BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23339_g1_i3 len=1063 path=[948:0-136 5678:137-140 1089:141-448
1397:449-475 5586:476-490 1439:491-525 3955:526-1062]

Length=1063
                                                                      Score     E

ref|XP_009770848.1|  PREDICTED: transcription initiation factor T...    392   1e-132   
ref|XP_009770230.1|  PREDICTED: transcription initiation factor T...    386   3e-130   
ref|XP_009627090.1|  PREDICTED: transcription initiation factor T...    384   1e-129   
ref|XP_006356824.1|  PREDICTED: transcription initiation factor T...    384   2e-129   
ref|XP_009771448.1|  PREDICTED: transcription initiation factor T...    382   8e-129   
ref|XP_004238058.1|  PREDICTED: transcription initiation factor T...    382   1e-128   
ref|XP_009627089.1|  PREDICTED: transcription initiation factor T...    379   2e-127   
emb|CDO96974.1|  unnamed protein product                                377   1e-126   
ref|XP_009627091.1|  PREDICTED: transcription initiation factor T...    375   5e-126   
ref|XP_010526568.1|  PREDICTED: transcription initiation factor T...    374   1e-125   
ref|XP_002275472.1|  PREDICTED: transcription initiation factor T...    372   8e-125   Vitis vinifera
gb|KDP27622.1|  hypothetical protein JCGZ_19627                         366   1e-122   
ref|XP_011014718.1|  PREDICTED: transcription initiation factor T...    364   8e-122   
ref|XP_008236817.1|  PREDICTED: transcription initiation factor T...    364   9e-122   
ref|XP_009347327.1|  PREDICTED: transcription initiation factor T...    363   2e-121   
ref|XP_008382356.1|  PREDICTED: transcription initiation factor T...    363   2e-121   
ref|XP_009368359.1|  PREDICTED: transcription initiation factor T...    363   3e-121   
ref|XP_011037239.1|  PREDICTED: transcription initiation factor T...    362   6e-121   
ref|XP_003540935.1|  PREDICTED: transcription initiation factor T...    361   1e-120   
ref|XP_006384534.1|  hypothetical protein POPTR_0004s17160g             360   5e-120   
ref|XP_007201890.1|  hypothetical protein PRUPE_ppa009920mg             360   5e-120   
gb|KHN25442.1|  Protein AF-9 like                                       359   7e-120   
ref|XP_006487290.1|  PREDICTED: transcription initiation factor T...    359   1e-119   
ref|XP_007041992.1|  YEATS family protein isoform 1                     359   2e-119   
ref|XP_011088532.1|  PREDICTED: transcription initiation factor T...    358   3e-119   
ref|XP_004507004.1|  PREDICTED: protein AF-9 homolog isoform X1         357   4e-119   
ref|XP_010271406.1|  PREDICTED: transcription initiation factor T...    356   2e-118   
ref|XP_002306148.2|  YEATS family protein                               355   2e-118   Populus trichocarpa [western balsam poplar]
gb|EYU37906.1|  hypothetical protein MIMGU_mgv1a011824mg                355   3e-118   
gb|EYU37905.1|  hypothetical protein MIMGU_mgv1a011824mg                355   4e-118   
ref|XP_007131738.1|  hypothetical protein PHAVU_011G037800g             354   1e-117   
ref|XP_009379570.1|  PREDICTED: transcription initiation factor T...    353   3e-117   
ref|XP_006423534.1|  hypothetical protein CICLE_v10029039mg             352   4e-117   
gb|KDO46697.1|  hypothetical protein CISIN_1g024038mg                   345   6e-115   
ref|XP_004290328.1|  PREDICTED: protein AF-9 homolog                    346   9e-115   
gb|KFK31550.1|  hypothetical protein AALP_AA6G126500                    344   5e-114   
ref|XP_010246404.1|  PREDICTED: transcription initiation factor T...    345   5e-114   
emb|CBI37970.3|  unnamed protein product                                343   5e-114   
ref|NP_001190475.1|  GAS 41-like protein                                344   5e-114   
ref|NP_199373.1|  GAS 41-like protein                                   344   5e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AES89292.2|  YEATS family protein                                    344   6e-114   
ref|XP_002865236.1|  hypothetical protein ARALYDRAFT_494425             343   1e-113   
ref|XP_006398239.1|  hypothetical protein EUTSA_v10000994mg             342   3e-113   
ref|XP_006379267.1|  hypothetical protein POPTR_0009s12900g             340   2e-112   
ref|XP_006592078.1|  PREDICTED: transcription initiation factor T...    339   2e-112   
ref|XP_007041993.1|  YEATS family protein isoform 2                     337   8e-112   
ref|XP_007041994.1|  YEATS family protein isoform 3                     337   9e-112   
ref|XP_006280955.1|  hypothetical protein CARUB_v10026956mg             338   1e-111   
ref|XP_011047070.1|  PREDICTED: transcription initiation factor T...    336   5e-111   
ref|XP_009101584.1|  PREDICTED: transcription initiation factor T...    336   6e-111   
ref|XP_009101585.1|  PREDICTED: transcription initiation factor T...    336   6e-111   
ref|XP_010441694.1|  PREDICTED: transcription initiation factor T...    336   9e-111   
ref|XP_010441695.1|  PREDICTED: transcription initiation factor T...    335   1e-110   
ref|XP_009368360.1|  PREDICTED: transcription initiation factor T...    335   1e-110   
ref|XP_003607095.1|  YEATS domain-containing protein                    334   2e-110   
emb|CDY38963.1|  BnaC07g18570D                                          332   3e-109   
ref|XP_010029691.1|  PREDICTED: transcription initiation factor T...    332   4e-109   
ref|XP_011047051.1|  PREDICTED: transcription initiation factor T...    331   6e-109   
ref|XP_003517178.1|  PREDICTED: transcription initiation factor T...    328   1e-107   
gb|KHN41899.1|  Protein AF-9 like                                       328   2e-107   
ref|XP_007046720.1|  YEATS family protein isoform 1                     327   2e-107   
ref|XP_010029693.1|  PREDICTED: transcription initiation factor T...    327   2e-107   
ref|XP_004507005.1|  PREDICTED: protein AF-9 homolog isoform X2         326   3e-107   
ref|XP_003537632.1|  PREDICTED: transcription initiation factor T...    327   6e-107   
ref|XP_010649052.1|  PREDICTED: transcription initiation factor T...    324   2e-106   
ref|XP_002269156.2|  PREDICTED: transcription initiation factor T...    325   2e-106   Vitis vinifera
gb|KDO46699.1|  hypothetical protein CISIN_1g024038mg                   324   4e-106   
gb|ACU19426.1|  unknown                                                 324   5e-106   Glycine max [soybeans]
ref|XP_002313001.1|  YEATS family protein                               324   5e-106   Populus trichocarpa [western balsam poplar]
ref|XP_008804007.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    324   9e-106   
ref|XP_011047060.1|  PREDICTED: transcription initiation factor T...    322   1e-105   
ref|XP_010940985.1|  PREDICTED: transcription initiation factor T...    323   1e-105   
ref|XP_010940986.1|  PREDICTED: transcription initiation factor T...    323   1e-105   
ref|XP_009401622.1|  PREDICTED: transcription initiation factor T...    322   1e-105   
gb|KDO46698.1|  hypothetical protein CISIN_1g024038mg                   322   3e-105   
ref|XP_008440809.1|  PREDICTED: transcription initiation factor T...    320   2e-104   
emb|CDP21325.1|  unnamed protein product                                319   3e-104   
ref|XP_011099821.1|  PREDICTED: transcription initiation factor T...    319   3e-104   
ref|XP_008791265.1|  PREDICTED: transcription initiation factor T...    319   4e-104   
ref|XP_009384397.1|  PREDICTED: transcription initiation factor T...    317   9e-104   
ref|XP_007157921.1|  hypothetical protein PHAVU_002G109100g             317   2e-103   
ref|XP_002513016.1|  YEATS domain-containing protein, putative          314   7e-103   Ricinus communis
ref|XP_006656613.1|  PREDICTED: transcription initiation factor T...    315   1e-102   
ref|XP_006851796.1|  hypothetical protein AMTR_s00040p00236410          314   3e-102   
ref|NP_001056732.1|  Os06g0137300                                       315   7e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004287823.1|  PREDICTED: protein AF-9 homolog                    313   8e-102   
ref|NP_001141800.1|  uncharacterized protein LOC100273936               312   1e-101   Zea mays [maize]
ref|XP_010113366.1|  Protein AF-9-like protein                          313   1e-101   
gb|AFK46477.1|  unknown                                                 313   1e-101   
ref|XP_007204905.1|  hypothetical protein PRUPE_ppa009845mg             313   1e-101   
ref|XP_002530747.1|  YEATS domain-containing protein, putative          312   2e-101   Ricinus communis
ref|XP_004134869.1|  PREDICTED: protein AF-9 homolog                    312   2e-101   
ref|XP_008372792.1|  PREDICTED: transcription initiation factor T...    312   3e-101   
ref|XP_008241810.1|  PREDICTED: transcription initiation factor T...    311   4e-101   
ref|XP_008346320.1|  PREDICTED: transcription initiation factor T...    311   4e-101   
gb|KDP46722.1|  hypothetical protein JCGZ_06510                         311   5e-101   
ref|XP_009378183.1|  PREDICTED: transcription initiation factor T...    311   7e-101   
ref|XP_004507006.1|  PREDICTED: protein AF-9 homolog isoform X3         308   8e-101   
ref|XP_003612162.1|  AF-9-like protein                                  309   4e-100   
ref|XP_004964476.1|  PREDICTED: protein AF-9 homolog                    308   5e-100   
gb|EEE65052.1|  hypothetical protein OsJ_20050                          312   1e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004512129.1|  PREDICTED: protein AF-9 homolog                    308   2e-99    
gb|EMT06696.1|  Protein AF-9-like protein                               308   5e-99    
ref|XP_003561209.1|  PREDICTED: transcription initiation factor T...    307   5e-99    
ref|XP_006425511.1|  hypothetical protein CICLE_v10026276mg             306   7e-99    
ref|XP_006466934.1|  PREDICTED: transcription initiation factor T...    306   7e-99    
ref|XP_008337037.1|  PREDICTED: transcription initiation factor T...    305   1e-98    
gb|KDO71156.1|  hypothetical protein CISIN_1g024341mg                   305   1e-98    
ref|XP_003607096.1|  YEATS domain-containing protein                    303   2e-98    
gb|KCW56651.1|  hypothetical protein EUGRSUZ_I02357                     303   4e-98    
gb|AFK33694.1|  unknown                                                 303   1e-97    
ref|XP_010679864.1|  PREDICTED: transcription initiation factor T...    302   2e-97    
ref|XP_011025946.1|  PREDICTED: transcription initiation factor T...    301   1e-96    
gb|KCW56652.1|  hypothetical protein EUGRSUZ_I02357                     299   2e-96    
ref|XP_011025947.1|  PREDICTED: transcription initiation factor T...    299   4e-96    
ref|XP_011025948.1|  PREDICTED: transcription initiation factor T...    298   1e-95    
ref|XP_010246406.1|  PREDICTED: transcription initiation factor T...    296   1e-95    
ref|XP_011099822.1|  PREDICTED: transcription initiation factor T...    294   1e-94    
gb|KCW56650.1|  hypothetical protein EUGRSUZ_I02357                     294   2e-94    
ref|XP_007046721.1|  YEATS family protein isoform 2                     291   7e-94    
ref|XP_009611985.1|  PREDICTED: transcription initiation factor T...    293   9e-94    
ref|XP_008440808.1|  PREDICTED: transcription initiation factor T...    293   1e-93    
ref|XP_006340726.1|  PREDICTED: transcription initiation factor T...    291   3e-93    
ref|XP_004232482.1|  PREDICTED: transcription initiation factor T...    290   7e-93    
ref|XP_009781834.1|  PREDICTED: transcription initiation factor T...    288   6e-92    
gb|EPS71197.1|  hypothetical protein M569_03561                         283   2e-90    
ref|XP_010548291.1|  PREDICTED: transcription initiation factor T...    282   8e-90    
ref|XP_008337030.1|  PREDICTED: transcription initiation factor T...    282   6e-89    
ref|XP_006298345.1|  hypothetical protein CARUB_v10014413mg             276   2e-87    
ref|XP_002310857.2|  hypothetical protein POPTR_0007s14070g             272   7e-86    Populus trichocarpa [western balsam poplar]
ref|NP_001189547.1|  TBP-associated factor 14                           271   1e-85    
ref|XP_011025949.1|  PREDICTED: transcription initiation factor T...    268   1e-84    
ref|XP_011025950.1|  PREDICTED: transcription initiation factor T...    268   2e-84    
ref|XP_010489443.1|  PREDICTED: transcription initiation factor T...    268   5e-84    
ref|XP_010467597.1|  PREDICTED: transcription initiation factor T...    265   3e-83    
ref|XP_010413214.1|  PREDICTED: transcription initiation factor T...    261   2e-81    
ref|XP_006409209.1|  hypothetical protein EUTSA_v10022830mg             258   1e-80    
emb|CDY56588.1|  BnaC07g48130D                                          258   1e-80    
ref|XP_009102291.1|  PREDICTED: transcription initiation factor T...    257   5e-80    
ref|XP_009102290.1|  PREDICTED: transcription initiation factor T...    257   5e-80    
emb|CDY38168.1|  BnaA07g02150D                                          255   3e-79    
gb|KFK40176.1|  hypothetical protein AALP_AA3G340200                    252   3e-78    
ref|XP_002862271.1|  predicted protein                                  248   2e-77    
ref|XP_002985664.1|  hypothetical protein SELMODRAFT_122900             249   2e-77    
ref|XP_002974290.1|  hypothetical protein SELMODRAFT_174113             250   3e-77    
ref|XP_010467598.1|  PREDICTED: transcription initiation factor T...    246   1e-75    
gb|ACU21300.1|  unknown                                                 241   6e-75    Glycine max [soybeans]
ref|XP_001783775.1|  predicted protein                                  234   1e-71    
ref|XP_008344256.1|  PREDICTED: transcription initiation factor T...    233   4e-71    
gb|KDO71157.1|  hypothetical protein CISIN_1g024341mg                   226   1e-68    
ref|XP_001761097.1|  predicted protein                                  218   2e-65    
ref|NP_179391.1|  TBP-associated factor 14                              207   2e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884095.1|  predicted protein                                  203   9e-60    
ref|XP_003607097.1|  YEATS domain-containing protein                    197   6e-58    
ref|XP_009772041.1|  PREDICTED: transcription initiation factor T...    192   1e-55    
gb|KHN11753.1|  Protein AF-9 like                                       167   2e-47    
ref|XP_005844386.1|  hypothetical protein CHLNCDRAFT_36861              162   6e-44    
gb|KDD76454.1|  hypothetical protein H632_c220p1                        156   6e-42    
ref|XP_003060346.1|  YEATS domain-containing protein                    149   6e-40    
ref|XP_005832246.1|  hypothetical protein GUITHDRAFT_163356             151   1e-39    
ref|XP_005651231.1|  yeats-domain-containing protein                    150   2e-39    
gb|AFK47910.1|  unknown                                                 146   4e-39    
ref|XP_002505271.1|  YEATS domain-containing protein                    148   7e-39    Micromonas commoda
ref|XP_011025951.1|  PREDICTED: transcription initiation factor T...    142   3e-36    
ref|XP_002958730.1|  hypothetical protein VOLCADRAFT_84613              139   2e-35    
ref|XP_004367627.1|  YEATS family protein                               142   2e-35    
ref|XP_008893122.1|  hypothetical protein PPTG_01545                    139   3e-35    
gb|ETI45331.1|  hypothetical protein F443_10061                         139   3e-35    
ref|XP_001695345.1|  transcription factor IIF                           137   1e-34    Chlamydomonas reinhardtii
ref|XP_009526277.1|  hypothetical protein PHYSODRAFT_354558             136   3e-34    
gb|ACU17358.1|  unknown                                                 130   2e-33    Glycine max [soybeans]
emb|CCA18213.1|  conserved hypothetical protein                         130   4e-32    
ref|XP_008865500.1|  hypothetical protein H310_03424                    131   5e-32    
emb|CCI10060.1|  unnamed protein product                                129   9e-32    
ref|XP_007509795.1|  predicted protein                                  130   1e-31    
ref|XP_009035381.1|  hypothetical protein AURANDRAFT_6211               127   1e-31    
gb|KHN05303.1|  hypothetical protein glysoja_048995                     125   2e-31    
ref|XP_006582646.1|  PREDICTED: transcription initiation factor T...    125   4e-31    
ref|XP_002184079.1|  predicted protein                                  125   7e-31    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008865501.1|  hypothetical protein, variant                      127   1e-30    
gb|EPB87916.1|  hypothetical protein HMPREF1544_05323                   125   2e-30    
ref|XP_002907902.1|  conserved hypothetical protein                     129   2e-30    
ref|XP_009823837.1|  hypothetical protein H257_02048                    125   6e-30    
gb|KDO34285.1|  hypothetical protein SPRG_19102                         123   2e-29    
ref|XP_008621452.1|  hypothetical protein SDRG_16997                    123   2e-29    
ref|XP_001423790.1|  hypothetical protein                               123   2e-29    Paramecium tetraurelia strain d4-2
ref|XP_005703056.1|  YEATS domain-containing protein 4                  122   4e-29    
emb|CBJ32065.1|  conserved unknown protein                              122   5e-29    
emb|CEG63855.1|  hypothetical protein RMATCC62417_00931                 121   6e-29    
emb|CEI89760.1|  hypothetical protein RMCBS344292_04108                 121   7e-29    
emb|CEG78079.1|  hypothetical protein RMATCC62417_12736                 121   9e-29    
ref|XP_005109184.1|  PREDICTED: YEATS domain-containing protein 4...    120   2e-28    
gb|EXX57078.1|  Yaf9p                                                   120   2e-28    
ref|XP_001452404.1|  hypothetical protein                               120   3e-28    Paramecium tetraurelia strain d4-2
gb|KFH68141.1|  YEATS domain-containing protein 4                       119   4e-28    
ref|XP_009054020.1|  hypothetical protein LOTGIDRAFT_203873             119   7e-28    
ref|XP_003959402.1|  hypothetical protein KAFR_0J02030                  118   8e-28    
ref|XP_011065633.1|  PREDICTED: YEATS domain-containing protein 4       118   1e-27    
emb|CEG00603.1|  YEATS                                                  117   2e-27    
ref|XP_396159.2|  PREDICTED: YEATS domain-containing protein 4 is...    117   4e-27    Apis mellifera [bee]
ref|XP_006621607.1|  PREDICTED: YEATS domain-containing protein 4...    117   4e-27    
ref|XP_004350973.1|  hypothetical protein DFA_12034                     118   4e-27    
ref|XP_001605429.2|  PREDICTED: YEATS domain-containing protein 4       117   4e-27    Nasonia vitripennis
ref|NP_985323.1|  AFL227Cp                                              116   4e-27    Eremothecium gossypii ATCC 10895
ref|XP_004930356.1|  PREDICTED: YEATS domain-containing protein 4...    117   4e-27    
ref|XP_003691941.1|  PREDICTED: YEATS domain-containing protein 4...    117   4e-27    
ref|XP_003083940.1|  putative TAF14b (ISS)                              118   5e-27    
ref|XP_003700619.1|  PREDICTED: YEATS domain-containing protein 4...    117   5e-27    
ref|XP_001421897.1|  predicted protein                                  115   6e-27    Ostreococcus lucimarinus CCE9901
gb|EFZ20235.1|  hypothetical protein SINV_09145                         116   7e-27    
ref|XP_005181237.1|  PREDICTED: YEATS domain-containing protein 4...    116   8e-27    
ref|XP_002129300.1|  PREDICTED: YEATS domain-containing protein 4...    116   1e-26    Ciona intestinalis [sea vase]
gb|KFM59185.1|  YEATS domain-containing protein 4                       116   1e-26    
ref|XP_003286649.1|  hypothetical protein DICPUDRAFT_150634             117   1e-26    
gb|EWM26089.1|  protein af-9                                            118   1e-26    
ref|XP_006621608.1|  PREDICTED: YEATS domain-containing protein 4...    115   1e-26    
ref|XP_006570350.1|  PREDICTED: YEATS domain-containing protein 4...    115   1e-26    
gb|EZA58670.1|  YEATS domain-containing protein                         115   2e-26    
gb|EJK74990.1|  hypothetical protein THAOC_03304                        116   2e-26    
ref|XP_003668702.1|  hypothetical protein NDAI_0B04250                  114   2e-26    
ref|NP_001155688.1|  YEATS domain containing 4-like                     114   3e-26    Acyrthosiphon pisum
ref|XP_973381.1|  PREDICTED: YEATS domain-containing protein 4          114   3e-26    Tribolium castaneum [rust-red flour beetle]
gb|EFN61963.1|  YEATS domain-containing protein 4                       114   3e-26    
ref|XP_001962382.1|  GF14466                                            114   3e-26    Drosophila ananassae
ref|XP_003399133.1|  PREDICTED: YEATS domain-containing protein 4...    112   4e-26    
gb|EFN79787.1|  YEATS domain-containing protein 4                       114   4e-26    
ref|NP_609086.1|  Gas41                                                 114   4e-26    Drosophila melanogaster
ref|XP_002078449.1|  GD22526                                            114   5e-26    Drosophila simulans
ref|XP_002088102.1|  GE18389                                            114   5e-26    Drosophila yakuba
ref|XP_002036011.1|  GM13720                                            114   5e-26    Drosophila sechellia
ref|XP_003487813.1|  PREDICTED: YEATS domain-containing protein 4...    114   5e-26    
ref|XP_002067022.1|  GK24245                                            114   5e-26    Drosophila willistoni
ref|XP_008553107.1|  PREDICTED: YEATS domain-containing protein 4       114   6e-26    
ref|XP_001970096.1|  GG23565                                            114   7e-26    Drosophila erecta
dbj|GAM27571.1|  hypothetical protein SAMD00019534_107470               114   7e-26    
ref|XP_001633555.1|  predicted protein                                  114   7e-26    Nematostella vectensis
gb|KFM28541.1|  AF-9-like protein                                       112   8e-26    
ref|XP_002019119.1|  GL25598                                            113   9e-26    Drosophila persimilis
gb|EHJ75966.1|  YEATS domain containing protein 4                       113   1e-25    
ref|XP_002430189.1|  YEATS domain-containing protein, putative          112   1e-25    Pediculus humanus corporis [human body lice]
emb|CCH41080.1|  hypothetical protein BN7_617                           112   1e-25    
ref|XP_008178714.1|  PREDICTED: YEATS domain containing 4-like is...    112   1e-25    
gb|KFB42262.1|  YEATS domain containing protein 4                       112   2e-25    
ref|XP_001842030.1|  YEATS domain containing protein 4                  112   2e-25    Culex quinquefasciatus
