAKVADFNLSNQAP  272

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  273   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  332

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKAL
Sbjct  333   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKAL  392

Query  1242  QPLLK  1256
             QPLL+
Sbjct  393   QPLLR  397



>emb|CDX79833.1| BnaA05g03230D [Brassica napus]
Length=412

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/365 (80%), Positives = 320/365 (88%), Gaps = 3/365 (1%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEES-YPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQK  341
             + +K +MR+W CC+C V+ES +PS E    K P       +GR       A      V K
Sbjct  35    IGKKGKMRRWFCCSCHVQESNHPSSEHNRSKTPPTRYQ-DYGR-NNKKPPAPMKPPSVLK  92

Query  342   AIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDS  521
                +IEVP +SL ELKE+TENFGSKALIGEGSYGRVY+AN NDGK+VAVKKLD SSE ++
Sbjct  93    EPTTIEVPVMSLSELKEKTENFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNSSEPET  152

Query  522   NAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPG  701
             N EFLTQVS VS+LK++N V+LLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGAQPG
Sbjct  153   NVEFLTQVSKVSRLKNDNFVQLLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGAQPG  212

Query  702   PTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAP  881
             PTL+W QRVR+AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE+FKAK+ADFNLSNQAP
Sbjct  213   PTLEWMQRVRVAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEDFKAKVADFNLSNQAP  272

Query  882   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  1061
             DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ
Sbjct  273   DMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQ  332

Query  1062  SLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKAL  1241
             SLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKAL
Sbjct  333   SLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKAL  392

Query  1242  QPLLK  1256
             QPLL+
Sbjct  393   QPLLR  397



>ref|XP_009386962.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=368

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/364 (80%), Positives = 317/364 (87%), Gaps = 7/364 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             M++WLCC   +  SY +HE+E L  PT+DA G   +Y  G K   P      KA P IEV
Sbjct  1     MQRWLCCARHLGGSYHAHENEYLTSPTDDAYG-MPKYSAGPKNEPP------KAPPPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELK++T+NFGSKAL+GEGSYGRVY A LND K VA+KKLD SSE ++NAEFL Q
Sbjct  54    PALSLDELKDKTDNFGSKALVGEGSYGRVYLAVLNDEKQVALKKLDSSSESETNAEFLAQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN+VE+LGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW Q
Sbjct  114   VSVVSRLKHENVVEMLGYCVEGNLRLLAYEFATMGSLHDILHGRKGVQGAQPGPPLDWMQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  174   RVRIAVDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQC+DP++ G+YPPK VAK AAVAALCVQYEAEFRPNM+IVVKAL PLL S 
Sbjct  294   PRLSEDKVKQCIDPRMNGDYPPKAVAKFAAVAALCVQYEAEFRPNMSIVVKALSPLLLSK  353

Query  1263  APAP  1274
               AP
Sbjct  354   QVAP  357



>ref|XP_006305151.1| hypothetical protein CARUB_v10009518mg [Capsella rubella]
 gb|EOA38049.1| hypothetical protein CARUB_v10009518mg [Capsella rubella]
Length=365

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/358 (81%), Positives = 319/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+E+S   +E + LK     +D       K  K A   K EV+K    IEV
Sbjct  1     MRKWICCTCQIEDS---NEEQQLKNSQQQSDAN----HKNPKPAPVAKHEVKKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +S+AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAESDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLG+CV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  351



>emb|CDY06223.1| BnaA09g49800D [Brassica napus]
Length=363

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/358 (81%), Positives = 320/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+++S   +E E LK     +D       K  K A   K++ QK    +EV
Sbjct  1     MRKWICCTCQIQDS---NEEEHLKSSHQQSDAN----HKNPKPAAVAKSDAQKEPLPVEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDVS E +S+AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVSPEAESDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLV+LLG+CV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT 
Sbjct  114   VSMVSRLKHENLVQLLGFCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVRIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK  351



>ref|XP_009118489.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Brassica 
rapa]
Length=364

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 319/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+++S    E E LK     +D       K  K A   K++ QK    +EV
Sbjct  1     MRKWICCTCQIQDST---EEEHLKSSHQQSDAN----HKNPKPAAVAKSDAQKEPLPVEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDVS E +S+AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVSPEAESDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLV+LLG+CV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT 
Sbjct  114   VSMVSRLKHENLVQLLGFCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK  351



>emb|CDX98366.1| BnaC06g17270D [Brassica napus]
Length=390

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/360 (80%), Positives = 318/360 (88%), Gaps = 7/360 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y + E++  + P +        + K T+V+  V+ +     P+I+V
Sbjct  25    MRRWLCCACNVEEPYHTTENDHRRSPKH-----HNGHNKNTEVS--VRPDALNVPPAIDV  77

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DG++VAVKKLD S+E +SN EFLTQ
Sbjct  78    PALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGRAVAVKKLDNSAEPESNFEFLTQ  137

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKL+HEN V+L GYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ
Sbjct  138   VSRVSKLQHENFVQLFGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  197

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEKVQP V+HRD+RSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  198   RVRIAVEAARGLEYLHEKVQPAVVHRDVRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  257

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTG LTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA 
Sbjct  258   STRVLGTFGYHAPEYAMTGSLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAA  317

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKL G+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLKSS
Sbjct  318   PRLSEDKVKQCVDPKLNGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKSS  377



>ref|XP_009118488.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Brassica 
rapa]
Length=365

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 320/358 (89%), Gaps = 6/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+++S    E E LK     +D    +  K   VA   K++ QK    +EV
Sbjct  1     MRKWICCTCQIQDST---EEEHLKSSHQQSDATNHKNPKPAAVA---KSDAQKEPLPVEV  54

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDVS E +S+AEFL+Q
Sbjct  55    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVSPEAESDAEFLSQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENLV+LLG+CV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT 
Sbjct  115   VSMVSRLKHENLVQLLGFCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTT  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  175   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK
Sbjct  295   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK  352



>emb|CDX67793.1| BnaA07g18330D [Brassica napus]
Length=366

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/360 (79%), Positives = 317/360 (88%), Gaps = 7/360 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y + E++  + P +        + K  +V+  V+ +     P+I+V
Sbjct  1     MRRWLCCACHVEEPYHTTENDHRRSPKH-----HNGHNKNQEVS--VRPDALNVPPAIDV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DG++VAVKKLD S+E +SN EFLTQ
Sbjct  54    PALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGRAVAVKKLDNSAEPESNFEFLTQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKL+HEN V+L GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ
Sbjct  114   VSRVSKLQHENFVQLFGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEKVQP VIHRD+RSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  174   RVRIAVEAARGLEYLHEKVQPAVIHRDVRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTG LTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA 
Sbjct  234   STRVLGTFGYHAPEYAMTGSLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAA  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKL G+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLKSS
Sbjct  294   PRLSEDKVKQCVDPKLNGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKSS  353



>ref|XP_009104201.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Brassica 
rapa]
 ref|XP_009104202.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Brassica 
rapa]
Length=366

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/360 (79%), Positives = 317/360 (88%), Gaps = 7/360 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C VEE Y + E++  + P +        + K  +V+  V+ +     P+I+V
Sbjct  1     MRRWLCCACHVEEPYHTTENDHRRSPKH-----HNGHNKNQEVS--VRPDALNVPPAIDV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DG++VAVKKLD S+E +SN EFLTQ
Sbjct  54    PALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGRAVAVKKLDNSAEPESNFEFLTQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS VSKL+HEN V+L GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ
Sbjct  114   VSRVSKLQHENFVQLFGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAV+AA+GLEYLHEKVQP VIHRD+RSSNVLLFE+FKAKIADFNLSNQ+PDMAARLH
Sbjct  174   RVRIAVEAARGLEYLHEKVQPAVIHRDVRSSNVLLFEDFKAKIADFNLSNQSPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTG LTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA 
Sbjct  234   STRVLGTFGYHAPEYAMTGSLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAA  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKL G+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLKSS
Sbjct  294   PRLSEDKVKQCVDPKLNGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKSS  353



>ref|XP_009630699.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Nicotiana tomentosiformis]
Length=348

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/330 (85%), Positives = 312/330 (95%), Gaps = 2/330 (1%)
 Frame = +3

Query  291   YEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLND  470
             Y+ G++V  P K E +KAIP+IEVP LSLDELKE+T+NFGSKALIGEGSYGRVY+ANL++
Sbjct  19    YQNGSRVPGPAKAEAEKAIPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLSN  78

Query  471   GKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGS  650
              K+VAVKKLDVSSE ++N +FLTQ++ VS+LKH+NLVELLGYCVEGN+R+LAYEFATMGS
Sbjct  79    EKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGS  138

Query  651   LHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLF  830
             LHDILHGRKGVQGAQPGPTLDW QRV+IAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLF
Sbjct  139   LHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLF  198

Query  831   EEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLE  1010
             E++KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLE
Sbjct  199   EDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLE  258

Query  1011  LLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCV  1190
             LLTGRKPVDHTMPRGQQSLVTWATPRLSEDKV+QCVDPKLKG YP K VAK+AAVAALCV
Sbjct  259   LLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVQQCVDPKLKG-YPQKAVAKMAAVAALCV  317

Query  1191  QYEAEFRPNMTIVVKALQPLLKS-SAPAPE  1277
             QYE+EFRPNM+IVVKALQPLLK+  APAPE
Sbjct  318   QYESEFRPNMSIVVKALQPLLKAPPAPAPE  347



>ref|XP_009104200.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Brassica 
rapa]
Length=408

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/421 (71%), Positives = 337/421 (80%), Gaps = 28/421 (7%)
 Frame = +3

Query  3     HPLGPHFHFLSKTRKRRNRRAEDSTGNYHLS-DLPGTCVSSWLLFTIGEHKLIF*LSEKS  179
             HP  P +H       RR + A D +  Y +  D P           IG+         + 
Sbjct  2     HPTDPDYH-------RRGQTANDRSPGYFVRLDKPRAVDD----LHIGK---------RE  41

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             +MR+WLCC C VEE Y + E++  + P +        + K  +V+  V+ +     P+I+
Sbjct  42    KMRRWLCCACHVEEPYHTTENDHRRSPKH-----HNGHNKNQEVS--VRPDALNVPPAID  94

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LSLDELKE+T+NFGSKALIGEGSYGR Y+A L DG++VAVKKLD S+E +SN EFLT
Sbjct  95    VPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLKDGRAVAVKKLDNSAEPESNFEFLT  154

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVS VSKL+HEN V+L GYCVEGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT
Sbjct  155   QVSRVSKLQHENFVQLFGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  214

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRVRIAV+AA+GLEYLHEKVQP VIHRD+RSSNVLLFE+FKAKIADFNLSNQ+PDMAARL
Sbjct  215   QRVRIAVEAARGLEYLHEKVQPAVIHRDVRSSNVLLFEDFKAKIADFNLSNQSPDMAARL  274

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTG LTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  275   HSTRVLGTFGYHAPEYAMTGSLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  334

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
              PRLSEDKVKQCVDPKL G+YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLKS
Sbjct  335   APRLSEDKVKQCVDPKLNGDYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKS  394

Query  1260  S  1262
             S
Sbjct  395   S  395



>ref|XP_010056837.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Eucalyptus 
grandis]
Length=388

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/330 (81%), Positives = 297/330 (90%), Gaps = 4/330 (1%)
 Frame = +3

Query  153   LIF*LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTE  332
             L+   S   +MR+WLCCTCQVEESY +++ E LK P N   G     +K +K++ PVK E
Sbjct  34    LLLKKSPSKKMRRWLCCTCQVEESYAANDDELLKSPRNHVHGP----QKNSKLSAPVKPE  89

Query  333   VQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSE  512
             VQK+ P IEVP LSLDELKE+T+NFGSK+LIGEGSYGRVY+ANL+ GK+VAVKKLD SSE
Sbjct  90    VQKSAPPIEVPALSLDELKEKTDNFGSKSLIGEGSYGRVYYANLDSGKAVAVKKLDNSSE  149

Query  513   QDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGA  692
              +S+ EFLTQVSMVS+LKHEN V+LLGYCVEGNLR+LAYEFATMGSLHD+LHGRKGVQGA
Sbjct  150   AESDVEFLTQVSMVSRLKHENFVQLLGYCVEGNLRVLAYEFATMGSLHDVLHGRKGVQGA  209

Query  693   QPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSN  872
             QPGP LDWTQRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKA+IADFNLSN
Sbjct  210   QPGPVLDWTQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKARIADFNLSN  269

Query  873   QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR  1052
             QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR
Sbjct  270   QAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPR  329

Query  1053  GQQSLVTWATPRLSEDKVKQCVDPKLKGEY  1142
             GQQSLVTWATPRLSEDKVKQCVDP+L G+Y
Sbjct  330   GQQSLVTWATPRLSEDKVKQCVDPRLNGDY  359



>ref|XP_010414222.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010414223.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010414225.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010414226.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010469804.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010469805.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010469806.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
Length=364

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 323/364 (89%), Gaps = 4/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +  ES  ++E   LK P   +D    + +K   VA P   E QK    IEV
Sbjct  1     MRRWICCGDKNGESDLANEEVHLKTPWQQSDAN-QKNQKPQAVANP---ETQKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV++E ++NAEFL+Q
Sbjct  57    PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAAEAETNAEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++L+GYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRDIRSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK  
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPP  356

Query  1263  APAP  1274
             AP P
Sbjct  357   APVP  360



>ref|XP_010510290.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010510291.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
 ref|XP_010510292.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
Length=364

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/364 (79%), Positives = 322/364 (88%), Gaps = 4/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +  ES  ++E   LK P   +D    + +K   VA P   E QK    IEV
Sbjct  1     MRRWICCGDKNGESDLANEEVHLKTPWQQSDAN-QKNQKPQAVANP---ETQKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV++E ++NAEFL+Q
Sbjct  57    PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAAEAETNAEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++L+GYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRDIRSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM IVVKALQPLLK  
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMRIVVKALQPLLKPP  356

Query  1263  APAP  1274
             AP P
Sbjct  357   APVP  360



>emb|CDY23345.1| BnaC04g48730D [Brassica napus]
Length=410

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/375 (78%), Positives = 326/375 (87%), Gaps = 6/375 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEES-YPSHE-SEALKGPTNDADGKFGRYEKGTKVATPVKTEVQ  338
             + +K +MR+WLCC+C V+ES +P  E + +   PT   D  +GR +K        K  V 
Sbjct  36    IGKKGKMRRWLCCSCHVQESNHPRVEHNRSRTPPTRHYD--YGRNDKKPPPPM--KPAVL  91

Query  339   KAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQD  518
             K  P I+VP +SL ELKE+TENFGSKALIGEGSYGRVY+A  NDGK++AVKKLD +SE +
Sbjct  92    KEPPPIDVPTMSLAELKEKTENFGSKALIGEGSYGRVYYAKFNDGKAMAVKKLDNASEPE  151

Query  519   SNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQP  698
             +N EFLTQVS VS+L ++N V+LLGYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQP
Sbjct  152   TNVEFLTQVSKVSRLNNDNFVQLLGYCVEGNVRVLAYEFATMGSLHDILHGRKGVQGAQP  211

Query  699   GPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQA  878
             GPTL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIAD+NLSNQA
Sbjct  212   GPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADYNLSNQA  271

Query  879   PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ  1058
             PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ
Sbjct  272   PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ  331

Query  1059  QSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKA  1238
             QSLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKA
Sbjct  332   QSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKA  391

Query  1239  LQPLLKSSAPAPESP  1283
             LQPLL+SS  A   P
Sbjct  392   LQPLLRSSGAAAPPP  406



>ref|XP_006294474.1| hypothetical protein CARUB_v10023490mg [Capsella rubella]
 ref|XP_006294475.1| hypothetical protein CARUB_v10023490mg [Capsella rubella]
 gb|EOA27372.1| hypothetical protein CARUB_v10023490mg [Capsella rubella]
 gb|EOA27373.1| hypothetical protein CARUB_v10023490mg [Capsella rubella]
Length=364

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/364 (78%), Positives = 321/364 (88%), Gaps = 4/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +  ES  ++E   LK P   ++      +K  K     K E QK    IEV
Sbjct  1     MRRWICCGDKNGESDLANEEVHLKTPWQQSEAN----QKNQKPQAVAKPETQKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV++E ++NAEFL+Q
Sbjct  57    PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAAEAETNAEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+L+HENL++L+GYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLQHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRDIRSSNVLLFE+++AKIADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKIADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK  
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPP  356

Query  1263  APAP  1274
             AP P
Sbjct  357   APVP  360



>ref|XP_009142178.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Brassica rapa]
 emb|CDY30389.1| BnaA04g24900D [Brassica napus]
Length=410

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/375 (78%), Positives = 326/375 (87%), Gaps = 6/375 (2%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEES-YPSHE-SEALKGPTNDADGKFGRYEKGTKVATPVKTEVQ  338
             + +K +MR+WLCC+C V+ES +P  E + +   PT   D  +GR +K        K  V 
Sbjct  36    IGKKGKMRRWLCCSCHVQESNHPRVEHNRSRTPPTRHYD--YGRNDKKPPPPM--KPAVL  91

Query  339   KAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQD  518
             K  P I+VP +SL ELKE+TENFGSKALIGEGSYGRVY+A  NDGK++AVKKLD +SE +
Sbjct  92    KEPPPIDVPTMSLAELKEKTENFGSKALIGEGSYGRVYYAKFNDGKAMAVKKLDNASEPE  151

Query  519   SNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQP  698
             +N EFLTQVS VS+L ++N V+LLGYCVEGN+R+LAYEFATMGSLHDILHGRKGVQGAQP
Sbjct  152   TNVEFLTQVSKVSRLNNDNFVQLLGYCVEGNVRVLAYEFATMGSLHDILHGRKGVQGAQP  211

Query  699   GPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQA  878
             GPTL+W QRVR+AVDAAKGLEYLHEKVQP VIHRDIRSSNVLLFE+FKAKIAD+NLSNQA
Sbjct  212   GPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLLFEDFKAKIADYNLSNQA  271

Query  879   PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ  1058
             PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ
Sbjct  272   PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ  331

Query  1059  QSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKA  1238
             QSLVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKA
Sbjct  332   QSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKA  391

Query  1239  LQPLLKSSAPAPESP  1283
             LQPLL+SS  A   P
Sbjct  392   LQPLLRSSGAAAPPP  406



>ref|XP_010912132.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Elaeis 
guineensis]
Length=343

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/320 (88%), Positives = 304/320 (95%), Gaps = 0/320 (0%)
 Frame = +3

Query  294   EKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDG  473
             +KG+K++   K+E QKA P IEVP LSLDELKE+TENFGSK L+GEGSYGRVYFA L++G
Sbjct  2     QKGSKLSAVAKSETQKAPPPIEVPALSLDELKEKTENFGSKFLVGEGSYGRVYFATLSNG  61

Query  474   KSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSL  653
             K VA+KKLDVSSE +SN EFLTQVSMVSKLKHEN++E+LGYCV+GNLR+LAYE+ATMGSL
Sbjct  62    KQVALKKLDVSSEPESNNEFLTQVSMVSKLKHENVLEMLGYCVQGNLRLLAYEYATMGSL  121

Query  654   HDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE  833
             HD+LHGRKGVQGAQPGP LDW QRVRIA+DAAKGLEYLHEKVQP +IHRDIRSSNVLLFE
Sbjct  122   HDVLHGRKGVQGAQPGPVLDWMQRVRIAIDAAKGLEYLHEKVQPSIIHRDIRSSNVLLFE  181

Query  834   EFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL  1013
             +F+AKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL
Sbjct  182   DFRAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL  241

Query  1014  LTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQ  1193
             LTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQ
Sbjct  242   LTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQ  301

Query  1194  YEAEFRPNMTIVVKALQPLL  1253
             YEAEFRPNM+IVVKAL PLL
Sbjct  302   YEAEFRPNMSIVVKALSPLL  321



>dbj|BAH20354.1| AT3G59350 [Arabidopsis thaliana]
Length=351

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/347 (83%), Positives = 311/347 (90%), Gaps = 4/347 (1%)
 Frame = +3

Query  231   SHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFG  410
             S E+E L+ P +  D  FG + +  + A  VK +  K  PSI+VP LSLDELKE+T+NFG
Sbjct  2     SSENEHLRSPKHHND--FGHHTRKPQAA--VKPDALKEPPSIDVPALSLDELKEKTDNFG  57

Query  411   SKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELL  590
             SK+LIGEGSYGR Y+A L DGK+VAVKKLD ++E +SN EFLTQVS VSKLKH+N VEL 
Sbjct  58    SKSLIGEGSYGRAYYATLKDGKAVAVKKLDNAAEPESNVEFLTQVSRVSKLKHDNFVELF  117

Query  591   GYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLH  770
             GYCVEGN RILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW QRVRIAVDAA+GLEYLH
Sbjct  118   GYCVEGNFRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQRVRIAVDAARGLEYLH  177

Query  771   EKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYA  950
             EKVQP VIHRDIRSSNVLLFE+FKAKIADFNLSNQ+PDMAARLHSTRVLGTFGYHAPEYA
Sbjct  178   EKVQPAVIHRDIRSSNVLLFEDFKAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYA  237

Query  951   MTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKL  1130
             MTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKL
Sbjct  238   MTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKL  297

Query  1131  KGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPA  1271
             KGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLL+SS  A
Sbjct  298   KGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLRSSTAA  344



>ref|NP_172155.1| PTI1-like tyrosine-protein kinase 1 [Arabidopsis thaliana]
 ref|NP_001030981.1| PTI1-like tyrosine-protein kinase 1 [Arabidopsis thaliana]
 sp|Q8H1G6.1|PTI11_ARATH RecName: Full=PTI1-like tyrosine-protein kinase 1; Short=PTI1-1 
[Arabidopsis thaliana]
 gb|AAN12919.1| putative kinase interactor [Arabidopsis thaliana]
 dbj|BAH20156.1| AT1G06700 [Arabidopsis thaliana]
 gb|AEE28025.1| PTI1-like tyrosine-protein kinase 1 [Arabidopsis thaliana]
 gb|AEE28026.1| PTI1-like tyrosine-protein kinase 1 [Arabidopsis thaliana]
Length=361

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/358 (80%), Positives = 319/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+E+S   +E + LK     +D       K +K A   K EV+K    IEV
Sbjct  1     MRKWICCTCQIEDS---NEEQQLKSSQQQSDAN----HKNSKPAPVAKHEVKKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +++ EFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLG+CV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  351



>ref|XP_002892354.1| hypothetical protein ARALYDRAFT_887872 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68613.1| hypothetical protein ARALYDRAFT_887872 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/358 (80%), Positives = 319/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+E+S   +E + LK     +D       K  K A   K E++K    IEV
Sbjct  1     MRKWICCTCQIEDS---NEEQQLKSSQQQSDAN----HKNPKPAPVAKHEMKKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +++AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLG+CV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  351



>gb|AAK44075.1|AF370260_1 putative protein kinase interactor [Arabidopsis thaliana]
Length=361

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/358 (80%), Positives = 318/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+E+S   +E + LK     +D       K +K A   K EV+K    IEV
Sbjct  1     MRKWICCTCQIEDS---NEEQQLKSSQQQSDAN----HKNSKPAPVAKHEVKKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +++ EFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLG+CV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IV KALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVAKALQPLLK  351



>ref|XP_010486484.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Camelina sativa]
 ref|XP_010486492.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Camelina sativa]
Length=365

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/358 (80%), Positives = 318/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+++S   +E + LK     +D       K  K A   K EV+K    IEV
Sbjct  1     MRKWICCTCQMDDS---NEEQQLKSSQQQSDAN----HKNPKPAPVAKHEVKKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +S+AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGIAVALKKLDVAPEAESDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL +LLG+CV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLTQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  351



>ref|XP_009414666.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/368 (76%), Positives = 315/368 (86%), Gaps = 8/368 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYE--KGTKVATPVKTEVQKAIPSI  356
             MR+W CC+  ++ S+  HE+E L    +DA      Y+   G+   T  K E  KA PSI
Sbjct  1     MRRWFCCSRHLDGSFHVHENEYLTSSMHDA------YDMPNGSNYCTFPKNEPPKATPSI  54

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             EVP LSLDELKE+T+NFG+KAL+GEGSYGRVY A LN+G  VA+KK D SS+ +++ EFL
Sbjct  55    EVPALSLDELKEKTDNFGTKALVGEGSYGRVYLAVLNNGNQVALKKFDSSSDSEASTEFL  114

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              QVS+VS+LKHEN+VE+LGYC+EGNLR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW
Sbjct  115   VQVSIVSRLKHENVVEMLGYCIEGNLRLLAYEFATMGSLHDILHGRKGVQGAQPGPPLDW  174

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAAR
Sbjct  175   MQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAAR  234

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL+TGRKPVDHTMPRGQQSLVTW
Sbjct  235   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELMTGRKPVDHTMPRGQQSLVTW  294

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDP+LKG+Y PK VAKLAAVAALCVQYEAEFRPNM+IVVKAL  L+ 
Sbjct  295   ATPRLSEDKVKQCVDPRLKGDYAPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALSALVN  354

Query  1257  SSAPAPES  1280
                P P +
Sbjct  355   KQVPNPTT  362



>ref|XP_010457811.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Camelina sativa]
 ref|XP_010457812.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Camelina sativa]
Length=365

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/358 (80%), Positives = 318/358 (89%), Gaps = 7/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CC CQ+++S   +E + LK     +D       K  K A   K EV+K    IEV
Sbjct  1     MRKWICCRCQMDDS---NEEQQLKSSQQQSDAN----HKNPKPAPVAKHEVKKEALPIEV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDV+ E +S+AEFL+Q
Sbjct  54    PPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAESDAEFLSQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++LLG+CV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  114   VSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIT  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  174   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  294   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLK  351



>emb|CDY09961.1| BnaC08g44900D [Brassica napus]
Length=366

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/358 (80%), Positives = 317/358 (89%), Gaps = 5/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CCTCQ+++S    E E LK     +D    +  K   VA   + EVQK    +EV
Sbjct  1     MRKWICCTCQIQDS---SEEEHLKSSQQQSDANH-KVPKPAAVAKH-EAEVQKEPLPVEV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS DE+KE+TENFGSKALIGEGSYGRVY+A LNDG +VA+KKLDVS E +S+A FL+Q
Sbjct  56    PPLSSDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVSPEAESDAVFLSQ  115

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+L HENLV+LLG+CV+G+LR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT 
Sbjct  116   VSMVSRLNHENLVQLLGFCVDGSLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTT  175

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARLH
Sbjct  176   RVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLH  235

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  236   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  295

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQC+DPKLK +YPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK
Sbjct  296   PRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK  353



>gb|ABR16274.1| unknown [Picea sitchensis]
 gb|ACN40564.1| unknown [Picea sitchensis]
Length=366

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 316/369 (86%), Gaps = 10/369 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYE--KGTKVATPVKTEVQKAIPSI  356
             MR+W CC C  E +    E++ L    N+ +G  G Y+  +G K   P K      +P I
Sbjct  1     MRRWFCCACSTEGAPEQPENQFLNAAKNNGNGFQGDYKASEGAKSGPPQK------VPPI  54

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             E P LSLDELKE T+NFG KALIGEGSYGRVY+A L+DG+  A+KKLDVS++ ++NAEFL
Sbjct  55    EAPSLSLDELKEATDNFGPKALIGEGSYGRVYYATLSDGQPAAIKKLDVSNQPEANAEFL  114

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              QVSMVS+LKH+++VEL+GYCVEG LR+LAYEFATMGSLHDILHGRKGVQGAQPGP LDW
Sbjct  115   AQVSMVSRLKHDHIVELVGYCVEGTLRVLAYEFATMGSLHDILHGRKGVQGAQPGPVLDW  174

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRV+IAV AAKGLEYLHEK QP +IHRDIRSSNVLLF++FKAKIADFNLSNQAPDMAAR
Sbjct  175   MQRVKIAVGAAKGLEYLHEKAQPHIIHRDIRSSNVLLFDDFKAKIADFNLSNQAPDMAAR  234

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW
Sbjct  235   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  294

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL-  1253
             ATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYEA+FRPNM+IVVKALQPLL 
Sbjct  295   ATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLT  354

Query  1254  -KSSAPAPE  1277
              K + PA E
Sbjct  355   PKPAIPASE  363



>ref|NP_180632.1| PTI1-like tyrosine-protein kinase 2 [Arabidopsis thaliana]
 sp|O49339.1|PTI12_ARATH RecName: Full=PTI1-like tyrosine-protein kinase 2; Short=PTI1-2 
[Arabidopsis thaliana]
 gb|AAC02745.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAC34450.1| putative PTI1-like protein tyrosine kinase [Arabidopsis thaliana]
 gb|ABD85164.1| At2g30740 [Arabidopsis thaliana]
 dbj|BAF02106.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC08434.1| PTI1-like tyrosine-protein kinase 2 [Arabidopsis thaliana]
Length=366

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/358 (79%), Positives = 317/358 (89%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +  +S  S+E   LK P  +++      +K  K    VK E QK    IEV
Sbjct  1     MRRWICCGDKKGDSDLSNEEVHLKSPWQNSEAN----QKNQKPQAVVKPEAQKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++N EFL Q
Sbjct  57    PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++L+GYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRDIRSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK  354



>emb|CDP20710.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/314 (89%), Positives = 299/314 (95%), Gaps = 1/314 (0%)
 Frame = +3

Query  336   QKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQ  515
             QK IP IEVP LSL+ELKE+T+NFG+KALIGEGSYGRVY+A+L  GK+VAVKKLDVSSE 
Sbjct  4     QKTIPPIEVPALSLEELKEKTDNFGTKALIGEGSYGRVYYADLESGKAVAVKKLDVSSEP  63

Query  516   DSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQ  695
             +SN EFLTQVSMVS+LKHENLVELLGYCVEGNLR+LAYEFATMGSLHDILHGRKGVQ AQ
Sbjct  64    ESNVEFLTQVSMVSRLKHENLVELLGYCVEGNLRVLAYEFATMGSLHDILHGRKGVQNAQ  123

Query  696   PGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQ  875
             PGPTLDW  RVRIAVDAA+GLEYLHEKVQP +IHRDIRSSNVL+FE++KAKIADFNLSNQ
Sbjct  124   PGPTLDWITRVRIAVDAARGLEYLHEKVQPAIIHRDIRSSNVLVFEDYKAKIADFNLSNQ  183

Query  876   APDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRG  1055
             APDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDH MPRG
Sbjct  184   APDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHNMPRG  243

Query  1056  QQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             QQSLVTWATPRLSEDKVKQC+DPKLK ++PPKGVAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  244   QQSLVTWATPRLSEDKVKQCIDPKLK-DFPPKGVAKLAAVAALCVQYEAEFRPNMSIVVK  302

Query  1236  ALQPLLKSSAPAPE  1277
             ALQPLLKS  PAPE
Sbjct  303   ALQPLLKSQVPAPE  316



>ref|XP_006410175.1| hypothetical protein EUTSA_v10016840mg [Eutrema salsugineum]
 gb|ESQ51628.1| hypothetical protein EUTSA_v10016840mg [Eutrema salsugineum]
Length=364

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/358 (78%), Positives = 317/358 (89%), Gaps = 4/358 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +  +S  S+  E +K     +D       K +K     K EVQK    IEV
Sbjct  1     MRRWICCGRKTGDSDLSNNEEHVKTQWQQSDAN----HKNSKPQAVTKPEVQKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++NAEFL+Q
Sbjct  57    PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNAEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWIT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRDIRSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLK  354



>ref|XP_010525876.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X2 [Tarenaya 
hassleriana]
Length=411

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/401 (73%), Positives = 328/401 (82%), Gaps = 13/401 (3%)
 Frame = +3

Query  78    GNYHLSDLPGTCVSSWLLFTIGEHKLI--F*LSEKSRMRKWLCCTCQVEESYPSHESEAL  251
             G+YH   L G   S      + + + +    + ++++MR+WLCC C VEE Y   + E+L
Sbjct  3     GDYHRRGLSGNDSSPGYFVRLDKPRAVDDLYIGKRAKMRRWLCCACHVEEPYHLPKHESL  62

Query  252   KGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPS-IEVPELSLDELKEQTENFGSKALIG  428
             K P +  +  +GR     K    VK       P  I+VP LSLD+LKE+T+NFGSKALIG
Sbjct  63    KIPRHINNIGYGR-----KPPAAVKPPAVPREPPPIDVPALSLDKLKEKTDNFGSKALIG  117

Query  429   EGSYGRVYFANLNDGK-----SVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLG  593
             EGSYGRVY+ANLND       +VAVKKLD S++ +S+ EFLTQVS VSKLKHEN V LLG
Sbjct  118   EGSYGRVYYANLNDDDEAEAVAVAVKKLDNSAKPESDVEFLTQVSRVSKLKHENFVRLLG  177

Query  594   YCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHE  773
             YC+EGN+RILAYEFA MGSLHDILHGRKGVQGAQPGPTLDW QRVRIAVDAA+GL+YLHE
Sbjct  178   YCIEGNIRILAYEFAIMGSLHDILHGRKGVQGAQPGPTLDWMQRVRIAVDAARGLDYLHE  237

Query  774   KVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAM  953
             K QPP+IHRDIRSSNVLLF+ FKAKI DFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAM
Sbjct  238   KFQPPIIHRDIRSSNVLLFQGFKAKIGDFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAM  297

Query  954   TGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLK  1133
             TGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDP LK
Sbjct  298   TGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPNLK  357

Query  1134  GEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             GEYPPK VAKLAAVAALCVQYEAEFRPNM+IVVKALQPLL+
Sbjct  358   GEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLR  398



>ref|XP_010525868.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 isoform X1 [Tarenaya 
hassleriana]
Length=474

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/370 (78%), Positives = 317/370 (86%), Gaps = 11/370 (3%)
 Frame = +3

Query  165   LSEKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKA  344
             + ++++MR+WLCC C VEE Y   + E+LK P +  +  +GR     K    VK      
Sbjct  97    IGKRAKMRRWLCCACHVEEPYHLPKHESLKIPRHINNIGYGR-----KPPAAVKPPAVPR  151

Query  345   IPS-IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGK-----SVAVKKLDVS  506
              P  I+VP LSLD+LKE+T+NFGSKALIGEGSYGRVY+ANLND       +VAVKKLD S
Sbjct  152   EPPPIDVPALSLDKLKEKTDNFGSKALIGEGSYGRVYYANLNDDDEAEAVAVAVKKLDNS  211

Query  507   SEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQ  686
             ++ +S+ EFLTQVS VSKLKHEN V LLGYC+EGN+RILAYEFA MGSLHDILHGRKGVQ
Sbjct  212   AKPESDVEFLTQVSRVSKLKHENFVRLLGYCIEGNIRILAYEFAIMGSLHDILHGRKGVQ  271

Query  687   GAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNL  866
             GAQPGPTLDW QRVRIAVDAA+GL+YLHEK QPP+IHRDIRSSNVLLF+ FKAKI DFNL
Sbjct  272   GAQPGPTLDWMQRVRIAVDAARGLDYLHEKFQPPIIHRDIRSSNVLLFQGFKAKIGDFNL  331

Query  867   SNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTM  1046
             SNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTM
Sbjct  332   SNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTM  391

Query  1047  PRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTI  1226
             PRGQQSLVTWATPRLSEDKVKQCVDP LKGEYPPK VAKLAAVAALCVQYEAEFRPNM+I
Sbjct  392   PRGQQSLVTWATPRLSEDKVKQCVDPNLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSI  451

Query  1227  VVKALQPLLK  1256
             VVKALQPLL+
Sbjct  452   VVKALQPLLR  461



>ref|XP_004956066.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X2 
[Setaria italica]
 ref|XP_004956067.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X3 
[Setaria italica]
 ref|XP_004956068.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X4 
[Setaria italica]
Length=368

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/373 (76%), Positives = 315/373 (84%), Gaps = 16/373 (4%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAI--PSI  356
             MR+W CC C  ++    H  E  K  +N  D K        K + P  T+ +  I  P+I
Sbjct  1     MRQWFCCNCHFDDEEDGHNKEQSKAQSNKIDPK-------QKSSKPPVTQPEPEISPPTI  53

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             +VPELSLD+LKE+T+NFGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N EFL
Sbjct  54    DVPELSLDDLKEKTDNFGSSALIGEGSYGRVYHATLDDGRQAAVKKLD-ASENEPNDEFL  112

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              QVS+ SKLKH+NLVE+LGYCVEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW
Sbjct  113   KQVSLASKLKHDNLVEMLGYCVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDW  172

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRV+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAAR
Sbjct  173   MQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAAR  232

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW
Sbjct  233   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  292

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+
Sbjct  293   ATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQ  352

Query  1257  ------SSAPAPE  1277
                   +S PAPE
Sbjct  353   QRPAPTASEPAPE  365



>ref|XP_004956065.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X1 
[Setaria italica]
Length=386

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/375 (76%), Positives = 316/375 (84%), Gaps = 16/375 (4%)
 Frame = +3

Query  177   SRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAI--P  350
             S MR+W CC C  ++    H  E  K  +N  D K        K + P  T+ +  I  P
Sbjct  17    SDMRQWFCCNCHFDDEEDGHNKEQSKAQSNKIDPK-------QKSSKPPVTQPEPEISPP  69

Query  351   SIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAE  530
             +I+VPELSLD+LKE+T+NFGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N E
Sbjct  70    TIDVPELSLDDLKEKTDNFGSSALIGEGSYGRVYHATLDDGRQAAVKKLD-ASENEPNDE  128

Query  531   FLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTL  710
             FL QVS+ SKLKH+NLVE+LGYCVEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP L
Sbjct  129   FLKQVSLASKLKHDNLVEMLGYCVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVL  188

Query  711   DWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMA  890
             DW QRV+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMA
Sbjct  189   DWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMA  248

Query  891   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  1070
             ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV
Sbjct  249   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  308

Query  1071  TWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPL  1250
             TWATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PL
Sbjct  309   TWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPL  368

Query  1251  LK------SSAPAPE  1277
             L+      +S PAPE
Sbjct  369   LQQRPAPTASEPAPE  383



>emb|CDY10754.1| BnaA05g11820D [Brassica napus]
Length=365

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/364 (76%), Positives = 317/364 (87%), Gaps = 3/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             M +W+CC     +S  S++ + LK     ++G      K   VA P   E  K    IEV
Sbjct  1     MHRWICCGRTSGDSDVSNDEQHLKTQWQQSEGAANNKPKPQAVAKP---EAPKEALPIEV  57

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS++E+KE+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+Q
Sbjct  58    PLLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLSQ  117

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW  
Sbjct  118   VSMVSRLKHENFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWIT  177

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  178   RVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  237

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  238   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  297

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK+ 
Sbjct  298   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKTP  357

Query  1263  APAP  1274
             AP P
Sbjct  358   APVP  361



>ref|XP_002879278.1| hypothetical protein ARALYDRAFT_902068 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55537.1| hypothetical protein ARALYDRAFT_902068 [Arabidopsis lyrata subsp. 
lyrata]
Length=364

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/354 (79%), Positives = 313/354 (88%), Gaps = 4/354 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +  +S  S+E   LK P   +D      +K  K     K E QK    IEV
Sbjct  1     MRRWICCGEKRGDSDLSNEEVHLKSPWQQSDAN----QKNQKPQAVAKPEAQKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++N+EFL+Q
Sbjct  57    PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNSEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++L+GYCV+ NLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRDIRSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQ  350



>ref|XP_004970920.1| PREDICTED: PTI1-like tyrosine-protein kinase 1-like isoform X2 
[Setaria italica]
 ref|XP_004970921.1| PREDICTED: PTI1-like tyrosine-protein kinase 1-like isoform X3 
[Setaria italica]
 ref|XP_004970922.1| PREDICTED: PTI1-like tyrosine-protein kinase 1-like isoform X4 
[Setaria italica]
Length=368

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/365 (77%), Positives = 314/365 (86%), Gaps = 9/365 (2%)
 Frame = +3

Query  189   KWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPE  368
             +W+CC CQV+ES    E+   K  TN+ADG      KG K +   K E Q A P I +P 
Sbjct  4     RWVCCNCQVDES-DQRENGQFKVTTNNADG----MTKGFKDSATGKVEPQNAAPPINIPV  58

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             LSLDEL E+T++FGS ALIGEGSYGRVY+A L++G  +AVKKLD S+E +   EFLTQVS
Sbjct  59    LSLDELIEKTDDFGSTALIGEGSYGRVYYAVLDNGTKMAVKKLD-STENEPTTEFLTQVS  117

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             +VS+LKHEN V++LGYC E NLRI+AYEFATMGSLHD+LHGRKGVQGAQPGP LDW QRV
Sbjct  118   LVSRLKHENFVDMLGYCTERNLRIVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWMQRV  177

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             ++AVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAKIADFNLSNQAPDMAARLHST
Sbjct  178   KVAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKIADFNLSNQAPDMAARLHST  237

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR
Sbjct  238   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  297

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL---KS  1259
             L+EDKVKQCVDP+LKGEYP KG+AKLAAVAALCVQYEAEFRPNM+IVVKAL PLL   ++
Sbjct  298   LTEDKVKQCVDPRLKGEYPAKGLAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLVSKQT  357

Query  1260  SAPAP  1274
               PAP
Sbjct  358   QTPAP  362



>ref|XP_004970919.1| PREDICTED: PTI1-like tyrosine-protein kinase 1-like isoform X1 
[Setaria italica]
Length=386

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/358 (77%), Positives = 311/358 (87%), Gaps = 6/358 (2%)
 Frame = +3

Query  189   KWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPE  368
             +W+CC CQV+ES    E+   K  TN+ADG      KG K +   K E Q A P I +P 
Sbjct  4     RWVCCNCQVDES-DQRENGQFKVTTNNADG----MTKGFKDSATGKVEPQNAAPPINIPV  58

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             LSLDEL E+T++FGS ALIGEGSYGRVY+A L++G  +AVKKLD S+E +   EFLTQVS
Sbjct  59    LSLDELIEKTDDFGSTALIGEGSYGRVYYAVLDNGTKMAVKKLD-STENEPTTEFLTQVS  117

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             +VS+LKHEN V++LGYC E NLRI+AYEFATMGSLHD+LHGRKGVQGAQPGP LDW QRV
Sbjct  118   LVSRLKHENFVDMLGYCTERNLRIVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWMQRV  177

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             ++AVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAKIADFNLSNQAPDMAARLHST
Sbjct  178   KVAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKIADFNLSNQAPDMAARLHST  237

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR
Sbjct  238   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  297

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             L+EDKVKQCVDP+LKGEYP KG+AKLAAVAALCVQYEAEFRPNM+IVVKAL PLL ++
Sbjct  298   LTEDKVKQCVDPRLKGEYPAKGLAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLAAN  355



>ref|XP_009144277.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Brassica 
rapa]
Length=365

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/364 (76%), Positives = 315/364 (87%), Gaps = 3/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             M +W+CC     +S  S++ + LK     ++G      K   VA P   E  K    IEV
Sbjct  1     MHRWICCGRTSGDSDVSNDEQHLKTQWQQSEGANNNKPKPQAVAKP---EAPKEALPIEV  57

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS++E+KE+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+Q
Sbjct  58    PLLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLSQ  117

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW  
Sbjct  118   VSMVSRLKHENFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWIT  177

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  178   RVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  237

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  238   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  297

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVK  QPLLK+ 
Sbjct  298   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKPFQPLLKTP  357

Query  1263  APAP  1274
             AP P
Sbjct  358   APVP  361



>emb|CDY47124.1| BnaC04g13810D [Brassica napus]
Length=364

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/364 (76%), Positives = 316/364 (87%), Gaps = 4/364 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             M +W+CC     +S  S++ + LK     +     +  K   VA P   E  K    IEV
Sbjct  1     MHRWICCGRSSGDSDVSNDEQHLKTQWQQSQAANNK-PKPQAVAKP---EAPKEALPIEV  56

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS++E+KE+TENFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+Q
Sbjct  57    PLLSVEEVKEKTENFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLSQ  116

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHEN ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW  
Sbjct  117   VSMVSRLKHENFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWIT  176

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AK+ADFNLSNQAPD AARLH
Sbjct  177   RVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKVADFNLSNQAPDNAARLH  236

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  237   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  296

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQPLLK+ 
Sbjct  297   PRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKTP  356

Query  1263  APAP  1274
             AP P
Sbjct  357   APVP  360



>ref|NP_001141426.1| uncharacterized LOC100273536 [Zea mays]
 gb|ACF86354.1| unknown [Zea mays]
 gb|ACG32976.1| protein kinase Pti1 [Zea mays]
 tpg|DAA60399.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=368

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 318/369 (86%), Gaps = 9/369 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPV-KTEVQKAIPSIE  359
             MR+WLCC C  ++    H+ E  K  +N  D K    +K +K   PV + E + + P+I+
Sbjct  1     MRQWLCCNCHFDDEEDGHDKEQAKAQSNKIDPK----QKSSK--PPVSQPEPEFSPPTID  54

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VPELSLD+LK++T++FGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N EFL 
Sbjct  55    VPELSLDDLKQKTDDFGSSALIGEGSYGRVYHAALDDGRQAAVKKLD-ASENEPNDEFLK  113

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVS+ SKLKHENLVE+LGYCV+GN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW 
Sbjct  114   QVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWM  173

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRV+I ++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARL
Sbjct  174   QRVKIVIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARL  233

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  234   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  293

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+ 
Sbjct  294   TPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQ  353

Query  1260  SAPAPESPE  1286
               PAP + E
Sbjct  354   R-PAPGTAE  361



>ref|XP_004970923.1| PREDICTED: PTI1-like tyrosine-protein kinase 1-like isoform X5 
[Setaria italica]
Length=359

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/355 (78%), Positives = 309/355 (87%), Gaps = 6/355 (2%)
 Frame = +3

Query  189   KWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPE  368
             +W+CC CQV+ES    E+   K  TN+ADG      KG K +   K E Q A P I +P 
Sbjct  4     RWVCCNCQVDES-DQRENGQFKVTTNNADG----MTKGFKDSATGKVEPQNAAPPINIPV  58