ref|XP_004525578.1|  PREDICTED: YEATS domain-containing protein 4...    112   2e-25    
ref|XP_002737992.1|  PREDICTED: YEATS domain-containing protein 4...    112   2e-25    Saccoglossus kowalevskii
ref|XP_002495372.1|  ZYRO0B09724p                                       112   2e-25    Zygosaccharomyces rouxii CBS 732
gb|EJY86976.1|  Transcription initiation factor IIF, auxiliary su...    113   2e-25    
ref|XP_001662633.1|  YEATS domain containing protein 4                  112   2e-25    Aedes aegypti
gb|AGO14274.1|  AaceriAFL227Cp                                          111   3e-25    
ref|XP_318687.4|  AGAP009650-PA                                         111   5e-25    Anopheles gambiae str. PEST
gb|ELU10838.1|  hypothetical protein CAPTEDRAFT_115398                  110   6e-25    
gb|KDR09543.1|  YEATS domain-containing protein 4                       111   6e-25    
ref|XP_002289857.1|  hypothetical protein THAPSDRAFT_262215             111   6e-25    Thalassiosira pseudonana CCMP1335
emb|CDK26132.1|  unnamed protein product                                110   6e-25    
gb|EFW46633.2|  hypothetical protein CAOG_04591                         112   7e-25    
ref|XP_006676025.1|  hypothetical protein BATDEDRAFT_84772              110   8e-25    
ref|XP_792019.1|  PREDICTED: YEATS domain-containing protein 4-like     110   8e-25    Strongylocentrotus purpuratus [purple urchin]
ref|XP_002052483.1|  GJ17562                                            110   2e-24    Drosophila virilis
gb|ETN58334.1|  YEATS domain containing protein 4                       110   2e-24    
ref|XP_003646987.1|  hypothetical protein Ecym_5416                     109   2e-24    
gb|EFA81875.1|  hypothetical protein PPL_05107                          110   2e-24    Heterostelium album PN500
ref|XP_002003121.1|  GI17738                                            108   4e-24    Drosophila mojavensis
gb|ACO11108.1|  YEATS domain-containing protein 4                       106   4e-24    Caligus rogercresseyi
gb|EFX87329.1|  hypothetical protein DAPPUDRAFT_187412                  108   6e-24    
ref|XP_001988804.1|  GH11361                                            108   7e-24    Drosophila grimshawi
gb|ERL89813.1|  hypothetical protein D910_07174                         107   7e-24    
ref|XP_009014852.1|  hypothetical protein HELRODRAFT_92407              107   9e-24    
dbj|GAA38138.2|  YEATS domain-containing protein 4                      107   9e-24    
emb|CDS07109.1|  hypothetical protein LRAMOSA09632                      107   1e-23    
gb|ENN73214.1|  hypothetical protein YQE_10165                          107   1e-23    
ref|XP_008398934.1|  PREDICTED: YEATS domain-containing protein 4       107   1e-23    
ref|XP_009494011.1|  hypothetical protein H696_01835                    106   2e-23    
gb|EIE80938.1|  hypothetical protein RO3G_05643                         112   2e-23    
gb|KHN75213.1|  YEATS domain-containing protein 4                       107   2e-23    
ref|XP_004347338.1|  predicted protein                                  108   2e-23    
emb|CDF91528.1|  ZYBA0S12-00958g1_1                                     106   2e-23    
ref|XP_010789345.1|  PREDICTED: YEATS domain-containing protein 4       106   2e-23    
ref|XP_001837573.1|  YEATS family protein                               107   2e-23    Coprinopsis cinerea okayama7#130
emb|CDH17364.1|  probable protein AF-9 homolog                          106   2e-23    
ref|XP_011105229.1|  yaf9p                                              106   3e-23    
ref|XP_002614099.1|  hypothetical protein BRAFLDRAFT_113729             106   3e-23    
ref|XP_003686094.1|  hypothetical protein TPHA_0F01760                  105   3e-23    
ref|XP_003383357.1|  PREDICTED: YEATS domain-containing protein 4...    106   3e-23    
emb|CCL98248.1|  predicted protein                                      107   3e-23    
gb|EJT42751.1|  YAF9-like protein                                       106   3e-23    
emb|CDW84119.1|  wd40 repeat-containing protein                         110   4e-23    
ref|XP_005538666.1|  hypothetical protein, conserved                    105   4e-23    
emb|CDH49198.1|  subunit of both the 4 histone h4acetyltransferas...    105   5e-23    
gb|EMD40505.1|  hypothetical protein CERSUDRAFT_148578                  106   5e-23    
ref|XP_009173060.1|  hypothetical protein T265_08874                    105   5e-23    
gb|ESW99429.1|  Subunit of both the NuA4 histone H4 acetyltransfe...    105   6e-23    
gb|EWC46995.1|  hypothetical protein DRE_03757                          104   1e-22    
ref|XP_002493799.1|  Subunit of both the NuA4 histone H4 acetyltr...    104   1e-22    
emb|CDO73800.1|  hypothetical protein BN946_scf185015.g129              104   1e-22    
ref|XP_003675147.1|  hypothetical protein NCAS_0B06920                  104   1e-22    
gb|KGK37408.1|  hypothetical protein JL09_g3463                         103   1e-22    
ref|XP_001644092.1|  hypothetical protein Kpol_505p11                   103   2e-22    
gb|ERG80453.1|  yeats domain-containing protein 4                       103   2e-22    
gb|EAR89954.2|  YEATS domain protein, putative                          105   3e-22    
ref|NP_014292.3|  Yaf9p                                                 103   3e-22    
gb|AAT93068.1|  YNL107W                                                 103   3e-22    
ref|XP_005761621.1|  hypothetical protein EMIHUDRAFT_105587             101   4e-22    
ref|XP_003682147.1|  hypothetical protein TDEL_0F01250                  102   4e-22    
emb|CDR46656.1|  CYFA0S25e00386g1_1                                     102   4e-22    
pdb|3RLS|A  Chain A, Crystal Structure Of Yeast Af-9 Homolog Prot...    101   5e-22    
ref|XP_006577611.1|  PREDICTED: transcription initiation factor T...    101   5e-22    
ref|XP_011119366.1|  hypothetical protein AOL_s00043g578                102   6e-22    
ref|XP_003748236.1|  PREDICTED: YEATS domain-containing protein 4...    102   6e-22    
emb|CDO96423.1|  unnamed protein product                                102   6e-22    
gb|KDQ29641.1|  hypothetical protein PLEOSDRAFT_50540                   102   6e-22    
gb|AFK39614.1|  unknown                                               98.2    8e-22    
ref|XP_007851313.1|  histone acetyltransferase subunit                  102   9e-22    
ref|XP_445171.1|  hypothetical protein                                  101   1e-21    
ref|XP_007303178.1|  yeats-domain-containing protein                    102   1e-21    
emb|CCK71758.1|  hypothetical protein KNAG_0H03440                      101   1e-21    
ref|XP_001010199.1|  YEATS family protein                               105   1e-21    
ref|XP_007874818.1|  hypothetical protein PNEG_02787                    100   1e-21    
pdb|3FK3|A  Chain A, Structure Of The Yeats Domain, Yaf9              99.8    2e-21    
ref|XP_004996917.1|  hypothetical protein PTSG_02424                    100   2e-21    
ref|XP_456131.1|  hypothetical protein                                  100   3e-21    
gb|EDV12360.1|  conserved hypothetical protein                          100   3e-21    
dbj|BAO41520.1|  protein AF-9 homolog                                 99.8    5e-21    
ref|XP_005718004.1|  unnamed protein product                            101   5e-21    
ref|XP_003148396.1|  hypothetical protein LOAG_12836                  99.8    5e-21    
gb|KDR84097.1|  hypothetical protein GALMADRAFT_133465                  100   7e-21    
ref|XP_007365057.1|  yeats family protein                               100   7e-21    
gb|EPS98762.1|  hypothetical protein FOMPIDRAFT_1164885                 100   7e-21    
emb|CAX75423.1|  YEATS domain-containing protein                      99.4    8e-21    
emb|CAX70553.1|  YEATS domain-containing protein                      98.6    8e-21    
gb|EJW84775.1|  hypothetical protein WUBG_04313                       99.4    8e-21    
ref|XP_007268625.1|  yeats-domain-containing protein                  99.8    8e-21    
ref|XP_007337842.1|  yeats-domain-containing protein                  99.4    9e-21    
ref|XP_007862070.1|  yeats-domain-containing protein                  99.4    1e-20    
emb|CAX75424.1|  YEATS domain-containing protein                      98.6    1e-20    
emb|CCD78376.1|  putative gas41                                       98.6    1e-20    
gb|EOB09189.1|  YEATS domain-containing protein 4                     98.2    2e-20    
gb|EMC89421.1|  YEATS domain-containing protein 4                     97.4    3e-20    
ref|XP_010642507.1|  PREDICTED: YEATS domain-containing protein 4...  96.7    3e-20    
ref|XP_008821918.1|  PREDICTED: YEATS domain-containing protein 4     97.4    3e-20    
ref|XP_005008941.1|  PREDICTED: YEATS domain-containing protein 4     97.4    4e-20    
ref|XP_006191989.1|  PREDICTED: LOW QUALITY PROTEIN: YEATS domain...  97.1    4e-20    
ref|XP_006768219.1|  PREDICTED: YEATS domain-containing protein 4     97.1    4e-20    
ref|XP_010412145.1|  PREDICTED: YEATS domain-containing protein 4     97.1    4e-20    
ref|XP_006095542.1|  PREDICTED: YEATS domain-containing protein 4...  97.1    5e-20    
ref|XP_001894434.1|  Hypothetical 26.0 kDa protein in CYB5-LEU4 i...  93.6    5e-20    
ref|XP_007528460.1|  PREDICTED: YEATS domain-containing protein 4     97.1    5e-20    
ref|XP_004483908.1|  PREDICTED: YEATS domain-containing protein 4...  96.7    5e-20    
ref|NP_001120999.1|  YEATS domain-containing protein 4                97.1    5e-20    
ref|NP_001083406.1|  YEATS domain containing 4                        96.7    5e-20    
emb|CDS32548.1|  YEATS domain containing protein                      96.7    5e-20    
ref|NP_001069833.1|  YEATS domain-containing protein 4                96.7    6e-20    
ref|XP_001362643.1|  PREDICTED: YEATS domain-containing protein 4...  96.7    6e-20    
ref|XP_010303494.1|  PREDICTED: YEATS domain-containing protein 4     96.7    6e-20    
ref|NP_001004981.1|  YEATS domain containing 4                        96.7    6e-20    
ref|XP_009543826.1|  hypothetical protein HETIRDRAFT_312423           98.2    6e-20    
gb|EJU06215.1|  yeats-domain-containing protein                       96.7    6e-20    
ref|NP_080846.1|  YEATS domain-containing protein 4                   96.7    6e-20    
ref|NP_006521.1|  YEATS domain-containing protein 4 isoform 1         96.7    6e-20    
ref|XP_003989082.2|  PREDICTED: LOW QUALITY PROTEIN: YEATS domain...  96.7    6e-20    
ref|XP_002190655.1|  PREDICTED: YEATS domain-containing protein 4     96.7    6e-20    
ref|XP_006006639.1|  PREDICTED: YEATS domain-containing protein 4...  96.7    7e-20    
ref|XP_005142635.1|  PREDICTED: YEATS domain-containing protein 4     96.7    7e-20    
ref|XP_007195104.1|  PREDICTED: YEATS domain-containing protein 4     96.7    7e-20    
ref|XP_007423455.1|  PREDICTED: YEATS domain-containing protein 4     96.3    7e-20    
ref|XP_005280099.1|  PREDICTED: YEATS domain-containing protein 4     96.3    8e-20    
emb|CAC01935.1|  NuBI-1 protein                                       96.3    8e-20    
ref|XP_003224663.1|  PREDICTED: YEATS domain-containing protein 4     96.3    8e-20    
ref|XP_007637017.1|  PREDICTED: YEATS domain-containing protein 4...  96.7    8e-20    
ref|XP_004203757.1|  Piso0_000776                                     96.3    9e-20    
ref|XP_003516064.2|  PREDICTED: YEATS domain-containing protein 4...  95.5    9e-20    
ref|XP_010128752.1|  PREDICTED: YEATS domain-containing protein 4     95.9    1e-19    
gb|KFV92511.1|  YEATS domain-containing protein 4                     95.9    1e-19    
ref|XP_004203175.1|  Piso0_000776                                     95.9    1e-19    
ref|XP_009904710.1|  PREDICTED: YEATS domain-containing protein 4     95.9    1e-19    
gb|KFO05433.1|  YEATS domain-containing protein 4                     95.5    1e-19    
ref|NP_001072971.1|  YEATS domain-containing protein 4                95.9    1e-19    
gb|KFV71853.1|  YEATS domain-containing protein 4                     95.5    1e-19    
ref|XP_006121638.1|  PREDICTED: YEATS domain-containing protein 4...  95.9    1e-19    
ref|XP_001271859.1|  histone acetyltransferase subunit (Yaf9), pu...  96.3    1e-19    
ref|XP_625391.1|  transcription factor TFIIF                          99.0    2e-19    
ref|XP_005039947.1|  PREDICTED: YEATS domain-containing protein 4     96.3    2e-19    
ref|XP_006456709.1|  hypothetical protein AGABI2DRAFT_122603          95.9    2e-19    
ref|XP_009981686.1|  PREDICTED: YEATS domain-containing protein 4     95.1    2e-19    
ref|XP_003367450.1|  YEATS family protein                             95.1    2e-19    
ref|XP_010560061.1|  PREDICTED: YEATS domain-containing protein 4...  95.1    2e-19    
ref|XP_006095543.1|  PREDICTED: YEATS domain-containing protein 4...  94.7    2e-19    
ref|XP_007901922.1|  PREDICTED: YEATS domain-containing protein 4...  96.3    2e-19    
ref|XP_008573452.1|  PREDICTED: YEATS domain-containing protein 4     95.1    2e-19    
ref|XP_005957163.1|  PREDICTED: LOW QUALITY PROTEIN: YEATS domain...  95.1    2e-19    
ref|XP_666505.1|  Gas41                                               98.6    2e-19    
ref|XP_003202122.2|  PREDICTED: YEATS domain-containing protein 4     95.1    2e-19    
gb|KHJ89427.1|  YEATS family protein                                  94.7    2e-19    
ref|XP_001876499.1|  predicted protein                                94.0    3e-19    
ref|XP_004483909.1|  PREDICTED: YEATS domain-containing protein 4...  94.7    3e-19    
ref|XP_010209347.1|  PREDICTED: YEATS domain-containing protein 4     95.1    3e-19    
ref|XP_005419343.1|  PREDICTED: YEATS domain-containing protein 4     95.1    3e-19    
ref|XP_006633642.1|  PREDICTED: YEATS domain-containing protein 4...  94.7    3e-19    
ref|XP_003037969.1|  hypothetical protein SCHCODRAFT_80298            95.1    3e-19    
gb|KFO91219.1|  YEATS domain-containing protein 4                     94.4    3e-19    
ref|XP_002837617.1|  hypothetical protein                             94.7    3e-19    
gb|ELK26893.1|  YEATS domain-containing protein 4                     94.4    3e-19    
gb|EFB14643.1|  hypothetical protein PANDA_011185                     94.4    3e-19    
gb|EMS19297.1|  protein of YEATS family                               95.5    3e-19    
gb|KFV79591.1|  YEATS domain-containing protein 4                     94.0    4e-19    
ref|XP_007055966.1|  PREDICTED: YEATS domain-containing protein 4...  92.8    4e-19    
ref|XP_008924801.1|  PREDICTED: YEATS domain-containing protein 4     95.5    4e-19    
gb|KFB42264.1|  YEATS domain containing protein 4                     94.0    4e-19    
gb|KFD54014.1|  hypothetical protein M513_05033                       94.4    4e-19    
gb|EYB98728.1|  hypothetical protein Y032_0128g1416                   92.8    4e-19    
gb|ETN69222.1|  YEATS family protein                                  93.2    4e-19    
ref|XP_009970618.1|  PREDICTED: YEATS domain-containing protein 4     94.0    4e-19    
ref|XP_008631110.1|  PREDICTED: YEATS domain-containing protein 4     94.4    4e-19    
ref|XP_010179581.1|  PREDICTED: YEATS domain-containing protein 4     94.0    4e-19    
ref|XP_006121639.1|  PREDICTED: YEATS domain-containing protein 4...  94.0    4e-19    
ref|XP_007664491.1|  PREDICTED: YEATS domain-containing protein 4...  94.0    5e-19    
ref|XP_008502707.1|  PREDICTED: YEATS domain-containing protein 4     94.0    5e-19    
ref|XP_005856818.1|  PREDICTED: YEATS domain-containing protein 4     94.0    5e-19    
gb|KFM03418.1|  YEATS domain-containing protein 4                     93.6    5e-19    
ref|XP_001117373.2|  PREDICTED: YEATS domain-containing protein 4...  92.8    6e-19    
ref|XP_002113740.1|  hypothetical protein TRIADDRAFT_57479            94.7    6e-19    
ref|XP_006886142.1|  PREDICTED: YEATS domain-containing protein 4     94.0    6e-19    
ref|XP_004178495.1|  hypothetical protein TBLA_0B01330                94.0    7e-19    
ref|XP_007664490.1|  PREDICTED: YEATS domain-containing protein 4...  93.6    9e-19    
gb|EYB98726.1|  hypothetical protein Y032_0128g1416                   93.2    1e-18    
gb|EDM16628.1|  YEATS domain containing 4 (predicted), isoform CRA_a  90.9    1e-18    
gb|EYB98723.1|  hypothetical protein Y032_0128g1416                   92.0    1e-18    
gb|EYB98727.1|  hypothetical protein Y032_0128g1416                   93.2    1e-18    
ref|XP_002553111.1|  KLTH0D09196p                                     92.0    1e-18    
gb|EYB98724.1|  hypothetical protein Y032_0128g1416                   92.4    1e-18    
ref|XP_007901921.1|  PREDICTED: YEATS domain-containing protein 4...  94.0    1e-18    
ref|XP_006688240.1|  yeats-domain-containing protein                  92.4    1e-18    
ref|XP_002845369.1|  YEATS family protein                             93.2    1e-18    
ref|XP_001749999.1|  hypothetical protein                             96.3    2e-18    
ref|XP_004083078.1|  PREDICTED: YEATS domain-containing protein 4...  92.4    2e-18    
ref|XP_001383904.1|  yeast chromatin modifying complex protein        92.4    2e-18    
gb|KDQ64195.1|  hypothetical protein JAAARDRAFT_52178                 93.2    2e-18    
ref|XP_007773476.1|  yeats-domain-containing protein                  93.6    2e-18    
ref|XP_009670065.1|  PREDICTED: YEATS domain-containing protein 4     93.2    2e-18    
gb|EHN00553.1|  Yaf9p                                                 92.0    2e-18    
ref|XP_003233422.1|  histone acetyltransferase subunit                92.8    2e-18    
gb|EZF34854.1|  hypothetical protein H101_01617                       92.8    2e-18    
gb|KGL95560.1|  YEATS domain-containing protein 4                     92.0    2e-18    
ref|XP_004483910.1|  PREDICTED: YEATS domain-containing protein 4...  90.1    2e-18    
ref|NP_001002752.1|  YEATS domain-containing protein 4                92.4    2e-18    
ref|XP_006027035.1|  PREDICTED: YEATS domain-containing protein 4     93.2    2e-18    
gb|EGD96475.1|  histone acetyltransferase subunit                     92.8    2e-18    
ref|XP_003972931.1|  PREDICTED: YEATS domain-containing protein 4...  92.0    2e-18    
gb|KDQ08226.1|  hypothetical protein BOTBODRAFT_166080                92.8    2e-18    
ref|XP_005515079.1|  PREDICTED: YEATS domain-containing protein 4     94.0    2e-18    
ref|XP_008301784.1|  PREDICTED: YEATS domain-containing protein 4     92.0    2e-18    
ref|XP_003445065.1|  PREDICTED: YEATS domain-containing protein 4...  92.0    3e-18    
ref|XP_008313928.1|  PREDICTED: YEATS domain-containing protein 4     92.0    3e-18    
emb|CDQ05928.1|  Protein BM-GFL-1, isoform c                          93.6    3e-18    
ref|XP_009886135.1|  PREDICTED: YEATS domain-containing protein 4     93.2    3e-18    
ref|XP_006267131.1|  PREDICTED: YEATS domain-containing protein 4     92.8    3e-18    
ref|XP_007382488.1|  yeats-domain-containing protein                  92.4    3e-18    
ref|XP_003770900.1|  PREDICTED: YEATS domain-containing protein 4     94.0    3e-18    
ref|XP_005480815.1|  PREDICTED: YEATS domain-containing protein 4     93.2    3e-18    
ref|XP_010890319.1|  PREDICTED: YEATS domain-containing protein 4...  91.7    3e-18    
ref|NP_001290878.1|  YEATS domain containing 4                        91.7    3e-18    
ref|XP_007719459.1|  YEATS domain-containing protein 4                92.0    3e-18    
ref|XP_010890321.1|  PREDICTED: YEATS domain-containing protein 4...  91.7    3e-18    
gb|ETO30855.1|  hypothetical protein RFI_06266                        94.4    4e-18    
emb|CCX12301.1|  Similar to Protein AF-9 homolog; acc. no. Q4WPM8     91.3    4e-18    
ref|XP_005431932.1|  PREDICTED: YEATS domain-containing protein 4     91.3    4e-18    
gb|ETE62705.1|  Cleavage and polyadenylation specificity factor s...  95.5    4e-18    
ref|XP_008718517.1|  hypothetical protein HMPREF1541_05958            91.7    4e-18    
ref|XP_005814903.1|  PREDICTED: YEATS domain-containing protein 4...  90.9    5e-18    
gb|EIJ87270.1|  hypothetical protein NEQG_02605                       90.1    6e-18    
gb|EGT37659.1|  hypothetical protein CAEBREN_01943                    90.5    6e-18    
ref|XP_007564514.1|  PREDICTED: YEATS domain-containing protein 4     90.9    6e-18    
ref|XP_002789841.1|  YEATS family protein                             91.3    6e-18    
gb|EEQ90631.1|  histone acetyltransferase subunit Yaf9                91.3    6e-18    
ref|XP_002622928.1|  histone acetyltransferase subunit                91.3    6e-18    
gb|EEH21250.1|  hypothetical protein PABG_03481                       91.3    6e-18    
gb|EGU13191.1|  YEATS family protein                                  91.7    7e-18    
gb|EEH03727.1|  YEATS family protein                                  91.3    7e-18    
ref|XP_010757684.1|  hypothetical protein PADG_02049                  91.3    7e-18    
ref|XP_002140871.1|  YEATS family protein                             93.6    7e-18    
ref|XP_002633384.1|  C. briggsae CBR-GFL-1 protein                    90.5    8e-18    
gb|EHY65368.1|  hypothetical protein NERG_01814                       89.7    8e-18    
ref|NP_593730.1|  YEATS family histone acetyltransferase subunit ...  90.5    8e-18    
gb|KFG27010.1|  hypothetical protein NESG_00081                       89.7    8e-18    
ref|XP_003171730.1|  YEATS domain-containing protein 4                90.9    8e-18    
ref|XP_004027182.1|  protein phosphatase 2c, putative                 94.0    9e-18    
gb|KHJ75766.1|  YEATS family protein                                  88.2    1e-17    
emb|CCA75203.1|  related to YAF9-Component of a chromatin modifyi...  89.7    1e-17    
ref|XP_004583293.1|  PREDICTED: uncharacterized protein LOC101527379  93.6    1e-17    
ref|XP_001492273.2|  PREDICTED: YEATS domain-containing protein 4     92.4    1e-17    
ref|XP_001528835.1|  hypothetical protein LELG_05761                  89.7    2e-17    
ref|XP_001523368.1|  conserved hypothetical protein                   89.7    2e-17    
ref|XP_005927271.1|  PREDICTED: YEATS domain-containing protein 4...  89.4    2e-17    
emb|CCO30038.1|  Protein AF-9 homolog                                 90.1    2e-17    
emb|CDJ93941.1|  YEATS domain containing protein                      89.4    2e-17    
emb|CDJ05129.1|  YEATS domain containing protein                      89.4    2e-17    
gb|EUB64253.1|  YEATS domain-containing protein                       89.4    2e-17    
ref|XP_002617425.1|  hypothetical protein CLUG_02869                  89.4    2e-17    
dbj|GAD95376.1|  histone acetyltransferase subunit (Yaf9), putative   89.7    2e-17    
ref|XP_005374356.1|  PREDICTED: YEATS domain-containing protein 4     89.0    3e-17    



>ref|XP_009770848.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Nicotiana sylvestris]
Length=274

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 217/272 (80%), Positives = 243/272 (89%), Gaps = 0/272 (0%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
            +++S KKH  + PD+TGP   S RTKM+KSSDDS+ K++ +KLK +E+ VPIVYGN+AFW
Sbjct  3    QSSSTKKHVQEPPDVTGPNPKSQRTKMVKSSDDSDKKNTGKKLKELEVGVPIVYGNIAFW  62

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LGKKASE+QSHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVVD PPFELSECGWG
Sbjct  63   LGKKASEFQSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVDGPPFELSECGWG  122

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEI ITL+FH DVCDKPLHLYHHLKLYPEDESGPLSTKKP+VVESYDEIVL++PSEAF 
Sbjct  123  EFEIVITLHFHTDVCDKPLHLYHHLKLYPEDESGPLSTKKPVVVESYDEIVLAEPSEAFF  182

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            ARV NHPAVSVPRLP  L LPP  P+EDVDRRKR D+KDHPLSQWFTNFSEADELLKLTA
Sbjct  183  ARVQNHPAVSVPRLPPGLNLPPPVPIEDVDRRKRSDSKDHPLSQWFTNFSEADELLKLTA  242

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            ARQQVQGHIARLRRQLS++ GQHQ LKPA + 
Sbjct  243  ARQQVQGHIARLRRQLSLIEGQHQQLKPADDL  274



>ref|XP_009770230.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Nicotiana sylvestris]
Length=277

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 216/275 (79%), Positives = 243/275 (88%), Gaps = 3/275 (1%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddsea---kdsAQKLKGIEISVPIVYGNV  701
            +++S KKH  + PD+TGP   S RTKM+KSSDDS+    +++ +KLK +E+ VPIVYGN+
Sbjct  3    QSSSTKKHVQEPPDVTGPNPKSQRTKMVKSSDDSDKKFVQNTGKKLKELEVGVPIVYGNI  62

Query  700  AFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSEC  521
            AFWLGKKASE+QSHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVVD PPFELSEC
Sbjct  63   AFWLGKKASEFQSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVDGPPFELSEC  122

Query  520  GWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSE  341
            GWGEFEI ITL+FH DVCDKPLHLYHHLKLYPEDESGPLSTKKP+VVESYDEIVL++PSE
Sbjct  123  GWGEFEIVITLHFHTDVCDKPLHLYHHLKLYPEDESGPLSTKKPVVVESYDEIVLAEPSE  182

Query  340  AFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLK  161
            AF ARV NHPAVSVPRLP  L LPP  P+EDVDRRKR D+KDHPLSQWFTNFSEADELLK
Sbjct  183  AFFARVQNHPAVSVPRLPPGLNLPPPVPIEDVDRRKRSDSKDHPLSQWFTNFSEADELLK  242

Query  160  LTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            LTAARQQVQGHIARLRRQLS++ GQHQ LKPA + 
Sbjct  243  LTAARQQVQGHIARLRRQLSLIEGQHQQLKPADDL  277



>ref|XP_009627090.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Nicotiana tomentosiformis]
Length=274

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 212/272 (78%), Positives = 240/272 (88%), Gaps = 0/272 (0%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
            +++S KKH  D PD+TGP   S  TKM+KSSDDS+ K+S +KLK +E+ VPIVYGN+AFW
Sbjct  3    QSSSTKKHAQDPPDVTGPNPKSQHTKMVKSSDDSDKKNSGKKLKELEVGVPIVYGNIAFW  62

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LGKKASE+ SHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVVD+PPFELSECGWG
Sbjct  63   LGKKASEFHSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVDSPPFELSECGWG  122

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEI +TL+FH DVCDKPLHLYHHLKLYPEDESGPLSTK+P+VVESYDEIV ++PSEAF 
Sbjct  123  EFEIVLTLHFHTDVCDKPLHLYHHLKLYPEDESGPLSTKRPVVVESYDEIVFAEPSEAFF  182

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            ARV NH AVSVPRL   L LPP  P+EDVDR+KRG TKDHPLSQWFTNFSEADELLKLTA
Sbjct  183  ARVQNHSAVSVPRLLPGLNLPPPVPIEDVDRKKRGGTKDHPLSQWFTNFSEADELLKLTA  242

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            ARQQVQGHIARLRRQLS++ GQHQ LKPA++ 
Sbjct  243  ARQQVQGHIARLRRQLSLIEGQHQQLKPASDL  274



>ref|XP_006356824.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006356825.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Solanum tuberosum]
Length=274

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 215/272 (79%), Positives = 238/272 (88%), Gaps = 0/272 (0%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
            +++S K H  D  DITGP   S RTKM+ +SDDSE K S +KLK +E+ VPIVYGNVAFW
Sbjct  3    QSSSTKTHDQDPTDITGPTLKSQRTKMVNTSDDSEKKSSGKKLKELEVGVPIVYGNVAFW  62

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LGKKASE+QSHKWT+Y+RGATNEDLGVV+KR VFQLHSSFNNPTRVVD PPFEL+E GWG
Sbjct  63   LGKKASEFQSHKWTIYVRGATNEDLGVVVKRVVFQLHSSFNNPTRVVDNPPFELTESGWG  122

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEI +TL+FH DVCDKPLHLYHHLKLYPEDESG LSTKKP+VVESYDEIV ++PSE+F 
Sbjct  123  EFEIVMTLHFHTDVCDKPLHLYHHLKLYPEDESGALSTKKPVVVESYDEIVFAEPSESFF  182

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            ARV NHPAV+VPRLP  L LPP  P+EDVDRRKRGDTKDHPLSQ FTNFSEADELLKLTA
Sbjct  183  ARVQNHPAVNVPRLPPGLNLPPPVPIEDVDRRKRGDTKDHPLSQLFTNFSEADELLKLTA  242

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            ARQQVQGHIARLRRQLSMV GQHQ LKPA++ 
Sbjct  243  ARQQVQGHIARLRRQLSMVDGQHQQLKPASDL  274



>ref|XP_009771448.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X3 [Nicotiana sylvestris]
Length=274

 Score =   382 bits (981),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 209/275 (76%), Positives = 235/275 (85%), Gaps = 6/275 (2%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddsea---kdsAQKLKGIEISVPIVYGNV  701
            +++S KKH  + PD+TGP   S RTKM+KSSDDS+    +++ +KLK +E+ VPIVYGN+
Sbjct  3    QSSSTKKHVQEPPDVTGPNPKSQRTKMVKSSDDSDKKFVQNTGKKLKELEVGVPIVYGNI  62

Query  700  AFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSEC  521
            AFWLGKKASE+QSHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVVD PPFELSEC
Sbjct  63   AFWLGKKASEFQSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVDGPPFELSEC  122

Query  520  GWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSE  341
            GWGEFEI ITL+FH DVCDKPLHLYHHLKLYPEDESGPLSTKKP+VVESYDEIVL++PSE
Sbjct  123  GWGEFEIVITLHFHTDVCDKPLHLYHHLKLYPEDESGPLSTKKPVVVESYDEIVLAEPSE  182

Query  340  AFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLK  161
            AF ARV NHPAVSV   P         P EDVDRRKR D+KDHPLSQWFTNFSEADELLK
Sbjct  183  AFFARVQNHPAVSV---PRLPPGLNLPPPEDVDRRKRSDSKDHPLSQWFTNFSEADELLK  239

Query  160  LTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            LTAARQQVQGHIARLRRQLS++ GQHQ LKPA + 
Sbjct  240  LTAARQQVQGHIARLRRQLSLIEGQHQQLKPADDL  274



>ref|XP_004238058.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Solanum lycopersicum]
Length=274

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 214/272 (79%), Positives = 238/272 (88%), Gaps = 0/272 (0%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
            +++S KKH  D  D TGP   S RTKM+ +SDDSE K S +KLK +E+ VPIVYGNVAFW
Sbjct  3    QSSSTKKHDQDPTDSTGPTLKSQRTKMVNTSDDSEKKSSDKKLKELEVGVPIVYGNVAFW  62

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LGKKASE+QSHKWT+Y+RGATNEDLGVV+KR VFQLHSSFNNPTRVVD PPFELSE GWG
Sbjct  63   LGKKASEFQSHKWTIYVRGATNEDLGVVVKRVVFQLHSSFNNPTRVVDNPPFELSESGWG  122

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEI +TL+FH DVCDKPLHLYHHLKLYPEDESG LSTKKP+VVESYDEIV ++PSE+F 
Sbjct  123  EFEIVMTLHFHTDVCDKPLHLYHHLKLYPEDESGALSTKKPVVVESYDEIVFAEPSESFF  182

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            ARV N+PAV+VPRLP  L LPP  P+EDVD+RKRGDTKDHPLSQWFTNFSEADELLKLTA
Sbjct  183  ARVQNNPAVNVPRLPPGLNLPPPVPIEDVDQRKRGDTKDHPLSQWFTNFSEADELLKLTA  242

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            ARQQVQGHIARLRRQLS V GQHQ LKPA++ 
Sbjct  243  ARQQVQGHIARLRRQLSTVDGQHQQLKPASDL  274



>ref|XP_009627089.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Nicotiana tomentosiformis]
Length=277

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 211/275 (77%), Positives = 240/275 (87%), Gaps = 3/275 (1%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddsea---kdsAQKLKGIEISVPIVYGNV  701
            +++S KKH  D PD+TGP   S  TKM+KSSDDS+    ++S +KLK +E+ VPIVYGN+
Sbjct  3    QSSSTKKHAQDPPDVTGPNPKSQHTKMVKSSDDSDKKFVQNSGKKLKELEVGVPIVYGNI  62

Query  700  AFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSEC  521
            AFWLGKKASE+ SHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVVD+PPFELSEC
Sbjct  63   AFWLGKKASEFHSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVDSPPFELSEC  122

Query  520  GWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSE  341
            GWGEFEI +TL+FH DVCDKPLHLYHHLKLYPEDESGPLSTK+P+VVESYDEIV ++PSE
Sbjct  123  GWGEFEIVLTLHFHTDVCDKPLHLYHHLKLYPEDESGPLSTKRPVVVESYDEIVFAEPSE  182

Query  340  AFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLK  161
            AF ARV NH AVSVPRL   L LPP  P+EDVDR+KRG TKDHPLSQWFTNFSEADELLK
Sbjct  183  AFFARVQNHSAVSVPRLLPGLNLPPPVPIEDVDRKKRGGTKDHPLSQWFTNFSEADELLK  242

Query  160  LTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            LTAARQQVQGHIARLRRQLS++ GQHQ LKPA++ 
Sbjct  243  LTAARQQVQGHIARLRRQLSLIEGQHQQLKPASDL  277



>emb|CDO96974.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   377 bits (967),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 208/271 (77%), Positives = 239/271 (88%), Gaps = 0/271 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG D+PD  GPA+ S RTKM+KSSDD+E K+ A+KLK +EISVPIVYGN+AFWL
Sbjct  5    SSSSKKHGTDQPDSGGPASKSQRTKMVKSSDDTEKKNLAKKLKELEISVPIVYGNIAFWL  64

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RG TNED+ VV+KR VFQLHSSFNNPTRVVD PPFELSE GWGE
Sbjct  65   GKKASEYQSHKWTVYVRGGTNEDISVVVKRVVFQLHSSFNNPTRVVDGPPFELSESGWGE  124

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEI ITL+FHNDVC+KPLHLYHHLKLYPE++SGP+STKKP+VVESYDEIV ++PSE F +
Sbjct  125  FEIVITLHFHNDVCEKPLHLYHHLKLYPEEDSGPMSTKKPVVVESYDEIVFTEPSEGFFS  184

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV VPRLPA  ALPP  PLED D+R+RGDTKDH LSQWF+NFSEADELLKL AA
Sbjct  185  RVQNHPAVVVPRLPAGFALPPPVPLEDADKRRRGDTKDHTLSQWFSNFSEADELLKLAAA  244

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA LRRQLS++ GQHQ LK A++ 
Sbjct  245  RQQVQAHIATLRRQLSLIDGQHQQLKSASDM  275



>ref|XP_009627091.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X3 [Nicotiana tomentosiformis]
Length=274

 Score =   375 bits (963),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 206/275 (75%), Positives = 234/275 (85%), Gaps = 6/275 (2%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddsea---kdsAQKLKGIEISVPIVYGNV  701
            +++S KKH  D PD+TGP   S  TKM+KSSDDS+    ++S +KLK +E+ VPIVYGN+
Sbjct  3    QSSSTKKHAQDPPDVTGPNPKSQHTKMVKSSDDSDKKFVQNSGKKLKELEVGVPIVYGNI  62

Query  700  AFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSEC  521
            AFWLGKKASE+ SHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVVD+PPFELSEC
Sbjct  63   AFWLGKKASEFHSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVDSPPFELSEC  122

Query  520  GWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSE  341
            GWGEFEI +TL+FH DVCDKPLHLYHHLKLYPEDESGPLSTK+P+VVESYDEIV ++PSE
Sbjct  123  GWGEFEIVLTLHFHTDVCDKPLHLYHHLKLYPEDESGPLSTKRPVVVESYDEIVFAEPSE  182

Query  340  AFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLK  161
            AF ARV NH AVSV   P  L      P EDVDR+KRG TKDHPLSQWFTNFSEADELLK
Sbjct  183  AFFARVQNHSAVSV---PRLLPGLNLPPPEDVDRKKRGGTKDHPLSQWFTNFSEADELLK  239

Query  160  LTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            LTAARQQVQGHIARLRRQLS++ GQHQ LKPA++ 
Sbjct  240  LTAARQQVQGHIARLRRQLSLIEGQHQQLKPASDL  274



>ref|XP_010526568.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Tarenaya hassleriana]
Length=267

 Score =   374 bits (960),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/270 (74%), Positives = 226/270 (84%), Gaps = 7/270 (3%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG D+P+ITGP   SLRTKM          +  +KLK IEISVPIVYGNVAFWL
Sbjct  4    SSSSKKHGQDQPEITGPTPKSLRTKM-------AKPEEKKKLKDIEISVPIVYGNVAFWL  56

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLGVV+K+ VFQLHSSFNNPTRVV+ PPFELSE GWGE
Sbjct  57   GKKASEYQSHKWTVYVRGATNEDLGVVMKKVVFQLHSSFNNPTRVVEEPPFELSESGWGE  116

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH DVCDKPL LYHHLKLYPEDESGPLSTKKP+VVESYDEIV   PSE+FLA
Sbjct  117  FEIAITLYFHTDVCDKPLSLYHHLKLYPEDESGPLSTKKPVVVESYDEIVFPDPSESFLA  176

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV+ PRLPA  +LP    +ED  ++KRGD KDH L QWF NFSEADELL+L AA
Sbjct  177  RVQNHPAVTFPRLPAGYSLPAPMQVEDPGKKKRGDIKDHSLGQWFMNFSEADELLQLAAA  236

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            RQQVQ HIA+LRRQ+S++ GQ+QPLK  ++
Sbjct  237  RQQVQAHIAKLRRQISLLEGQNQPLKTGSD  266



>ref|XP_002275472.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Vitis vinifera]
Length=273

 Score =   372 bits (955),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 202/268 (75%), Positives = 234/268 (87%), Gaps = 0/268 (0%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            S KKHG D+PDI GP   S R+KM+KS++D E K+  ++LK +EISVPIVYGN+AFWLGK
Sbjct  5    STKKHGPDQPDIVGPTPKSQRSKMVKSTEDGEKKNLNKRLKDVEISVPIVYGNIAFWLGK  64

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASEYQSHKWT+Y+R  TNEDLGVVIKRAVFQLHSSFNNPTRVV++PPFELSE GWGEFE
Sbjct  65   KASEYQSHKWTVYVRSPTNEDLGVVIKRAVFQLHSSFNNPTRVVESPPFELSEAGWGEFE  124

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAITLYF +DVCDKPL+LYHHLKLYPEDESGP+S KKP+VVESYDEIV S+PSE F ARV
Sbjct  125  IAITLYFQSDVCDKPLNLYHHLKLYPEDESGPMSAKKPVVVESYDEIVFSEPSEGFFARV  184

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             NHPAV VPRLPA  +LPP  PLEDV+ +KR D+KD+PL+QWF NFSEADELL+L AARQ
Sbjct  185  QNHPAVIVPRLPAGFSLPPPVPLEDVNEKKRFDSKDNPLNQWFKNFSEADELLQLAAARQ  244

Query  142  QVQGHIARLRRQLSMVGGQHQPLKPATE  59
            QVQ HIA+LRRQ+S++ GQHQ LKP ++
Sbjct  245  QVQAHIAKLRRQISVIDGQHQQLKPTSD  272



>gb|KDP27622.1| hypothetical protein JCGZ_19627 [Jatropha curcas]
Length=273

 Score =   366 bits (940),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/265 (74%), Positives = 233/265 (88%), Gaps = 1/265 (0%)
 Frame = -1

Query  865  NSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLG  686
            +S+K++G D+P+++G  + S RTKM   ++D+E K   +KLK +EIS+PIVYGN++FWLG
Sbjct  5    SSSKRNGQDQPELSGTTSKSQRTKM-SKTEDTEKKILNKKLKDVEISIPIVYGNISFWLG  63

Query  685  KKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEF  506
            KKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNP RVV++PPFELSE GWGEF
Sbjct  64   KKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPIRVVESPPFELSEAGWGEF  123

Query  505  EIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLAR  326
            EIAITLYFH+DVCDKPL+LYHHLKLYPEDESGP+STKKP+VVESYDEIV  +PSE F AR
Sbjct  124  EIAITLYFHSDVCDKPLNLYHHLKLYPEDESGPMSTKKPVVVESYDEIVFPEPSEGFFAR  183

Query  325  VHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAAR  146
            V +HPAV++PRLPA   LPP  P+ED  +RKRGDTKDHPLSQWF NFSEADELL+L AAR
Sbjct  184  VQSHPAVTLPRLPAGFTLPPPVPVEDASKRKRGDTKDHPLSQWFMNFSEADELLQLAAAR  243

Query  145  QQVQGHIARLRRQLSMVGGQHQPLK  71
            QQVQ HIA+LRRQ+S++ GQHQ +K
Sbjct  244  QQVQAHIAKLRRQISLIDGQHQQMK  268



>ref|XP_011014718.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Populus euphratica]
Length=276

 Score =   364 bits (935),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 198/267 (74%), Positives = 231/267 (87%), Gaps = 1/267 (0%)
 Frame = -1

Query  868  ANSAKKHGADRP-DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
             +S+KK+G D P +I+GP   S R KM K+ +++E K   +KLK +EISVPIVYGN+AFW
Sbjct  5    TSSSKKNGQDHPVEISGPIPKSQRIKMSKTEENTEKKILNKKLKDVEISVPIVYGNIAFW  64

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRV++ PPFELSE GWG
Sbjct  65   LGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVIETPPFELSEAGWG  124

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEIAITLYFH+DVCDKPL+LYHHLKLYPEDESG LS KKP+VVESYDEIV  +PSE FL
Sbjct  125  EFEIAITLYFHSDVCDKPLNLYHHLKLYPEDESGSLSMKKPVVVESYDEIVFPEPSEGFL  184

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            AR+ +HPAV++PRLPA   LPP  P+ED  +RKRGDTKDHPLSQWF NFSEADELL+L A
Sbjct  185  ARIQSHPAVNLPRLPAGFTLPPPVPVEDTSKRKRGDTKDHPLSQWFMNFSEADELLQLAA  244

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLK  71
            ARQQVQ HIA+LRRQ+S++ GQ+Q LK
Sbjct  245  ARQQVQAHIAKLRRQISLIDGQNQQLK  271



>ref|XP_008236817.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Prunus mume]
Length=274

 Score =   364 bits (935),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 194/260 (75%), Positives = 229/260 (88%), Gaps = 1/260 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+K HG D+P+++GP   SLRTKM    +DSE K   +KLK +EISVPIVYGN++FWL
Sbjct  4    SSSSKSHGLDQPELSGPTPKSLRTKM-GKPEDSEKKIFHKKLKDVEISVPIVYGNISFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRV+++PPFELSECGWGE
Sbjct  63   GKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVIESPPFELSECGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITL+FH+DVCDKPL+L+HHLKLYPEDESGP+STKKP+VVESYDEIV  +PSEAFLA
Sbjct  123  FEIAITLFFHSDVCDKPLNLFHHLKLYPEDESGPMSTKKPVVVESYDEIVFPEPSEAFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV N PA+ VPRLPA   LPP  P+ED  +RKRGDTKDHP+SQWF NFSEADELL+L AA
Sbjct  183  RVQNQPALIVPRLPAGSVLPPPVPVEDPSKRKRGDTKDHPMSQWFMNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGG  89
            RQQVQ HIA+ RR++S++ G
Sbjct  243  RQQVQAHIAKFRREISLLDG  262



>ref|XP_009347327.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Pyrus x bretschneideri]
 ref|XP_009347328.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Pyrus x bretschneideri]
Length=275

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 230/265 (87%), Gaps = 3/265 (1%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATM--SLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAF  695
             +S+  HG D+P+I+GPA    SLRTKM    +DSE K   +KLK +EISVPIVYGN+AF
Sbjct  4    GSSSTMHGPDQPEISGPAPAPKSLRTKM-GKPEDSEKKIFHKKLKDVEISVPIVYGNIAF  62

Query  694  WLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGW  515
            WLGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRVV++PPFELSECGW
Sbjct  63   WLGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVVESPPFELSECGW  122

Query  514  GEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAF  335
            GEFEIAITL+FH+DVCDKPL+L+HHLKLYP DESGP+STKKP+VVESYDEIV  +PSEAF
Sbjct  123  GEFEIAITLFFHSDVCDKPLNLFHHLKLYPADESGPMSTKKPVVVESYDEIVFPEPSEAF  182

Query  334  LARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLT  155
            LARV N PAV VPRLPA +ALPP  P+ED   RKRGDTKDHPL QWFTNFSEADELL+L 
Sbjct  183  LARVQNQPAVVVPRLPAGVALPPPVPVEDPSNRKRGDTKDHPLCQWFTNFSEADELLRLA  242

Query  154  AARQQVQGHIARLRRQLSMVGGQHQ  80
             ARQQVQ HIA+ RR+++++ GQHQ
Sbjct  243  TARQQVQTHIAKFRREITLLEGQHQ  267



>ref|XP_008382356.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Malus domestica]
Length=275

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/265 (75%), Positives = 231/265 (87%), Gaps = 3/265 (1%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGP--ATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAF  695
             +S+K HG D+P+I+GP  A  SLRTKM    +DSE K   +KLK +EISVPIVYGN+AF
Sbjct  4    GSSSKMHGPDQPEISGPXPAPKSLRTKM-GKPEDSEKKIFHKKLKDVEISVPIVYGNIAF  62

Query  694  WLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGW  515
            WLGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRVV++PPFELSECGW
Sbjct  63   WLGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVVESPPFELSECGW  122