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             LSLDEL E+T++FGS ALIGEGSYGRVY+A L++G  +AVKKLD S+E +   EFLTQVS
Sbjct  59    LSLDELIEKTDDFGSTALIGEGSYGRVYYAVLDNGTKMAVKKLD-STENEPTTEFLTQVS  117

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             +VS+LKHEN V++LGYC E NLRI+AYEFATMGSLHD+LHGRKGVQGAQPGP LDW QRV
Sbjct  118   LVSRLKHENFVDMLGYCTERNLRIVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWMQRV  177

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             ++AVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAKIADFNLSNQAPDMAARLHST
Sbjct  178   KVAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKIADFNLSNQAPDMAARLHST  237

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR
Sbjct  238   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  297

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             L+EDKVKQCVDP+LKGEYP KG+AKLAAVAALCVQYEAEFRPNM+IVVKAL PLL
Sbjct  298   LTEDKVKQCVDPRLKGEYPAKGLAKLAAVAALCVQYEAEFRPNMSIVVKALSPLL  352



>ref|XP_008651094.1| PREDICTED: uncharacterized LOC100273536 isoform X1 [Zea mays]
 tpg|DAA60401.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=388

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/369 (77%), Positives = 318/369 (86%), Gaps = 9/369 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPV-KTEVQKAIPSIE  359
             MR+WLCC C  ++    H+ E  K  +N  D K    +K +K   PV + E + + P+I+
Sbjct  21    MRQWLCCNCHFDDEEDGHDKEQAKAQSNKIDPK----QKSSK--PPVSQPEPEFSPPTID  74

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VPELSLD+LK++T++FGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N EFL 
Sbjct  75    VPELSLDDLKQKTDDFGSSALIGEGSYGRVYHAALDDGRQAAVKKLD-ASENEPNDEFLK  133

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVS+ SKLKHENLVE+LGYCV+GN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW 
Sbjct  134   QVSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWM  193

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRV+I ++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARL
Sbjct  194   QRVKIVIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARL  253

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  254   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  313

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+ 
Sbjct  314   TPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQ  373

Query  1260  SAPAPESPE  1286
               PAP + E
Sbjct  374   R-PAPGTAE  381



>ref|NP_001045098.1| Os01g0899000 [Oryza sativa Japonica Group]
 dbj|BAD82355.1| putative protein kinase Pti1 [Oryza sativa Japonica Group]
 dbj|BAF07012.1| Os01g0899000 [Oryza sativa Japonica Group]
 dbj|BAH00686.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55819.1| hypothetical protein OsJ_04421 [Oryza sativa Japonica Group]
Length=369

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/360 (77%), Positives = 311/360 (86%), Gaps = 6/360 (2%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             R R+W+CC CQV ES       A K  T++ADG      KG K +   K + Q +  +I 
Sbjct  3     RWRRWICCNCQVNESDQLENGHA-KVLTSNADG----VTKGLKDSATEKAQPQNSALTIN  57

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             +P LSLDEL E+T++FGS ALIGEGSYGRVY+A L+ G  +AVKKLD S+E +  +EFLT
Sbjct  58    IPVLSLDELVEKTDDFGSSALIGEGSYGRVYYAVLDSGTKIAVKKLD-SNENEPTSEFLT  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QV++VS+LKHEN V++LGYC EGNLR++AYEFATMGSLHD+LHGRKGVQGAQPGP LDW 
Sbjct  117   QVALVSRLKHENFVDMLGYCTEGNLRLVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWM  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRVRIAVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAK+ADFNLSNQAPDMAARL
Sbjct  177   QRVRIAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKVADFNLSNQAPDMAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRL+EDKVKQC+DP+L GEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL S
Sbjct  297   TPRLTEDKVKQCIDPRLNGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLTS  356



>gb|AAF63147.1|AC011001_17 Putative protein kinase [Arabidopsis thaliana]
Length=377

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/330 (83%), Positives = 301/330 (91%), Gaps = 0/330 (0%)
 Frame = +3

Query  267   DADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGR  446
             DA   +    K +K A   K EV+K    IEVP LSLDE+KE+TENFGSKALIGEGSYGR
Sbjct  38    DAIFMYAANHKNSKPAPVAKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGR  97

Query  447   VYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILA  626
             VY+A LNDG +VA+KKLDV+ E +++ EFL+QVSMVS+LKHENL++LLG+CV+GNLR+LA
Sbjct  98    VYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLA  157

Query  627   YEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDI  806
             YEFATMGSLHDILHGRKGVQGAQPGPTLDW  RV+IAV+AA+GLEYLHEK QPPVIHRDI
Sbjct  158   YEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDI  217

Query  807   RSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVY  986
             RSSNVLLFE++KAKIADFNLSNQAPD AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVY
Sbjct  218   RSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVY  277

Query  987   SFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvakl  1166
             SFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQC+DPKLK +YPPK VAKL
Sbjct  278   SFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKL  337

Query  1167  aavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             AAVAALCVQYEAEFRPNM+IVVKALQPLLK
Sbjct  338   AAVAALCVQYEAEFRPNMSIVVKALQPLLK  367



>ref|XP_002461902.1| hypothetical protein SORBIDRAFT_02g010180 [Sorghum bicolor]
 gb|EER98423.1| hypothetical protein SORBIDRAFT_02g010180 [Sorghum bicolor]
Length=367

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/357 (78%), Positives = 313/357 (88%), Gaps = 8/357 (2%)
 Frame = +3

Query  189   KWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPV-KTEVQKAIPSIEVP  365
             KWLCC C V++    H+ E  K  +N  D K    +K +K   PV + E + + P+I+VP
Sbjct  2     KWLCCNCHVDDEEDGHDMEQAKTQSNKIDPK----QKSSK--PPVSQPEPEFSPPTIDVP  55

Query  366   ELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQV  545
             ELSLD+LK++T++FGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N EFL QV
Sbjct  56    ELSLDDLKQKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLD-ASENEPNDEFLKQV  114

Query  546   SMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQR  725
             S+ SKLKHENLVE+LGYCV+GN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW QR
Sbjct  115   SLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQR  174

Query  726   VRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHS  905
             V+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLHS
Sbjct  175   VKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLHS  234

Query  906   TRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATP  1085
             TRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATP
Sbjct  235   TRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATP  294

Query  1086  RLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             RLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+
Sbjct  295   RLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQ  351



>ref|XP_009144276.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X1 [Brassica 
rapa]
Length=366

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/365 (75%), Positives = 316/365 (87%), Gaps = 4/365 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYE-KGTKVATPVKTEVQKAIPSIE  359
             M +W+CC     +S  S++ + LK     ++G     + K   VA P   E  K    IE
Sbjct  1     MHRWICCGRTSGDSDVSNDEQHLKTQWQQSEGAANNNKPKPQAVAKP---EAPKEALPIE  57

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LS++E+KE+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+
Sbjct  58    VPLLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLS  117

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKHEN ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW 
Sbjct  118   QVSMVSRLKHENFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWI  177

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AK+ADFNLSNQAPD AARL
Sbjct  178   TRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKVADFNLSNQAPDNAARL  237

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  238   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  297

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVK  QPLLK+
Sbjct  298   TPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKPFQPLLKT  357

Query  1260  SAPAP  1274
              AP P
Sbjct  358   PAPVP  362



>gb|EEC71964.1| hypothetical protein OsI_04798 [Oryza sativa Indica Group]
Length=369

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/360 (77%), Positives = 310/360 (86%), Gaps = 6/360 (2%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             R R W+CC CQV ES       A K  T++ADG      KG K +   K + Q +  +I 
Sbjct  3     RWRHWICCNCQVNESDQLENGHA-KVLTSNADG----VTKGLKDSATEKAQPQNSALTIN  57

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             +P LSLDEL E+T++FGS ALIGEGSYGRVY+A L+ G  +AVKKLD S+E +  +EFLT
Sbjct  58    IPVLSLDELVEKTDDFGSSALIGEGSYGRVYYAVLDSGTKIAVKKLD-SNENEPTSEFLT  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QV++VS+LKHEN V++LGYC EGNLR++AYEFATMGSLHD+LHGRKGVQGAQPGP LDW 
Sbjct  117   QVALVSRLKHENFVDMLGYCTEGNLRLVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWM  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRVRIAVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAK+ADFNLSNQAPDMAARL
Sbjct  177   QRVRIAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKVADFNLSNQAPDMAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRL+EDKVKQC+DP+L GEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL S
Sbjct  297   TPRLTEDKVKQCIDPRLNGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLTS  356



>ref|XP_006645177.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Oryza brachyantha]
Length=369

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/360 (77%), Positives = 311/360 (86%), Gaps = 6/360 (2%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             R R W+CC C V+ES       A K   N+ DG      KG K +   KT+ Q    +I 
Sbjct  3     RWRSWICCNCVVDESDQLENGHA-KVLANNVDG----VTKGLKDSATEKTQPQNPALTIN  57

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             +P LSLDEL E+T++FGSKALIGEGSYGRVY+A L+ G  +AVKKLD S+E +  +EFLT
Sbjct  58    IPVLSLDELVEKTDDFGSKALIGEGSYGRVYYAVLHSGTKIAVKKLD-SNENEPTSEFLT  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QV++VS+LKHENLV++LGYC+EGNLR++AYEFATMGSLHD+LHGRKGVQGAQPGP LDW 
Sbjct  117   QVALVSRLKHENLVDMLGYCMEGNLRMVAYEFATMGSLHDVLHGRKGVQGAQPGPALDWM  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRV+IAVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAK+ADFNLSNQAPDMAARL
Sbjct  177   QRVKIAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKVADFNLSNQAPDMAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRL+EDKVKQC+DP+L GEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL S
Sbjct  297   TPRLTEDKVKQCIDPRLNGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLTS  356



>dbj|BAJ84876.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87206.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/358 (77%), Positives = 304/358 (85%), Gaps = 8/358 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR WLCC  +  E    HE E  K   N  DGK        K + P + E   + P+I V
Sbjct  1     MRNWLCCKGRRGEDDDEHEMEHSKAQGNKIDGK-------QKSSKPAEPEPDISPPTINV  53

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS ++LKE+T+NFGS +LIGEGSYGRVY A ++DG+  AVKK D +SE + N EFL Q
Sbjct  54    PELSFEDLKEKTDNFGSSSLIGEGSYGRVYHATMDDGRQAAVKKFD-ASENEHNDEFLKQ  112

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHENLVE+LGY VEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  113   VSLVSRLKHENLVEMLGYYVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  172

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  173   RVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  232

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  233   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  292

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRLSEDKVKQCVDP+LKGEYPPKGVAKL AVAALCVQYEAEFRPNM+IVVKAL PLL+
Sbjct  293   PRLSEDKVKQCVDPRLKGEYPPKGVAKLGAVAALCVQYEAEFRPNMSIVVKALSPLLQ  350



>ref|XP_006650884.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Oryza brachyantha]
Length=368

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/360 (79%), Positives = 310/360 (86%), Gaps = 11/360 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTK--VATPVKTEVQKAIPSI  356
             MR+W CC C  +E    H  E      N  D K    +K +K  V+ P   E + A  +I
Sbjct  1     MRQWFCCNCHFDEE-DDHGKERSNAQGNKTDAK----QKSSKPPVSQP---EPEIAPLTI  52

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             +VPELSL++LK++T+NFGS ALIGEGSYGRVY A L+D +  AVKKLD +SE + N EFL
Sbjct  53    DVPELSLEDLKQKTDNFGSNALIGEGSYGRVYHATLDDERQAAVKKLD-ASENEPNDEFL  111

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              QVS+VSKLKHENLVE+LGYCVEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW
Sbjct  112   KQVSLVSKLKHENLVEMLGYCVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDW  171

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
             TQRV+IA++AAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAAR
Sbjct  172   TQRVKIAIEAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAAR  231

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW
Sbjct  232   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  291

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNMTIVVKAL PLL+
Sbjct  292   ATPRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMTIVVKALSPLLQ  351



>ref|XP_008674700.1| PREDICTED: LOW QUALITY PROTEIN: PTI1-like tyrosine-protein kinase 
3 [Zea mays]
Length=363

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/365 (76%), Positives = 312/365 (85%), Gaps = 7/365 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             M +  CC CQV+ES   HE+  +K   N+ DG       G K +T  K E Q A P I++
Sbjct  1     MWRRCCCNCQVDES-DQHENGHVKATINNIDGAI----MGLKDSTTGKVEPQDAAPQIDI  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDEL E+T++FGS ALIGEGSYGRVY+A L++G  +AVKKLD S+E +  AEFLTQ
Sbjct  56    PVLSLDELIEKTDDFGSTALIGEGSYGRVYYAILDNGTKMAVKKLD-STENEPTAEFLTQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN V++LGYC+E NLRI+AYEFATMGSLHD+LHGRKGVQGAQPG  LDW Q
Sbjct  115   VSLVSRLKHENFVDMLGYCMERNLRIVAYEFATMGSLHDVLHGRKGVQGAQPGLALDWMQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  175   RVQIAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKIADFNLSNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-  1259
             PRL+EDKVKQCVDP+L GEYP KG+AKLAAVAALCVQYEAEF PNM+IVVKAL PLL + 
Sbjct  295   PRLTEDKVKQCVDPRLMGEYPAKGLAKLAAVAALCVQYEAEFXPNMSIVVKALSPLLVTK  354

Query  1260  SAPAP  1274
               P+P
Sbjct  355   QTPSP  359



>emb|CDY29646.1| BnaA04g17810D [Brassica napus]
Length=368

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/363 (77%), Positives = 320/363 (88%), Gaps = 11/363 (3%)
 Frame = +3

Query  183   MRKWLCC-TCQVEESYPSHESEALKGPTN----DADGKFGRYEKGTKVATPVKTEVQKAI  347
             MR+W+CC      +S  S++ + LK        DA  +  R +  TK   P     ++A+
Sbjct  1     MRRWICCGRISGGDSDLSNDEQHLKTQWQQQQPDAANQKLRPQPATKPDAP-----KEAL  55

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             P IEVP LS++E+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++NA
Sbjct  56    P-IEVPPLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNA  114

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EFL+QVSMVS+LKH+NL++L+GYCV+ +LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPT
Sbjct  115   EFLSQVSMVSRLKHDNLIQLVGYCVDEDLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPT  174

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             LDW  RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AKIADFNLSNQAPD 
Sbjct  175   LDWITRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKIADFNLSNQAPDN  234

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL
Sbjct  235   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  294

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQP
Sbjct  295   VTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQP  354

Query  1248  LLK  1256
             LLK
Sbjct  355   LLK  357



>ref|XP_008666980.1| PREDICTED: putative Pti1-like kinase isoform X1 [Zea mays]
 gb|ACG35108.1| protein kinase Pti1 [Zea mays]
 gb|ACN25707.1| unknown [Zea mays]
 tpg|DAA39739.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=368

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/368 (76%), Positives = 313/368 (85%), Gaps = 7/368 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C  +     H  E  K  +N  D K    +K +K     + E + + P+I+V
Sbjct  1     MRRWLCCNCHYDVEEDDHAKEQAKAQSNKTDSK----QKSSKPPG-SQPEPEFSPPTIDV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSLD+LK +T++FGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N EFL Q
Sbjct  56    PELSLDDLKLKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLD-ASENEPNDEFLKQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKHENLVE+LGYCV+GN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  115   VSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  175   RVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALC QYEAEFRPNM+IVVKAL PLL+  
Sbjct  295   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCAQYEAEFRPNMSIVVKALSPLLQQR  354

Query  1263  APAPESPE  1286
              PAP + E
Sbjct  355   -PAPTTEE  361



>ref|XP_009141095.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X1 [Brassica 
rapa]
Length=368

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/363 (76%), Positives = 320/363 (88%), Gaps = 11/363 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTN-----DADGKFGRYEKGTKVATPVKTEVQKAI  347
             MR+W+CC     +S  S++ + ++         DA  +  + +  TK   P     ++A+
Sbjct  1     MRRWICCGRISGDSDLSNDQQHVETHWQQQQQPDAANQKLKPQPATKPDVP-----KEAL  55

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             P IEVP LS++E+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++NA
Sbjct  56    P-IEVPPLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNA  114

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EFL+QVSMVS+LKH+NL++L+GYCV+ +LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPT
Sbjct  115   EFLSQVSMVSRLKHDNLIQLVGYCVDEDLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPT  174

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             LDW  RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AKIADFNLSNQAPD 
Sbjct  175   LDWITRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKIADFNLSNQAPDN  234

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL
Sbjct  235   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  294

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQP
Sbjct  295   VTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQP  354

Query  1248  LLK  1256
             LLK
Sbjct  355   LLK  357



>ref|XP_009141096.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 isoform X2 [Brassica 
rapa]
Length=367

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/363 (76%), Positives = 321/363 (88%), Gaps = 12/363 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALK-----GPTNDADGKFGRYEKGTKVATPVKTEVQKAI  347
             MR+W+CC     +S  S++ + ++         DA+ K  + +  TK   P     ++A+
Sbjct  1     MRRWICCGRISGDSDLSNDQQHVETHWQQQQQPDANQKL-KPQPATKPDVP-----KEAL  54

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             P IEVP LS++E+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++NA
Sbjct  55    P-IEVPPLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNA  113

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EFL+QVSMVS+LKH+NL++L+GYCV+ +LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPT
Sbjct  114   EFLSQVSMVSRLKHDNLIQLVGYCVDEDLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPT  173

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             LDW  RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AKIADFNLSNQAPD 
Sbjct  174   LDWITRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKIADFNLSNQAPDN  233

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL
Sbjct  234   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  293

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQP
Sbjct  294   VTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQP  353

Query  1248  LLK  1256
             LLK
Sbjct  354   LLK  356



>ref|XP_008651852.1| PREDICTED: salt-inducible putative protein serine/threonine/tyrosine 
kinase isoform X1 [Zea mays]
 ref|XP_008651853.1| PREDICTED: salt-inducible putative protein serine/threonine/tyrosine 
kinase isoform X1 [Zea mays]
 tpg|DAA62260.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=364

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/364 (75%), Positives = 308/364 (85%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT +   SY  HE+E    P       F            VK++  KA PSIEV
Sbjct  1     MRRWFCCT-RFNASYREHENERPITPEEKEGNGFS-----------VKSDPIKAPPSIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS +ELKE+T+NFGSKALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PELSFEELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH+N VE+LGYCVEGN R++ YEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+++AKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+  
Sbjct  289   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PQPP  352



>ref|NP_001051870.1| Os03g0844100 [Oryza sativa Japonica Group]
 gb|AAS07354.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF99848.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13784.1| Os03g0844100 [Oryza sativa Japonica Group]
 dbj|BAG90295.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76513.1| hypothetical protein OsI_14289 [Oryza sativa Indica Group]
 gb|EEE60282.1| hypothetical protein OsJ_13337 [Oryza sativa Japonica Group]
Length=368

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/368 (76%), Positives = 309/368 (84%), Gaps = 7/368 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CC C  +E    H  E      N  D K    +K +K     + E + A  +I+V
Sbjct  1     MRQWFCCNCHFDEE-DDHGKERSNAQGNKMDAK----QKSSKPPA-GQPEPEIAPLTIDV  54

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSL++LK++T+NFGS ALIGEGSYGRVY A L+DG+  AVKKLD +SE + N EFL Q
Sbjct  55    PELSLEDLKQKTDNFGSNALIGEGSYGRVYHATLDDGRQAAVKKLD-ASENEPNDEFLKQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS  S+LKHENLVE+LGYCVEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDWTQ
Sbjct  114   VSQASRLKHENLVEMLGYCVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWTQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA++AAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  174   RVKIAIEAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDP+LK EYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+  
Sbjct  294   PRLSEDKVKQCVDPRLKSEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQK  353

Query  1263  APAPESPE  1286
                P + E
Sbjct  354   PAVPAASE  361



>ref|XP_003578428.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Brachypodium 
distachyon]
Length=364

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 305/364 (84%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CC+ Q    Y  HE E    P       F             K++  KA P IE+
Sbjct  1     MRRWFCCS-QFHAPYREHEHEFPSSPDEKEGNGFAS-----------KSDPTKAPPPIEI  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSLDELKE+T+NFGSKALIGEGSYGRVY+A L+  K VAVKKLD SS+ + + EFLTQ
Sbjct  49    PELSLDELKEKTDNFGSKALIGEGSYGRVYYAILDSEKHVAVKKLDTSSDPEPDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             +S+VSKLKHEN VE+LGYCVEGN R++AYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   ISIVSKLKHENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDWIQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGL YLHEKVQP ++HRDIRSSN+LLFE++KAKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLAYLHEKVQPSIVHRDIRSSNILLFEDYKAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQC+DP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+  
Sbjct  289   PRLTEDTVKQCIDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PQPP  352



>emb|CDX97800.1| BnaC04g41390D [Brassica napus]
Length=369

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 319/364 (88%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCC-TCQVEESYPSHESEALKGPTN-----DADGKFGRYEKGTKVATPVKTEVQKA  344
             MR+W+CC      +S  S++ + LK         DA  +  R +   K   P     ++A
Sbjct  1     MRRWICCGRISGGDSGLSNDEQHLKTQWQQQQQPDAANQKLRPQPAAKPDAP-----KEA  55

Query  345   IPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSN  524
             +P IEVP LS++E+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++N
Sbjct  56    LP-IEVPPLSVEEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETN  114

Query  525   AEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGP  704
             +EFL+QVSMVS+LKH+NL++L+GYCV+ +LR+LAYEFATMGSLHD+LHGRKGVQGAQPGP
Sbjct  115   SEFLSQVSMVSRLKHDNLIQLVGYCVDEDLRVLAYEFATMGSLHDVLHGRKGVQGAQPGP  174

Query  705   TLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPD  884
             TLDW  RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AKIADFNLSNQAPD
Sbjct  175   TLDWITRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKIADFNLSNQAPD  234

Query  885   MAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  1064
              AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS
Sbjct  235   NAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQS  294

Query  1065  LVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             LVTWATPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  295   LVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQ  354

Query  1245  PLLK  1256
             PLLK
Sbjct  355   PLLK  358



>ref|NP_001105273.1| salt-inducible putative protein serine/threonine/tyrosine kinase 
[Zea mays]
 gb|AAU11815.1| salt-inducible putative protein serine/threonine/tyrosine kinase 
[Zea mays]
Length=364

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 307/364 (84%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT +   SY  HE+E    P       F            VK++  KA PSIEV
Sbjct  1     MRRWFCCT-RFNASYREHENERPITPEEKEGNGFS-----------VKSDPIKAPPSIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS +ELKE+T+NFGSKALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PELSFEELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH+N VE+LGYCVEGN R++ YEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+++AKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAM GQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMAGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+  
Sbjct  289   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PQPP  352



>emb|CDY06658.1| BnaA10g04370D [Brassica napus]
Length=408

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/355 (76%), Positives = 306/355 (86%), Gaps = 3/355 (1%)
 Frame = +3