Query  514  GEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAF  335
            GEFEIAITL+FH+DVCDKPL+L+HHLKLYP DESGP+STKKP+VVESYDEIV  +PS+AF
Sbjct  123  GEFEIAITLFFHSDVCDKPLNLFHHLKLYPADESGPMSTKKPVVVESYDEIVFPEPSDAF  182

Query  334  LARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLT  155
            LARV N PAV +PRLPA +ALPP  P+ED   RKRGDTKDHPL QWFTNFSEADELL+L 
Sbjct  183  LARVQNQPAVVIPRLPAGVALPPPVPVEDPSNRKRGDTKDHPLCQWFTNFSEADELLRLV  242

Query  154  AARQQVQGHIARLRRQLSMVGGQHQ  80
             ARQQVQ HIA+ RR+++++ GQHQ
Sbjct  243  TARQQVQAHIAKFRREITLLEGQHQ  267



>ref|XP_009368359.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Pyrus x bretschneideri]
Length=275

 Score =   363 bits (931),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 200/265 (75%), Positives = 230/265 (87%), Gaps = 3/265 (1%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATM--SLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAF  695
             +S+  HG D+P+I+GPA    SLRTKM    +DSE K   +KLK +EISVPIVYGN+AF
Sbjct  4    GSSSTMHGPDQPEISGPAPAPKSLRTKM-GKPEDSEKKIFHKKLKDVEISVPIVYGNIAF  62

Query  694  WLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGW  515
            WLGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRVV++PPFELSECGW
Sbjct  63   WLGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVVESPPFELSECGW  122

Query  514  GEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAF  335
            GEFEIAITL+FH+DVCDKPL+L+HHLKLYP DESGP+STKKP+VVESYDEIV  +PSEAF
Sbjct  123  GEFEIAITLFFHSDVCDKPLNLFHHLKLYPADESGPMSTKKPVVVESYDEIVFPEPSEAF  182

Query  334  LARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLT  155
            LARV N PAV VPRLPA +ALPP  P+ED   RKRGDTKDHPL QWFTNFSEADELL+L 
Sbjct  183  LARVQNQPAVVVPRLPAGVALPPPVPVEDPSNRKRGDTKDHPLCQWFTNFSEADELLRLA  242

Query  154  AARQQVQGHIARLRRQLSMVGGQHQ  80
             ARQQVQ HIA+ RR+++++ GQHQ
Sbjct  243  TARQQVQTHIAKFRREITLLEGQHQ  267



>ref|XP_011037239.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Populus euphratica]
Length=276

 Score =   362 bits (929),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 197/267 (74%), Positives = 230/267 (86%), Gaps = 1/267 (0%)
 Frame = -1

Query  868  ANSAKKHGADRP-DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
             +S+KK+G D P +I+GP   S R KM K+ +++E K   +KLK +EISVPIVYGN+AFW
Sbjct  5    TSSSKKNGQDHPVEISGPIPKSQRIKMSKTEENTEKKILNKKLKDVEISVPIVYGNIAFW  64

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRV++ PPFELSE GWG
Sbjct  65   LGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVIETPPFELSEAGWG  124

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEIAITLYFH+DVCDKPL+LYHHLKLYPEDESG LS KKP+VVESYDEIV  +PSE  L
Sbjct  125  EFEIAITLYFHSDVCDKPLNLYHHLKLYPEDESGSLSMKKPVVVESYDEIVFPEPSEGLL  184

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            AR+ +HPAV++PRLPA   LPP  P+ED  +RKRGDTKDHPLSQWF NFSEADELL+L A
Sbjct  185  ARIQSHPAVNLPRLPAGFTLPPPVPVEDTSKRKRGDTKDHPLSQWFMNFSEADELLQLAA  244

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLK  71
            ARQQVQ HIA+LRRQ+S++ GQ+Q LK
Sbjct  245  ARQQVQAHIAKLRRQISLIDGQNQQLK  271



>ref|XP_003540935.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Glycine max]
Length=273

 Score =   361 bits (927),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/271 (72%), Positives = 234/271 (86%), Gaps = 1/271 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+ KHG D+PD++GP   S RTKM   S+D++ K+  +KLK +EIS+PIVYGNVAFWL
Sbjct  4    SSSSTKHGQDQPDLSGPTPKSQRTKM-GKSEDNDKKNLGKKLKDVEISIPIVYGNVAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLG +IK AVFQLHSSFNNPTRVV++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGTIIKHAVFQLHSSFNNPTRVVESPPFELSESGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FE++ITLYFH+DVCDKPL+LYHHLKLYPEDE+  +STKKP+VVE YDEIV   PSEAFLA
Sbjct  123  FEVSITLYFHSDVCDKPLNLYHHLKLYPEDENSSMSTKKPVVVEFYDEIVFPDPSEAFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV++PRLPA L LPP+ P+ED  +R++GDTKDH LSQWF NFSEADELL+L AA
Sbjct  183  RVQNHPAVNLPRLPAGLTLPPSIPVEDASKRRKGDTKDHSLSQWFMNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA+LRRQ+S++ GQHQ  K +++ 
Sbjct  243  RQQVQAHIAKLRRQISLIDGQHQQFKSSSDL  273



>ref|XP_006384534.1| hypothetical protein POPTR_0004s17160g [Populus trichocarpa]
 gb|ERP62331.1| hypothetical protein POPTR_0004s17160g [Populus trichocarpa]
Length=276

 Score =   360 bits (923),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 195/260 (75%), Positives = 226/260 (87%), Gaps = 1/260 (0%)
 Frame = -1

Query  847  GADRP-DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASE  671
            G D P +I+GP   S R KM K+ +++E K   +KLK +EISVPIVYGN+AFWLGKKA+E
Sbjct  12   GQDHPVEISGPIPKSQRIKMSKTEENTEKKILNKKLKDVEISVPIVYGNIAFWLGKKANE  71

Query  670  YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAIT  491
            YQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRV++APPFELSE GWGEFEIAIT
Sbjct  72   YQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVIEAPPFELSEAGWGEFEIAIT  131

Query  490  LYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHP  311
            LYFH+DVCDKPL+LYHHLKLYPEDESG LS KKP+VVESYDEIV  +PSE FLAR+ +HP
Sbjct  132  LYFHSDVCDKPLNLYHHLKLYPEDESGSLSMKKPVVVESYDEIVFPEPSEGFLARIQSHP  191

Query  310  AVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQG  131
            AV++PRLP+   LPP  P+ED  +RKRGDTKDHPLSQWF NFSEADELL+L AARQQVQ 
Sbjct  192  AVNLPRLPSGFTLPPPVPVEDTSKRKRGDTKDHPLSQWFMNFSEADELLQLAAARQQVQA  251

Query  130  HIARLRRQLSMVGGQHQPLK  71
            HIA+LRRQ+S++ GQ+Q LK
Sbjct  252  HIAKLRRQISLIDGQNQQLK  271



>ref|XP_007201890.1| hypothetical protein PRUPE_ppa009920mg [Prunus persica]
 gb|EMJ03089.1| hypothetical protein PRUPE_ppa009920mg [Prunus persica]
Length=272

 Score =   360 bits (923),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/260 (75%), Positives = 229/260 (88%), Gaps = 3/260 (1%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+K HG D+P+++GP   SLRTKM    +DSE K   +KLK +EISVPIVYGN++FWL
Sbjct  4    SSSSKSHGLDQPELSGPK--SLRTKM-GKPEDSEKKIFHKKLKDVEISVPIVYGNISFWL  60

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRV+++PPFELSECGWGE
Sbjct  61   GKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVIESPPFELSECGWGE  120

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITL+FH+DVCDKPL+L+HHLKLYPEDESGP+STKKP+VVESYDEIV  +PSEAFLA
Sbjct  121  FEIAITLFFHSDVCDKPLNLFHHLKLYPEDESGPMSTKKPVVVESYDEIVFPEPSEAFLA  180

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV N PA+ VPRLPA   LPP  P+ED  +RKRGDTKDHP+SQWF NFSEADELL+L AA
Sbjct  181  RVQNQPALIVPRLPAGSVLPPPVPVEDPSKRKRGDTKDHPMSQWFMNFSEADELLQLAAA  240

Query  148  RQQVQGHIARLRRQLSMVGG  89
            RQQVQ HIA+ RR++S++ G
Sbjct  241  RQQVQAHIAKFRREISLLDG  260



>gb|KHN25442.1| Protein AF-9 like [Glycine soja]
Length=273

 Score =   359 bits (922),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 193/271 (71%), Positives = 234/271 (86%), Gaps = 1/271 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+ KHG D+P+++GP   S RTKM   S+D++ K+  +KLK +EIS+PIVYGNVAFWL
Sbjct  4    SSSSTKHGQDQPELSGPTPKSQRTKM-GKSEDNDKKNLGKKLKDVEISIPIVYGNVAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLG +IK AVFQLHSSFNNPTRVV++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGTIIKHAVFQLHSSFNNPTRVVESPPFELSESGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FE++ITLYFH+DVCDKPL+LYHHLKLYPEDE+  +STKKP+VVE YDEIV   PSEAFLA
Sbjct  123  FEVSITLYFHSDVCDKPLNLYHHLKLYPEDENSSMSTKKPVVVEFYDEIVFPDPSEAFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV++PRLPA L LPP+ P+ED  +R++GDTKDH LSQWF NFSEADELL+L AA
Sbjct  183  RVQNHPAVNLPRLPAGLTLPPSIPVEDASKRRKGDTKDHSLSQWFMNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA+LRRQ+S++ GQHQ  K +++ 
Sbjct  243  RQQVQAHIAKLRRQISLIDGQHQQFKSSSDL  273



>ref|XP_006487290.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Citrus sinensis]
Length=273

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 229/270 (85%), Gaps = 1/270 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG  +P+  GP     R KM    +++E ++  +KLK +EIS+PIVYGNVAFWL
Sbjct  4    SSSSKKHGPGQPEEIGPTLKLQRIKM-SKPEEAEKRNLNKKLKDVEISIPIVYGNVAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTR V++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH DVCDKPL+LYHHLKLYPEDESG +STKKP+VVESYDEIV  +PS++FLA
Sbjct  123  FEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKKPVVVESYDEIVFPEPSDSFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV++PRLP    LPP  P+ED  +RKRGDTKDHPL+QWF NFSEADELL+L AA
Sbjct  183  RVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDHPLAQWFMNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            RQQVQ HIA+L+RQ+S++ GQ Q L+  ++
Sbjct  243  RQQVQAHIAKLKRQISLIDGQQQQLRSTSD  272



>ref|XP_007041992.1| YEATS family protein isoform 1 [Theobroma cacao]
 gb|EOX97823.1| YEATS family protein isoform 1 [Theobroma cacao]
Length=299

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/275 (71%), Positives = 229/275 (83%), Gaps = 4/275 (1%)
 Frame = -1

Query  883  LECLKANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGN  704
            L+     S+KKHG D+PDI+G A  S  TKM       E  +  +KLK +EISVPIVYGN
Sbjct  28   LQTCPGPSSKKHGPDQPDISGAALKSQHTKM----GKPEDTERKKKLKDVEISVPIVYGN  83

Query  703  VAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSE  524
             AFWLGKKASEYQSHKWT+Y+RGATNEDL VV+KR VFQLHSSFNNPTRVV++ PFELSE
Sbjct  84   AAFWLGKKASEYQSHKWTVYVRGATNEDLSVVVKRVVFQLHSSFNNPTRVVESAPFELSE  143

Query  523  CGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPS  344
             GWGEFEIAITLYFHNDVC+KPL+LYHHLKLYPEDESGP+S KKP+VVE Y+EIV ++PS
Sbjct  144  SGWGEFEIAITLYFHNDVCEKPLNLYHHLKLYPEDESGPMSIKKPVVVEFYNEIVFTEPS  203

Query  343  EAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELL  164
            E+FLARV N+PAV+ PRLPA   LP +AP+ED  +RKRGDTKDHPL+QWF NFSEADELL
Sbjct  204  ESFLARVQNYPAVTFPRLPAGFTLPSSAPIEDESKRKRGDTKDHPLNQWFLNFSEADELL  263

Query  163  KLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            +L AARQQVQ HIA+LRRQ+S++ GQ+Q  K +++
Sbjct  264  QLAAARQQVQAHIAKLRRQISVIDGQNQQFKSSSD  298



>ref|XP_011088532.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Sesamum indicum]
Length=280

 Score =   358 bits (918),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/264 (75%), Positives = 227/264 (86%), Gaps = 1/264 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            +K+GA++PD +G      RTK+ KSSDD+E K  A+KLK  EI +PIVYGN+AFWLGKKA
Sbjct  3    QKNGAEQPDTSGSMPKLQRTKITKSSDDNEKKSLAKKLKDSEICIPIVYGNIAFWLGKKA  62

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SEYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTR+VD+PPFELSE GWGEFEIA
Sbjct  63   SEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRIVDSPPFELSESGWGEFEIA  122

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITL+FH+DV DKPLHLYHHLKLYPEDESGPLSTKKP+VVESYDEIV+++PSEA  ARV N
Sbjct  123  ITLHFHSDVGDKPLHLYHHLKLYPEDESGPLSTKKPVVVESYDEIVIAEPSEALFARVQN  182

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            +PAV VPR        P  P+ED+D R +GDTKDHPL+QWFTNFSEADELLKL AARQQV
Sbjct  183  YPAVIVPR-LPVGFTLPPVPMEDLDNRNKGDTKDHPLNQWFTNFSEADELLKLAAARQQV  241

Query  136  QGHIARLRRQLSMVGGQHQPLKPA  65
            Q HIARLRRQL+++ GQHQ LK A
Sbjct  242  QAHIARLRRQLTLIDGQHQQLKAA  265



>ref|XP_004507004.1| PREDICTED: protein AF-9 homolog isoform X1 [Cicer arietinum]
Length=273

 Score =   357 bits (917),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 237/270 (88%), Gaps = 1/270 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG D+ +++GP + S RTKM   S+D++ K+S +KLK +EISVPIVYGN+AFWL
Sbjct  4    SSSSKKHGQDQSELSGPTSKSQRTKM-GKSEDNDKKNSGKKLKDVEISVPIVYGNMAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGA+NEDLGV+IKR VFQLHSSFNNPTRVVDAPPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGASNEDLGVIIKRVVFQLHSSFNNPTRVVDAPPFELSEAGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITL+FH+DVCDKPL+LYHHLKLYPEDE+  +STKKP+VVE YDE+V   PSEAFLA
Sbjct  123  FEIAITLHFHSDVCDKPLNLYHHLKLYPEDENSSMSTKKPVVVEFYDEVVFPDPSEAFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV+ PRLPA   LPP  P+ED +RR++GDTKD+PLSQWF +FSEADELL+L AA
Sbjct  183  RVQNHPAVNFPRLPAGHTLPPPIPVEDANRRRKGDTKDNPLSQWFLSFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            RQQVQ HIA+++RQ+S++ GQH+ LK +++
Sbjct  243  RQQVQAHIAKVKRQISLIEGQHKQLKSSSD  272



>ref|XP_010271406.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Nelumbo nucifera]
Length=274

 Score =   356 bits (913),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/269 (72%), Positives = 224/269 (83%), Gaps = 0/269 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
             +SA+KHG D+ D +G    S R KM + ++D + K S ++LK +EISVPIVYG ++FWL
Sbjct  4    TSSARKHGGDQSDGSGSLQKSQRAKMGRVTEDGDRKSSNKRLKDVEISVPIVYGTISFWL  63

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEY SHKWT+YIRGATNEDLGVVIKRAVFQLH SFNNPTRVV++PPFELSE GWGE
Sbjct  64   GKKASEYNSHKWTVYIRGATNEDLGVVIKRAVFQLHPSFNNPTRVVESPPFELSESGWGE  123

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH+DVCDK L LYHHLKLYPEDESGP +TKKP+VVESYDEIV S+PSE+F  
Sbjct  124  FEIAITLYFHSDVCDKQLDLYHHLKLYPEDESGPQTTKKPVVVESYDEIVFSEPSESFFT  183

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV VPRLPA   LPP   +++V+ +KRGDTKDHPLSQWF NFSEADELLKL AA
Sbjct  184  RVQNHPAVIVPRLPASFNLPPPGAIDNVNEKKRGDTKDHPLSQWFMNFSEADELLKLAAA  243

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            RQQVQ +I +LRRQLS++ GQ Q  KP +
Sbjct  244  RQQVQAYIGKLRRQLSVIDGQPQQAKPTS  272



>ref|XP_002306148.2| YEATS family protein [Populus trichocarpa]
 gb|EEE86659.2| YEATS family protein [Populus trichocarpa]
Length=272

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 193/260 (74%), Positives = 221/260 (85%), Gaps = 5/260 (2%)
 Frame = -1

Query  847  GADRP-DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASE  671
            G D P +I+GP   S R KM      +E     +KLK +EISVPIVYGN+AFWLGKKA+E
Sbjct  12   GQDHPVEISGPIPKSQRIKM----SKTEENTEKKKLKDVEISVPIVYGNIAFWLGKKANE  67

Query  670  YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAIT  491
            YQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRV++APPFELSE GWGEFEIAIT
Sbjct  68   YQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVIEAPPFELSEAGWGEFEIAIT  127

Query  490  LYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHP  311
            LYFH+DVCDKPL+LYHHLKLYPEDESG LS KKP+VVESYDEIV  +PSE FLAR+ +HP
Sbjct  128  LYFHSDVCDKPLNLYHHLKLYPEDESGSLSMKKPVVVESYDEIVFPEPSEGFLARIQSHP  187

Query  310  AVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQG  131
            AV++PRLP+   LPP  P+ED  +RKRGDTKDHPLSQWF NFSEADELL+L AARQQVQ 
Sbjct  188  AVNLPRLPSGFTLPPPVPVEDTSKRKRGDTKDHPLSQWFMNFSEADELLQLAAARQQVQA  247

Query  130  HIARLRRQLSMVGGQHQPLK  71
            HIA+LRRQ+S++ GQ+Q LK
Sbjct  248  HIAKLRRQISLIDGQNQQLK  267



>gb|EYU37906.1| hypothetical protein MIMGU_mgv1a011824mg [Erythranthe guttata]
Length=269

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 197/266 (74%), Positives = 227/266 (85%), Gaps = 1/266 (0%)
 Frame = -1

Query  853  KHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKAS  674
            K GA++P+I+G    S RTK+ KSSDD+E K  A+KLK  EI +PIVYGN+AFWLGKKAS
Sbjct  4    KSGAEQPEISGSTQKSQRTKITKSSDDNEKKSLAKKLKDSEICIPIVYGNIAFWLGKKAS  63

Query  673  EYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAI  494
            EYQSH+WT+Y+RGATNEDLGVV+KRAVFQLHSSFNNPTRV++ PPFELSECGWGEFEIAI
Sbjct  64   EYQSHRWTVYVRGATNEDLGVVVKRAVFQLHSSFNNPTRVIEKPPFELSECGWGEFEIAI  123

Query  493  TLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNH  314
            TL+FH+DV +KPLHLYHHLKLYPE+ESGPLSTKKP+V+ESYDEIV+S+PSEA  ARV NH
Sbjct  124  TLHFHSDVGEKPLHLYHHLKLYPEEESGPLSTKKPVVIESYDEIVVSEPSEALFARVQNH  183

Query  313  PAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQ  134
            PAV VPR        P  PLEDVD + R DTKD+PL+QWFTNFSEADELLKL AARQQVQ
Sbjct  184  PAVIVPR-LPADFTLPPVPLEDVDSKNRVDTKDNPLNQWFTNFSEADELLKLAAARQQVQ  242

Query  133  GHIARLRRQLSMVGGQHQPLKPATEF  56
             HIARLRRQL++V GQHQ LK  ++ 
Sbjct  243  AHIARLRRQLTLVDGQHQQLKAPSDI  268



>gb|EYU37905.1| hypothetical protein MIMGU_mgv1a011824mg [Erythranthe guttata]
Length=268

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 197/266 (74%), Positives = 227/266 (85%), Gaps = 1/266 (0%)
 Frame = -1

Query  853  KHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKAS  674
            K GA++P+I+G    S RTK+ KSSDD+E K  A+KLK  EI +PIVYGN+AFWLGKKAS
Sbjct  4    KSGAEQPEISGSTQKSQRTKITKSSDDNEKKSLAKKLKDSEICIPIVYGNIAFWLGKKAS  63

Query  673  EYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAI  494
            EYQSH+WT+Y+RGATNEDLGVV+KRAVFQLHSSFNNPTRV++ PPFELSECGWGEFEIAI
Sbjct  64   EYQSHRWTVYVRGATNEDLGVVVKRAVFQLHSSFNNPTRVIEKPPFELSECGWGEFEIAI  123

Query  493  TLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNH  314
            TL+FH+DV +KPLHLYHHLKLYPE+ESGPLSTKKP+V+ESYDEIV+S+PSEA  ARV NH
Sbjct  124  TLHFHSDVGEKPLHLYHHLKLYPEEESGPLSTKKPVVIESYDEIVVSEPSEALFARVQNH  183

Query  313  PAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQ  134
            PAV VPR        P  PLEDVD + R DTKD+PL+QWFTNFSEADELLKL AARQQVQ
Sbjct  184  PAVIVPR-LPADFTLPPVPLEDVDSKNRVDTKDNPLNQWFTNFSEADELLKLAAARQQVQ  242

Query  133  GHIARLRRQLSMVGGQHQPLKPATEF  56
             HIARLRRQL++V GQHQ LK  ++ 
Sbjct  243  AHIARLRRQLTLVDGQHQQLKAPSDM  268



>ref|XP_007131738.1| hypothetical protein PHAVU_011G037800g [Phaseolus vulgaris]
 gb|ESW03732.1| hypothetical protein PHAVU_011G037800g [Phaseolus vulgaris]
Length=274

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 229/263 (87%), Gaps = 1/263 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG D+P+++GP   S RTKM   S+D++ K+  +KLK +EISVPIVYGN+AFWL
Sbjct  4    SSSSKKHGQDQPELSGPTPKSQRTKM-GKSEDNDKKNMGKKLKDLEISVPIVYGNIAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLG ++KR VFQLHSSFNNPTRVV++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGAIVKRVVFQLHSSFNNPTRVVESPPFELSEAGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FE+AITLYFH+DVCDKPL+LYHHLKLYPEDE+  +S KKP+VVE YDEIV   PSEAFLA
Sbjct  123  FEVAITLYFHSDVCDKPLNLYHHLKLYPEDENSSMSAKKPVVVEFYDEIVFPDPSEAFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV +H AV++PRLPA + LPP  P+ED  +R++GDTKDH LSQWFTNFSEADELL+L AA
Sbjct  183  RVQSHSAVNLPRLPAGITLPPPIPVEDASKRRKGDTKDHSLSQWFTNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQ  80
            RQQVQ HIA+LRRQ++++ GQHQ
Sbjct  243  RQQVQAHIAKLRRQINLIDGQHQ  265



>ref|XP_009379570.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Pyrus x bretschneideri]
Length=273

 Score =   353 bits (905),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/263 (74%), Positives = 230/263 (87%), Gaps = 1/263 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
             +S+K HG D+P+I+G +  SLRTKM    +DSE K   +KLK +EISVPIVYGN+AFWL
Sbjct  4    GSSSKMHGPDQPEISGSSPKSLRTKM-GQPEDSEKKIFHKKLKDVEISVPIVYGNIAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF+NPTRVV++PPFELSECGWGE
Sbjct  63   GKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFSNPTRVVESPPFELSECGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITL+FH+DVCDKPL+L+HHLKLYPEDESGP+STKKP+VVESYDEIV  +PSEA LA
Sbjct  123  FEIAITLFFHSDVCDKPLNLFHHLKLYPEDESGPMSTKKPVVVESYDEIVFPEPSEALLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV N PAV VPRLPA +ALPP  P+ED  + KRGDTKDH L QWFTNFSEADELL+L AA
Sbjct  183  RVQNEPAVVVPRLPAGVALPPPVPVEDPSKGKRGDTKDHFLCQWFTNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQ  80
            RQQVQ HIA+ RR+++++ G+++
Sbjct  243  RQQVQAHIAKFRREMTLLEGKNK  265