Query  171   EKSRMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIP  350
             E+ RM KW+CCTCQ+++S   HE E LK              K  K     K EV+K   
Sbjct  40    ERMRMCKWMCCTCQIQDS---HEEEHLKSSHQHHHHSDAANHKNPKPPALAKPEVRKEPL  96

Query  351   SIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAE  530
              IEVP LSLDE+K++T+NFGSK+LIGEGSYGRVY+  LNDG +VA+KKLD + E +S+AE
Sbjct  97    PIEVPALSLDEVKQKTDNFGSKSLIGEGSYGRVYYGTLNDGIAVALKKLDAAPEAESDAE  156

Query  531   FLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTL  710
             FL+QVSMVS+LKHENLV+LLG+CV+G LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTL
Sbjct  157   FLSQVSMVSRLKHENLVQLLGFCVDGKLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTL  216

Query  711   DWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMA  890
             DWT RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSN+LLFE+++ KIADFNLSNQ+PD A
Sbjct  217   DWTTRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNILLFEDYRPKIADFNLSNQSPDNA  276

Query  891   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLV  1070
             ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD+ MPRGQQSLV
Sbjct  277   ARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDNNMPRGQQSLV  336

Query  1071  TWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             TWATPRLSEDKVK+C+DPKL  EYPPK VAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  337   TWATPRLSEDKVKECIDPKLNAEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVK  391



>dbj|BAD34419.1| putative Pto kinase interactor 1 [Oryza sativa Japonica Group]
Length=372

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/360 (76%), Positives = 308/360 (86%), Gaps = 4/360 (1%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKF--GRYEKGTKVATPVKTEVQKAIPSI  356
             +R+W CCT Q    Y  HE+E    P    D       +  G   A P   +  KA P I
Sbjct  2     LRRWFCCT-QFHAPYREHENEFPDIPEEKEDLNLFVNIWLAGNGFA-PKSDDPTKAPPPI  59

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             EVPELS DELKE+T+NFGSKAL+GEGSYGRVY+A L++GK VAVKKLD S+E + + +FL
Sbjct  60    EVPELSFDELKEKTDNFGSKALVGEGSYGRVYYATLDNGKQVAVKKLDASTEPEVDNDFL  119

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
             TQVS+VS+L+HEN VE+LGYCVEGN R++AYEFATMGSLHDILHGRKGV GAQPGP LDW
Sbjct  120   TQVSIVSRLRHENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDW  179

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRVRIA+DAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIADFN SNQ+PDMAAR
Sbjct  180   MQRVRIAIDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNPSNQSPDMAAR  239

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW
Sbjct  240   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  299

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+
Sbjct  300   ATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQ  359



>gb|ACL54553.1| unknown [Zea mays]
Length=364

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/364 (75%), Positives = 307/364 (84%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT +   SY  HE+E    P       F            VK++  KA PSIEV
Sbjct  1     MRRWFCCT-RFNASYREHENERPITPEEKEGNGFS-----------VKSDPIKAPPSIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS +ELKE+T+NFGSKALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PGLSFEELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH+N VE+LGYCVEGN R++ YEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+++AKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+  
Sbjct  289   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PQPP  352



>ref|XP_006660839.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Oryza brachyantha]
Length=361

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/358 (76%), Positives = 305/358 (85%), Gaps = 11/358 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             +R+W CCT Q    Y  HE+E    P       F           P   +  KA P I+V
Sbjct  2     LRRWFCCT-QFHAPYREHENEFPDIPDEKEGNGFA----------PKSDDPTKAPPPIKV  50

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS DELKE+T+NFGSKAL+GEGSYGRVY+A L++G  VAVKKLD S+E + + EFLTQ
Sbjct  51    PELSFDELKEKTDNFGSKALVGEGSYGRVYYATLDNGNHVAVKKLDASTEPELDNEFLTQ  110

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN VE+LGYC+EGN R++AYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  111   VSIVSRLKHENFVEMLGYCLEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  170

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSNVL+FE++KAKIADFNLSNQ+PDMAARLH
Sbjct  171   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNVLIFEDYKAKIADFNLSNQSPDMAARLH  230

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  231   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  290

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+
Sbjct  291   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQ  348



>ref|XP_004957330.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Setaria 
italica]
Length=365

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/364 (76%), Positives = 307/364 (84%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT Q   SY  HE+E    P       F        VA    ++  KA P IEV
Sbjct  1     MRRWFCCT-QFHASYREHENELPISPDEKEGNGF--------VAN---SDPNKAPPPIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS +ELKE+T+NFGSKALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PELSFEELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH N VE+LGYCVEGN R++AYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSIASKLKHANFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKV+P ++HRDIRSSNVLLFE++KAKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVRPSIVHRDIRSSNVLLFEDYKAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+  
Sbjct  289   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PHPP  352



>gb|AFU92323.1| PTI1 [Bambusa multiplex var. riviereorum]
Length=364

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/373 (75%), Positives = 313/373 (84%), Gaps = 18/373 (5%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CC C  ++   +HE E  K             +K  K A   + E+  + P+I+V
Sbjct  1     MRQWFCCNCGFDDEEDAHEREHSKSQITK--------QKSLKPAGQPEPEI--SPPTIDV  50

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSL++LK++T+NFGS ALIGEGSYGRVY A L+DG+  AVKKLD ++E + N EFL Q
Sbjct  51    PELSLEDLKQKTDNFGSNALIGEGSYGRVYHATLDDGRQAAVKKLD-AAENEPNDEFLKQ  109

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHENLVE+LGY VE N RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  110   VSLVSRLKHENLVEMLGYYVEDNSRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  169

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA++AAKGLEYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  170   RVKIAIEAAKGLEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  229

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVV LELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  230   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVPLELLTGRKPVDHTMPRGQQSLVTWAT  289

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK--  1256
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+  
Sbjct  290   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQK  349

Query  1257  -----SSAPAPES  1280
                  +S PAPE+
Sbjct  350   PVAPAASEPAPET  362



>ref|NP_001105958.1| putative Pti1-like kinase [Zea mays]
 gb|ABG36852.1| putative Pti1-like kinase [Zea mays]
Length=368

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/368 (76%), Positives = 311/368 (85%), Gaps = 7/368 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC C  +     H  E  +  +N  D K    +K +K     + E + + P+I+V
Sbjct  1     MRRWLCCNCHYDVEEDDHAKEQAEAQSNKTDSK----QKSSKPPG-SQPEPEFSPPTIDV  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSLD+LK +T++FGS ALIGEGSYGRVY A L+DG+  AVKKLD + E + N EFL Q
Sbjct  56    PELSLDDLKLKTDDFGSSALIGEGSYGRVYHATLDDGRQAAVKKLD-APENEPNDEFLKQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKHENLVE+LGYCV+GN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  115   VSLASKLKHENLVEMLGYCVDGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  175   RVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDP+LKGEYPPKGVAKLAAVAALC QYEAEFRPNM+IV KAL PLL+  
Sbjct  295   PRLSEDKVKQCVDPRLKGEYPPKGVAKLAAVAALCAQYEAEFRPNMSIVAKALSPLLQQR  354

Query  1263  APAPESPE  1286
              PAP + E
Sbjct  355   -PAPTTEE  361



>ref|XP_009119040.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X1 [Brassica 
rapa]
Length=367

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/352 (76%), Positives = 304/352 (86%), Gaps = 3/352 (1%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             RM KW+CCTCQ+++S   HE E LK              K  K     K EV+K    IE
Sbjct  2     RMCKWMCCTCQIQDS---HEEEHLKSSHQHHHHSDAANHKNPKPPALAKPEVRKEPLPIE  58

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LSLDE+K++T+NFGSK+LIGEGSYGRVY+  LNDG +VA+KKLD + E +S+AEFL+
Sbjct  59    VPALSLDEVKQKTDNFGSKSLIGEGSYGRVYYGTLNDGIAVALKKLDAAPEAESDAEFLS  118

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKHENLV+LLG+CV+G LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDWT
Sbjct  119   QVSMVSRLKHENLVQLLGFCVDGKLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWT  178

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSN+LLFE+++ KIADFNLSNQ+PD AARL
Sbjct  179   TRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNILLFEDYRPKIADFNLSNQSPDNAARL  238

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD+ MPRGQQSLVTWA
Sbjct  239   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDNNMPRGQQSLVTWA  298

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             TPRLSEDKVK+C+DPKL  +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  299   TPRLSEDKVKECIDPKLNADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVK  350



>emb|CDY10217.1| BnaC05g04600D [Brassica napus]
Length=365

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/352 (77%), Positives = 305/352 (87%), Gaps = 5/352 (1%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             RM KW+CCTCQ+++S   HE E LK              K  K     K EV+K    IE
Sbjct  2     RMCKWMCCTCQIQDS---HEEEHLKSSHQHHHSDANH--KNPKPPAVAKPEVRKEPLPIE  56

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LSLDE+KE+T+NFGSK+LIGEGSYGRVY+  LNDG +VA+KKLD + E +S++EFL+
Sbjct  57    VPALSLDEVKEKTDNFGSKSLIGEGSYGRVYYGTLNDGVAVALKKLDAAPEAESDSEFLS  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKHENLV+LLG+CV+G LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDWT
Sbjct  117   QVSMVSRLKHENLVQLLGFCVDGKLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWT  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSNVLLFE++K KIADFNLSNQ+PD AARL
Sbjct  177   TRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKPKIADFNLSNQSPDNAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD+ MPRGQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDNNMPRGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             TPRLSEDKVK+C+DPKL+ +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  297   TPRLSEDKVKECIDPKLQADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVK  348



>ref|NP_001167677.1| uncharacterized protein LOC100381338 [Zea mays]
 gb|ACG34826.1| hypothetical protein [Zea mays]
Length=364

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/364 (75%), Positives = 306/364 (84%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT +   SY  HE+E    P       F            VK++  KA PSIEV
Sbjct  1     MRRWFCCT-RFNASYREHENERPITPEEKEGNGFS-----------VKSDPIKAPPSIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS +ELKE+T+NFGS ALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PELSFEELKEKTDNFGSMALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH+N VE+LGYCVEGN R++ YEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+++AKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PL +  
Sbjct  289   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLXQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PQPP  352



>ref|XP_003562475.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 [Brachypodium 
distachyon]
Length=368

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/368 (74%), Positives = 307/368 (83%), Gaps = 7/368 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR W CC C+       H+ E  K   N  D K    +K ++ A   + E+    P+I+V
Sbjct  1     MRHWFCCNCRFGGEEDDHDMEHSKAKGNKMDAK----QKSSRPAD--QPEIDFFPPTIDV  54

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS ++LK++T+NFGS +LIGEGSYGRVY A ++DG+  A+KK D +SE + N EFL Q
Sbjct  55    PELSFEDLKQKTDNFGSNSLIGEGSYGRVYHATMDDGRQAAIKKFD-ASENEPNDEFLKQ  113

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VSKL HENLVE+LGY VEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP LDW Q
Sbjct  114   VSLVSKLNHENLVEMLGYYVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPVLDWMQ  173

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA++AAKG+EYLHEKV P +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDMAARLH
Sbjct  174   RVKIAIEAAKGVEYLHEKVHPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDMAARLH  233

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  234   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  293

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQC+DP+LKGEYPPKGVAKLAAVAALCVQYEAEFRPNM+IVVKAL PLL+  
Sbjct  294   PRLSEDKVKQCIDPRLKGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPLLQQR  353

Query  1263  APAPESPE  1286
                P + E
Sbjct  354   PVVPAASE  361



>dbj|BAJ96290.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/357 (75%), Positives = 304/357 (85%), Gaps = 12/357 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CC+ Q   SY  HE E    P       F             K++  KA P IE+
Sbjct  1     MRRWFCCS-QFHASYREHEHEFPSSPDEKEGNGFD-----------TKSDPTKAPPPIEI  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELSLDELKE+T+NFGSKALIGEGSYGRVY+A L+ GK +AVKKLD S++ + + EFLTQ
Sbjct  49    PELSLDELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHLAVKKLDTSADPEPDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             +S+VS+LKHEN VE+LGYCVEGN R++AYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   LSIVSRLKHENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGL YLHEKVQP ++HRDIRSSNVLLFE+++AK+ADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLAYLHEKVQPSIVHRDIRSSNVLLFEDYRAKVADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRL+ED VKQC+DP+LKGE PPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL
Sbjct  289   PRLTEDTVKQCIDPRLKGECPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLL  345



>gb|ABG36851.1| putative Pti1-like kinase [Zea mays]
Length=364

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/364 (74%), Positives = 305/364 (84%), Gaps = 12/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT +   SY  H +E    P       F            VK++  KA PSIEV
Sbjct  1     MRRWFCCT-RFNASYREHVNERPITPEEKEGNGFS-----------VKSDPIKAPPSIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS +ELKE+T+NFGSKALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PELSFEELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH+N VE+LGYCVEGN R++ YEFATMGSLHDILHGRKGV G QPGP LDW Q
Sbjct  109   VSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGVQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+++AKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA 
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAA  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL+  
Sbjct  289   PRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLQHK  348

Query  1263  APAP  1274
                P
Sbjct  349   PQPP  352



>ref|XP_009119041.1| PREDICTED: PTI1-like tyrosine-protein kinase 1 isoform X2 [Brassica 
rapa]
Length=366

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/352 (76%), Positives = 305/352 (87%), Gaps = 4/352 (1%)
 Frame = +3

Query  180   RMRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             RM KW+CCTCQ+++S   HE E LK            + K  K     K EV+K    IE
Sbjct  2     RMCKWMCCTCQIQDS---HEEEHLKSSHQHHHHSDANH-KNPKPPALAKPEVRKEPLPIE  57

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LSLDE+K++T+NFGSK+LIGEGSYGRVY+  LNDG +VA+KKLD + E +S+AEFL+
Sbjct  58    VPALSLDEVKQKTDNFGSKSLIGEGSYGRVYYGTLNDGIAVALKKLDAAPEAESDAEFLS  117

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKHENLV+LLG+CV+G LR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDWT
Sbjct  118   QVSMVSRLKHENLVQLLGFCVDGKLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWT  177

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEK QPPVIHRDIRSSN+LLFE+++ KIADFNLSNQ+PD AARL
Sbjct  178   TRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNILLFEDYRPKIADFNLSNQSPDNAARL  237

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD+ MPRGQQSLVTWA
Sbjct  238   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDNNMPRGQQSLVTWA  297

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             TPRLSEDKVK+C+DPKL  +YPPK VAKLAAVAALCVQYEAEFRPNM+IVVK
Sbjct  298   TPRLSEDKVKECIDPKLNADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVK  349



>emb|CDM85329.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/389 (70%), Positives = 322/389 (83%), Gaps = 12/389 (3%)
 Frame = +3

Query  123   WLLFTIGEHKLIF*LSEKSRMRKWLCC-TCQVEESYPSHESEALKGPTNDADGKFGRYEK  299
             ++LF +G  +      E+   R+ +CC   + +E+   H     K  TN+ADG      K
Sbjct  2     YVLFIVGVKQG----KERVMWRRCICCQAAEFDENENGHAKAKAKASTNNADG----MRK  53

Query  300   GTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKS  479
             G K +  VK E Q + PSI +P LSLDEL E+T++FG+KALIGEGSYGRVY+A L++G  
Sbjct  54    GLKDSATVKAEPQDSAPSINIPVLSLDELIEKTDDFGAKALIGEGSYGRVYYAVLDNGTK  113

Query  480   VAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHD  659
             +AVKKLD S+E +  +EF TQVS+VS+LKHEN V++LGYC+E NLRI+AYEFATMGSLHD
Sbjct  114   MAVKKLD-STENEPISEFSTQVSLVSRLKHENFVDILGYCMERNLRIVAYEFATMGSLHD  172

Query  660   ILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEF  839
             +LHGRKGVQGAQPGP L+W QR++IAVDAAKGLEYLHEKVQP ++HRD+RSSN+LLFE+F
Sbjct  173   VLHGRKGVQGAQPGPPLNWMQRMKIAVDAAKGLEYLHEKVQPSIVHRDVRSSNILLFEDF  232

Query  840   KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLT  1019
             KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLT
Sbjct  233   KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLT  292

Query  1020  GRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYE  1199
             GRKPVDHT PRGQQSLVTWATPRL+EDKVK C+DP+L+GEYPPKG+AKL AVAALCVQYE
Sbjct  293   GRKPVDHTAPRGQQSLVTWATPRLTEDKVKGCIDPRLEGEYPPKGLAKLGAVAALCVQYE  352

Query  1200  AEFRPNMTIVVKALQPLL--KSSAPAPES  1280
             AEFRP+M+IVVKAL PL   + + PAP +
Sbjct  353   AEFRPSMSIVVKALSPLTLSRQTPPAPAA  381



>gb|EEC84875.1| hypothetical protein OsI_32021 [Oryza sativa Indica Group]
Length=417

 Score =   528 bits (1359),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 266/327 (81%), Positives = 294/327 (90%), Gaps = 0/327 (0%)
 Frame = +3

Query  294   EKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDG  473
             EK      P   +  KA P IEVPELS DELKE+T+NFGSKAL+GEGSYGRVY+A L++G
Sbjct  84    EKEGNGFAPKSDDPTKAPPPIEVPELSFDELKEKTDNFGSKALVGEGSYGRVYYATLDNG  143

Query  474   KSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSL  653
             K VAVKKLD S+E + + +FLTQVS+VS+L+HEN VE+LGYCVEGN R++AYEFATMGSL
Sbjct  144   KQVAVKKLDASTEPEVDNDFLTQVSIVSRLRHENFVEMLGYCVEGNQRLVAYEFATMGSL  203

Query  654   HDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFE  833
             HDILHGRKGV GAQPGP LDW QRVRIA+DAAKGLEYLHEKVQP ++HRDIRSSNVLLFE
Sbjct  204   HDILHGRKGVPGAQPGPALDWMQRVRIAIDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFE  263

Query  834   EFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL  1013
             ++KAKIADFN SNQ+PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL
Sbjct  264   DYKAKIADFNPSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLEL  323

Query  1014  LTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQ  1193
             LTGRKPVDHTMPRGQQSLVTWATPRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQ
Sbjct  324   LTGRKPVDHTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQ  383

Query  1194  YEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             YE+EFRPNM+IVVKAL PLL+   P P
Sbjct  384   YESEFRPNMSIVVKALSPLLQHKPPLP  410



>ref|XP_009132750.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Brassica rapa]
Length=363

 Score =   525 bits (1352),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 309/355 (87%), Gaps = 7/355 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVE-ESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             M +W+CC      +S  S++   LK      D    + +   K   P     ++A+P IE
Sbjct  1     MPRWICCGGHRRGDSDISNDDHHLKTQWQQPDANKAKPQAVAKPEAP-----KEALP-IE  54

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LS++E++E+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+
Sbjct  55    VPPLSVEEVEEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLS  114

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKHEN ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW 
Sbjct  115   QVSMVSRLKHENFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWI  174

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AKIADFNLSNQAPD AARL
Sbjct  175   TRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKIADFNLSNQAPDNAARL  234

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  235   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  294

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             TPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  295   TPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQ  349



>dbj|BAJ97816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   526 bits (1354),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 268/372 (72%), Positives = 312/372 (84%), Gaps = 6/372 (2%)
 Frame = +3

Query  171   EKSRMRKWLCC-TCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAI  347
             E+   R+ +CC   + +E+     +   K PTN+ DG     +KG K +  VK E Q + 
Sbjct  15    ERVMWRRCICCQAAEFDENENGRANPKAKAPTNNVDG----MKKGLKDSATVKAEPQDSA  70

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             PSI +P LSLDEL E+T++FG+KALIGEGSYGRVY+A L++G  +AVKKLD S+E +  +
Sbjct  71    PSINIPVLSLDELIEKTDDFGAKALIGEGSYGRVYYAVLDNGTKMAVKKLD-STENEPIS  129

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EF TQVS+VS+LKHEN V++LGYC+E NLRI+AYEFATMGSLHD+LHGRKGVQGAQPGP 
Sbjct  130   EFSTQVSLVSRLKHENFVDILGYCMERNLRIVAYEFATMGSLHDVLHGRKGVQGAQPGPP  189

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             L+W QR++IAVDAAKGLEYLHEKVQP ++HRD+RSSN+LLFE+FKAKIADFNLSNQAPDM
Sbjct  190   LNWMQRMKIAVDAAKGLEYLHEKVQPSIVHRDVRSSNILLFEDFKAKIADFNLSNQAPDM  249

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHT PRGQQSL
Sbjct  250   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTAPRGQQSL  309

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRL+EDKV  C+DP+L+GEYPPKGVAKL AVAALCVQYEAEFRP+M+IVVKAL P
Sbjct  310   VTWATPRLTEDKVTACIDPRLEGEYPPKGVAKLGAVAALCVQYEAEFRPSMSIVVKALSP  369

Query  1248  LLKSSAPAPESP  1283
             L  S    P  P
Sbjct  370   LTLSRQTPPAPP  381



>emb|CDX84819.1| BnaA03g14110D [Brassica napus]
Length=363

 Score =   525 bits (1351),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 268/355 (75%), Positives = 309/355 (87%), Gaps = 7/355 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVE-ESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             M +W+CC      +S  S++   LK      D    R +   K   P     ++A+P IE
Sbjct  1     MPRWICCGGHRRGDSDISNDDHHLKTQWQQPDANKTRPQAVAKPEAP-----KEALP-IE  54

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LS++E++E+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+
Sbjct  55    VPPLSVEEVEEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLS  114

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKHEN ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW 
Sbjct  115   QVSMVSRLKHENFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWI  174

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AK+ADFNLSNQAPD AARL
Sbjct  175   TRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKVADFNLSNQAPDNAARL  234

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  235   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  294

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             TPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  295   TPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQ  349



>emb|CDY23984.1| BnaC03g17070D [Brassica napus]
Length=363

 Score =   524 bits (1349),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 267/355 (75%), Positives = 310/355 (87%), Gaps = 7/355 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVE-ESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIE  359
             M +W+CC      +S  S++ + LK      D    R +   K   P     ++A+P IE
Sbjct  1     MPRWICCGGHRSGDSDISNDEKHLKTQWQQPDANKTRPQAVAKPEAP-----KEALP-IE  54

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LS++E++E+T+NFGSK+LIGEGSYGRVY+A L+DGK+VA+KKLDV+ E ++N EFL+
Sbjct  55    VPPLSVEEVEEKTDNFGSKSLIGEGSYGRVYYATLSDGKAVALKKLDVAPEAETNTEFLS  114

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVSMVS+LKH+N ++L+GYCV+ NLR+LAYEFATMGSLHD+LHGRKGVQGAQPGPTLDW 
Sbjct  115   QVSMVSRLKHDNFIQLVGYCVDENLRVLAYEFATMGSLHDVLHGRKGVQGAQPGPTLDWI  174

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
              RV+IAV+AA+GLEYLHEKVQPPVIHRD+RSSNVLLFE+++AK+ADFNLSNQAPD AARL
Sbjct  175   TRVKIAVEAARGLEYLHEKVQPPVIHRDVRSSNVLLFEDYQAKVADFNLSNQAPDNAARL  234

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  235   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  294