>ref|XP_006423534.1| hypothetical protein CICLE_v10029039mg [Citrus clementina]
 gb|ESR36774.1| hypothetical protein CICLE_v10029039mg [Citrus clementina]
 gb|KDO46696.1| hypothetical protein CISIN_1g024038mg [Citrus sinensis]
Length=273

 Score =   352 bits (904),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 230/270 (85%), Gaps = 1/270 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG  +P+ +GP     R KM    +++E K+  +KLK +EIS+PIVYGNVAFWL
Sbjct  4    SSSSKKHGPGQPEESGPTLKLQRIKM-SKPEEAEKKNLNKKLKDVEISIPIVYGNVAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTR V++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH DVCDKPL+LYHHLKLYPEDESG +STKKP+VVESYDEIV  +PS++FLA
Sbjct  123  FEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKKPVVVESYDEIVFPEPSDSFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV++PRLP    LPP  P+ED  +RKRGDTKDHPL+QWF NFSEADELL+L AA
Sbjct  183  RVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDHPLAQWFMNFSEADELLQLAAA  242

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            RQQVQ HIA+L+RQ+S++ GQ Q L+  ++
Sbjct  243  RQQVQAHIAKLKRQISLIDGQQQQLRSTSD  272



>gb|KDO46697.1| hypothetical protein CISIN_1g024038mg [Citrus sinensis]
Length=240

 Score =   345 bits (886),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGNVAFWLGKKASEYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  9    KKLKDVEISIPIVYGNVAFWLGKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSF  68

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTR V++PPFELSE GWGEFEIAITLYFH DVCDKPL+LYHHLKLYPEDESG +STKK
Sbjct  69   NNPTRAVESPPFELSESGWGEFEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKK  128

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDEIV  +PS++FLARV NHPAV++PRLP    LPP  P+ED  +RKRGDTKDH
Sbjct  129  PVVVESYDEIVFPEPSDSFLARVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDH  188

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+QWF NFSEADELL+L AARQQVQ HIA+L+RQ+S++ GQ Q L+  ++
Sbjct  189  PLAQWFMNFSEADELLQLAAARQQVQAHIAKLKRQISLIDGQQQQLRSTSD  239



>ref|XP_004290328.1| PREDICTED: protein AF-9 homolog [Fragaria vesca subsp. vesca]
Length=273

 Score =   346 bits (888),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 185/262 (71%), Positives = 219/262 (84%), Gaps = 1/262 (0%)
 Frame = -1

Query  865  NSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLG  686
            +S   +  D+PD + P       KM+K  D  +     +KLK +EISVPIVYGN+AFWLG
Sbjct  5    SSPVMNSPDQPDTSAPTPKPQPAKMVKLEDTEKKIFH-KKLKDVEISVPIVYGNIAFWLG  63

Query  685  KKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEF  506
            KKA+EYQSHKWT+Y+RGATNEDLGVVIKR VFQLHSSFNNPTRVV++PPFELSECGWGEF
Sbjct  64   KKANEYQSHKWTVYVRGATNEDLGVVIKRVVFQLHSSFNNPTRVVESPPFELSECGWGEF  123

Query  505  EIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLAR  326
            EIAITL+FH+DVC+KPL+L+HHLKLYPEDESGP+STKKP+VVESYDEIV  +PSE+FLAR
Sbjct  124  EIAITLFFHSDVCEKPLNLFHHLKLYPEDESGPISTKKPVVVESYDEIVFPEPSESFLAR  183

Query  325  VHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAAR  146
            V NHPA+  PRLP+ L LPP  P+ED  +RKRGDTKDHPL+QWF NFSEADELL+L AAR
Sbjct  184  VQNHPAIVSPRLPSGLTLPPPVPVEDPSKRKRGDTKDHPLTQWFMNFSEADELLQLAAAR  243

Query  145  QQVQGHIARLRRQLSMVGGQHQ  80
            QQVQ HIA+ RR++S++  Q Q
Sbjct  244  QQVQAHIAKFRREISLMDVQQQ  265



>gb|KFK31550.1| hypothetical protein AALP_AA6G126500 [Arabis alpina]
Length=268

 Score =   344 bits (883),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 219/271 (81%), Gaps = 7/271 (3%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KK   D+P+ T P   SLRTKM          D  +KLK IEISVP+VYGNVAFWL
Sbjct  5    SSSSKKQVQDQPETTEPTLKSLRTKM-------SKSDEKKKLKDIEISVPLVYGNVAFWL  57

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKW +Y+RGATNED+  V+K+ VFQLHSSFNNPTRV++ PPFE+SE GWGE
Sbjct  58   GKKASEYQSHKWAVYVRGATNEDISTVVKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGE  117

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIA+TL+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLA
Sbjct  118  FEIAMTLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLA  177

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPA++ PRLP+   LP    ++D  ++KRGDTKDH L QWFT+FSEADELL+L AA
Sbjct  178  RVQNHPALTFPRLPSGYNLPAPMQVDDNGKKKRGDTKDHSLGQWFTSFSEADELLQLAAA  237

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA+LRRQ+S++ GQ+Q +K  ++ 
Sbjct  238  RQQVQAHIAKLRRQISLLEGQNQTIKTGSDL  268



>ref|XP_010246404.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010246405.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Nelumbo nucifera]
Length=274

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 190/269 (71%), Positives = 225/269 (84%), Gaps = 0/269 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
             +SA+KHG D+ + +G    S R KM   ++DSE K S+++LK +EISVPIVYG V+FWL
Sbjct  4    TSSARKHGGDQSEGSGSVLKSQRAKMGGIANDSEKKGSSKRLKDVEISVPIVYGTVSFWL  63

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GK+ASEY SHKWT+Y+RG TNEDLGVVI+RAVFQLH+SFNNPTRVVD+PPFELSE GWGE
Sbjct  64   GKRASEYNSHKWTVYVRGTTNEDLGVVIRRAVFQLHTSFNNPTRVVDSPPFELSESGWGE  123

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH+DVCDK L LYHHLKLYPED+SGP STKKP+VVESYDEIV S+PSE+F A
Sbjct  124  FEIAITLYFHSDVCDKQLDLYHHLKLYPEDDSGPQSTKKPVVVESYDEIVFSEPSESFFA  183

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV VPRLPA   LPP AP+++V+ +K+GDTKDH LSQWF  FSEADELLKL AA
Sbjct  184  RVQNHPAVIVPRLPATFNLPPPAPIDNVNEKKKGDTKDHTLSQWFMTFSEADELLKLAAA  243

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            RQQVQ +I +LRRQ+S++ GQ Q   P +
Sbjct  244  RQQVQAYIVKLRRQMSLIDGQPQQSLPTS  272



>emb|CBI37970.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   343 bits (881),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 208/231 (90%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVPIVYGN+AFWLGKKASEYQSHKWT+Y+R  TNEDLGVVIKRAVFQLHSSF
Sbjct  15   KRLKDVEISVPIVYGNIAFWLGKKASEYQSHKWTVYVRSPTNEDLGVVIKRAVFQLHSSF  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFELSE GWGEFEIAITLYF +DVCDKPL+LYHHLKLYPEDESGP+S KK
Sbjct  75   NNPTRVVESPPFELSEAGWGEFEIAITLYFQSDVCDKPLNLYHHLKLYPEDESGPMSAKK  134

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDEIV S+PSE F ARV NHPAV VPRLPA  +LPP  PLEDV+ +KR D+KD+
Sbjct  135  PVVVESYDEIVFSEPSEGFFARVQNHPAVIVPRLPAGFSLPPPVPLEDVNEKKRFDSKDN  194

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+QWF NFSEADELL+L AARQQVQ HIA+LRRQ+S++ GQHQ LKP ++
Sbjct  195  PLNQWFKNFSEADELLQLAAARQQVQAHIAKLRRQISVIDGQHQQLKPTSD  245



>ref|NP_001190475.1| GAS 41-like protein [Arabidopsis thaliana]
 gb|AED95274.1| GAS 41-like protein [Arabidopsis thaliana]
Length=267

 Score =   344 bits (883),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 221/271 (82%), Gaps = 7/271 (3%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KK   D+P+ + P   SL+TKM KS +        +KLK IEISVPIVYGNVAFWL
Sbjct  4    SSSSKKQAQDQPETSEPTLKSLKTKMTKSDEK-------KKLKDIEISVPIVYGNVAFWL  56

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKW +Y+RGATNED+ VV+K+ VFQLHSSFN+PTRV++ PPFE+SE GWGE
Sbjct  57   GKKASEYQSHKWAVYVRGATNEDISVVVKKVVFQLHSSFNSPTRVIEEPPFEVSESGWGE  116

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIA+TL+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLA
Sbjct  117  FEIAMTLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLA  176

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPA++ PRLP+   LP    +ED  ++KRGDTKDH L QWF +FSEADELL+L AA
Sbjct  177  RVQNHPALTFPRLPSGYNLPAPMQVEDTGKKKRGDTKDHSLGQWFMSFSEADELLQLAAA  236

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA+LRRQ+S++ GQ+Q +K  ++ 
Sbjct  237  RQQVQAHIAKLRRQISLLEGQNQTVKTGSDL  267



>ref|NP_199373.1| GAS 41-like protein [Arabidopsis thaliana]
 sp|Q9FH40.1|TA14B_ARATH RecName: Full=Transcription initiation factor TFIID subunit 14b; 
AltName: Full=GAS 41-like protein; AltName: Full=Protein 
AF-9 homolog a; AltName: Full=TBP-associated factor 14b; Short=AtTAF14b 
[Arabidopsis thaliana]
 dbj|BAB11199.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL59945.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20126.1| unknown protein [Arabidopsis thaliana]
 gb|AAR28019.1| TAF14b [Arabidopsis thaliana]
 gb|AED95273.1| GAS 41-like protein [Arabidopsis thaliana]
Length=268

 Score =   344 bits (883),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 181/271 (67%), Positives = 221/271 (82%), Gaps = 6/271 (2%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KK   D+P+ + P   SL+TKM KS +        +KLK IEISVPIVYGNVAFWL
Sbjct  4    SSSSKKQAQDQPETSEPTLKSLKTKMTKSDEKQ------KKLKDIEISVPIVYGNVAFWL  57

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKW +Y+RGATNED+ VV+K+ VFQLHSSFN+PTRV++ PPFE+SE GWGE
Sbjct  58   GKKASEYQSHKWAVYVRGATNEDISVVVKKVVFQLHSSFNSPTRVIEEPPFEVSESGWGE  117

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIA+TL+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLA
Sbjct  118  FEIAMTLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLA  177

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPA++ PRLP+   LP    +ED  ++KRGDTKDH L QWF +FSEADELL+L AA
Sbjct  178  RVQNHPALTFPRLPSGYNLPAPMQVEDTGKKKRGDTKDHSLGQWFMSFSEADELLQLAAA  237

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA+LRRQ+S++ GQ+Q +K  ++ 
Sbjct  238  RQQVQAHIAKLRRQISLLEGQNQTVKTGSDL  268



>gb|AES89292.2| YEATS family protein [Medicago truncatula]
Length=273

 Score =   344 bits (883),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 185/269 (69%), Positives = 226/269 (84%), Gaps = 1/269 (0%)
 Frame = -1

Query  877  CLKANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVA  698
             L  +S+K H  D+  ++GP   S   KM   S+D++ K+S +KLK +EISVPIVYGNV+
Sbjct  1    MLNTSSSKNHDQDQSQLSGPTPNSHPIKM-GKSEDNDKKNSGKKLKDVEISVPIVYGNVS  59

Query  697  FWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECG  518
            FWLGKKASEYQSHKWT+Y+RGA+NEDLGV++KR VFQLH+SFNNPTR+VDAPPFELSE G
Sbjct  60   FWLGKKASEYQSHKWTIYVRGASNEDLGVIVKRVVFQLHTSFNNPTRIVDAPPFELSEAG  119

Query  517  WGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEA  338
            WGEFEIAITLYFH+DVCDKP++LYH L+LYP+DES   STKKP+VVE YDE+V   PSEA
Sbjct  120  WGEFEIAITLYFHSDVCDKPVNLYHQLRLYPDDESSSYSTKKPVVVEFYDEVVFPDPSEA  179

Query  337  FLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKL  158
            FLAR+ NHP V++PRLPA L LPP  P+ED  +R+RGDTKD+PLSQWF NFSEADELL+L
Sbjct  180  FLARLQNHPVVNMPRLPAGLTLPPPIPIEDASKRRRGDTKDNPLSQWFLNFSEADELLQL  239

Query  157  TAARQQVQGHIARLRRQLSMVGGQHQPLK  71
             AARQQVQ HI++L+RQ+S++ GQH+ LK
Sbjct  240  AAARQQVQAHISKLKRQISLIDGQHKQLK  268



>ref|XP_002865236.1| hypothetical protein ARALYDRAFT_494425 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41495.1| hypothetical protein ARALYDRAFT_494425 [Arabidopsis lyrata subsp. 
lyrata]
Length=268

 Score =   343 bits (880),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 180/271 (66%), Positives = 220/271 (81%), Gaps = 6/271 (2%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KK   D+P+ + P   SL+ KM KS +        +KLK IEISVPIVYGNVAFWL
Sbjct  4    SSSSKKQAQDQPETSEPTLKSLKAKMTKSDEKQ------KKLKDIEISVPIVYGNVAFWL  57

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKW +Y+RGATNED+ VV+K+ VFQLHSSFNNPTRV++ PPFE+SE GWGE
Sbjct  58   GKKASEYQSHKWAVYVRGATNEDISVVVKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGE  117

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIA+TL+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FL+
Sbjct  118  FEIAMTLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLS  177

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPA++ PRLP+   LP    +ED  ++KRGDTKDH L QWF +FSEADELL+L AA
Sbjct  178  RVQNHPALTFPRLPSGYNLPAPMQVEDTGKKKRGDTKDHSLGQWFMSFSEADELLQLAAA  237

Query  148  RQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            RQQVQ HIA+LRRQ+S++ GQ+Q +K  ++ 
Sbjct  238  RQQVQAHIAKLRRQISLLEGQNQTVKTGSDL  268



>ref|XP_006398239.1| hypothetical protein EUTSA_v10000994mg [Eutrema salsugineum]
 gb|ESQ39692.1| hypothetical protein EUTSA_v10000994mg [Eutrema salsugineum]
Length=268

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 181/256 (71%), Positives = 212/256 (83%), Gaps = 7/256 (3%)
 Frame = -1

Query  841  DRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQS  662
            D+PDI+G  + S RTKM          D  +KLK IEISVP+VYGNVAFWLGKKASEYQS
Sbjct  13   DQPDISGSTSKSQRTKM-------SKSDEKKKLKDIEISVPLVYGNVAFWLGKKASEYQS  65

Query  661  HKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYF  482
            HKW +Y+RGATNED+ VVIK+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIAITL+F
Sbjct  66   HKWAVYVRGATNEDISVVIKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAITLHF  125

Query  481  HNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVS  302
            H+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLARV NHPA++
Sbjct  126  HSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHPALT  185

Query  301  VPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIA  122
             PRLP+   LP    +ED  ++KRGDTKDH L QWFT+FSEADELL+L AARQQVQ HIA
Sbjct  186  FPRLPSGYNLPAPMQVEDSGKKKRGDTKDHSLGQWFTSFSEADELLQLAAARQQVQAHIA  245

Query  121  RLRRQLSMVGGQHQPL  74
            +LRRQ+S++ GQ+Q +
Sbjct  246  KLRRQISLLEGQNQTI  261



>ref|XP_006379267.1| hypothetical protein POPTR_0009s12900g [Populus trichocarpa]
 gb|ERP57064.1| hypothetical protein POPTR_0009s12900g [Populus trichocarpa]
Length=250

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGN+AFWLGKK++EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  19   KKLKDVEISIPIVYGNIAFWLGKKSNEYQSHKWTIYVRGATNEDLGVVIKRAVFQLHSSF  78

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRV++APPFELSE GWGEFEIAITLYFH+DVCDKPL+LYHHLKLYPEDE GP+S KK
Sbjct  79   NNPTRVIEAPPFELSEAGWGEFEIAITLYFHSDVCDKPLNLYHHLKLYPEDEPGPVSMKK  138

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDEIV  +PSE FLARV +HPAV++PRLPA   LPP  P+ED  +RKRGDTKD+
Sbjct  139  PVVVESYDEIVFPEPSEGFLARVQSHPAVNLPRLPAGFTLPPPMPVEDTSKRKRGDTKDN  198

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PL+QWF  FSEAD+LL+L AARQQVQ HIA+LRRQ+S++ GQ Q LK
Sbjct  199  PLAQWFMKFSEADKLLQLAAARQQVQAHIAKLRRQISLINGQDQHLK  245



>ref|XP_006592078.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Glycine max]
Length=239

 Score =   339 bits (869),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 207/232 (89%), Gaps = 0/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGNVAFWLGKKASEYQSHKWT+Y+RGATNEDLG +IK AVFQLHSSF
Sbjct  8    KKLKDVEISIPIVYGNVAFWLGKKASEYQSHKWTVYVRGATNEDLGTIIKHAVFQLHSSF  67

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFELSE GWGEFE++ITLYFH+DVCDKPL+LYHHLKLYPEDE+  +STKK
Sbjct  68   NNPTRVVESPPFELSESGWGEFEVSITLYFHSDVCDKPLNLYHHLKLYPEDENSSMSTKK  127

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE YDEIV   PSEAFLARV NHPAV++PRLPA L LPP+ P+ED  +R++GDTKDH
Sbjct  128  PVVVEFYDEIVFPDPSEAFLARVQNHPAVNLPRLPAGLTLPPSIPVEDASKRRKGDTKDH  187

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
             LSQWF NFSEADELL+L AARQQVQ HIA+LRRQ+S++ GQHQ  K +++ 
Sbjct  188  SLSQWFMNFSEADELLQLAAARQQVQAHIAKLRRQISLIDGQHQQFKSSSDL  239



>ref|XP_007041993.1| YEATS family protein isoform 2 [Theobroma cacao]
 gb|EOX97824.1| YEATS family protein isoform 2 [Theobroma cacao]
Length=242

 Score =   337 bits (865),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EISVPIVYGN AFWLGKKASEYQSHKWT+Y+RGATNEDL VV+KR VFQLHSSF
Sbjct  11   KKLKDVEISVPIVYGNAAFWLGKKASEYQSHKWTVYVRGATNEDLSVVVKRVVFQLHSSF  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++ PFELSE GWGEFEIAITLYFHNDVC+KPL+LYHHLKLYPEDESGP+S KK
Sbjct  71   NNPTRVVESAPFELSESGWGEFEIAITLYFHNDVCEKPLNLYHHLKLYPEDESGPMSIKK  130

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE Y+EIV ++PSE+FLARV N+PAV+ PRLPA   LP +AP+ED  +RKRGDTKDH
Sbjct  131  PVVVEFYNEIVFTEPSESFLARVQNYPAVTFPRLPAGFTLPSSAPIEDESKRKRGDTKDH  190

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+QWF NFSEADELL+L AARQQVQ HIA+LRRQ+S++ GQ+Q  K +++
Sbjct  191  PLNQWFLNFSEADELLQLAAARQQVQAHIAKLRRQISVIDGQNQQFKSSSD  241



>ref|XP_007041994.1| YEATS family protein isoform 3 [Theobroma cacao]
 gb|EOX97825.1| YEATS family protein isoform 3 [Theobroma cacao]
Length=241

 Score =   337 bits (865),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 177/231 (77%), Positives = 207/231 (90%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EISVPIVYGN AFWLGKKASEYQSHKWT+Y+RGATNEDL VV+KR VFQLHSSF
Sbjct  10   KKLKDVEISVPIVYGNAAFWLGKKASEYQSHKWTVYVRGATNEDLSVVVKRVVFQLHSSF  69

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++ PFELSE GWGEFEIAITLYFHNDVC+KPL+LYHHLKLYPEDESGP+S KK
Sbjct  70   NNPTRVVESAPFELSESGWGEFEIAITLYFHNDVCEKPLNLYHHLKLYPEDESGPMSIKK  129

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE Y+EIV ++PSE+FLARV N+PAV+ PRLPA   LP +AP+ED  +RKRGDTKDH
Sbjct  130  PVVVEFYNEIVFTEPSESFLARVQNYPAVTFPRLPAGFTLPSSAPIEDESKRKRGDTKDH  189

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+QWF NFSEADELL+L AARQQVQ HIA+LRRQ+S++ GQ+Q  K +++
Sbjct  190  PLNQWFLNFSEADELLQLAAARQQVQAHIAKLRRQISVIDGQNQQFKSSSD  240



>ref|XP_006280955.1| hypothetical protein CARUB_v10026956mg [Capsella rubella]
 gb|EOA13853.1| hypothetical protein CARUB_v10026956mg [Capsella rubella]
Length=268

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 179/262 (68%), Positives = 214/262 (82%), Gaps = 7/262 (3%)
 Frame = -1

Query  841  DRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQS  662
            D+P+ + P   SL+ KM KS +        +KLK IEISVPIVYGNVAFWLGKKASEYQS
Sbjct  14   DQPETSEPTLKSLKAKMTKSDEK-------KKLKDIEISVPIVYGNVAFWLGKKASEYQS  66

Query  661  HKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYF  482
            HKW +Y+RGATNED+ VV+K+ VFQLHSSFNNPTRVV+ PPFE+SE GWGEFEIA+TL+F
Sbjct  67   HKWAVYVRGATNEDISVVVKKVVFQLHSSFNNPTRVVEEPPFEVSESGWGEFEIAMTLHF  126

Query  481  HNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVS  302
            H+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLARV NHPA++
Sbjct  127  HSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHPALT  186

Query  301  VPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIA  122
             PRLP+   LP    ++D  ++KRGDTKDH L QWF +FSEADELL+L AARQQVQ HIA
Sbjct  187  FPRLPSGYNLPAPMQVDDTGKKKRGDTKDHSLGQWFMSFSEADELLQLAAARQQVQAHIA  246

Query  121  RLRRQLSMVGGQHQPLKPATEF  56
            +LRRQ+S++ GQ+Q +K  T+ 
Sbjct  247  KLRRQISLLEGQNQTIKTGTDL  268



>ref|XP_011047070.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X3 [Populus euphratica]
Length=250

 Score =   336 bits (861),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGN+AFWLGK ++EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  19   KKLKDVEISIPIVYGNIAFWLGKMSNEYQSHKWTIYVRGATNEDLGVVIKRAVFQLHSSF  78

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRV++APPFELSE GWGEFEIAI LYFH+DVCDKPL+LYHHLKLYPEDE GP+S KK
Sbjct  79   NNPTRVIEAPPFELSEAGWGEFEIAIALYFHSDVCDKPLNLYHHLKLYPEDEPGPVSIKK  138

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDEIV  +PSE FLARV +HPAV++PRLPA   LPP  P+ED  +RKRGDTKD 
Sbjct  139  PVVVESYDEIVFPEPSEGFLARVQSHPAVNLPRLPAGFTLPPPMPVEDTSKRKRGDTKDS  198