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQ  1244
             TPRLSEDKVKQCVDPKLKGEYPPK VAKLAAVAALCVQYE+EFRPNM+IVVKALQ
Sbjct  295   TPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQ  349



>gb|EAZ12767.1| hypothetical protein OsJ_02684 [Oryza sativa Japonica Group]
Length=417

 Score =   522 bits (1345),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 261/313 (83%), Positives = 290/313 (93%), Gaps = 0/313 (0%)
 Frame = +3

Query  318   PVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKL  497
             P   +  KA P IEVPELS DELKE+T+NFGSKAL+GEGSYGRVY+A L++GK VAVKKL
Sbjct  92    PKSDDPTKAPPPIEVPELSFDELKEKTDNFGSKALVGEGSYGRVYYATLDNGKQVAVKKL  151

Query  498   DVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRK  677
             D S+E + + +FLTQVS+VS+L+HEN VE+LGYCVEGN R++AYEFATMGSLHDILHGRK
Sbjct  152   DASTEPEVDNDFLTQVSIVSRLRHENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRK  211

Query  678   GVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIAD  857
             GV GAQPGP LDW QRVRIA+DAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIAD
Sbjct  212   GVPGAQPGPALDWMQRVRIAIDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIAD  271

Query  858   FNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD  1037
             FN SNQ+PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD
Sbjct  272   FNPSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD  331

Query  1038  HTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPN  1217
             HTMPRGQQSLVTWATPRL+ED VKQCVDP+LKGEYPPKGVAKLAAVAALCVQYE+EFRP+
Sbjct  332   HTMPRGQQSLVTWATPRLTEDTVKQCVDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPS  391

Query  1218  MTIVVKALQPLLK  1256
             M+IVVKAL PLL+
Sbjct  392   MSIVVKALSPLLQ  404



>ref|XP_002879277.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55536.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   519 bits (1336),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 267/366 (73%), Positives = 311/366 (85%), Gaps = 11/366 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W+CC  +   +  S E   +K P  ++D       +  + A P +T     +P IEV
Sbjct  1     MRRWMCCAGKKGVADSSTEELHMKSPWQNSDAN-----QKNQNAKPEET-----LP-IEV  49

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV+ E ++NAEFL+Q
Sbjct  50    PSLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEDETNAEFLSQ  109

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+LKHENL++L+GYCV+  LR+LAYE ATMGSLHDILHGRKGVQGAQPGPTLDW  
Sbjct  110   VSMVSRLKHENLIQLVGYCVDEKLRVLAYELATMGSLHDILHGRKGVQGAQPGPTLDWIT  169

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQP VIHRDIRSSNVLLFE++KAKIADFNLSNQAPD AARL 
Sbjct  170   RVKIAVEAARGLEYLHEKVQPHVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLQ  229

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STR+LGTFGYH+PEYAMTG+LT KSDVYSFGVVLLELLTGRKPVD TMPRGQQSLVTWAT
Sbjct  230   STRILGTFGYHSPEYAMTGELTHKSDVYSFGVVLLELLTGRKPVDPTMPRGQQSLVTWAT  289

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             P+LSED+V+QCVDPKLKGEYPPK VAKLAAVAALCVQYE+E RP M+ VVKALQ LL + 
Sbjct  290   PKLSEDEVEQCVDPKLKGEYPPKSVAKLAAVAALCVQYESECRPKMSTVVKALQQLLVAP  349

Query  1263  APAPES  1280
              P P+S
Sbjct  350   IPIPQS  355



>gb|EMS55178.1| PTI1-like tyrosine-protein kinase 3 [Triticum urartu]
Length=347

 Score =   516 bits (1330),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 256/310 (83%), Positives = 289/310 (93%), Gaps = 0/310 (0%)
 Frame = +3

Query  324   KTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDV  503
             K++  KA P IE+PELSLDELKE+T+NFGSKALIGEGSYGRVY+A L+ GK +AVKKLD 
Sbjct  19    KSDPTKAPPPIEIPELSLDELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHLAVKKLDT  78

Query  504   SSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGV  683
             S++ + + EFLTQ+S+VS+LKHEN VE+LGYCVEGN R++AYEFATMGSLHDILHGRKGV
Sbjct  79    SADPEPDNEFLTQLSIVSRLKHENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGV  138

Query  684   QGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFN  863
              GAQPGP LDW QRV+IA+DAAKGL YLHEKVQP ++HRDIRSSNVLLFE+++AK+ADFN
Sbjct  139   PGAQPGPALDWMQRVKIAIDAAKGLAYLHEKVQPSIVHRDIRSSNVLLFEDYRAKVADFN  198

Query  864   LSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHT  1043
             LSNQ+PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHT
Sbjct  199   LSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHT  258

Query  1044  MPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMT  1223
             MPRGQQSLVTWATPRL+ED VKQC+DP+LKGE PPKGVAKLAAVAALCVQYE+EFRP+M+
Sbjct  259   MPRGQQSLVTWATPRLTEDTVKQCIDPRLKGECPPKGVAKLAAVAALCVQYESEFRPSMS  318

Query  1224  IVVKALQPLL  1253
             IVVKAL PLL
Sbjct  319   IVVKALSPLL  328



>ref|XP_008664425.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Zea mays]
 ref|XP_008664429.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Zea mays]
 gb|ACN35686.1| unknown [Zea mays]
 tpg|DAA48309.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA48310.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
Length=363

 Score =   516 bits (1330),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 267/364 (73%), Positives = 307/364 (84%), Gaps = 11/364 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+   +  Y  +E+    G T+  D   G        + P K       PSIEV
Sbjct  1     MRRWLCCS-HFDTPYLENEN----GFTSSPDRTSGNGNGLNANSDPAKP------PSIEV  49

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDEL+E+T++FGSKAL+GEGSYGRVY+A L + + VAVKKLD S++ + + EFL Q
Sbjct  50    PALSLDELREKTDDFGSKALVGEGSYGRVYYAVLENEQHVAVKKLDTSADPEPDNEFLAQ  109

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN V++LGYC++G+ R+LAYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  110   VSVVSRLKHENFVDMLGYCIQGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWMQ  169

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIADFNLS+Q+PDMAARLH
Sbjct  170   RVKIAVDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNLSSQSPDMAARLH  229

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  230   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  289

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL EDKVKQCVDP+L GEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL ++
Sbjct  290   PRLGEDKVKQCVDPRLNGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLVNA  349

Query  1263  APAP  1274
                P
Sbjct  350   PYQP  353



>gb|EMS48873.1| PTI1-like tyrosine-protein kinase 3 [Triticum urartu]
Length=363

 Score =   516 bits (1329),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 257/303 (85%), Positives = 283/303 (93%), Gaps = 1/303 (0%)
 Frame = +3

Query  348   PSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNA  527
             P+I+VPELS ++LKE+T+NFGS +LIGEGSYGRVY A ++DG+  A+KK D +SE + N 
Sbjct  45    PTIDVPELSFEDLKEKTDNFGSSSLIGEGSYGRVYHATMDDGRQAAIKKFD-ASENEPND  103

Query  528   EFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPT  707
             EFL QVS+VS+LKHENLVE+LGY VEGN RILAYEFATMGSLHD+LHGRKGVQGAQPGP 
Sbjct  104   EFLKQVSLVSRLKHENLVEMLGYYVEGNYRILAYEFATMGSLHDVLHGRKGVQGAQPGPV  163

Query  708   LDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDM  887
             LDW QRV+IA++AAKG+EYLHEKVQP +IHRDIRSSNVLLFE+FKAKIADFNL NQAPDM
Sbjct  164   LDWMQRVKIAIEAAKGIEYLHEKVQPSIIHRDIRSSNVLLFEDFKAKIADFNLLNQAPDM  223

Query  888   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  1067
             AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL
Sbjct  224   AARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSL  283

Query  1068  VTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQP  1247
             VTWATPRLSEDKVKQCVDP+LKGEYPPKGVAKL AVAALCVQYEAEFRPNM+IVVKAL P
Sbjct  284   VTWATPRLSEDKVKQCVDPRLKGEYPPKGVAKLGAVAALCVQYEAEFRPNMSIVVKALSP  343

Query  1248  LLK  1256
             LL+
Sbjct  344   LLQ  346



>ref|XP_002445776.1| hypothetical protein SORBIDRAFT_07g025590 [Sorghum bicolor]
 gb|EES15271.1| hypothetical protein SORBIDRAFT_07g025590 [Sorghum bicolor]
Length=361

 Score =   514 bits (1325),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 271/371 (73%), Positives = 308/371 (83%), Gaps = 16/371 (4%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGR-YEKGTKVATPVKTEVQKAIPSIE  359
             MR+WLCC+   +  Y  +E+    G T+  D   G      +  A P         PSIE
Sbjct  1     MRRWLCCS-HFDTPYLENEN----GFTSSPDKTSGNDLNSNSDPAKP---------PSIE  46

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             VP LS DELKE+T++FGSKAL+GEGSYGRVY+A L   + VAVKKLD S++ + + EFL 
Sbjct  47    VPALSFDELKEKTDDFGSKALVGEGSYGRVYYAVLETEQHVAVKKLDTSADPEPDNEFLA  106

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             QVS VS+LKHEN V+LLGYC+EG+ R+LAYEFATMGSLHDILHGRKGV GAQPGP LDW 
Sbjct  107   QVSTVSRLKHENFVDLLGYCIEGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWM  166

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRV+IAVDAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIADFNLS+Q+PDMAARL
Sbjct  167   QRVKIAVDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNLSSQSPDMAARL  226

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA
Sbjct  227   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  286

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRL EDKVKQCVDP+L GEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL +
Sbjct  287   TPRLGEDKVKQCVDPRLNGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLVN  346

Query  1260  SAPAPE-SPEI  1289
             +   P  +P+I
Sbjct  347   APYQPAGAPDI  357



>ref|XP_004970349.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X5 
[Setaria italica]
Length=361

 Score =   514 bits (1325),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 298/357 (83%), Gaps = 13/357 (4%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT   +  Y  +E+     P   +          T  + P K       PSIEV
Sbjct  1     MRRWFCCT-HFDTPYLENENGFTSSPDRTSGNGL------TSNSDPAKP------PSIEV  47

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P L  DELKE+T++FGSK L+GEGSYGRVY+A L +GK  AVKKLD S++ + + EFL Q
Sbjct  48    PALLFDELKEKTDDFGSKTLVGEGSYGRVYYAVLENGKHAAVKKLDASADPEPDNEFLAQ  107

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN V++LGYC+EG+ R+LAYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  108   VSVVSRLKHENFVDMLGYCIEGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWMQ  167

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIADFNLS+Q+PDMAARLH
Sbjct  168   RVRIAVDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNLSSQSPDMAARLH  227

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  228   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  287

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRL EDKVKQC+DP+L GEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL
Sbjct  288   PRLGEDKVKQCIDPRLNGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLL  344



>tpg|DAA56330.1| TPA: putative protein kinase superfamily protein, partial [Zea 
mays]
Length=336

 Score =   513 bits (1320),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 263/342 (77%), Positives = 295/342 (86%), Gaps = 6/342 (2%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             M +  CC CQV+ES   HE+  +K   N+ DG       G K +T  K E Q A P I++
Sbjct  1     MWRRCCCNCQVDES-DQHENGHVKATINNIDGAI----MGLKDSTTGKVEPQDAAPQIDI  55

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDEL E+T++FGS ALIGEGSYGRVY+A L++G  +AVKKLD S+E +  AEFLTQ
Sbjct  56    PVLSLDELIEKTDDFGSTALIGEGSYGRVYYAILDNGTKMAVKKLD-STENEPTAEFLTQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN V++LGYC+E NLRI+AYEFATMGSLHD+LHGRKGVQGAQPG  LDW Q
Sbjct  115   VSLVSRLKHENFVDMLGYCMERNLRIVAYEFATMGSLHDVLHGRKGVQGAQPGLALDWMQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+FKAKIADFNLSNQAPDMAARLH
Sbjct  175   RVQIAVDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDFKAKIADFNLSNQAPDMAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEF  1208
             PRL+EDKVKQCVDP+L GEYP KG+AKLAAVAALCVQYEAEF
Sbjct  295   PRLTEDKVKQCVDPRLMGEYPAKGLAKLAAVAALCVQYEAEF  336



>tpg|DAA48308.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=361

 Score =   513 bits (1322),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 267/364 (73%), Positives = 307/364 (84%), Gaps = 13/364 (4%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+WLCC+   +  Y  +E+    G T+  D   G        + P K       PSIEV
Sbjct  1     MRRWLCCS-HFDTPYLENEN----GFTSSPDRTSGNGLNAN--SDPAKP------PSIEV  47

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDEL+E+T++FGSKAL+GEGSYGRVY+A L + + VAVKKLD S++ + + EFL Q
Sbjct  48    PALSLDELREKTDDFGSKALVGEGSYGRVYYAVLENEQHVAVKKLDTSADPEPDNEFLAQ  107

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN V++LGYC++G+ R+LAYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  108   VSVVSRLKHENFVDMLGYCIQGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWMQ  167

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAVDAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIADFNLS+Q+PDMAARLH
Sbjct  168   RVKIAVDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNLSSQSPDMAARLH  227

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  228   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  287

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRL EDKVKQCVDP+L GEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL ++
Sbjct  288   PRLGEDKVKQCVDPRLNGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLLVNA  347

Query  1263  APAP  1274
                P
Sbjct  348   PYQP  351



>gb|EMT05387.1| Serine/threonine-protein kinase PBS1 [Aegilops tauschii]
Length=437

 Score =   516 bits (1328),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/348 (76%), Positives = 296/348 (85%), Gaps = 11/348 (3%)
 Frame = +3

Query  210   QVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELK  389
             Q   SY  HE E    P       F             K++  K  P IE+PELSLDELK
Sbjct  82    QFHASYREHEHEFPSSPDEKEGNGFDS-----------KSDPTKTPPPIEIPELSLDELK  130

Query  390   EQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKH  569
             E+T+NFGSKALIGEGSYGRVY+A L+ GK +AVKKLD S++ + + EFLTQ+S+VS+LKH
Sbjct  131   EKTDNFGSKALIGEGSYGRVYYAILDSGKHLAVKKLDTSADPEPDNEFLTQLSIVSRLKH  190

Query  570   ENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAA  749
             EN VE+LGYCVEGN R++AYEFATMGSLHDILHGRKGV GAQPGP LDW QRV+IA+DAA
Sbjct  191   ENFVEMLGYCVEGNQRLVAYEFATMGSLHDILHGRKGVPGAQPGPALDWMQRVKIAIDAA  250

Query  750   KGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFG  929
             KGL YLHEKVQP ++HRDIRSSNVLLFE+++AK+ADFNLSNQ+PDMAARLHSTRVLGTFG
Sbjct  251   KGLAYLHEKVQPSIVHRDIRSSNVLLFEDYRAKVADFNLSNQSPDMAARLHSTRVLGTFG  310

Query  930   YHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVK  1109
             YHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL+ED VK
Sbjct  311   YHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTEDTVK  370

Query  1110  QCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             QC+DP+LKGE PPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL
Sbjct  371   QCIDPRLKGECPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLL  418



>ref|XP_003574855.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Brachypodium 
distachyon]
 ref|XP_010235355.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Brachypodium 
distachyon]
 ref|XP_010235356.1| PREDICTED: PTI1-like tyrosine-protein kinase 3 [Brachypodium 
distachyon]
Length=359

 Score =   511 bits (1315),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/357 (74%), Positives = 299/357 (84%), Gaps = 12/357 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CC   V+  Y  H    +  P   A+G  G    G    TP+          IEV
Sbjct  1     MRRWFCC-AHVDTPYHEHGDGFVNSPEK-ANGN-GFTPDGDHGKTPL---------PIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS  ELKE+T++FGSKAL+GEGSYGRVY+A L +GK VAVKKLD S++ + + EF+ Q
Sbjct  49    PELSFAELKEKTDDFGSKALVGEGSYGRVYYAVLENGKHVAVKKLDTSADPEPDNEFIAQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS++S+LKH+N V++LGYC+EG+ R+LAYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSVISRLKHDNFVDMLGYCLEGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             R++I VDAAKGLEYLHEKVQP V+HRDIRSSNVLLFE++KAKIADFNLSNQ+PDMAARLH
Sbjct  169   RIKIVVDAAKGLEYLHEKVQPSVVHRDIRSSNVLLFEDYKAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             PRL EDKV QCVDP+L GEYPPKGVAKLAAVAALCVQYE+EFRP+M+IVVKAL PLL
Sbjct  289   PRLGEDKVTQCVDPRLNGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPLL  345



>dbj|BAF79941.1| receptor-like kinase [Marchantia polymorpha]
Length=369

 Score =   506 bits (1302),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 295/361 (82%), Gaps = 2/361 (1%)
 Frame = +3

Query  192   WLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPEL  371
             W CC         S++      P  +  G      K ++   P        +  I  P +
Sbjct  3     WCCCCEDRNIEKLSNDQSGYHHPNQNMHGGGQGAPKPSENQPPKPGGQTPKLQPISAPSI  62

Query  372   SLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSM  551
             +++EL+E T+NFG KALIGEGSYGRVY+ANL DG++ A+KKLD S++ D   EFLTQVSM
Sbjct  63    TIEELREATDNFGPKALIGEGSYGRVYYANLQDGRAAAIKKLDASTQPDQ--EFLTQVSM  120

Query  552   VSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVR  731
             VS+LK+EN+VEL+GYC++   R+LAYEFATMGSLHDILHGRKGV+GAQPGP LDW QRV+
Sbjct  121   VSRLKNENVVELIGYCLDNTQRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLDWMQRVK  180

Query  732   IAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTR  911
             IAV +A+GLEYLHEK QP +IHRDI+SSNVLLF+++ AKIADFNLSNQAPDMAARLHSTR
Sbjct  181   IAVGSARGLEYLHEKAQPAIIHRDIKSSNVLLFDDYTAKIADFNLSNQAPDMAARLHSTR  240

Query  912   VLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL  1091
             VLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL
Sbjct  241   VLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL  300

Query  1092  SEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPA  1271
             SEDKVKQCVDPKLKGEYPPK VAK+AAVAALCVQYEA+FRPNM+IVVKALQPLL +   A
Sbjct  301   SEDKVKQCVDPKLKGEYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALQPLLTTRTAA  360

Query  1272  P  1274
             P
Sbjct  361   P  361



>ref|XP_010276544.1| PREDICTED: pto-interacting protein 1-like [Nelumbo nucifera]
Length=362

 Score =   504 bits (1297),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 261/368 (71%), Positives = 299/368 (81%), Gaps = 12/368 (3%)
 Frame = +3

Query  198   CCTCQVEESYPSHESEALKGPTNDADGKFGRY---EKGTKVATPVKTEVQKAIPSIEVPE  368
             C +C  E+      +       NDA G  G Y   E   K   PVK +       I VP 
Sbjct  3     CFSCCEEDEIHKAANSGAPFVANDAAGNGGGYHATEAAPKGTQPVKVQ------PIAVPA  56

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             +S+DELKE T+NFG+KALIGEGSYGRVY+  L DG++ A+KKLD S + D   EFL QVS
Sbjct  57    ISVDELKEVTDNFGTKALIGEGSYGRVYYGLLKDGRAAAIKKLDASKQPDQ--EFLAQVS  114

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             MVS+LKHEN+VE+LGYCV+G+LR+LAYEFATMGSLHDILHGRKGV+GAQPGP L W QRV
Sbjct  115   MVSRLKHENVVEMLGYCVDGSLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRV  174

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             +IAV AAKGLEYLHEK QPP+IHRDI+SSNVLLF++  AKIADF+LSNQAPDMAARLHST
Sbjct  175   KIAVGAAKGLEYLHEKAQPPIIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHST  234

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQL+ KSDVYSFGVV+LELLTGRKPVDHT+PRGQQSLVTWATPR
Sbjct  235   RVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVVLELLTGRKPVDHTLPRGQQSLVTWATPR  294

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS-SA  1265
             LSEDKV+QCVD +L G+YPPK  AK+AAVAALCVQYEA+FRPNM+IVVKALQPLL + S 
Sbjct  295   LSEDKVRQCVDARLGGDYPPKAAAKMAAVAALCVQYEADFRPNMSIVVKALQPLLNARSG  354

Query  1266  PAPESPEI  1289
             P  E+P +
Sbjct  355   PPGETPNL  362



>ref|XP_006294520.1| hypothetical protein CARUB_v10023553mg [Capsella rubella]
 gb|EOA27418.1| hypothetical protein CARUB_v10023553mg [Capsella rubella]
Length=345

 Score =   503 bits (1295),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 260/362 (72%), Positives = 297/362 (82%), Gaps = 18/362 (5%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CC  + E S  S+    LK P+                       +++A  SIEV
Sbjct  1     MRKWICCARKQEVSGSSNAQLHLKIPSRAV------------------ANLEEARLSIEV  42

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGK+VA+KKLDV  E ++NA+FL+Q
Sbjct  43    PPLSLDEIKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVEPEAETNAKFLSQ  102

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             V+MVS+LKH N ++L GY V  NLR+LAYEFATMGSLHDILHGRKGVQGA+PGPTLDW  
Sbjct  103   VAMVSRLKHVNFIQLFGYFVVDNLRVLAYEFATMGSLHDILHGRKGVQGAKPGPTLDWLT  162

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHEKVQPPVIH+DIRSSNVLLF++++AKIADFNLSNQ PD AARL 
Sbjct  163   RVKIAVEAARGLEYLHEKVQPPVIHKDIRSSNVLLFDDYQAKIADFNLSNQDPDNAARLQ  222

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTG LT KSDVYSFGVVLLELLTGRKP+DH MPRGQQSLVTWAT
Sbjct  223   STRVLGTFGYHAPEYAMTGLLTPKSDVYSFGVVLLELLTGRKPLDHKMPRGQQSLVTWAT  282

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             P+LSEDKVKQCVD KLKGEYP K VAKLAAVAALCVQY+A+ RP M+ VVKALQ LLK  
Sbjct  283   PKLSEDKVKQCVDRKLKGEYPLKSVAKLAAVAALCVQYDADCRPTMSTVVKALQRLLKPH  342

Query  1263  AP  1268
              P
Sbjct  343   VP  344



>ref|XP_006492834.1| PREDICTED: probable protein kinase At2g41970-like [Citrus sinensis]
 gb|KDO70882.1| hypothetical protein CISIN_1g046595mg [Citrus sinensis]
Length=363

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 259/364 (71%), Positives = 298/364 (82%), Gaps = 6/364 (2%)
 Frame = +3

Query  195   LCCTCQVEESYP-SHESEALKGPTNDADGKFGRYEKGTKVATPVKTEV-QKAIPSIEVPE  368
             LCC  Q EE  P + ++ A     N   G   R E  T V   VKT   QKA+P IE+P+
Sbjct  2     LCCGGQEEEPQPPASQTTAPPRSGNTQPGGSARGEPRTNV---VKTGTPQKALP-IEIPQ  57

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             + LDEL   T NFG+KALIGEGSYGRV++A L DG   A+KKLD SS  +  ++F  Q+S
Sbjct  58    IKLDELNRLTSNFGTKALIGEGSYGRVFYAKLTDGTPAAIKKLDTSSAPEPESDFAAQLS  117

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             +VS+LKHE+ VELLGYC+E N RIL Y+FATMGSLHD+LHGRKGVQGA+PGP L W QRV
Sbjct  118   VVSRLKHEHFVELLGYCMESNNRILVYQFATMGSLHDVLHGRKGVQGAEPGPVLTWNQRV  177

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             ++A  AAKGLE+LHEKVQPP++HRD+RSSNVLLF++FK+KIADFNL+NQ+ D AARLHST
Sbjct  178   KVAYGAAKGLEFLHEKVQPPIVHRDVRSSNVLLFDDFKSKIADFNLTNQSSDTAARLHST  237

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPR
Sbjct  238   RVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPR  297

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKVKQCVDPKL  +YPPK +AKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S   
Sbjct  298   LSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPA  357

Query  1269  APES  1280
              PE+
Sbjct  358   GPEA  361



>ref|XP_006429911.1| hypothetical protein CICLE_v10013472mg [Citrus clementina]
 gb|ESR43151.1| hypothetical protein CICLE_v10013472mg [Citrus clementina]
Length=363

 Score =   502 bits (1293),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 259/364 (71%), Positives = 298/364 (82%), Gaps = 6/364 (2%)
 Frame = +3

Query  195   LCCTCQVEESYP-SHESEALKGPTNDADGKFGRYEKGTKVATPVKTEV-QKAIPSIEVPE  368
             LCC  Q EE  P + ++ A     N   G   R E  T V   VKT   QKA+P IE+P+
Sbjct  2     LCCGGQEEEPQPPASQTTAPPRSGNTQPGGSARGEPRTNV---VKTGTPQKALP-IEIPQ  57

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             + LDEL   T NFG+KALIGEGSYGRV++A L DG   A+KKLD SS  +  ++F  Q+S
Sbjct  58    IKLDELNRLTSNFGTKALIGEGSYGRVFYAKLTDGTPAAIKKLDTSSAPEPESDFAAQLS  117

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             +VS+LKHE+ VELLGYC+E N RIL Y+FATMGSLHD+LHGRKGVQGA+PGP L W QRV
Sbjct  118   VVSRLKHEHFVELLGYCLESNNRILVYQFATMGSLHDVLHGRKGVQGAEPGPVLTWNQRV  177

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             ++A  AAKGLE+LHEKVQPP++HRD+RSSNVLLF++FK+KIADFNL+NQ+ D AARLHST
Sbjct  178   KVAYGAAKGLEFLHEKVQPPIVHRDVRSSNVLLFDDFKSKIADFNLTNQSSDTAARLHST  237

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPR
Sbjct  238   RVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPR  297

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKVKQCVDPKL  +YPPK +AKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S   
Sbjct  298   LSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPA  357

Query  1269  APES  1280
              PE+
Sbjct  358   GPEA  361



>ref|XP_006849729.1| hypothetical protein AMTR_s00024p00246360 [Amborella trichopoda]
 gb|ERN11310.1| hypothetical protein AMTR_s00024p00246360 [Amborella trichopoda]
Length=361

 Score =   502 bits (1292),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 263/362 (73%), Positives = 296/362 (82%), Gaps = 4/362 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELS  374
             LCC    EE Y    ++    P     G  G   KG  VA       QK +P IE P LS
Sbjct  2     LCCGGAEEEPYGQPTNQHTNPPNGRPYGNEG-MSKGPNVAK--NGAPQKVLP-IETPALS  57

Query  375   LDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMV  554
             L ELK+ T NFG+KALIGEGSYGRV++A L  G++ A+K+LD SS Q+S+A+F  Q+SMV
Sbjct  58    LSELKQLTNNFGTKALIGEGSYGRVFYATLQTGQAAAIKQLDPSSFQESDADFAEQLSMV  117

Query  555   SKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRI  734
             S+LKHE++VEL+GYC+E N RILAY++ATMGSLHDI+HGRKGVQ A+PGP LDW QRVRI
Sbjct  118   SRLKHEHIVELIGYCLEANNRILAYQYATMGSLHDIIHGRKGVQDAEPGPILDWNQRVRI  177

Query  735   AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRV  914
             A  AAKGLEYLHEKVQPPVIHRDIRSSNVL+F+++ AKIADFNL++QAPDMAARLHSTRV
Sbjct  178   AHGAAKGLEYLHEKVQPPVIHRDIRSSNVLIFDDYSAKIADFNLTSQAPDMAARLHSTRV  237

Query  915   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS  1094
             LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRLS
Sbjct  238   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLS  297

Query  1095  EDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             EDKVKQCV PKL   YPPK VAK+AAVAALCVQYEA+FRPNMTIVVKALQPLL S     
Sbjct  298   EDKVKQCVHPKLNNNYPPKAVAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNSRPGGT  357

Query  1275  ES  1280
             ES
Sbjct  358   ES  359



>tpg|DAA62261.1| TPA: putative protein kinase superfamily protein, partial [Zea 
mays]
Length=330

 Score =   498 bits (1283),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 240/320 (75%), Positives = 270/320 (84%), Gaps = 12/320 (4%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT +   SY  HE+E    P       F            VK++  KA PSIEV
Sbjct  1     MRRWFCCT-RFNASYREHENERPITPEEKEGNGFS-----------VKSDPIKAPPSIEV  48

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             PELS +ELKE+T+NFGSKALIGEGSYGRVY+A L+ GK VAVKKLD S++ + + EFLTQ
Sbjct  49    PELSFEELKEKTDNFGSKALIGEGSYGRVYYAILDSGKHVAVKKLDASTDPELDNEFLTQ  108

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+ SKLKH+N VE+LGYCVEGN R++ YEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  109   VSIASKLKHDNFVEMLGYCVEGNQRLVVYEFATMGSLHDILHGRKGVPGAQPGPALDWMQ  168

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA+DAAKGLEYLHEKVQP ++HRDIRSSN+LLFE+++AKIADFNLSNQ+PDMAARLH
Sbjct  169   RVKIAIDAAKGLEYLHEKVQPSIVHRDIRSSNILLFEDYRAKIADFNLSNQSPDMAARLH  228

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  229   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  288

Query  1083  PRLSEDKVKQCVDPKLKGEY  1142
             PRL+ED VKQCVDP+LKGEY
Sbjct  289   PRLTEDTVKQCVDPRLKGEY  308



>ref|XP_004970345.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X1 
[Setaria italica]
 ref|XP_004970346.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X2 
[Setaria italica]
 ref|XP_004970347.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X3 
[Setaria italica]
 ref|XP_004970348.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like isoform X4 
[Setaria italica]
Length=394

 Score =   501 bits (1289),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 257/390 (66%), Positives = 292/390 (75%), Gaps = 46/390 (12%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MR+W CCT   +  Y  +E+     P   +          T  + P K       PSIEV
Sbjct  1     MRRWFCCT-HFDTPYLENENGFTSSPDRTSGNGL------TSNSDPAKP------PSIEV  47

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P L  DELKE+T++FGSK L+GEGSYGRVY+A L +GK  AVKKLD S++ + + EFL Q
Sbjct  48    PALLFDELKEKTDDFGSKTLVGEGSYGRVYYAVLENGKHAAVKKLDASADPEPDNEFLAQ  107

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VS+VS+LKHEN V++LGYC+EG+ R+LAYEFATMGSLHDILHGRKGV GAQPGP LDW Q
Sbjct  108   VSVVSRLKHENFVDMLGYCIEGDQRLLAYEFATMGSLHDILHGRKGVAGAQPGPALDWMQ  167

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RVRIAVDAAKGLEYLHEKVQP ++HRDIRSSNVLLFE++KAKIADFNLS+Q+PDMAARLH
Sbjct  168   RVRIAVDAAKGLEYLHEKVQPSIVHRDIRSSNVLLFEDYKAKIADFNLSSQSPDMAARLH  227

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT
Sbjct  228   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  287

Query  1083  PRLSEDKVKQCVDPKLKGEY---------------------------------ppkgvak  1163
             PRL EDKVKQC+DP+L GEY                                       +
Sbjct  288   PRLGEDKVKQCIDPRLNGEYPPKGVAKVWSSTLLPCVLLLYNLISEIQSYQQLFSLLSMQ  347

Query  1164  laavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             LAAVAALCVQYE+EFRP+M+IVVKAL PLL
Sbjct  348   LAAVAALCVQYESEFRPSMSIVVKALSPLL  377



>ref|XP_010270968.1| PREDICTED: pto-interacting protein 1 [Nelumbo nucifera]
 ref|XP_010270969.1| PREDICTED: pto-interacting protein 1 [Nelumbo nucifera]
Length=362

 Score =   499 bits (1284),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 261/344 (76%), Positives = 297/344 (86%), Gaps = 6/344 (2%)
 Frame = +3

Query  261   TNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSY  440
              N++ G  G Y   T+VA P  T+  K  P IEVP +S+DELKE T+NFG+K+LIGEGSY
Sbjct  24    ANNSAGNGGGY-PATEVA-PKGTQPVKVQP-IEVPAISVDELKEVTDNFGTKSLIGEGSY  80

Query  441   GRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRI  620
             GRVY+  L DG++ A+KKLD S + D   EFL QVSMVS+LKHEN+VELLGYCV+G+LR+
Sbjct  81    GRVYYGLLKDGRAAAIKKLDASKQPDQ--EFLAQVSMVSRLKHENVVELLGYCVDGSLRV  138

Query  621   LAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHR  800
             L+YEFATMGSLHDILHGRKGV+GAQPGP L W QRV+IAV AAKGLEYLHEK QP +IHR
Sbjct  139   LSYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHR  198

Query  801   DIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSD  980
             DI+SSNVLLF++  AKIADF+LSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL+ KSD
Sbjct  199   DIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSD  258

Query  981   VYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgva  1160
             VYSFGVVLLELLTGRKPVDHT+PRGQQSLVTWATPRLSEDKVKQCVD +L G+YPPK VA
Sbjct  259   VYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLGGDYPPKAVA  318

Query  1161  klaavaalCVQYEAEFRPNMTIVVKALQPLLKS-SAPAPESPEI  1289
             K+AAVAALCVQYEA+FRPNM+IVVKALQPLL + S P  ESP +
Sbjct  319   KMAAVAALCVQYEADFRPNMSIVVKALQPLLNARSGPPGESPNL  362



>ref|XP_009604049.1| PREDICTED: probable protein kinase At2g41970 [Nicotiana tomentosiformis]
Length=365

 Score =   499 bits (1284),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 295/367 (80%), Gaps = 12/367 (3%)
 Frame = +3

Query  198   CCTCQVEESY----PSHESEALKGPTNDADGKFGRYEKG--TKVATPVKTEVQKAIPSIE  359
             CC    E+ Y    PS+++ A     N   G   R E G   K  TP     QK +P IE
Sbjct  3     CCGGGEEDVYSGGPPSNQNTAPPRAGNPYGGASDRGEPGGGAKTGTP-----QKVLP-IE  56

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             +P +SLDEL + T NFG KALIGEGSYGRV+FA L+DG+  A+KKLD SS  + +++F  
Sbjct  57    IPVVSLDELNKLTGNFGQKALIGEGSYGRVFFAKLSDGQQAAIKKLDTSSSSEPDSDFTA  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             Q+SMVS+LKHE+ V L+GYC+E N RIL YEFA MGSLHD+LHGRKGVQGA+PGP L W 
Sbjct  117   QLSMVSRLKHEHFVTLMGYCLEANNRILVYEFAAMGSLHDVLHGRKGVQGAEPGPVLTWN  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             +RV+IA  AAKGLEYLHEKVQPP++HRD+RSSNVLLF++F AKIADFNL+NQ+ D AARL
Sbjct  177   ERVKIAYGAAKGLEYLHEKVQPPIVHRDVRSSNVLLFDDFTAKIADFNLTNQSSDTAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRLSEDKVKQCVDPKL  +YP K +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL +
Sbjct  297   TPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNA  356

Query  1260  SAPAPES  1280
                 PES
Sbjct  357   KPAGPES  363



>emb|CAE55203.1| protein kinase 1 [Nicotiana tabacum]
Length=365

 Score =   498 bits (1282),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 294/367 (80%), Gaps = 12/367 (3%)
 Frame = +3

Query  198   CCTCQVEESY----PSHESEALKGPTNDADGKFGRYEKG--TKVATPVKTEVQKAIPSIE  359
             CC    E+ Y    PS+++ A     N   G   R E G   K  TP     QK +P IE
Sbjct  3     CCGGGEEDVYSGGPPSNQNTAPPRAGNPYGGASDRGEPGGGAKTGTP-----QKVLP-IE  56

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             +P +SLDEL + T NFG KALIGEGSYGRV+FA L+DG+  A+KKLD SS  + +++F  
Sbjct  57    IPVVSLDELNKLTGNFGQKALIGEGSYGRVFFAKLSDGQQAAIKKLDTSSSSEPDSDFTA  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             Q+SMVS LKHE+ V L+GYC+E N RIL YEFA MGSLHD+LHGRKGVQGA+PGP L W 
Sbjct  117   QLSMVSALKHEHFVTLMGYCLEANNRILVYEFAAMGSLHDVLHGRKGVQGAEPGPVLTWN  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             +RV+IA  AAKGLEYLHEKVQPP++HRD+RSSNVLLF++F AKIADFNL+NQ+ D AARL
Sbjct  177   ERVKIAYGAAKGLEYLHEKVQPPIVHRDVRSSNVLLFDDFTAKIADFNLTNQSSDTAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRLSEDKVKQCVDPKL  +YP K +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL +
Sbjct  297   TPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNA  356

Query  1260  SAPAPES  1280
                 PES
Sbjct  357   KPAGPES  363



>ref|XP_002974370.1| hypothetical protein SELMODRAFT_149642 [Selaginella moellendorffii]
 ref|XP_002975243.1| hypothetical protein SELMODRAFT_150414 [Selaginella moellendorffii]
 gb|EFJ24028.1| hypothetical protein SELMODRAFT_150414 [Selaginella moellendorffii]
 gb|EFJ24592.1| hypothetical protein SELMODRAFT_149642 [Selaginella moellendorffii]
Length=355

 Score =   497 bits (1280),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 254/309 (82%), Positives = 279/309 (90%), Gaps = 4/309 (1%)
 Frame = +3

Query  354   IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEF  533
             I VP L +DELKE TENFG K+LIGEGSYGRVY A L  G++ A+KKLD +S+ D   EF
Sbjct  50    IAVPMLGIDELKEATENFGPKSLIGEGSYGRVYLAELRSGQA-AIKKLDQNSQPDQ--EF  106

Query  534   LTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLD  713
             L QVSMVS+LK+EN+VEL+GYCV+G LR+LAYEFATMGSLHDILHGRKGV+GA PGP LD
Sbjct  107   LAQVSMVSRLKNENVVELIGYCVDGPLRVLAYEFATMGSLHDILHGRKGVKGALPGPVLD  166

Query  714   WTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAA  893
             W QRV+IAV AAKGLEYLHEKV PP+IHRDI+SSNVLLF+++ AKIADFNLSNQAPD AA
Sbjct  167   WAQRVKIAVGAAKGLEYLHEKVSPPLIHRDIKSSNVLLFDDYTAKIADFNLSNQAPDTAA  226

Query  894   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  1073
             RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDH+MPRGQQSLVT
Sbjct  227   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHSMPRGQQSLVT  286

Query  1074  WATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             WATPRLSEDKVKQCVDPKLKGEYP K VAK+AAVAALCVQYEA+FRPNM IVVKALQPLL
Sbjct  287   WATPRLSEDKVKQCVDPKLKGEYPAKAVAKMAAVAALCVQYEADFRPNMGIVVKALQPLL  346

Query  1254  KS-SAPAPE  1277
              + +APA E
Sbjct  347   TARAAPAAE  355



>gb|KDP24647.1| hypothetical protein JCGZ_25563 [Jatropha curcas]
Length=365

 Score =   497 bits (1279),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 248/336 (74%), Positives = 289/336 (86%), Gaps = 2/336 (1%)
 Frame = +3

Query  282   FGRYEKGT-KVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFA  458
             +G  ++G  K A P K+   + +  IEVP +SL+EL   T+NFGSKALIGEGSYGRV++A
Sbjct  29    YGDSQRGEPKSANPAKSGAPQKMLPIEVPSMSLEELNRLTDNFGSKALIGEGSYGRVFYA  88

Query  459   NLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFA  638
              L DG   A+KKLD ++ Q+ +++F  Q+S+VS+LKH++ +EL+GYC+E N RIL Y+FA
Sbjct  89    KLEDGGEAAIKKLDANTSQEPDSDFAAQLSLVSRLKHDHFLELMGYCLESNSRILVYQFA  148

Query  639   TMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSN  818
             TMGSLHD+LHGRKGVQGA+PGP L W QRV+IA  AAKGLEYLHEK QPPV+HRD+RSSN
Sbjct  149   TMGSLHDVLHGRKGVQGAEPGPVLSWNQRVKIAFGAAKGLEYLHEKCQPPVVHRDVRSSN  208

Query  819   VLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGV  998
             VLLF++F AKIADFNLS+ + D AARLHSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGV
Sbjct  209   VLLFDDFMAKIADFNLSSASSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGV  268

Query  999   VLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaava  1178
             VLLELLTGRKPVDHTMP+GQQSLVTWATPRLSEDKVKQCVDPKL  EYPPK +AKLAAVA
Sbjct  269   VLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCVDPKLNNEYPPKAIAKLAAVA  328

Query  1179  alCVQYEAEFRPNMTIVVKALQPLLKSSAPA-PESP  1283
             ALCVQYEA+FRPNMTIVVKALQPLL SS PA PE+P
Sbjct  329   ALCVQYEADFRPNMTIVVKALQPLLNSSKPAGPETP  364



>ref|XP_006840315.1| hypothetical protein AMTR_s00045p00078520 [Amborella trichopoda]
 gb|ERN01990.1| hypothetical protein AMTR_s00045p00078520 [Amborella trichopoda]
Length=362

 Score =   496 bits (1278),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 262/372 (70%), Positives = 302/372 (81%), Gaps = 13/372 (3%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGP--TNDADGKFGRYEKGTKVATPVKTEVQKAIPSI  356
             M  + CC     E  P  ++     P   N+  G  G ++     A P  ++V +  P I
Sbjct  1     MGCFSCC-----EDDPIQKASDGGNPFMANNMAGNVGNHQAAD--AAPKGSQVVQVQP-I  52

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             EV  +S+DELKE T+NFGSKALIGEGSYGRVY+  L  G++ A+KKLD S + D   EFL
Sbjct  53    EVAAISVDELKEITDNFGSKALIGEGSYGRVYYGVLKSGQAAAIKKLDASKQPDQ--EFL  110

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              QVSMVS+L HEN+VEL+GYCV+GNLR+LAYEFATMGSLHDILHGRKGV+GAQPGP L W
Sbjct  111   AQVSMVSRLTHENVVELVGYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSW  170

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRV+IAV AA+GLEYLHEK QP +IHRDI+SSNVLLF++  AKIADF+LSNQAPDMAAR
Sbjct  171   AQRVKIAVGAARGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAAR  230

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQL+ KSDVYSFGVVLLELLTGRKPVDHT+PRGQQSLVTW
Sbjct  231   LHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTW  290

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVD +L GEYPPK VAK+AAVAALCVQYEA+FRPNM+IVVKALQPLL 
Sbjct  291   ATPRLSEDKVKQCVDTRLGGEYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALQPLLN  350

Query  1257  SS-APAPESPEI  1289
             +  APA ++P +
Sbjct  351   ARPAPAGDNPSL  362



>ref|XP_010510296.1| PREDICTED: PTI1-like tyrosine-protein kinase 2 [Camelina sativa]
Length=348

 Score =   495 bits (1274),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 295/362 (81%), Gaps = 14/362 (4%)
 Frame = +3

Query  183   MRKWLCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEV  362
             MRKW+CC  + + S  S++   LK   N A  K                E Q+    I+V
Sbjct  1     MRKWICCAPKQKVSDSSNDGLHLKSTRNHAAAK--------------PEEAQRKPLPIQV  46

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LS+DE+KE+T+NFGSK+LIGEGSYGRVY+A LNDGKSVA+K LDV  E ++NA+FL Q
Sbjct  47    PRLSIDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKSVALKNLDVDPEGETNAKFLIQ  106

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             VSMVS+L H+NL++L+GY V  NLR+LAYEFA MGSLHDILHGRKGV+GAQPGPTLDW  
Sbjct  107   VSMVSRLNHKNLIQLVGYYVGENLRVLAYEFAPMGSLHDILHGRKGVRGAQPGPTLDWIT  166

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IAV+AA+GLEYLHE V+P VIHRDIRSSNVLLFE+++AKIADFNLSNQ PD AARL 
Sbjct  167   RVKIAVEAARGLEYLHENVRPHVIHRDIRSSNVLLFEDYQAKIADFNLSNQDPDNAARLQ  226

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STR+LGTFGY APEYAMTGQLTQKSDVYSFGVVLLE+LTGRKPVD TMPRGQQSLVTWAT
Sbjct  227   STRILGTFGYRAPEYAMTGQLTQKSDVYSFGVVLLEILTGRKPVDPTMPRGQQSLVTWAT  286

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSE +V QCVDPKLKG+YPPK VAKLA+VAALCVQ+E+E RP M+ VVKALQ LLK  
Sbjct  287   PRLSEGEVMQCVDPKLKGKYPPKSVAKLASVAALCVQFESECRPTMSTVVKALQQLLKPR  346

Query  1263  AP  1268
              P
Sbjct  347   VP  348



>ref|XP_010257509.1| PREDICTED: probable protein kinase At2g41970 isoform X3 [Nelumbo 
nucifera]
Length=363

 Score =   494 bits (1271),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 254/362 (70%), Positives = 295/362 (81%), Gaps = 2/362 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELS  374
             LCC    EE+Y    ++    P       F R E     A+      QK +P IE P LS
Sbjct  2     LCCGGAEEENYGPPVNQYTAPPKGGDSQGFARGESRGPSASRSGAP-QKVLP-IETPALS  59

Query  375   LDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMV  554
             LDEL   T NFGSKALIGEGSYGRV+ A L++G++ A+KKLD SS Q+ +++F  Q+S+V
Sbjct  60    LDELNRLTGNFGSKALIGEGSYGRVFHATLSNGQAAAIKKLDASSSQEPDSDFAAQLSVV  119

Query  555   SKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRI  734
             S+LK+E+ VELLGYC+E N RILAY+FAT+GSLHD+LHGRKGVQGA+PGP L+W QRV+I
Sbjct  120   SRLKNEHFVELLGYCLEANNRILAYQFATLGSLHDVLHGRKGVQGAEPGPVLNWNQRVKI  179

Query  735   AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRV  914
             A  AA+GLEYLHEKVQP ++HRD+RSSNVLLF++F AKIADFNLS+Q+ D AARLHSTRV
Sbjct  180   AYGAARGLEYLHEKVQPSIVHRDVRSSNVLLFDDFLAKIADFNLSSQSTDTAARLHSTRV  239