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PL+QWF  FSEAD+LL+L AARQQVQ HIA+LRRQ+S++ GQ+Q LK
Sbjct  199  PLAQWFMKFSEADKLLQLAAARQQVQAHIAKLRRQISLINGQNQHLK  245



>ref|XP_009101584.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Brassica rapa]
 emb|CDY39435.1| BnaAnng05660D [Brassica napus]
Length=261

 Score =   336 bits (862),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 179/265 (68%), Positives = 215/265 (81%), Gaps = 7/265 (3%)
 Frame = -1

Query  853  KHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKAS  674
            K   D P+ + P   SLRTKM KS +        +KLK IEISVP+VYGN+A+WLGKKAS
Sbjct  3    KQAQDPPETSEPTLKSLRTKMTKSDEK-------KKLKDIEISVPLVYGNIAYWLGKKAS  55

Query  673  EYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAI  494
            EYQSHKWT+Y+RGATNED+ VVIK+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIAI
Sbjct  56   EYQSHKWTVYVRGATNEDISVVIKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAI  115

Query  493  TLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNH  314
            TL+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVE YDEIV   P E+FLARV NH
Sbjct  116  TLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVEHYDEIVFPDPCESFLARVQNH  175

Query  313  PAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQ  134
            PA++ PRLP+   LP    ++D  ++KRGDTKDH L QWFT+FSEADELL+L AARQQVQ
Sbjct  176  PALTFPRLPSGYNLPAPMQVDDNGKKKRGDTKDHSLGQWFTSFSEADELLQLAAARQQVQ  235

Query  133  GHIARLRRQLSMVGGQHQPLKPATE  59
             HIA+LRRQ+S++ GQ+Q +K  ++
Sbjct  236  AHIAKLRRQISLLEGQNQTIKTGSD  260



>ref|XP_009101585.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Brassica rapa]
Length=260

 Score =   336 bits (861),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 179/265 (68%), Positives = 215/265 (81%), Gaps = 8/265 (3%)
 Frame = -1

Query  853  KHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKAS  674
            K   D P+ + P   SLRTKM KS +        +KLK IEISVP+VYGN+A+WLGKKAS
Sbjct  3    KQAQDPPETSEPTLKSLRTKMTKSDE--------KKLKDIEISVPLVYGNIAYWLGKKAS  54

Query  673  EYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAI  494
            EYQSHKWT+Y+RGATNED+ VVIK+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIAI
Sbjct  55   EYQSHKWTVYVRGATNEDISVVIKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAI  114

Query  493  TLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNH  314
            TL+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVE YDEIV   P E+FLARV NH
Sbjct  115  TLHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVEHYDEIVFPDPCESFLARVQNH  174

Query  313  PAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQ  134
            PA++ PRLP+   LP    ++D  ++KRGDTKDH L QWFT+FSEADELL+L AARQQVQ
Sbjct  175  PALTFPRLPSGYNLPAPMQVDDNGKKKRGDTKDHSLGQWFTSFSEADELLQLAAARQQVQ  234

Query  133  GHIARLRRQLSMVGGQHQPLKPATE  59
             HIA+LRRQ+S++ GQ+Q +K  ++
Sbjct  235  AHIAKLRRQISLLEGQNQTIKTGSD  259



>ref|XP_010441694.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Camelina sativa]
 ref|XP_010481552.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Camelina sativa]
 ref|XP_010494673.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Camelina sativa]
Length=268

 Score =   336 bits (861),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 215/262 (82%), Gaps = 6/262 (2%)
 Frame = -1

Query  841  DRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQS  662
            D+P+ + P   SL+TKM KS +        +KLK IEISVPIVYGNVAFWLGKKASEYQS
Sbjct  13   DQPETSEPTLKSLKTKMTKSDEKQ------KKLKDIEISVPIVYGNVAFWLGKKASEYQS  66

Query  661  HKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYF  482
            HKW +Y+RGATNED+ VV+K+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIA+TL+F
Sbjct  67   HKWAVYVRGATNEDISVVVKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAMTLHF  126

Query  481  HNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVS  302
            H+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLARV NH A++
Sbjct  127  HSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHLALT  186

Query  301  VPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIA  122
             PRLP+   LP    ++D  ++KRGDTKDH L QWFT+FSEADELL+L AARQQVQ HIA
Sbjct  187  FPRLPSGYNLPAPMQVDDTGKKKRGDTKDHSLGQWFTSFSEADELLQLAAARQQVQAHIA  246

Query  121  RLRRQLSMVGGQHQPLKPATEF  56
            +LRRQ+S++ GQ+Q +K  ++ 
Sbjct  247  KLRRQISVLEGQNQTIKTGSDL  268



>ref|XP_010441695.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Camelina sativa]
 ref|XP_010481553.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Camelina sativa]
 ref|XP_010494674.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Camelina sativa]
Length=267

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 215/262 (82%), Gaps = 7/262 (3%)
 Frame = -1

Query  841  DRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQS  662
            D+P+ + P   SL+TKM KS +        +KLK IEISVPIVYGNVAFWLGKKASEYQS
Sbjct  13   DQPETSEPTLKSLKTKMTKSDEK-------KKLKDIEISVPIVYGNVAFWLGKKASEYQS  65

Query  661  HKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYF  482
            HKW +Y+RGATNED+ VV+K+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIA+TL+F
Sbjct  66   HKWAVYVRGATNEDISVVVKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAMTLHF  125

Query  481  HNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVS  302
            H+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FLARV NH A++
Sbjct  126  HSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLARVQNHLALT  185

Query  301  VPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIA  122
             PRLP+   LP    ++D  ++KRGDTKDH L QWFT+FSEADELL+L AARQQVQ HIA
Sbjct  186  FPRLPSGYNLPAPMQVDDTGKKKRGDTKDHSLGQWFTSFSEADELLQLAAARQQVQAHIA  245

Query  121  RLRRQLSMVGGQHQPLKPATEF  56
            +LRRQ+S++ GQ+Q +K  ++ 
Sbjct  246  KLRRQISVLEGQNQTIKTGSDL  267



>ref|XP_009368360.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Pyrus x bretschneideri]
Length=259

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 189/245 (77%), Positives = 213/245 (87%), Gaps = 3/245 (1%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATM--SLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAF  695
             +S+  HG D+P+I+GPA    SLRTKM    +DSE K   +KLK +EISVPIVYGN+AF
Sbjct  4    GSSSTMHGPDQPEISGPAPAPKSLRTKM-GKPEDSEKKIFHKKLKDVEISVPIVYGNIAF  62

Query  694  WLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGW  515
            WLGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTRVV++PPFELSECGW
Sbjct  63   WLGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRVVESPPFELSECGW  122

Query  514  GEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAF  335
            GEFEIAITL+FH+DVCDKPL+L+HHLKLYP DESGP+STKKP+VVESYDEIV  +PSEAF
Sbjct  123  GEFEIAITLFFHSDVCDKPLNLFHHLKLYPADESGPMSTKKPVVVESYDEIVFPEPSEAF  182

Query  334  LARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLT  155
            LARV N PAV VPRLPA +ALPP  P+ED   RKRGDTKDHPL QWFTNFSEADELL+L 
Sbjct  183  LARVQNQPAVVVPRLPAGVALPPPVPVEDPSNRKRGDTKDHPLCQWFTNFSEADELLRLA  242

Query  154  AARQQ  140
             ARQQ
Sbjct  243  TARQQ  247



>ref|XP_003607095.1| YEATS domain-containing protein [Medicago truncatula]
Length=245

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EISVPIVYGNV+FWLGKKASEYQSHKWT+Y+RGA+NEDLGV++KR VFQLH+SF
Sbjct  14   KKLKDVEISVPIVYGNVSFWLGKKASEYQSHKWTIYVRGASNEDLGVIVKRVVFQLHTSF  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTR+VDAPPFELSE GWGEFEIAITLYFH+DVCDKP++LYH L+LYP+DES   STKK
Sbjct  74   NNPTRIVDAPPFELSEAGWGEFEIAITLYFHSDVCDKPVNLYHQLRLYPDDESSSYSTKK  133

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE YDE+V   PSEAFLAR+ NHP V++PRLPA L LPP  P+ED  +R+RGDTKD+
Sbjct  134  PVVVEFYDEVVFPDPSEAFLARLQNHPVVNMPRLPAGLTLPPPIPIEDASKRRRGDTKDN  193

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PLSQWF NFSEADELL+L AARQQVQ HI++L+RQ+S++ GQH+ LK
Sbjct  194  PLSQWFLNFSEADELLQLAAARQQVQAHISKLKRQISLIDGQHKQLK  240



>emb|CDY38963.1| BnaC07g18570D [Brassica napus]
Length=267

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 177/261 (68%), Positives = 214/261 (82%), Gaps = 7/261 (3%)
 Frame = -1

Query  841  DRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQS  662
            D P+ + P   SLRTKM KS +        +KLK IEISVP+VYGN+A WLGKKASEYQS
Sbjct  13   DPPETSEPTLKSLRTKMTKSDEK-------KKLKDIEISVPLVYGNIASWLGKKASEYQS  65

Query  661  HKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYF  482
            HKW++Y+RGATNED+ VVIK+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIAITL+F
Sbjct  66   HKWSVYVRGATNEDISVVIKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAITLHF  125

Query  481  HNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVS  302
            H+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVE YDEIV   PSE+FL+RV NHPA++
Sbjct  126  HSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVEHYDEIVFPDPSESFLSRVQNHPALT  185

Query  301  VPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIA  122
             PRLP+   LP    ++D  ++KRGDTKDH L QWFT+FSEADELL+L AARQQVQ HIA
Sbjct  186  FPRLPSGYNLPAPMQVDDNGKKKRGDTKDHSLGQWFTSFSEADELLQLAAARQQVQAHIA  245

Query  121  RLRRQLSMVGGQHQPLKPATE  59
            +LRRQ+S++ GQ+Q +K  ++
Sbjct  246  KLRRQISLLEGQNQTIKTGSD  266



>ref|XP_010029691.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Eucalyptus grandis]
 ref|XP_010029692.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Eucalyptus grandis]
 gb|KCW56653.1| hypothetical protein EUGRSUZ_I02357 [Eucalyptus grandis]
Length=270

 Score =   332 bits (850),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 212/269 (79%), Gaps = 1/269 (0%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            SA+K G  +P+  G AT   R K+ K S+D E K  +++LK  EIS+PIVYG +AF+LG+
Sbjct  2    SARKQGDGQPE-DGGATAGKRLKIAKFSEDPEKKGLSRRLKDAEISLPIVYGTIAFYLGR  60

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASE QSHKWT+Y+RGATNEDL  VIKR VFQLH SFNNPTRV++APPFELSECGWGEFE
Sbjct  61   KASESQSHKWTVYVRGATNEDLSAVIKRVVFQLHPSFNNPTRVMEAPPFELSECGWGEFE  120

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAI+L+FH DVCDK L LYHHLKLYPEDESGP STKKP+VVESYDEIV   PSEAF ARV
Sbjct  121  IAISLFFHPDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYDEIVFPDPSEAFYARV  180

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             N+PAV VPR+PA   +      E+   R+RGDTKDHPLSQWF NFSEADELLKL AARQ
Sbjct  181  QNNPAVIVPRMPAGFNISAPVAPENTSERERGDTKDHPLSQWFMNFSEADELLKLAAARQ  240

Query  142  QVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            QVQ HI +LRRQLS++ G  Q  KPA  +
Sbjct  241  QVQAHIVKLRRQLSVMDGMPQLSKPAPAY  269



>ref|XP_011047051.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Populus euphratica]
Length=253

 Score =   331 bits (848),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 199/230 (87%), Gaps = 3/230 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGN+AFWLGK ++EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  19   KKLKDVEISIPIVYGNIAFWLGKMSNEYQSHKWTIYVRGATNEDLGVVIKRAVFQLHSSF  78

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRV++APPFELSE GWGEFEIAI LYFH+DVCDKPL+LYHHLKLYPEDE GP+S KK
Sbjct  79   NNPTRVIEAPPFELSEAGWGEFEIAIALYFHSDVCDKPLNLYHHLKLYPEDEPGPVSIKK  138

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRl---padlalppaapLEDVDRRKRGDT  221
            P+VVESYDEIV  +PSE FLARV +HPAV++PRL          P  P+ED  +RKRGDT
Sbjct  139  PVVVESYDEIVFPEPSEGFLARVQSHPAVNLPRLPAGFTLPPPMPVVPVEDTSKRKRGDT  198

Query  220  KDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            KD PL+QWF  FSEAD+LL+L AARQQVQ HIA+LRRQ+S++ GQ+Q LK
Sbjct  199  KDSPLAQWFMKFSEADKLLQLAAARQQVQAHIAKLRRQISLINGQNQHLK  248



>ref|XP_003517178.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Glycine max]
 gb|KHN36037.1| Protein AF-9 like [Glycine soja]
Length=279

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/267 (69%), Positives = 216/267 (81%), Gaps = 0/267 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            K+ G    D    A    R K+   S+DS+ K++ ++LK +EI VPIVYG +AF+LG+KA
Sbjct  10   KRQGEQSSDDGASAIKLSRLKIAIPSEDSDKKNANRRLKDVEICVPIVYGTIAFYLGRKA  69

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SE QSHKWT+Y+RGA+NEDLGVV+KR VFQLH SFNNPTRVV++PPFELSECGWGEFEIA
Sbjct  70   SESQSHKWTVYVRGASNEDLGVVVKRVVFQLHPSFNNPTRVVESPPFELSECGWGEFEIA  129

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITLYFH DVC+K L LYHHLKLYPEDESGP STKKP+VVESY+EIV  +PSE FLARV N
Sbjct  130  ITLYFHPDVCEKQLDLYHHLKLYPEDESGPQSTKKPVVVESYNEIVFPEPSEGFLARVQN  189

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPAV+VPRLPA L LP   P++ V+ ++RGDTKDHPL+QWF NFSEADELLKL AARQQV
Sbjct  190  HPAVNVPRLPAGLNLPSPVPIDTVNDKERGDTKDHPLTQWFMNFSEADELLKLAAARQQV  249

Query  136  QGHIARLRRQLSMVGGQHQPLKPATEF  56
            Q HI +LRRQLS+V G  Q  KP + +
Sbjct  250  QAHIVKLRRQLSLVEGLPQLSKPPSGY  276



>gb|KHN41899.1| Protein AF-9 like [Glycine soja]
Length=279

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 214/267 (80%), Gaps = 0/267 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            K+ G    D    A    R K+   S+DS+ K++ ++LK +EI VPIVYG +AF+LG+KA
Sbjct  10   KRQGEQSSDDGASAIKPSRLKIAIPSEDSDKKNANRRLKDVEICVPIVYGTIAFYLGRKA  69

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SE QSHKWT+Y+RGA+NEDLGVV+KR VFQLH SFNNPTRVV++PPFELSECGWGEFEIA
Sbjct  70   SESQSHKWTVYVRGASNEDLGVVVKRVVFQLHPSFNNPTRVVESPPFELSECGWGEFEIA  129

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITLYFH+DVC+K L LY HLKLYPEDESGP STKKP+VVESY+EIV  +PSE FLARV N
Sbjct  130  ITLYFHSDVCEKQLDLYQHLKLYPEDESGPQSTKKPVVVESYNEIVFPEPSEVFLARVQN  189

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPAV+VPRLPA L L  + P + V+ ++RGDTKDH L+QWF NFSEADELLKL AARQQV
Sbjct  190  HPAVNVPRLPAGLNLSCSVPSDTVNDKERGDTKDHLLTQWFLNFSEADELLKLAAARQQV  249

Query  136  QGHIARLRRQLSMVGGQHQPLKPATEF  56
            Q HI +LRRQLS+V G  Q  KP + +
Sbjct  250  QAHIVKLRRQLSLVEGLPQLSKPPSGY  276



>ref|XP_007046720.1| YEATS family protein isoform 1 [Theobroma cacao]
 gb|EOX90877.1| YEATS family protein isoform 1 [Theobroma cacao]
Length=273

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 197/232 (85%), Gaps = 0/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK IEI VPIV G +AF+LG+KASE QSHKWT+Y+RGATNEDLGVV+K  VFQLH SF
Sbjct  39   RRLKDIEICVPIVCGTIAFYLGRKASESQSHKWTVYVRGATNEDLGVVVKHVVFQLHPSF  98

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTR+V++PPFELSECGWGEFEI I+L+FH+DVCDK L LYHHLKLYPEDESGP STKK
Sbjct  99   NNPTRLVESPPFELSECGWGEFEIGISLFFHSDVCDKQLDLYHHLKLYPEDESGPQSTKK  158

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   PSE F +RV NHPAV VPRLPA  +LP   P E+++ R RGDTKDH
Sbjct  159  PVVVESYNEIVFPDPSECFFSRVQNHPAVLVPRLPAGFSLPAPVPFENMNERGRGDTKDH  218

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            PLSQWF NFSEADELLKL AARQQVQ HI +LRRQLS++ G  QPLKPA+ +
Sbjct  219  PLSQWFMNFSEADELLKLAAARQQVQAHIVKLRRQLSVIDGMPQPLKPASSY  270



>ref|XP_010029693.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Eucalyptus grandis]
Length=269

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/269 (68%), Positives = 209/269 (78%), Gaps = 2/269 (1%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            SA+K G  +P+  G AT   R K+ K S+D E K  +++LK  EIS+PIVYG +AF+LG+
Sbjct  2    SARKQGDGQPEDGG-ATAGKRLKIAKFSEDPEKKGLSRRLKDAEISLPIVYGTIAFYLGR  60

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASE QSHKWT+Y+RGATNEDL  VIKR VFQLH SFNNPTRV++APPFELSECGWGEFE
Sbjct  61   KASESQSHKWTVYVRGATNEDLSAVIKRVVFQLHPSFNNPTRVMEAPPFELSECGWGEFE  120

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAI+L+FH DVCDK L LYHHLKLYPEDESGP STKKP+VVESYDEIV   PSEAF ARV
Sbjct  121  IAISLFFHPDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYDEIVFPDPSEAFYARV  180

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             N+PAV VPR         A   E+   R+RGDTKDHPLSQWF NFSEADELLKL AARQ
Sbjct  181  QNNPAVIVPR-MPAGFNISAPAPENTSERERGDTKDHPLSQWFMNFSEADELLKLAAARQ  239

Query  142  QVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            QVQ HI +LRRQLS++ G  Q  KPA  +
Sbjct  240  QVQAHIVKLRRQLSVMDGMPQLSKPAPAY  268



>ref|XP_004507005.1| PREDICTED: protein AF-9 homolog isoform X2 [Cicer arietinum]
Length=249

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 181/246 (74%), Positives = 215/246 (87%), Gaps = 1/246 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG D+ +++GP + S RTKM   S+D++ K+S +KLK +EISVPIVYGN+AFWL
Sbjct  4    SSSSKKHGQDQSELSGPTSKSQRTKM-GKSEDNDKKNSGKKLKDVEISVPIVYGNMAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGA+NEDLGV+IKR VFQLHSSFNNPTRVVDAPPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGASNEDLGVIIKRVVFQLHSSFNNPTRVVDAPPFELSEAGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITL+FH+DVCDKPL+LYHHLKLYPEDE+  +STKKP+VVE YDE+V   PSEAFLA
Sbjct  123  FEIAITLHFHSDVCDKPLNLYHHLKLYPEDENSSMSTKKPVVVEFYDEVVFPDPSEAFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV+ PRLPA   LPP  P+ED +RR++GDTKD+PLSQWF +FSEADELL+L AA
Sbjct  183  RVQNHPAVNFPRLPAGHTLPPPIPVEDANRRRKGDTKDNPLSQWFLSFSEADELLQLAAA  242

Query  148  RQQVQG  131
            RQQ  G
Sbjct  243  RQQKDG  248



>ref|XP_003537632.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Glycine max]
Length=279

 Score =   327 bits (837),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 182/267 (68%), Positives = 215/267 (81%), Gaps = 0/267 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            K+ G    D    A    R K+   S+DS+ K++ ++LK +EI VPIVYG +AF+LG+KA
Sbjct  10   KRQGEQSSDDGASAIKPSRLKIAIPSEDSDKKNANRRLKDVEICVPIVYGTIAFYLGRKA  69

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SE QSHKWT+Y+RGA+NEDLGVV+KR VFQLH SFNNPTRVV++PPFELSECGWGEFEIA
Sbjct  70   SESQSHKWTVYVRGASNEDLGVVVKRVVFQLHPSFNNPTRVVESPPFELSECGWGEFEIA  129

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITLYFH+DVC+K L LYHHLKLYPEDESGP STKKP+VVESY+EIV  +PSE FLARV N
Sbjct  130  ITLYFHSDVCEKQLDLYHHLKLYPEDESGPQSTKKPVVVESYNEIVFPEPSEVFLARVQN  189

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPAV+VPRLPA L LP   P + V+ ++RGDTKDH L+QWF NFSEADELLKL AARQQV
Sbjct  190  HPAVNVPRLPAGLNLPSPVPSDTVNDKERGDTKDHLLTQWFLNFSEADELLKLAAARQQV  249

Query  136  QGHIARLRRQLSMVGGQHQPLKPATEF  56
            Q HI +LRRQLS+V G  Q  KP + +
Sbjct  250  QAHIVKLRRQLSLVEGLPQLSKPPSGY  276



>ref|XP_010649052.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Vitis vinifera]
Length=246

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPI YG ++FWLG+KASE QSHKWT+Y+RGATNEDLGVVI+RAVFQLH SF
Sbjct  15   RRLKDVEICVPISYGTISFWLGRKASESQSHKWTVYVRGATNEDLGVVIRRAVFQLHPSF  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVVD+PPFELSE GWGEFEIAITLYFH+DVCDK L L+HHLKLYPEDESGP STKK
Sbjct  75   NNPMRVVDSPPFELSESGWGEFEIAITLYFHSDVCDKQLDLFHHLKLYPEDESGPQSTKK  134

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   P ++F ARV +HPAV VPRLPA   LP   P+E+   +KRGDTKDH
Sbjct  135  PVVVESYNEIVFPDPLDSFFARVKDHPAVIVPRLPASFNLPAPVPIENAKEKKRGDTKDH  194

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+QWF NFSEADELLKL  ARQQVQ HI +LRRQLS++ G  +PLKPA++
Sbjct  195  PLNQWFVNFSEADELLKLATARQQVQAHIVKLRRQLSVIDGLPRPLKPASD  245



>ref|XP_002269156.2| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Vitis vinifera]
 emb|CBI17388.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 196/231 (85%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPI YG ++FWLG+KASE QSHKWT+Y+RGATNEDLGVVI+RAVFQLH SF
Sbjct  42   RRLKDVEICVPISYGTISFWLGRKASESQSHKWTVYVRGATNEDLGVVIRRAVFQLHPSF  101

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVVD+PPFELSE GWGEFEIAITLYFH+DVCDK L L+HHLKLYPEDESGP STKK
Sbjct  102  NNPMRVVDSPPFELSESGWGEFEIAITLYFHSDVCDKQLDLFHHLKLYPEDESGPQSTKK  161

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   P ++F ARV +HPAV VPRLPA   LP   P+E+   +KRGDTKDH
Sbjct  162  PVVVESYNEIVFPDPLDSFFARVKDHPAVIVPRLPASFNLPAPVPIENAKEKKRGDTKDH  221

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+QWF NFSEADELLKL  ARQQVQ HI +LRRQLS++ G  +PLKPA++
Sbjct  222  PLNQWFVNFSEADELLKLATARQQVQAHIVKLRRQLSVIDGLPRPLKPASD  272



>gb|KDO46699.1| hypothetical protein CISIN_1g024038mg [Citrus sinensis]
Length=262

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 181/244 (74%), Positives = 210/244 (86%), Gaps = 1/244 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG  +P+ +GP     R KM    +++E K+  +KLK +EIS+PIVYGNVAFWL
Sbjct  4    SSSSKKHGPGQPEESGPTLKLQRIKM-SKPEEAEKKNLNKKLKDVEISIPIVYGNVAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTR V++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH DVCDKPL+LYHHLKLYPEDESG +STKKP+VVESYDEIV  +PS++FLA
Sbjct  123  FEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKKPVVVESYDEIVFPEPSDSFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV++PRLP    LPP  P+ED  +RKRGDTKDHPL+QWF NFSEADELL+L AA
Sbjct  183  RVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDHPLAQWFMNFSEADELLQLAAA  242

Query  148  RQQV  137
            RQQV
Sbjct  243  RQQV  246



>gb|ACU19426.1| unknown [Glycine max]
Length=279

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 181/267 (68%), Positives = 214/267 (80%), Gaps = 0/267 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            K+ G    D    A    R K+   S+DS+ K++ ++LK +EI VPIVYG +AF+LG+KA
Sbjct  10   KRQGEQSSDDGASAIKPSRLKIAIPSEDSDKKNANRRLKDVEICVPIVYGTIAFYLGRKA  69

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SE QSHKWT+Y+RGA+NEDLGVV+KR VFQLH SFNNPTRVV++PPFELSECGWGEFEIA
Sbjct  70   SESQSHKWTVYVRGASNEDLGVVVKRVVFQLHPSFNNPTRVVESPPFELSECGWGEFEIA  129

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITLYFH+DVC+K L LYHHLKLYPEDESGP STKKP+VVESY+EIV  +PSE FLARV N
Sbjct  130  ITLYFHSDVCEKQLDLYHHLKLYPEDESGPQSTKKPVVVESYNEIVFPEPSEVFLARVQN  189

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPAV+VPRLPA L LP   P + V+ ++RGD KDH L+QWF NFSEADELLKL AARQQV
Sbjct  190  HPAVNVPRLPAGLNLPSPVPSDTVNDKERGDPKDHLLTQWFLNFSEADELLKLAAARQQV  249

Query  136  QGHIARLRRQLSMVGGQHQPLKPATEF  56
            Q HI +LRRQLS+V G  Q  KP + +
Sbjct  250  QAHIVKLRRQLSLVEGLPQLSKPPSGY  276



>ref|XP_002313001.1| YEATS family protein [Populus trichocarpa]
 gb|EEE86956.1| YEATS family protein [Populus trichocarpa]
Length=282

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 173/259 (67%), Positives = 200/259 (77%), Gaps = 32/259 (12%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGN+AFWLGKK++EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  19   KKLKDVEISIPIVYGNIAFWLGKKSNEYQSHKWTIYVRGATNEDLGVVIKRAVFQLHSSF  78

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVC-------------------------  467
            NNPTRV++APPFELSE GWGEFEIAITLYFH+DVC                         
Sbjct  79   NNPTRVIEAPPFELSEAGWGEFEIAITLYFHSDVCDKPLNLKILLSFIFFSSLCMIVIYM  138

Query  466  -------DkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPA  308
                   D     YHHLKLYPEDE GP+S KKP+VVESYDEIV  +PSE FLARV +HPA
Sbjct  139  LCSLDMVDSSAARYHHLKLYPEDEPGPVSMKKPVVVESYDEIVFPEPSEGFLARVQSHPA  198

Query  307  VSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGH  128
            V++PRLPA   LPP  P+ED  +RKRGDTKD+PL+QWF  FSEAD+LL+L AARQQVQ H
Sbjct  199  VNLPRLPAGFTLPPPMPVEDTSKRKRGDTKDNPLAQWFMKFSEADKLLQLAAARQQVQAH  258

Query  127  IARLRRQLSMVGGQHQPLK  71
            IA+LRRQ+S++ GQ Q LK
Sbjct  259  IAKLRRQISLINGQDQHLK  277



>ref|XP_008804007.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
TFIID subunit 14b-like [Phoenix dactylifera]
Length=284

 Score =   324 bits (830),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 180/267 (67%), Positives = 206/267 (77%), Gaps = 1/267 (0%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            S KKHG ++         S R+K      D  A    ++LK  EIS PIVYG ++FWLGK
Sbjct  5    SPKKHGGEQQPDANSGQKSQRSKA-ARVSDDAADKKTRRLKDAEISFPIVYGTISFWLGK  63

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASE+ SHKWT+Y+R ATNEDL V+IKRAVFQLH SFNNPTRVV++ PFELSE GWGEFE
Sbjct  64   KASEFNSHKWTVYVRSATNEDLSVIIKRAVFQLHPSFNNPTRVVESAPFELSESGWGEFE  123

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAITL+FHNDVCDK L LYH LKLYPED++GP STKKP+VVE+YDEIV S+P+EAF  RV
Sbjct  124  IAITLFFHNDVCDKQLDLYHQLKLYPEDDNGPQSTKKPVVVETYDEIVFSEPTEAFFLRV  183

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             NHPA  VPRLPA L LP   P+E V+ +KRGDTKDHPLSQWF NFSEADELLKL AARQ
Sbjct  184  QNHPAAFVPRLPAGLNLPLPGPIEHVNEKKRGDTKDHPLSQWFMNFSEADELLKLAAARQ  243

Query  142  QVQGHIARLRRQLSMVGGQHQPLKPAT  62
            QVQ HI +LRRQLSM+ G  Q  K A+
Sbjct  244  QVQAHIVKLRRQLSMIDGLPQQSKTAS  270



>ref|XP_011047060.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Populus euphratica]
Length=251

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 197/230 (86%), Gaps = 5/230 (2%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGN+AFWLGK ++EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  19   KKLKDVEISIPIVYGNIAFWLGKMSNEYQSHKWTIYVRGATNEDLGVVIKRAVFQLHSSF  78

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRV++APPFELSE GWGEFEIAI LYFH+DVCDKPL+LYHHLKLYPEDE GP+S KK
Sbjct  79   NNPTRVIEAPPFELSEAGWGEFEIAIALYFHSDVCDKPLNLYHHLKLYPEDEPGPVSIKK  138

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRl---padlalppaapLEDVDRRKRGDT  221
            P+VVESYDEIV  +PSE FLARV +HPAV++PRL          P  P+ED  +RKRGDT
Sbjct  139  PVVVESYDEIVFPEPSEGFLARVQSHPAVNLPRLPAGFTLPPPMPVVPVEDTSKRKRGDT  198

Query  220  KDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            KD PL+QWF  FSEAD+LL+L AARQ  Q HIA+LRRQ+S++ GQ+Q LK
Sbjct  199  KDSPLAQWFMKFSEADKLLQLAAARQ--QAHIAKLRRQISLINGQNQHLK  246



>ref|XP_010940985.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Elaeis guineensis]
Length=284

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/269 (67%), Positives = 208/269 (77%), Gaps = 3/269 (1%)
 Frame = -1

Query  862  SAKKH-GADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLG  686
            S KKH G  +PD  G A    +        D  A    ++LK +EIS PIVYG ++FWLG
Sbjct  5    SPKKHAGEQQPD--GNAGQKSQRSKAARVSDDAADKKTRRLKDVEISFPIVYGTISFWLG  62

Query  685  KKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEF  506
            KKASE+ SHKWT+Y+R ATNEDL V+IKRAVFQLH SFNNPTRVV++ PFELSE GWGEF
Sbjct  63   KKASEFNSHKWTVYVRSATNEDLSVIIKRAVFQLHPSFNNPTRVVESAPFELSESGWGEF  122

Query  505  EIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLAR  326
            EIAITL+FHNDVCDK L LYH LKLYPED++GP STKKP+VVE+YDEIV S+P+EAF  R
Sbjct  123  EIAITLFFHNDVCDKQLDLYHQLKLYPEDDNGPQSTKKPVVVETYDEIVFSEPTEAFFLR  182

Query  325  VHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAAR  146
            V NHPA  VPRLPA L L P  P+E V+ +KRGDTKDHPLSQWF NFSEADELLKL AAR
Sbjct  183  VQNHPAAIVPRLPAGLNLLPPGPIEHVNEKKRGDTKDHPLSQWFMNFSEADELLKLAAAR  242

Query  145  QQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            QQVQ HI +LRRQLSM+ G  Q  K A++
Sbjct  243  QQVQAHIVKLRRQLSMIDGLPQQSKAASD  271



>ref|XP_010940986.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Elaeis guineensis]
Length=272

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/268 (68%), Positives = 207/268 (77%), Gaps = 3/268 (1%)
 Frame = -1

Query  862  SAKKH-GADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLG  686
            S KKH G  +PD  G A    +        D  A    ++LK +EIS PIVYG ++FWLG
Sbjct  5    SPKKHAGEQQPD--GNAGQKSQRSKAARVSDDAADKKTRRLKDVEISFPIVYGTISFWLG  62

Query  685  KKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEF  506
            KKASE+ SHKWT+Y+R ATNEDL V+IKRAVFQLH SFNNPTRVV++ PFELSE GWGEF
Sbjct  63   KKASEFNSHKWTVYVRSATNEDLSVIIKRAVFQLHPSFNNPTRVVESAPFELSESGWGEF  122

Query  505  EIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLAR  326
            EIAITL+FHNDVCDK L LYH LKLYPED++GP STKKP+VVE+YDEIV S+P+EAF  R
Sbjct  123  EIAITLFFHNDVCDKQLDLYHQLKLYPEDDNGPQSTKKPVVVETYDEIVFSEPTEAFFLR  182

Query  325  VHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAAR  146
            V NHPA  VPRLPA L L P  P+E V+ +KRGDTKDHPLSQWF NFSEADELLKL AAR
Sbjct  183  VQNHPAAIVPRLPAGLNLLPPGPIEHVNEKKRGDTKDHPLSQWFMNFSEADELLKLAAAR  242

Query  145  QQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            QQVQ HI +LRRQLSM+ G  Q  K A+
Sbjct  243  QQVQAHIVKLRRQLSMIDGLPQQSKAAS  270



>ref|XP_009401622.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Musa acuminata subsp. malaccensis]
Length=252

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 194/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EIS PIVYG +AFWLGKKA+EY SHKWT+Y+RGATNEDL V++KRAVFQLHSSF
Sbjct  21   RRLKDVEISFPIVYGTIAFWLGKKATEYNSHKWTVYVRGATNEDLSVIVKRAVFQLHSSF  80

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++ PFELSE GWGEFEIAITL+FH+DVCDK L LYH LKL+PE++SGP S KK
Sbjct  81   NNPTRVVESAPFELSESGWGEFEIAITLFFHSDVCDKQLDLYHQLKLFPEEDSGPQSIKK  140

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V E+YDEIV S+PSEAF ARV NHPA  VPRLP+ L LP   P++ V+ +KR DTKDH
Sbjct  141  PVVAETYDEIVFSEPSEAFFARVQNHPAAIVPRLPSGLNLPAPGPIDHVNEKKRSDTKDH  200

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            P SQWF NFSEADELLKL AARQQVQ HIA+LRRQLSM+ G  Q  K A+
Sbjct  201  PFSQWFMNFSEADELLKLAAARQQVQAHIAKLRRQLSMIDGLPQQSKAAS  250



>gb|KDO46698.1| hypothetical protein CISIN_1g024038mg [Citrus sinensis]
Length=267

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -1

Query  868  ANSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWL  689
            ++S+KKHG  +P+ +GP     R KM    +++E K+  +KLK +EIS+PIVYGNVAFWL
Sbjct  4    SSSSKKHGPGQPEESGPTLKLQRIKM-SKPEEAEKKNLNKKLKDVEISIPIVYGNVAFWL  62

Query  688  GKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGE  509
            GKKASEYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSFNNPTR V++PPFELSE GWGE
Sbjct  63   GKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGE  122

Query  508  FEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLA  329
            FEIAITLYFH DVCDKPL+LYHHLKLYPEDESG +STKKP+VVESYDEIV  +PS++FLA
Sbjct  123  FEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKKPVVVESYDEIVFPEPSDSFLA  182

Query  328  RVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAA  149
            RV NHPAV++PRLP    LPP  P+ED  +RKRGDTKDHPL+QWF NFSEADELL+L AA
Sbjct  183  RVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDHPLAQWFMNFSEADELLQLAAA  242

Query  148  RQQ  140
            RQQ
Sbjct  243  RQQ  245



>ref|XP_008440809.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Cucumis melo]
Length=277

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/249 (71%), Positives = 209/249 (84%), Gaps = 0/249 (0%)
 Frame = -1

Query  802  RTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNE  623
            R K+ KSS+ S+AK++++KLK +EI VPIV G +AF+LG+KASE QSHKWT+Y+RGATNE
Sbjct  25   RIKISKSSEGSDAKNASRKLKDMEICVPIVCGTIAFYLGRKASESQSHKWTVYVRGATNE  84

Query  622  DLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyh  443
            DLGVVIKR VFQLH SFNNPTRVV++PPFELSECGWGEFEIAITL+FH+DVCDK L L+H
Sbjct  85   DLGVVIKRVVFQLHPSFNNPTRVVESPPFELSECGWGEFEIAITLFFHSDVCDKQLDLFH  144

Query  442  hlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppa  263
            HLKLYPEDESGP +TKKP+VVESY+EIV   PSE F +RV NHPAV VPRLPA   LP  
Sbjct  145  HLKLYPEDESGPQTTKKPVVVESYNEIVFPDPSEIFFSRVQNHPAVVVPRLPAGFNLPNP  204

Query  262  apLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQH  83
            A +E++  R++GDTKDHPLSQWF NFSEADELLKL AARQQVQ HI +LRRQLS++ G  
Sbjct  205  ASIENMAEREKGDTKDHPLSQWFLNFSEADELLKLAAARQQVQAHIVKLRRQLSVMDGLP  264

Query  82   QPLKPATEF  56
            Q  KP   +
Sbjct  265  QFSKPTAGY  273



>emb|CDP21325.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 182/264 (69%), Positives = 213/264 (81%), Gaps = 2/264 (1%)
 Frame = -1

Query  850  HGADRPDITGPATMSL-RTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKAS  674
             G  +PD T  +T  + R K+ + S+DSE K + +++K +E+SVPIVYG +AFWLG+KAS
Sbjct  6    QGECQPDGTNESTPKIQRIKITRPSEDSEKKIAVKRVKDVEVSVPIVYGTIAFWLGRKAS  65

Query  673  EYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAI  494
            E  SHKWT+Y+RGATNEDLGVVIKRAVFQLH SFNNP RVV++PPFE+SECGWGEFEIAI
Sbjct  66   ETLSHKWTVYVRGATNEDLGVVIKRAVFQLHPSFNNPVRVVESPPFEISECGWGEFEIAI  125

Query  493  TLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNH  314
            +L+FHNDVCDK L LYHHLKLY E++SGP STKKP+VVE+Y+EIV  +P   FLARV NH
Sbjct  126  SLFFHNDVCDKQLDLYHHLKLYSEEDSGPQSTKKPVVVETYNEIVFPEPPADFLARVQNH  185

Query  313  PAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQ  134
            PAV VPRLPA L+LPPA   E V    RGDTKDH LS WF NFSEADELLKL AARQQVQ
Sbjct  186  PAVVVPRLPATLSLPPAPVQE-VHESGRGDTKDHTLSPWFVNFSEADELLKLAAARQQVQ  244

Query  133  GHIARLRRQLSMVGGQHQPLKPAT  62
             HI +LRRQLSM+ G  Q LKPA+
Sbjct  245  AHIMKLRRQLSMMDGMPQSLKPAS  268



>ref|XP_011099821.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Sesamum indicum]
Length=274

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 194/233 (83%), Gaps = 4/233 (2%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVPIVYG +AFWLG+KA+E QSHKWT+Y+RGATNEDLGVVIKRAVFQLH SF
Sbjct  41   KRLKDVEISVPIVYGTIAFWLGRKATETQSHKWTVYVRGATNEDLGVVIKRAVFQLHPSF  100

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV++PPFELSECGWGEFEIAI+L+FHNDVC+K L LYHHLKLY EDESGP STKK
Sbjct  101  NNPVRVVESPPFELSECGWGEFEIAISLFFHNDVCEKQLDLYHHLKLYSEDESGPQSTKK  160

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPR--lpadlalppaapLEDVDRRKRGDTK  218
            P+VVE+Y+EIV   PSE F ARV  HPAV VPR  +  +L    A  +ED++  KRGDTK
Sbjct  161  PVVVETYNEIVFPDPSEDFYARVQKHPAVIVPRLPVTINLPSVLATNVEDLN-EKRGDTK  219

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGG-QHQPLKPAT  62
            DHPLSQWF NFSEADELLKL AARQQVQ HI +LRRQLS++ G   Q  KPA+
Sbjct  220  DHPLSQWFNNFSEADELLKLAAARQQVQAHIIKLRRQLSVIDGLPLQSWKPAS  272



>ref|XP_008791265.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Phoenix dactylifera]
Length=273

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 206/259 (80%), Gaps = 3/259 (1%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            KKHG ++     P   S R K   ++  S+     ++LK +EIS PIVYG ++FWLGKKA
Sbjct  10   KKHGGEQHPDANPIQKSQRFK---AARVSDDDKKTRRLKDVEISFPIVYGAISFWLGKKA  66

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SEY SHKWT+Y+R ATNEDL V++K AVFQLH SFNNPTRVV++ PFELSE GWGEFEIA
Sbjct  67   SEYNSHKWTVYVRSATNEDLSVIVKSAVFQLHPSFNNPTRVVESAPFELSESGWGEFEIA  126

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITL+FH+DVCDK L+LYH LKLYPED++GP STK+P+VVE+YDEIVLS+P+EAF  RV N
Sbjct  127  ITLFFHSDVCDKQLNLYHQLKLYPEDDNGPQSTKRPVVVETYDEIVLSEPTEAFFLRVQN  186

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPA  VPRLPA L L P  P+E V+ +KRGDTKDHPLS WF NFSEADELLKL AARQQV
Sbjct  187  HPAAIVPRLPAGLNLSPPGPVEHVNEKKRGDTKDHPLSPWFMNFSEADELLKLAAARQQV  246

Query  136  QGHIARLRRQLSMVGGQHQ  80
            Q HIA+LRRQLSM+ G  Q
Sbjct  247  QAHIAKLRRQLSMIDGLPQ  265



>ref|XP_009384397.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Musa acuminata subsp. malaccensis]
Length=234

 Score =   317 bits (812),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 194/230 (84%), Gaps = 0/230 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EIS PIVYG +AFWLGKKASEY SHKWT+Y+RGATNEDLGV++KRAVFQLH SF
Sbjct  3    RRLKDVEISFPIVYGTIAFWLGKKASEYNSHKWTVYVRGATNEDLGVIVKRAVFQLHPSF  62

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++ PFELSE GWGEFEIAI L+FH+DVCDK L LYH LKL+PEDE+GP S KK
Sbjct  63   NNPTRVVESAPFELSESGWGEFEIAIRLFFHSDVCDKQLDLYHQLKLFPEDENGPQSIKK  122

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE YDEIV S+P+EA  ARV NHPA  VPRLP+ L LPP  P+ +++ +KRGDTKDH
Sbjct  123  PVVVEIYDEIVFSEPTEALFARVQNHPAAIVPRLPSGLNLPPPGPVNNINEKKRGDTKDH  182

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            PL+QWF NFSEADELLKL AARQ VQGH+ +LRRQLSM+ G  Q  K A+
Sbjct  183  PLNQWFMNFSEADELLKLAAARQYVQGHVGKLRRQLSMIDGLPQLSKAAS  232



>ref|XP_007157921.1| hypothetical protein PHAVU_002G109100g [Phaseolus vulgaris]
 gb|ESW29915.1| hypothetical protein PHAVU_002G109100g [Phaseolus vulgaris]
Length=278

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/267 (67%), Positives = 214/267 (80%), Gaps = 0/267 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            K+ G    D    A    R K+   S+DS+ K++ ++LK +EI VP+VYG +AF+LG+KA
Sbjct  10   KRQGEHLSDDGASAIKPSRLKIAIPSEDSDKKNANKRLKDVEICVPVVYGTIAFYLGRKA  69

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SE QSHKWT+Y+RGA+NEDLGVVIKR VFQLH SFNNPTRVV++PPFELSE GWGEFEIA
Sbjct  70   SESQSHKWTVYVRGASNEDLGVVIKRVVFQLHPSFNNPTRVVESPPFELSESGWGEFEIA  129

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            ITLYFH+D C+K L LYHHLKLYPEDESGP STKKP+VVESY+EIV  +PS+ FLAR+ N
Sbjct  130  ITLYFHSDACEKQLDLYHHLKLYPEDESGPQSTKKPVVVESYNEIVFPEPSDGFLARLQN  189

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPAV+VPRLPA L LP   P++ ++ ++RGDTKDH LSQWF NFSEADELLKL AARQQV
Sbjct  190  HPAVNVPRLPAGLNLPSPVPIDTMNDKERGDTKDHSLSQWFLNFSEADELLKLAAARQQV  249

Query  136  QGHIARLRRQLSMVGGQHQPLKPATEF  56
            Q HI +LRRQLS+V G  Q  KP + +
Sbjct  250  QAHIVKLRRQLSLVEGLPQLSKPPSGY  276



>ref|XP_002513016.1| YEATS domain-containing protein, putative [Ricinus communis]
 gb|EEF49519.1| YEATS domain-containing protein, putative [Ricinus communis]
Length=227

 Score =   314 bits (805),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EISVPIVYGN++FWLGKKA+EYQSHKWT+Y+RGATNEDLGVVIKRAVFQLHSSF
Sbjct  14   KKLKDVEISVPIVYGNISFWLGKKANEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSF  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRV+++PPFELSE GWGEFEIAITLYFH+DVCDKPL+LYHHLKLYPEDESGP+S KK
Sbjct  74   NNPTRVIESPPFELSEAGWGEFEIAITLYFHHDVCDKPLNLYHHLKLYPEDESGPMSIKK  133

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDEIV  +PSE F ARV +HPAV++PRLPA  +LPP  P+ED  +RKRGDTKDH
Sbjct  134  PVVVESYDEIVFPEPSEGFFARVQSHPAVTLPRLPAGFSLPPPVPVEDASKRKRGDTKDH  193

Query  211  PLSQWFTNFSEADELLKLTAARQQ  140
            PLSQWF NFSEADELL+L AARQQ
Sbjct  194  PLSQWFMNFSEADELLQLAAARQQ  217



>ref|XP_006656613.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Oryza brachyantha]
Length=259

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 190/225 (84%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS PIVYG ++FWLGKKASEY SHKWT+Y+R ATNEDL V++KR VFQLH SF
Sbjct  20   KKLKDVEISFPIVYGTISFWLGKKASEYNSHKWTVYVRSATNEDLSVIVKRVVFQLHPSF  79

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRVV+ PPFELSE GWGEFEIAITLYFH+DVC+K L L+H LKLYPE+++GP STKK
Sbjct  80   TNPTRVVEQPPFELSESGWGEFEIAITLYFHSDVCEKRLDLFHQLKLYPEEDTGPQSTKK  139

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD-RRKRGDTKD  215
            P+VVE+YDEIV  +P+EAF  RV NHPA +VPRLP  + LPP  P+E V   +KRGDTKD
Sbjct  140  PVVVETYDEIVFPEPTEAFFQRVQNHPAATVPRLPPGITLPPPGPMELVPHEKKRGDTKD  199