Query  915   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS  1094
             LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRLS
Sbjct  240   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLS  299

Query  1095  EDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             EDKVKQCVDPKL  +YPPK +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL S    P
Sbjct  300   EDKVKQCVDPKLNNDYPPKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGP  359

Query  1275  ES  1280
             +S
Sbjct  360   DS  361



>ref|XP_010036502.1| PREDICTED: probable protein kinase At2g41970 [Eucalyptus grandis]
 ref|XP_010036503.1| PREDICTED: probable protein kinase At2g41970 [Eucalyptus grandis]
 gb|KCW48115.1| hypothetical protein EUGRSUZ_K01851 [Eucalyptus grandis]
Length=363

 Score =   494 bits (1271),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 259/363 (71%), Positives = 291/363 (80%), Gaps = 4/363 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTN-DADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPEL  371
             LCC    EE+Y    S+    P   D  G      K + VA       QK +P IEVP L
Sbjct  2     LCCGGSEEENYGPPASQYTAPPRGGDPYGNARGEPKPSNVAR--GGAPQKVLP-IEVPAL  58

Query  372   SLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSM  551
             SL EL   T NFGSKAL+GEGSYGRV+ A L++G+  AVKKLD SS ++ ++EF  Q+SM
Sbjct  59    SLGELNRTTGNFGSKALVGEGSYGRVFLAKLSNGQRAAVKKLDTSSSEEPDSEFEAQLSM  118

Query  552   VSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVR  731
             VS+LKHEN  EL+GYC+E N RIL Y+FAT GSLHDILHGRKGVQ A+PGP L W QRV+
Sbjct  119   VSRLKHENFTELIGYCLEANNRILVYQFATQGSLHDILHGRKGVQNAEPGPVLSWNQRVK  178

Query  732   IAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTR  911
             IA  AA+GLEYLHEKVQPP++HRDIRSSNVLLF++F AKIADFNLSNQ+ D AARLHSTR
Sbjct  179   IAYGAARGLEYLHEKVQPPIVHRDIRSSNVLLFDDFLAKIADFNLSNQSSDTAARLHSTR  238

Query  912   VLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL  1091
             VLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRL
Sbjct  239   VLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRL  298

Query  1092  SEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPA  1271
             SEDKVKQCVDPKL  +YPPK +AKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S    
Sbjct  299   SEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAG  358

Query  1272  PES  1280
             P+S
Sbjct  359   PDS  361



>ref|XP_010257510.1| PREDICTED: probable protein kinase At2g41970 isoform X4 [Nelumbo 
nucifera]
Length=363

 Score =   494 bits (1271),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 254/362 (70%), Positives = 295/362 (81%), Gaps = 2/362 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELS  374
             LCC    EE+Y    ++    P       F R E     A+      QK +P IE P LS
Sbjct  2     LCCGGAEEENYGPPVNQYTAPPKGGDSQGFARGESRGPSASRSGAP-QKVLP-IETPALS  59

Query  375   LDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMV  554
             LDEL   T NFGSKALIGEGSYGRV+ A L++G++ A+KKLD SS Q+ +++F  Q+S+V
Sbjct  60    LDELNRLTGNFGSKALIGEGSYGRVFHATLSNGQAAAIKKLDASSSQEPDSDFAAQLSVV  119

Query  555   SKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRI  734
             S+LK+E+ VELLGYC+E N RILAY+FAT+GSLHD+LHGRKGVQGA+PGP L+W QRV+I
Sbjct  120   SRLKNEHFVELLGYCLEANNRILAYQFATLGSLHDVLHGRKGVQGAEPGPVLNWNQRVKI  179

Query  735   AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRV  914
             A  AA+GLEYLHEKVQP ++HRD+RSSNVLLF++F AKIADFNLS+Q+ D AARLHSTRV
Sbjct  180   AYGAARGLEYLHEKVQPSIVHRDVRSSNVLLFDDFLAKIADFNLSSQSTDTAARLHSTRV  239

Query  915   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS  1094
             LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRLS
Sbjct  240   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLS  299

Query  1095  EDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             EDKVKQCVDPKL  +YPPK +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL S    P
Sbjct  300   EDKVKQCVDPKLNNDYPPKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGP  359

Query  1275  ES  1280
             +S
Sbjct  360   DS  361



>ref|XP_009767643.1| PREDICTED: probable protein kinase At2g41970 isoform X1 [Nicotiana 
sylvestris]
Length=365

 Score =   494 bits (1271),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 254/367 (69%), Positives = 292/367 (80%), Gaps = 12/367 (3%)
 Frame = +3

Query  198   CCTCQVEESY----PSHESEALKGPTNDADGKFGRYEK--GTKVATPVKTEVQKAIPSIE  359
             CC    E+ Y    PS+++ A  G  N   G   R E   G K  T      QK +P IE
Sbjct  3     CCGGGEEDVYSGGPPSNQNTAPPGAGNPYGGASDRGEPRGGAKTGT-----AQKVLP-IE  56

Query  360   VPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLT  539
             +P + LDEL + T NFG KALIGEGSYGRV+FA L+ G+  A+KKLD SS  + +++F  
Sbjct  57    IPVVPLDELNKLTGNFGQKALIGEGSYGRVFFAKLSYGQQAAIKKLDTSSSSEPDSDFTA  116

Query  540   QVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWT  719
             Q+SMVS+LKHE+   L+GYC+E N RIL YEFA MGSLHD+LHGRKGVQGA+PGP L W 
Sbjct  117   QLSMVSRLKHEHFATLMGYCLEANNRILVYEFAAMGSLHDVLHGRKGVQGAEPGPVLTWN  176

Query  720   QRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARL  899
             QRV+IA  AAKGLEYLHEKVQPP++HRD+RSSNVLLF++F AKIADFNL+NQ+ D AARL
Sbjct  177   QRVKIAYGAAKGLEYLHEKVQPPIVHRDVRSSNVLLFDDFTAKIADFNLTNQSSDTAARL  236

Query  900   HSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWA  1079
             HSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWA
Sbjct  237   HSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWA  296

Query  1080  TPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKS  1259
             TPRLSEDKVKQCVDPKL  +YP K +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL +
Sbjct  297   TPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNA  356

Query  1260  SAPAPES  1280
                 PES
Sbjct  357   KPAGPES  363



>ref|XP_001766765.1| predicted protein [Physcomitrella patens]
 gb|EDQ68396.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   493 bits (1270),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 250/308 (81%), Positives = 283/308 (92%), Gaps = 4/308 (1%)
 Frame = +3

Query  354   IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEF  533
             I  P+LSLDE+++ T+NFG K+LIGEGSY RVY+A+L D +  A+KKLDVSS+ DS  EF
Sbjct  56    ISAPQLSLDEIRDCTDNFGPKSLIGEGSYARVYYASLPD-RVAAIKKLDVSSQPDS--EF  112

Query  534   LTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLD  713
             L+QVS+VS+LKHEN+VEL+GYC++G LR+LAYE+ATMGSLHDILHGRKGV+GAQPGP LD
Sbjct  113   LSQVSLVSRLKHENVVELIGYCLDGQLRVLAYEYATMGSLHDILHGRKGVKGAQPGPVLD  172

Query  714   WTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAA  893
             W QRV+IAV AA+GLEYLHEK QPP+IHRDI+SSNVLLF+ + AKIADFNLSNQAPDMAA
Sbjct  173   WMQRVKIAVGAARGLEYLHEKAQPPIIHRDIKSSNVLLFDSYVAKIADFNLSNQAPDMAA  232

Query  894   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  1073
             RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVD TMPRGQQSLVT
Sbjct  233   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDPTMPRGQQSLVT  292

Query  1074  WATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             WATPRLSEDKVKQCVDPKL+ EYPPK VAK+AAVAALCVQYE +FRPNM+IVVKALQPLL
Sbjct  293   WATPRLSEDKVKQCVDPKLRSEYPPKAVAKMAAVAALCVQYEPDFRPNMSIVVKALQPLL  352

Query  1254  KSSAPAPE  1277
              S+ PAP+
Sbjct  353   -SARPAPQ  359



>gb|ADE77381.1| unknown [Picea sitchensis]
Length=360

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 247/311 (79%), Positives = 282/311 (91%), Gaps = 3/311 (1%)
 Frame = +3

Query  354   IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEF  533
             IEVP++ ++ELKE T+NFG K+LIGEGSYGRVY++ L +G++ A+KKLD S + D   EF
Sbjct  52    IEVPQIPIEELKEATDNFGPKSLIGEGSYGRVYYSVLRNGRTAAIKKLDTSKQPDQ--EF  109

Query  534   LTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLD  713
             L QVSMVS LKHEN++EL+GYCVEG+LR+LAYEFATMGSLHDILHGRKGV+GAQPGP L 
Sbjct  110   LAQVSMVSGLKHENVLELVGYCVEGSLRVLAYEFATMGSLHDILHGRKGVRGAQPGPVLT  169

Query  714   WTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAA  893
             W QRV+IAV+AAKGLEYLHEK Q P+IHRDI+SSN+LLF++  AKIADF++SNQAPDMAA
Sbjct  170   WMQRVKIAVEAAKGLEYLHEKAQSPIIHRDIKSSNILLFDDCTAKIADFDVSNQAPDMAA  229

Query  894   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  1073
             RLHSTRVLGTFGYHAPEYAMTGQL+QKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT
Sbjct  230   RLHSTRVLGTFGYHAPEYAMTGQLSQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  289

Query  1074  WATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             WATPRLSEDKVKQCVD +LKG+YPPK VAK+AAVAALCVQYEA+FRPNM+IVVKALQPLL
Sbjct  290   WATPRLSEDKVKQCVDSRLKGDYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALQPLL  349

Query  1254  KSS-APAPESP  1283
              +   PA  SP
Sbjct  350   NARPVPAGRSP  360



>gb|AFV46209.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=273

 Score =   489 bits (1258),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 235/277 (85%), Positives = 256/277 (92%), Gaps = 4/277 (1%)
 Frame = +3

Query  219   ESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQT  398
             ESY S+E+E LK P N+ DG    +++ +K + PVK EVQKA+P IEVP LSL+ELKE+T
Sbjct  1     ESYQSNENEHLKSPRNNGDG----HQRHSKPSAPVKPEVQKAVPPIEVPSLSLEELKEKT  56

Query  399   ENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENL  578
             +NFGSK+LIGEGSYGRVYFA LNDGK VAVKKLDVSSE DSN EFLTQVSMVS+LKH+NL
Sbjct  57    DNFGSKSLIGEGSYGRVYFAQLNDGKEVAVKKLDVSSEPDSNVEFLTQVSMVSRLKHDNL  116

Query  579   VELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGL  758
             VELLGYCV+GNLR+LAYEFATMGSLHDILHGRKGVQGAQPGPTLDW QRVRIAVDAA+GL
Sbjct  117   VELLGYCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVRIAVDAARGL  176

Query  759   EYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHA  938
             EYLHEKVQP +IHRDIRSSNVLLFE++KAKIADFNLSNQAPDMAARLHSTRVLGTFGYHA
Sbjct  177   EYLHEKVQPSIIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHA  236

Query  939   PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP  1049
             PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP
Sbjct  237   PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP  273



>ref|XP_010257506.1| PREDICTED: probable protein kinase At2g41970 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010257507.1| PREDICTED: probable protein kinase At2g41970 isoform X1 [Nelumbo 
nucifera]
Length=397

 Score =   493 bits (1270),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 254/362 (70%), Positives = 295/362 (81%), Gaps = 2/362 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELS  374
             LCC    EE+Y    ++    P       F R E     A+      QK +P IE P LS
Sbjct  2     LCCGGAEEENYGPPVNQYTAPPKGGDSQGFARGESRGPSAS-RSGAPQKVLP-IETPALS  59

Query  375   LDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMV  554
             LDEL   T NFGSKALIGEGSYGRV+ A L++G++ A+KKLD SS Q+ +++F  Q+S+V
Sbjct  60    LDELNRLTGNFGSKALIGEGSYGRVFHATLSNGQAAAIKKLDASSSQEPDSDFAAQLSVV  119

Query  555   SKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRI  734
             S+LK+E+ VELLGYC+E N RILAY+FAT+GSLHD+LHGRKGVQGA+PGP L+W QRV+I
Sbjct  120   SRLKNEHFVELLGYCLEANNRILAYQFATLGSLHDVLHGRKGVQGAEPGPVLNWNQRVKI  179

Query  735   AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRV  914
             A  AA+GLEYLHEKVQP ++HRD+RSSNVLLF++F AKIADFNLS+Q+ D AARLHSTRV
Sbjct  180   AYGAARGLEYLHEKVQPSIVHRDVRSSNVLLFDDFLAKIADFNLSSQSTDTAARLHSTRV  239

Query  915   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS  1094
             LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRLS
Sbjct  240   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLS  299

Query  1095  EDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             EDKVKQCVDPKL  +YPPK +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL S    P
Sbjct  300   EDKVKQCVDPKLNNDYPPKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGP  359

Query  1275  ES  1280
             +S
Sbjct  360   DS  361



>ref|XP_006351354.1| PREDICTED: probable protein kinase At2g41970-like [Solanum tuberosum]
Length=366

 Score =   492 bits (1266),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 295/368 (80%), Gaps = 13/368 (4%)
 Frame = +3

Query  198   CCTCQVEESY----PSHESEALKGPTND-ADGKFGRYEK--GTKVATPVKTEVQKAIPSI  356
             CC    E+ Y    PS+++ A     N  A G   R E   GT+  TP     QK +P I
Sbjct  3     CCGGGEEDVYSGGPPSNQNTAPPRAGNPYAGGVSDRAEPRGGTRNGTP-----QKVLP-I  56

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             E+P L LDEL + T NFG KALIGEGSYGRV+FA L++G+  A+KKLD SS  + +++F 
Sbjct  57    EIPVLPLDELNKLTGNFGQKALIGEGSYGRVFFAKLSNGQEAAIKKLDTSSSPEPDSDFT  116

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              Q+SMVS+LKHE+ V L+GYC+E N RIL YEFA MGSLHD+LHGRKGVQGA+PGP L W
Sbjct  117   AQLSMVSRLKHEHFVTLMGYCLEANNRILIYEFAAMGSLHDVLHGRKGVQGAEPGPVLTW  176

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRV++A  AAKGLEYLHEK+QPP++HRD+RSSNVLLF++F AK+ADFNL+NQ  D AAR
Sbjct  177   NQRVKVAFGAAKGLEYLHEKIQPPIVHRDVRSSNVLLFDDFTAKVADFNLTNQTSDTAAR  236

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTW
Sbjct  237   LHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTW  296

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDPKL  +YP K +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL 
Sbjct  297   ATPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLT  356

Query  1257  SSAPAPES  1280
             +    PES
Sbjct  357   AKPAGPES  364



>ref|XP_002534374.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF28012.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=365

 Score =   491 bits (1263),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 254/364 (70%), Positives = 294/364 (81%), Gaps = 4/364 (1%)
 Frame = +3

Query  195   LCCTCQVEE--SYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPE  368
             LCC    EE    P+++  A     N+  G   R E   +   P K+   + +  IEVP 
Sbjct  2     LCCGGAEEELDGPPANQYTAPPKGGNNYAGGGERAEP--RSNNPAKSGTPQKVLPIEVPA  59

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             LSLDEL   T NFG+KALIGEGSYGRV++A LN+G+  A+KKLD S+ Q+ +++F  Q+S
Sbjct  60    LSLDELNRLTGNFGTKALIGEGSYGRVFYAKLNNGEEAAIKKLDTSTSQEPDSDFAAQLS  119

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             +VS+LKHE+ VEL+GYC+E N RIL Y+FATMGSLHD+LHGRKGVQGA+PGP L W QRV
Sbjct  120   VVSRLKHEHFVELIGYCLEANNRILIYQFATMGSLHDVLHGRKGVQGAEPGPALSWNQRV  179

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
              +A  AAKGLEYLHEKVQP V+HRD+RSSNVLLF++F +KIADFNLS+ + D AARLHST
Sbjct  180   IVAYGAAKGLEYLHEKVQPSVVHRDVRSSNVLLFDDFTSKIADFNLSSASSDTAARLHST  239

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPR
Sbjct  240   RVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPR  299

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKVKQCVDPKL  +YPPK VAKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S   
Sbjct  300   LSEDKVKQCVDPKLNNDYPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPA  359

Query  1269  APES  1280
              PES
Sbjct  360   GPES  363



>gb|ADE75753.1| unknown [Picea sitchensis]
Length=360

 Score =   490 bits (1261),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/311 (79%), Positives = 281/311 (90%), Gaps = 3/311 (1%)
 Frame = +3

Query  354   IEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEF  533
             IEVP++ ++ELKE T+NFG K+LIGEGSYGRVY++ L +G++ A+KKLD S + D   EF
Sbjct  52    IEVPQIPIEELKEATDNFGPKSLIGEGSYGRVYYSVLRNGRTAAIKKLDTSKQPDQ--EF  109

Query  534   LTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLD  713
             L QVSMVS LKHEN++EL+GYCVEG+LR+LAYEFATMGSLHDILHGRKGV+GAQPGP L 
Sbjct  110   LAQVSMVSGLKHENVLELVGYCVEGSLRVLAYEFATMGSLHDILHGRKGVRGAQPGPVLT  169

Query  714   WTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAA  893
             W QRV+IAV+AAKGLEYLHEK Q P+IHRDI+SS +LLF++  AKIADF++SNQAPDMAA
Sbjct  170   WMQRVKIAVEAAKGLEYLHEKAQSPIIHRDIKSSKILLFDDCTAKIADFDVSNQAPDMAA  229

Query  894   RLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  1073
             RLHSTRVLGTFGYHAPEYAMTGQL+QKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT
Sbjct  230   RLHSTRVLGTFGYHAPEYAMTGQLSQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVT  289

Query  1074  WATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLL  1253
             WATPRLSEDKVKQCVD +LKG+YPPK VAK+AAVAALCVQYEA+FRPNM+IVVKALQPLL
Sbjct  290   WATPRLSEDKVKQCVDSRLKGDYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALQPLL  349

Query  1254  KSS-APAPESP  1283
              +   PA  SP
Sbjct  350   NARPVPAGRSP  360



>ref|XP_010312154.1| PREDICTED: probable protein kinase At2g41970 [Solanum lycopersicum]
Length=366

 Score =   489 bits (1259),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 294/368 (80%), Gaps = 13/368 (4%)
 Frame = +3

Query  198   CCTCQVEESY----PSHESEALKGPTND-ADGKFGRYEK--GTKVATPVKTEVQKAIPSI  356
             CC  + E+ Y    PS+++       N  A G   R E   GT+  TP     QK +P I
Sbjct  3     CCGGREEDVYSGGPPSNQNTVPPRAGNPYAGGASDRAEPRGGTRNGTP-----QKVLP-I  56

Query  357   EVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFL  536
             E+P L LDEL + T NFG KALIGEGSYGRV+FA L++G+  A+KKLD SS  + +++F 
Sbjct  57    EIPVLPLDELNKLTGNFGQKALIGEGSYGRVFFAKLSNGQEAAIKKLDTSSSPEPDSDFT  116

Query  537   TQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDW  716
              Q+SMVS+LKHE+ V L+GYC+E N RIL YEFA MGSLHD+LHGRKGVQGA+PGP L W
Sbjct  117   AQLSMVSRLKHEHFVNLMGYCLEANNRILIYEFAAMGSLHDVLHGRKGVQGAEPGPVLTW  176

Query  717   TQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAAR  896
              QRV++A  AAKGLEYLHEK+QP ++HRD+RSSNVLLF++F AK+ADFNL+NQ  D AAR
Sbjct  177   NQRVKVAFGAAKGLEYLHEKIQPAIVHRDVRSSNVLLFDDFTAKVADFNLTNQTSDTAAR  236

Query  897   LHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTW  1076
             LHSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTW
Sbjct  237   LHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTW  296

Query  1077  ATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLK  1256
             ATPRLSEDKVKQCVDPKL  +YP K +AK+AAVAALCVQYEA+FRPNMTIVVKALQPLL 
Sbjct  297   ATPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLT  356

Query  1257  SSAPAPES  1280
             +    PES
Sbjct  357   AKPAGPES  364



>ref|XP_010111379.1| putative protein kinase [Morus notabilis]
 gb|EXC30857.1| putative protein kinase [Morus notabilis]
Length=365

 Score =   489 bits (1258),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 279/315 (89%), Gaps = 1/315 (0%)
 Frame = +3

Query  336   QKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQ  515
             QK +P IE P +SLDEL   T NFGSKALIGEGSYGRV++A L++G++ A+KKLD S+ Q
Sbjct  50    QKVLP-IETPAISLDELNRCTGNFGSKALIGEGSYGRVFYAKLSNGQAAAIKKLDTSTSQ  108

Query  516   DSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQ  695
             D ++EF  Q+S VS+LKHE+ VEL+GYC+E N RIL Y+FAT+GS+HDILHGRKGVQGA+
Sbjct  109   DPDSEFAAQLSQVSRLKHEHFVELIGYCLEANKRILVYQFATLGSVHDILHGRKGVQGAE  168

Query  696   PGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQ  875
             PGP L W QRV+IA  AAKGLE+LHEKVQPP++HRD+RSSNVLLF+++ +KIADF+L+NQ
Sbjct  169   PGPVLSWNQRVKIACGAAKGLEFLHEKVQPPIVHRDVRSSNVLLFDDYSSKIADFSLTNQ  228

Query  876   APDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRG  1055
             + D AARLHSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+G
Sbjct  229   SSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKG  288

Query  1056  QQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             QQSLVTWATPRLSEDKVKQCVDPKL  +YPPK +AKLAAVAALCVQYEA+FRPNMTIVVK
Sbjct  289   QQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVK  348

Query  1236  ALQPLLKSSAPAPES  1280
             ALQPLL S    P+S
Sbjct  349   ALQPLLNSKPAGPDS  363



>ref|XP_007202089.1| hypothetical protein PRUPE_ppa007444mg [Prunus persica]
 gb|EMJ03288.1| hypothetical protein PRUPE_ppa007444mg [Prunus persica]
Length=367

 Score =   489 bits (1258),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 246/364 (68%), Positives = 292/364 (80%), Gaps = 4/364 (1%)
 Frame = +3

Query  198   CCTCQVEESY--PSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEV-QKAIPSIEVPE  368
             CC    EE+Y  P+++  A         G  G      + +  VK+   QKA+P IE+P 
Sbjct  3     CCGGAEEENYGPPANQYNAAPPRGGSTYGAGGNDRGEPRSSNTVKSGAPQKALP-IEIPA  61

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             +SLDEL   T NFG KALIGEGSYGRV++A L++GKS A+KKLD  + Q+ +++F  Q+S
Sbjct  62    MSLDELNRLTGNFGQKALIGEGSYGRVFYAKLSNGKSAAIKKLDTGTSQEPDSDFSAQLS  121

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
              VS+LKHE+ VEL+GYC++ N RIL YEFA MGSLHDILHGRKGVQGA+PGP L W QR+
Sbjct  122   TVSRLKHEHFVELMGYCLDANNRILIYEFAAMGSLHDILHGRKGVQGAEPGPVLTWNQRI  181

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             +IA  AAKGLEYLHEKVQP ++HRD+RSSNVLLF++  +K+ADFNL+NQ+ D AARLHST
Sbjct  182   KIAYGAAKGLEYLHEKVQPSIVHRDVRSSNVLLFDDHVSKVADFNLTNQSSDTAARLHST  241

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPR
Sbjct  242   RVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPR  301

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKVKQC+DPKL  ++  K +AKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S   
Sbjct  302   LSEDKVKQCIDPKLNNDFQQKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPA  361

Query  1269  APES  1280
              P+S
Sbjct  362   GPDS  365



>ref|XP_010943700.1| PREDICTED: pto-interacting protein 1-like [Elaeis guineensis]
Length=362

 Score =   488 bits (1256),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 258/362 (71%), Positives = 293/362 (81%), Gaps = 11/362 (3%)
 Frame = +3

Query  198   CCTCQVEESYPSHESEALKGP--TNDADGKFGRYEKGTKVATPVKTEVQKA-IPSIEVPE  368
             C  C  E+    H +    GP   + + G  G Y    + A P    VQ   +  I VP 
Sbjct  3     CFGCCGEDDV--HRTADGGGPYMGSHSAGNVGAY----RAAEPAPKGVQTVKVQPIAVPA  56

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             + ++E+KE T+NFG +ALIGEGS+GRVYF  L  G+S A+KKLD S + D   EFL QVS
Sbjct  57    IPVEEIKEVTKNFGDEALIGEGSFGRVYFGVLKTGRSAAIKKLDASKQPDQ--EFLAQVS  114

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             MVS+LKHEN+VEL+GYCV+GNLR+LAYEFATMGSLHDILHGRKGV+GAQPGP L W QRV
Sbjct  115   MVSRLKHENVVELIGYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRV  174

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             +IAV AAKGLEYLHEK QP VIHRDI+SSNVLLF++  AKIADF+LSNQAPDMAARLHST
Sbjct  175   KIAVGAAKGLEYLHEKAQPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHST  234

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQL+ KSDVYSFGVVLLELLTGRKPVDHT+PRGQQSLVTWATPR
Sbjct  235   RVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPR  294

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKV+QCVD +L GEYPPK VAKLAAVAALCVQYEA+FRPNM+IVVKALQPLL + + 
Sbjct  295   LSEDKVRQCVDARLNGEYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNTRSG  354

Query  1269  AP  1274
              P
Sbjct  355   HP  356



>ref|XP_002308358.1| kinase family protein [Populus trichocarpa]
 gb|EEE91881.1| kinase family protein [Populus trichocarpa]
Length=363

 Score =   487 bits (1254),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 246/362 (68%), Positives = 289/362 (80%), Gaps = 2/362 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELS  374
              CC  + EE +    ++    P        GR E   + A P +    + +  IE+P + 
Sbjct  2     FCCGDKEEEPHGPPANQYTAPPRGGNPYGSGRGEP--RSANPARNGAPQKVLPIEIPAIP  59

Query  375   LDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMV  554
             LDEL   T NFG+KALIGEGSYGRV++A L+DG   A+KKLD SS Q+ +++F  Q+S+V
Sbjct  60    LDELNRMTGNFGTKALIGEGSYGRVFYAKLSDGMRAAIKKLDTSSSQEPDSDFAAQLSVV  119

Query  555   SKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRI  734
             S+LKHE+ VEL GYC++ N RIL Y+FA MGSLHD+LHGRKGVQGA+PGP L+W QRV+I
Sbjct  120   SRLKHEHFVELTGYCLDANNRILVYQFAVMGSLHDVLHGRKGVQGAEPGPVLNWNQRVKI  179

Query  735   AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRV  914
             A  AAKGLEYLHEKVQPP++HRD+RSSNVLLF++F ++IADFNLSN   D AARLHSTRV
Sbjct  180   AYGAAKGLEYLHEKVQPPIVHRDVRSSNVLLFDDFMSRIADFNLSNAHSDTAARLHSTRV  239

Query  915   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS  1094
             LGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRLS
Sbjct  240   LGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLS  299

Query  1095  EDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             EDKVKQCVDPKL  +YPPK VAKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S    P
Sbjct  300   EDKVKQCVDPKLNNDYPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGP  359

Query  1275  ES  1280
             ++
Sbjct  360   DA  361



>ref|NP_180631.1| putative protein tyrosine kinase [Arabidopsis thaliana]
 gb|AAC02744.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAY78706.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEC08433.1| protein kinase-like protein [Arabidopsis thaliana]
Length=338

 Score =   486 bits (1252),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 240/313 (77%), Positives = 279/313 (89%), Gaps = 0/313 (0%)
 Frame = +3

Query  339   KAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQD  518
             K I  I VP LS+DE+ EQT+NFG  +LIGEGSYGRVY+A LNDGK+VA+KKLD++ E +
Sbjct  25    KEILPIIVPSLSVDEVNEQTDNFGPNSLIGEGSYGRVYYATLNDGKAVALKKLDLAPEDE  84

Query  519   SNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQP  698
             +N EFL+QVSMVS+LKHENL++L+GYCV+ NLR+LAYEFATMGSLHDILHGRKGVQ A P
Sbjct  85    TNTEFLSQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQDALP  144

Query  699   GPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQA  878
             GPTLDW  RV+IAV+AA+GLEYLHEKVQP VIHRDIRSSN+LLF++++AKIADFNLSNQ+
Sbjct  145   GPTLDWITRVKIAVEAARGLEYLHEKVQPQVIHRDIRSSNILLFDDYQAKIADFNLSNQS  204

Query  879   PDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQ  1058
             PD AARL STRVLG+FGY++PEYAMTG+LT KSDVY FGVVLLELLTGRKPVDHTMPRGQ
Sbjct  205   PDNAARLQSTRVLGSFGYYSPEYAMTGELTHKSDVYGFGVVLLELLTGRKPVDHTMPRGQ  264

Query  1059  QSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKA  1238
             QSLVTWATP+LSED V++CVDPKLKGEY PK VAKLAAVAALCVQYE+  RP M+ VVKA
Sbjct  265   QSLVTWATPKLSEDTVEECVDPKLKGEYSPKSVAKLAAVAALCVQYESNCRPKMSTVVKA  324

Query  1239  LQPLLKSSAPAPE  1277
             LQ LL ++   P+
Sbjct  325   LQQLLIATGSIPQ  337



>ref|XP_008790478.1| PREDICTED: pto-interacting protein 1-like [Phoenix dactylifera]
 ref|XP_008790480.1| PREDICTED: pto-interacting protein 1-like [Phoenix dactylifera]
 ref|XP_008790481.1| PREDICTED: pto-interacting protein 1-like [Phoenix dactylifera]
Length=360

 Score =   487 bits (1254),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 294/366 (80%), Gaps = 12/366 (3%)
 Frame = +3

Query  198   CCTCQVEESYPSHESEALKGP--TNDADGKFGRYEKGTKVATPVKTEVQKA-IPSIEVPE  368
             C  C  E+    H +    GP     + G  G Y    + A P    VQ   +  I VP 
Sbjct  3     CFACCGEDDV--HRTADSGGPYMGTHSAGNDGTY----RAAEPAPKGVQTVKVQPIAVPA  56

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             + ++E+KE T NFG +ALIGEGS+GRVYF  L +G+S A+KKLD S + D   EFL QVS
Sbjct  57    IIVEEIKEVTRNFGDEALIGEGSFGRVYFGVLKNGRSAAIKKLDASKQPDQ--EFLAQVS  114

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             MVS+LKHEN+VEL+GYCV+GNLR+LAYEFATMGSLHDILHGRKGV+GAQPGP L W QRV
Sbjct  115   MVSRLKHENVVELIGYCVDGNLRVLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWAQRV  174

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             +IAV AAKGLEYLHEK QP +IHRDI+SSNVLLF++  AKIADF+LSNQAPDMAARLHST
Sbjct  175   KIAVGAAKGLEYLHEKAQPHIIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHST  234

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQL+ KSDVYSFGVVLLELLTGRKPVDHT+PRGQQSLVTWATPR
Sbjct  235   RVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPR  294

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKVKQCVD +L G YPPK VAKLAAVAALCVQYEA+FRPNM+IVVKALQPLL + + 
Sbjct  295   LSEDKVKQCVDARLNGAYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNTRSG  354

Query  1269  AP-ESP  1283
              P E+P
Sbjct  355   HPGEAP  360



>emb|CDP10167.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   488 bits (1255),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 244/315 (77%), Positives = 277/315 (88%), Gaps = 1/315 (0%)
 Frame = +3

Query  336   QKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQ  515
             QKA+P IE P LSL  L   T+NFG+KALIGEGSYGRV+ A LN+G+  A+KKLD SS  
Sbjct  54    QKALP-IETPVLSLSVLNRLTDNFGTKALIGEGSYGRVFCAKLNNGQPAAIKKLDTSSSP  112

Query  516   DSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQ  695
             + ++EF  Q+S VS+LK+E+ V L+GYC+EGN RILAYE+ATMGSLHD+LHGRKGVQGA+
Sbjct  113   EPDSEFAAQLSTVSRLKNEHFVGLIGYCLEGNNRILAYEYATMGSLHDVLHGRKGVQGAE  172

Query  696   PGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQ  875
             PGP L+W QRV+IA  AAKGLEYLHEKVQP ++HRD+RSSNVLLF++F AKIADFNL NQ
Sbjct  173   PGPVLNWNQRVKIAYGAAKGLEYLHEKVQPSIVHRDVRSSNVLLFDDFMAKIADFNLGNQ  232

Query  876   APDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRG  1055
             + D AARLHSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+G
Sbjct  233   SSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKG  292

Query  1056  QQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             QQSLVTWATPRLSEDKVKQCVDPKL  +YPPK +AK+AAVAALCVQYEA+FRPNMTIVVK
Sbjct  293   QQSLVTWATPRLSEDKVKQCVDPKLNNDYPPKAIAKMAAVAALCVQYEADFRPNMTIVVK  352

Query  1236  ALQPLLKSSAPAPES  1280
             ALQPLL S   APES
Sbjct  353   ALQPLLNSKPAAPES  367



>ref|XP_010243367.1| PREDICTED: probable protein kinase At2g41970 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010243368.1| PREDICTED: probable protein kinase At2g41970 isoform X1 [Nelumbo 
nucifera]
Length=362

 Score =   486 bits (1252),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/366 (68%), Positives = 291/366 (80%), Gaps = 11/366 (3%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPS----IEV  362
             LCC    EE+Y    ++    P        G    G   A P  + V+   P     IE 
Sbjct  2     LCCGGAEEENYGPPANQYTAPPR-------GGNSYGGGSAEPRPSAVRSGAPQKVLPIET  54

Query  363   PELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQ  542
             P LSLDEL + T NFG+KALIGEGSYGRV+ A L++G++ A+KKLD S+ Q+ +++F  Q
Sbjct  55    PALSLDELNKLTGNFGTKALIGEGSYGRVFHATLSNGQAAAIKKLDPSASQEPDSDFAAQ  114

Query  543   VSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQ  722
             +S VS+LKHE+ VELLGYC+E N RIL Y+FAT GSLHD+LHGRKGVQGA+PGP L W Q
Sbjct  115   LSAVSRLKHEHFVELLGYCLEANNRILVYQFATKGSLHDVLHGRKGVQGAEPGPVLSWNQ  174

Query  723   RVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLH  902
             RV+IA  AA+GLEYLHE+VQPP++HRD+RSSNVLLF++F +KIADFNL+NQ+PD AARLH
Sbjct  175   RVKIAYGAARGLEYLHERVQPPIVHRDVRSSNVLLFDDFMSKIADFNLTNQSPDTAARLH  234

Query  903   STRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWAT  1082
             STRVLGTFGYHAPEYAMTGQLT KSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWAT
Sbjct  235   STRVLGTFGYHAPEYAMTGQLTLKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWAT  294

Query  1083  PRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS  1262
             PRLSEDKVKQCVDPKL  +YPPK VAK+AAVAALCVQYEA+FRPNMTIVVKALQPLL S 
Sbjct  295   PRLSEDKVKQCVDPKLNNDYPPKAVAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNSK  354

Query  1263  APAPES  1280
                 +S
Sbjct  355   PAGADS  360



>ref|XP_011005288.1| PREDICTED: probable protein kinase At2g41970 [Populus euphratica]
Length=365

 Score =   486 bits (1252),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 245/362 (68%), Positives = 287/362 (79%), Gaps = 0/362 (0%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELS  374
              CC  + EE +    ++    P        G      + A P +    + +  IE+P + 
Sbjct  2     FCCGDKEEEPHGPPANQYTAPPRGGNPYGGGSGRGEPRSANPARNGAPQKVLPIEIPAIP  61

Query  375   LDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMV  554
             LDEL   T NFG+KALIGEGSYGRV++A L+DG   A+KKLD SS Q+ +++F  Q+S+V
Sbjct  62    LDELNRMTGNFGTKALIGEGSYGRVFYAKLSDGMRAAIKKLDTSSSQEPDSDFAAQLSVV  121

Query  555   SKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRI  734
             S+LKHE+ VEL GYC+E N RIL Y+FA MGSLHD+LHGRKGVQGA+PGP L+W QRV+I
Sbjct  122   SRLKHEHFVELTGYCLEANNRILVYQFAVMGSLHDVLHGRKGVQGAEPGPVLNWNQRVKI  181

Query  735   AVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRV  914
             A  AAKGLEYLHEKVQPP++HRD+RSSNVLLF++F ++IADFNLSN   D AARLHSTRV
Sbjct  182   AYGAAKGLEYLHEKVQPPIVHRDVRSSNVLLFDDFVSRIADFNLSNAHSDTAARLHSTRV  241

Query  915   LGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLS  1094
             LGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRLS
Sbjct  242   LGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLS  301

Query  1095  EDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAPAP  1274
             EDKVKQCVDPKL  +YPPK VAKLAAVAALCVQYEA+FRPNMTIVVKALQPLL S    P
Sbjct  302   EDKVKQCVDPKLNNDYPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGP  361

Query  1275  ES  1280
             ++
Sbjct  362   DA  363



>ref|XP_010653876.1| PREDICTED: probable protein kinase At2g41970 isoform X2 [Vitis 
vinifera]
Length=356

 Score =   486 bits (1251),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 239/315 (76%), Positives = 273/315 (87%), Gaps = 1/315 (0%)
 Frame = +3

Query  336   QKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQ  515
             QK +P IE P +SLDEL   T NFGSKALIGEGSYGRV++A L+ G+  A+KKLD SS Q
Sbjct  41    QKILP-IETPAMSLDELNRLTSNFGSKALIGEGSYGRVFYAKLSSGEGAAIKKLDTSSSQ  99

Query  516   DSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQ  695
             + +++F  Q+S+VS+L HEN V LLGYC+E + +IL Y+FATMGSLHD+LHGRKGVQGA+
Sbjct  100   EPDSDFAAQLSIVSRLTHENFVGLLGYCLEADNKILVYQFATMGSLHDMLHGRKGVQGAE  159

Query  696   PGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQ  875
             PGP L W QRV+IA  AAKGLEYLHEKVQP ++HRD+RSSNVLLF++F AKIADFNLSNQ
Sbjct  160   PGPVLSWNQRVKIAYGAAKGLEYLHEKVQPSIVHRDVRSSNVLLFDDFLAKIADFNLSNQ  219

Query  876   APDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRG  1055
             + D AARLHSTRVLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+G
Sbjct  220   SSDTAARLHSTRVLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKG  279

Query  1056  QQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVK  1235
             QQSLVTWATPRLSEDKVKQCVDPKL  +YP K +AK+AAVAALCVQYEA+FRPNMTIVVK
Sbjct  280   QQSLVTWATPRLSEDKVKQCVDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVK  339

Query  1236  ALQPLLKSSAPAPES  1280
             ALQPLL      P+S
Sbjct  340   ALQPLLNPKPAGPDS  354



>ref|XP_010676583.1| PREDICTED: pto-interacting protein 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676584.1| PREDICTED: pto-interacting protein 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676585.1| PREDICTED: pto-interacting protein 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010676586.1| PREDICTED: pto-interacting protein 1-like [Beta vulgaris subsp. 
vulgaris]
Length=363

 Score =   485 bits (1249),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 246/333 (74%), Positives = 280/333 (84%), Gaps = 8/333 (2%)
 Frame = +3

Query  273   DGKFGRYEKGTKVATPVKTEVQKAIPSIEVPELSLDELKEQTENFGSKALIGEGSYGRVY  452
             DG +   E       PVK +       I VPE+S+DEL+E TEN+GS ALIGEGSYGRVY
Sbjct  31    DGMYQIIENAPPRKPPVKVQ------PISVPEISVDELREVTENYGSNALIGEGSYGRVY  84

Query  453   FANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSMVSKLKHENLVELLGYCVEGNLRILAYE  632
             +  L +G++ A+KKLD S + D   EFL+QVSMVS+L HEN VELLGYCV+GNLRILAYE
Sbjct  85    YGVLKNGRAAAIKKLDASKQPDD--EFLSQVSMVSRLNHENFVELLGYCVDGNLRILAYE  142

Query  633   FATMGSLHDILHGRKGVQGAQPGPTLDWTQRVRIAVDAAKGLEYLHEKVQPPVIHRDIRS  812
             FA+ GSLHDILHGRKGV+GAQPGP L W QRV+IAV AA+GLE+LHEK  P + HRDI+S
Sbjct  143   FASNGSLHDILHGRKGVKGAQPGPALSWAQRVKIAVSAARGLEFLHEKASPTIFHRDIKS  202

Query  813   SNVLLFEEFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSF  992
             SN+LLF++  AKI DF+LSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQL  KSDVYSF
Sbjct  203   SNILLFDDDVAKIGDFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSF  262

Query  993   GVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYppkgvaklaa  1172
             GVVLLELLTGRKPVDHT+PRGQQSLVTWATP+LSEDKVKQCVDP+L  EYPPK VAK+AA
Sbjct  263   GVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDPRLNAEYPPKAVAKMAA  322

Query  1173  vaalCVQYEAEFRPNMTIVVKALQPLLKSSAPA  1271
             VAALCVQYEA+FRPNM+IVVKALQPLL ++ PA
Sbjct  323   VAALCVQYEADFRPNMSIVVKALQPLLNAARPA  355



>ref|XP_009411601.1| PREDICTED: pto-interacting protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=362

 Score =   485 bits (1249),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 294/362 (81%), Gaps = 11/362 (3%)
 Frame = +3

Query  198   CCTCQVEESYPSHESEALKGP--TNDADGKFGRYEKGTKVATPVKTEVQKAIPS-IEVPE  368
             C  C  E++   H +    GP  TN   G  G Y      A P    VQ   P  I VP 
Sbjct  3     CFGCCEEDNI--HRTTVSGGPYVTNYTTGNDGPYH----AANPPPKGVQTVRPQPIAVPA  56

Query  369   LSLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVS  548
             + ++E++E T+NFG +ALIGEGS+GRVYFA L +G+S A+KKLD S + D   EFL QVS
Sbjct  57    IPVEEIREVTKNFGDEALIGEGSFGRVYFAVLRNGRSTAIKKLDSSKQPDQ--EFLAQVS  114

Query  549   MVSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRV  728
             MVS+LKHEN+VEL+GYCV+GNLR+LAYEFATMGSLHDILHGRKGV+GAQPGP L W QRV
Sbjct  115   MVSRLKHENVVELVGYCVDGNLRLLAYEFATMGSLHDILHGRKGVKGAQPGPVLSWQQRV  174

Query  729   RIAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHST  908
             +IAV AAKGLEYLHEK QP +IHRDI++SNVLLF++  AKIADF+LSNQAPDMAARLHST
Sbjct  175   KIAVGAAKGLEYLHEKAQPHIIHRDIKTSNVLLFDDDVAKIADFDLSNQAPDMAARLHST  234

Query  909   RVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPR  1088
             RVLGTFGYHAPEYAMTGQL+ KSDVYSFGVVLLELLTGRKPVDHT+PRGQQSLVTWATPR
Sbjct  235   RVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPR  294

Query  1089  LSEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSSAP  1268
             LSEDKV+QC+D +L G+YPPK VAK AAVAALCVQYEA+FRPNM+IVVKALQPLL + + 
Sbjct  295   LSEDKVRQCIDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNTRSG  354

Query  1269  AP  1274
              P
Sbjct  355   HP  356



>ref|XP_004136558.1| PREDICTED: probable protein kinase At2g41970-like [Cucumis sativus]
Length=366

 Score =   485 bits (1248),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 249/364 (68%), Positives = 291/364 (80%), Gaps = 5/364 (1%)
 Frame = +3

Query  195   LCCTCQVEESYPSHESEALKGPTNDADGKFGRYEKG-TKVATPVKTEVQKAIPSIEVPEL  371
              CC    EE++ +  S+    P  +    +G  E+G  + +  V++   + +  IE P +
Sbjct  2     FCCGGVEEENFGAPSSQYTAPPRGNT---YGGSERGEPRTSNVVRSGAPQQVLPIETPVI  58

Query  372   SLDELKEQTENFGSKALIGEGSYGRVYFANLNDGKSVAVKKLDVSSEQDSNAEFLTQVSM  551
              LDEL   T NFG+K+ IGEGSYGRVY+A L  G++ A+KKLD SS  + + +F  Q+S 
Sbjct  59    PLDELNRLTGNFGTKSFIGEGSYGRVYYATLKSGQAAAIKKLDTSSSPEPDTDFAAQLSS  118

Query  552   VSKLKHENLVELLGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWTQRVR  731
             VS+LK EN +EL+GYC+E N RIL Y+FA MGSLHDILHGRKGVQGA+PGP L W QRV+
Sbjct  119   VSRLKQENFLELIGYCLEANNRILVYQFAKMGSLHDILHGRKGVQGAEPGPVLAWNQRVK  178

Query  732   IAVDAAKGLEYLHEKVQPPVIHRDIRSSNVLLFEEFKAKIADFNLSNQAPDMAARLHSTR  911
             IA  AAKGLEYLHEKVQP ++HRDIRSSNVLLF++F AKIADFNL+NQ+ D AARLHSTR
Sbjct  179   IAYGAAKGLEYLHEKVQPSIVHRDIRSSNVLLFDDFLAKIADFNLTNQSSDTAARLHSTR  238

Query  912   VLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL  1091
             VLGTFGYHAPEYAMTGQ+TQKSDVYSFGVVLLELLTGRKPVDHTMP+GQQSLVTWATPRL
Sbjct  239   VLGTFGYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRL  298

Query  1092  SEDKVKQCVDPKLKGEYppkgvaklaavaalCVQYEAEFRPNMTIVVKALQPLLKSS-AP  1268
             SEDKVKQCVDPKL  +YPPK +AKLAAVAALCVQYEA+FRPNMTIVVKALQPLL SS  P
Sbjct  299   SEDKVKQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSSKPP  358

Query  1269  APES  1280
              PES
Sbjct  359   GPES  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5003565261950