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            HPLSQWF+NFSEADELLKL AARQQVQ HIA+LRRQLSM+ G  Q
Sbjct  200  HPLSQWFSNFSEADELLKLAAARQQVQAHIAKLRRQLSMIDGMPQ  244



>ref|XP_006851796.1| hypothetical protein AMTR_s00040p00236410 [Amborella trichopoda]
 gb|ERN13263.1| hypothetical protein AMTR_s00040p00236410 [Amborella trichopoda]
Length=273

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 176/268 (66%), Positives = 210/268 (78%), Gaps = 3/268 (1%)
 Frame = -1

Query  859  AKKHGADRPDITGPATMSLRTKM-IkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            AKKHG D+ D  G A    R+K+   S D    K  A++LK +EIS+PIVYG ++FWLGK
Sbjct  7    AKKHGGDQLD--GNAQKMQRSKIGRSSDDGDNKKSLAKRLKDVEISIPIVYGTISFWLGK  64

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KA+EY SHKWT+YIRGATNEDL V IKR VFQLH SFNNP R V++PPFELSE GWGEFE
Sbjct  65   KANEYNSHKWTVYIRGATNEDLSVAIKRVVFQLHPSFNNPIRSVESPPFELSESGWGEFE  124

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAI+++F +DV DKPL L+HHLKLYPEDESGP STKKP+VVESYDEIV S+PSEAF AR 
Sbjct  125  IAISVHFQSDVSDKPLDLFHHLKLYPEDESGPQSTKKPVVVESYDEIVFSEPSEAFFARA  184

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             NHPA ++ RLP  L+  PA  LE+ + RKRGDTKDHPLSQWF NFSEADELLKL  ARQ
Sbjct  185  QNHPAATLSRLPVGLSSMPAGSLENTNDRKRGDTKDHPLSQWFNNFSEADELLKLATARQ  244

Query  142  QVQGHIARLRRQLSMVGGQHQPLKPATE  59
            Q+Q  I +L+RQL+M+  Q Q  +P+++
Sbjct  245  QIQAAIVKLKRQLNMLESQAQQTRPSSD  272



>ref|NP_001056732.1| Os06g0137300 [Oryza sativa Japonica Group]
 dbj|BAD68649.1| putative TAF14b [Oryza sativa Japonica Group]
 dbj|BAD68469.1| putative TAF14b [Oryza sativa Japonica Group]
 dbj|BAF18646.1| Os06g0137300 [Oryza sativa Japonica Group]
 gb|EEC79950.1| hypothetical protein OsI_21545 [Oryza sativa Indica Group]
Length=316

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 190/225 (84%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS PIVYG ++FWLGKKASEY SHKWT+Y+R ATNEDL V++KR VFQLH SF
Sbjct  77   KKLKDVEISFPIVYGTISFWLGKKASEYNSHKWTVYVRSATNEDLSVIVKRVVFQLHPSF  136

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRVV+ PPFELSE GWGEFEIAITLYFH+DVC+K L L+H LKLYPE+++GP STKK
Sbjct  137  TNPTRVVEQPPFELSESGWGEFEIAITLYFHSDVCEKRLDLFHQLKLYPEEDTGPQSTKK  196

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD-RRKRGDTKD  215
            P+VVE+YDEIV  +P+EAF  RV NHPA +VPRLP  + LPP  P+E V   +KRGDTKD
Sbjct  197  PVVVETYDEIVFPEPTEAFFQRVQNHPAATVPRLPPGITLPPPGPMELVPHEKKRGDTKD  256

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            HPLSQWF+NFSEADELLKL AARQQVQ HIA+LRRQLSM+ G  Q
Sbjct  257  HPLSQWFSNFSEADELLKLAAARQQVQAHIAKLRRQLSMIDGMPQ  301



>ref|XP_004287823.1| PREDICTED: protein AF-9 homolog [Fragaria vesca subsp. vesca]
Length=276

 Score =   313 bits (803),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 175/272 (64%), Positives = 211/272 (78%), Gaps = 3/272 (1%)
 Frame = -1

Query  862  SAKKHGADRPDITG---PATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFW  692
            SA+K G   P   G    A  S   +  KS+DDS+ K + +KLK ++I VPIVYG +AF+
Sbjct  2    SARKVGEAEPQPEGDGGSAQASQSVRASKSTDDSDKKSTDRKLKDVDICVPIVYGTIAFY  61

Query  691  LGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWG  512
            LG+KASE QSHKWT+Y+RGATNEDLG V+KR VFQLH SFNNP RV+++PPFEL+ECGWG
Sbjct  62   LGRKASESQSHKWTVYVRGATNEDLGAVVKRVVFQLHPSFNNPMRVIESPPFELTECGWG  121

Query  511  EFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFL  332
            EFEIAI+L+FHND+C+K L LYHHLKLY EDESGP STKKP+V+ESY+EIV   PSEAF 
Sbjct  122  EFEIAISLFFHNDICEKQLDLYHHLKLYTEDESGPQSTKKPVVMESYNEIVFPDPSEAFF  181

Query  331  ARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTA  152
            ARV NHPAV VPRLPA + LP     ++++  KRGDTKDHPLSQWF NFSEADELLKL A
Sbjct  182  ARVQNHPAVIVPRLPAGINLPKPVVNDNMNENKRGDTKDHPLSQWFLNFSEADELLKLAA  241

Query  151  ARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            ARQ+VQ HI  +RR+LS++ G  Q  K  + F
Sbjct  242  ARQEVQAHIVNVRRKLSLMEGVPQLSKQPSGF  273



>ref|NP_001141800.1| uncharacterized protein LOC100273936 [Zea mays]
 gb|ACF87068.1| unknown [Zea mays]
 gb|ACG34854.1| hypothetical protein [Zea mays]
Length=245

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 190/225 (84%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +E+S PIVYG ++FWLGKKASEY SHKWT+Y+R A NEDL V++KRAVFQLH SF
Sbjct  6    KRLKDVEVSFPIVYGTISFWLGKKASEYNSHKWTVYVRSANNEDLSVIVKRAVFQLHPSF  65

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRVV+ PPFELSE GWGEFEIAITLYFH+DVCDK L L+H LKLYPE+E+GP STKK
Sbjct  66   QNPTRVVEQPPFELSESGWGEFEIAITLYFHSDVCDKRLDLFHQLKLYPEEEAGPQSTKK  125

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD-RRKRGDTKD  215
            P+VVE+YDEIV  +P+EAF  RV NHPA +VPRLP  + LPP  P+E V   +KRGDTKD
Sbjct  126  PVVVETYDEIVFPEPTEAFFLRVQNHPAANVPRLPPGITLPPPGPMEIVPYEKKRGDTKD  185

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            HPLSQWF+NFSEADELLKL AARQQVQ HIA+LRRQL+M+ G  Q
Sbjct  186  HPLSQWFSNFSEADELLKLAAARQQVQVHIAKLRRQLTMIEGMPQ  230



>ref|XP_010113366.1| Protein AF-9-like protein [Morus notabilis]
 gb|EXC35373.1| Protein AF-9-like protein [Morus notabilis]
Length=271

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 213/269 (79%), Gaps = 0/269 (0%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            SA+K G  +PD      +    K+ KS++D++ K + ++LK  E+ VPIVYG +AF+LG+
Sbjct  2    SARKSGETQPDDASSVPVLQPVKIHKSAEDNDKKSANKRLKDAEVCVPIVYGTIAFYLGR  61

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASE QSHKWT+Y+RGATNEDLGVVIKR VFQLH SFNNPTRV+++ PFEL+ECGWGEFE
Sbjct  62   KASESQSHKWTVYVRGATNEDLGVVIKRVVFQLHPSFNNPTRVLESAPFELTECGWGEFE  121

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            I I+L+FH+++CDK + L+HHLKLYPEDESGP STKKP+VVESY+EIV   PSEA LARV
Sbjct  122  IGISLFFHSEICDKQVDLFHHLKLYPEDESGPQSTKKPVVVESYNEIVFPDPSEALLARV  181

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             NHP++ +PRLPA   LP     E+ + ++RGDTKDHPL+QWF NFSEADELLKL AARQ
Sbjct  182  QNHPSLVLPRLPAGFTLPSPVTTENPNEKERGDTKDHPLTQWFMNFSEADELLKLAAARQ  241

Query  142  QVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            QVQ HI +L+RQLS++ G  Q  KP + +
Sbjct  242  QVQIHIVKLKRQLSVMDGLPQLSKPPSGY  270



>gb|AFK46477.1| unknown [Lotus japonicus]
Length=282

 Score =   313 bits (802),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 213/267 (80%), Gaps = 1/267 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            ++ GA+  D    A    R K+   S++S+ K+  ++LK +EISVPIVYG +AF+LG+KA
Sbjct  14   QQQGAEDDDAPS-AIKPSRLKIAVPSEESDKKNVNKRLKDVEISVPIVYGTIAFYLGRKA  72

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIA  497
            SE QSHKWT+Y+RGA+NEDLGVV+K+ VFQLH SFNNPTRVV++PPF++SECGWGEFEIA
Sbjct  73   SESQSHKWTVYVRGASNEDLGVVVKKVVFQLHPSFNNPTRVVESPPFQVSECGWGEFEIA  132

Query  496  ITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHN  317
            I+L+FH+DVC+K L LYHHLKLYPEDESGP +TKKP+VVE+Y+EIV  +PSE FLARV N
Sbjct  133  ISLFFHSDVCEKQLDLYHHLKLYPEDESGPQNTKKPVVVETYNEIVFPEPSEVFLARVLN  192

Query  316  HPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            HPAV VP+LP  L LP    ++ V+ ++RGDTKDHPLSQWF NFSE DEL K  AARQQV
Sbjct  193  HPAVVVPKLPVGLNLPSPVAVDSVNDKERGDTKDHPLSQWFLNFSETDELSKPAAARQQV  252

Query  136  QGHIARLRRQLSMVGGQHQPLKPATEF  56
            Q HI +LRRQLS++ G  Q  KP + F
Sbjct  253  QAHIGKLRRQLSLMEGPPQQAKPPSGF  279



>ref|XP_007204905.1| hypothetical protein PRUPE_ppa009845mg [Prunus persica]
 gb|EMJ06104.1| hypothetical protein PRUPE_ppa009845mg [Prunus persica]
Length=275

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 208/261 (80%), Gaps = 0/261 (0%)
 Frame = -1

Query  838  RPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQSH  659
            +P+  G A  S   ++ KS++DS+ K + ++LK +EI VPIVYG +AF+LG+KASE QSH
Sbjct  12   QPEEGGSAQTSQSIRISKSAEDSDKKGTNRRLKDVEICVPIVYGTIAFYLGRKASESQSH  71

Query  658  KWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFH  479
            KWT+Y+RGATNEDLGVV+KR +FQLH SFNNP RVVD+PPFEL+ECGWGEFEI+I+L+FH
Sbjct  72   KWTVYVRGATNEDLGVVVKRVIFQLHPSFNNPMRVVDSPPFELTECGWGEFEISISLFFH  131

Query  478  NDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            +DVC++ L L+H LKLY EDESGP STKKP+V+ESY+E+V   PSEAF+ARV NHPAV V
Sbjct  132  SDVCERQLDLFHPLKLYTEDESGPQSTKKPVVMESYNELVFPDPSEAFVARVQNHPAVVV  191

Query  298  PRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIAR  119
            PRLPA   LP    ++  + + RGDTKDHPLSQWF NFSE DELLKL AARQ+VQ HI  
Sbjct  192  PRLPAGFNLPNPESIDRANEKGRGDTKDHPLSQWFLNFSEPDELLKLAAARQEVQAHIVN  251

Query  118  LRRQLSMVGGQHQPLKPATEF  56
            +RR+LSM+ G  Q  KP + +
Sbjct  252  VRRKLSMLDGVPQLSKPPSGY  272



>ref|XP_002530747.1| YEATS domain-containing protein, putative [Ricinus communis]
 gb|EEF31653.1| YEATS domain-containing protein, putative [Ricinus communis]
Length=270

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 191/231 (83%), Gaps = 3/231 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++K +EISVP+VYG +AF+LG+KASE QSH+WT+Y+RGATNED+GVVIKR VFQLH SF+
Sbjct  41   RIKDVEISVPVVYGTIAFYLGRKASETQSHRWTVYVRGATNEDIGVVIKRVVFQLHPSFS  100

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKP  389
            NPTRVV++PPFELSECGWGEFEIAITLYFH+DVC++ L LYH LKLYPEDE+GP STKKP
Sbjct  101  NPTRVVESPPFELSECGWGEFEIAITLYFHSDVCNEQLDLYHQLKLYPEDETGPQSTKKP  160

Query  388  IVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHP  209
            +VVESY+EIV   PSE FLARV NHPAV VPRLPA   LP      ++   KRGDTKDHP
Sbjct  161  VVVESYNEIVFPDPSENFLARVQNHPAVIVPRLPAGFNLPTPM---EIVNEKRGDTKDHP  217

Query  208  LSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            L  WF NFSEADELLKL AARQQVQ HI +LRRQL+++ G  QP   A+ +
Sbjct  218  LYHWFLNFSEADELLKLAAARQQVQAHIVKLRRQLNVIDGLPQPPITASTY  268



>ref|XP_004134869.1| PREDICTED: protein AF-9 homolog [Cucumis sativus]
 ref|XP_004169949.1| PREDICTED: protein AF-9 homolog [Cucumis sativus]
 gb|KGN48904.1| hypothetical protein Csa_6G505820 [Cucumis sativus]
Length=277

 Score =   312 bits (800),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 207/249 (83%), Gaps = 0/249 (0%)
 Frame = -1

Query  802  RTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNE  623
            R K+ KSS+ S+AK++++KLK +EI VPIV G +AF+LG+KASE QSHKWT+Y+RGATNE
Sbjct  25   RIKISKSSEGSDAKNASRKLKDMEICVPIVCGTIAFYLGRKASESQSHKWTVYVRGATNE  84

Query  622  DLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyh  443
            DLGVVIKR VFQLH SFNNPTRV+++PPFELSE GWGEFEIAITL+FH+DVCDK L L+H
Sbjct  85   DLGVVIKRVVFQLHPSFNNPTRVIESPPFELSESGWGEFEIAITLFFHSDVCDKQLDLFH  144

Query  442  hlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppa  263
            HLKLYPEDESGP +TKKP+VVESY+EIV   PSE F +RV NHPAV VPRLPA   LP  
Sbjct  145  HLKLYPEDESGPQTTKKPVVVESYNEIVFPDPSEIFFSRVQNHPAVVVPRLPAGFNLPNP  204

Query  262  apLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQH  83
            A +E++  R++GDTKDH LSQWF NFSEADELLKL AARQQVQ HI +LRRQLS++ G  
Sbjct  205  ASIENMAEREKGDTKDHSLSQWFLNFSEADELLKLAAARQQVQAHIVKLRRQLSVMDGLP  264

Query  82   QPLKPATEF  56
            Q  KP   +
Sbjct  265  QFSKPTAGY  273



>ref|XP_008372792.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Malus domestica]
Length=277

 Score =   312 bits (799),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK ++I VPIVYG VAF+LG+KASE QSHKWT+Y+RGATNEDLGVV+KR +FQLH SF
Sbjct  43   KRLKDVDICVPIVYGTVAFYLGRKASESQSHKWTVYVRGATNEDLGVVVKRVIFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RV+D+PPFEL+ECGWGEFEIAI+L+FHNDVC++ L LYHHLKLY EDESGP STKK
Sbjct  103  NNPMRVIDSPPFELTECGWGEFEIAISLFFHNDVCERQLDLYHHLKLYTEDESGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   P EA  ARV NHPAV VPRLPA   LP    ++  + ++RGDTKDH
Sbjct  163  PVVVESYNEIVFPDPLEACFARVQNHPAVVVPRLPAGFNLPNPVSIDQKNDKERGDTKDH  222

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            PLSQWF NFSEADELLKL AARQ+VQ HI  +RR+LSM+ G  Q  KP + +
Sbjct  223  PLSQWFLNFSEADELLKLAAARQEVQAHIVSVRRKLSMLDGPPQLSKPPSGY  274



>ref|XP_008241810.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Prunus mume]
Length=275

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 208/261 (80%), Gaps = 0/261 (0%)
 Frame = -1

Query  838  RPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQSH  659
            +P+  G A  S   ++ KS++D++ K + ++LK +EI VPIVYG +AF+LG+KASE QSH
Sbjct  12   QPEEGGSAQTSQSIRISKSAEDTDKKGTNRRLKDVEICVPIVYGTIAFYLGRKASESQSH  71

Query  658  KWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFH  479
            KWT+Y+RGATNEDLGVV+KR +FQLH SFNNP RVVD+PPFEL+ECGWGEFEI+I+L+FH
Sbjct  72   KWTVYVRGATNEDLGVVVKRVIFQLHPSFNNPMRVVDSPPFELTECGWGEFEISISLFFH  131

Query  478  NDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            +DVC++ L L+H LKLY EDESGP STK+P+V+ESY+E+V   PSEAF+ARV NHPAV V
Sbjct  132  SDVCERQLDLFHPLKLYTEDESGPQSTKRPVVMESYNELVFPDPSEAFVARVQNHPAVVV  191

Query  298  PRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIAR  119
            PRLPA   LP    ++ V  + RGDTKDHPLSQWF NFSE DELLKL AARQ+VQ HI  
Sbjct  192  PRLPAGFNLPNPESIDRVYEKGRGDTKDHPLSQWFLNFSEPDELLKLAAARQEVQAHIVN  251

Query  118  LRRQLSMVGGQHQPLKPATEF  56
            +RR+LSM+ G  Q  KP + +
Sbjct  252  VRRKLSMLDGVPQLSKPPSGY  272



>ref|XP_008346320.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like, 
partial [Malus domestica]
Length=276

 Score =   311 bits (798),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK ++I VPIVYG VAF+LG+KASE QSHKWT+Y+RGATNEDLGVV+KR +FQLH SF
Sbjct  43   KRLKDVDICVPIVYGTVAFYLGRKASESQSHKWTVYVRGATNEDLGVVVKRVIFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RV+D+PPFEL+ECGWGEFEIAI+L+FHNDVC++ L LYHHLKLY EDESGP STKK
Sbjct  103  NNPMRVIDSPPFELTECGWGEFEIAISLFFHNDVCERQLDLYHHLKLYTEDESGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   P EA  ARV NHPAV VPRLPA   LP    ++  + ++RGDTKDH
Sbjct  163  PVVVESYNEIVFPDPLEACFARVQNHPAVVVPRLPAGFNLPNPVSIDQKNDKERGDTKDH  222

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            PLSQWF NFSEADELLKL AARQ+VQ HI  +RR+LSM+ G  Q  KP + +
Sbjct  223  PLSQWFLNFSEADELLKLAAARQEVQAHIVSVRRKLSMLDGPPQLSKPPSGY  274



>gb|KDP46722.1| hypothetical protein JCGZ_06510 [Jatropha curcas]
Length=282

 Score =   311 bits (798),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 189/224 (84%), Gaps = 0/224 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +EISVP+V+G +AF+LG+KASE QSHKWT+Y+RG TNEDLG VIKR VFQLH SF
Sbjct  49   RRIKDVEISVPVVHGTIAFYLGRKASESQSHKWTVYVRGVTNEDLGAVIKRVVFQLHPSF  108

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFELSECGWGEFEI IT+ FH+DVCDK L LYHHLKLYPEDE+GP STKK
Sbjct  109  NNPTRVVESPPFELSECGWGEFEIVITIVFHSDVCDKQLDLYHHLKLYPEDETGPQSTKK  168

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   PSE+F  RV NHPAV VPRLPA   LP   P+E++  R+RGDTKDH
Sbjct  169  PVVVESYNEIVFPDPSESFFTRVQNHPAVIVPRLPAGFNLPTPVPIENLKERERGDTKDH  228

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            PLS WF NFSEADELLKL AARQQVQ HI +LRRQL+++ G  Q
Sbjct  229  PLSHWFLNFSEADELLKLAAARQQVQAHIIKLRRQLNVIDGLPQ  272



>ref|XP_009378183.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Pyrus x bretschneideri]
Length=277

 Score =   311 bits (796),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 191/232 (82%), Gaps = 0/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK ++I VPIVYG VAF+LG+KASE QSHKWT+Y+RGATNEDLGVV+KR +FQLH SF
Sbjct  43   KRLKDVDICVPIVYGTVAFYLGRKASESQSHKWTVYVRGATNEDLGVVVKRVIFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RV+D+PPFEL+ECGWGEFEIAI+L+FHNDVC++ L LYHHLKLY EDESGP STKK
Sbjct  103  NNPMRVIDSPPFELTECGWGEFEIAISLFFHNDVCERQLDLYHHLKLYTEDESGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   P EA  AR+ NHPAV VPRLPA   LP    ++  + ++RGDTKDH
Sbjct  163  PVVVESYNEIVFPDPLEACFARLQNHPAVIVPRLPAGFNLPNPVSIDQKNDKERGDTKDH  222

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            PLSQWF NFSEADELLKL AARQ+VQ HI  +RR+LSM+ G  Q  KP + +
Sbjct  223  PLSQWFLNFSEADELLKLAAARQEVQAHIVNVRRKLSMLDGPPQLSKPPSGY  274



>ref|XP_004507006.1| PREDICTED: protein AF-9 homolog isoform X3 [Cicer arietinum]
Length=216

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -1

Query  703  VAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSE  524
            +AFWLGKKASEYQSHKWT+Y+RGA+NEDLGV+IKR VFQLHSSFNNPTRVVDAPPFELSE
Sbjct  1    MAFWLGKKASEYQSHKWTVYVRGASNEDLGVIIKRVVFQLHSSFNNPTRVVDAPPFELSE  60

Query  523  CGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPS  344
             GWGEFEIAITL+FH+DVCDKPL+LYHHLKLYPEDE+  +STKKP+VVE YDE+V   PS
Sbjct  61   AGWGEFEIAITLHFHSDVCDKPLNLYHHLKLYPEDENSSMSTKKPVVVEFYDEVVFPDPS  120

Query  343  EAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELL  164
            EAFLARV NHPAV+ PRLPA   LPP  P+ED +RR++GDTKD+PLSQWF +FSEADELL
Sbjct  121  EAFLARVQNHPAVNFPRLPAGHTLPPPIPVEDANRRRKGDTKDNPLSQWFLSFSEADELL  180

Query  163  KLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            +L AARQQVQ HIA+++RQ+S++ GQH+ LK +++
Sbjct  181  QLAAARQQVQAHIAKVKRQISLIEGQHKQLKSSSD  215



>ref|XP_003612162.1| AF-9-like protein [Medicago truncatula]
 gb|AES95120.1| YEATS family protein [Medicago truncatula]
Length=275

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 195/229 (85%), Gaps = 0/229 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +EI VPIVYG +AF+LG+KASE QSHKWT+Y+RGA+NEDL  V+KR VFQLH SF
Sbjct  46   KRVKDVEICVPIVYGTIAFFLGRKASESQSHKWTVYVRGASNEDLSAVVKRVVFQLHPSF  105

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFE+SECGWGEFEIAITL+FH+D C+K L LYHHLKLYPEDESGP +TK+
Sbjct  106  NNPTRVVESPPFEISECGWGEFEIAITLFFHSDACEKQLDLYHHLKLYPEDESGPQNTKR  165

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V+ESY+E+V  +PSEAFLARV NHPAV VPRLP  L LP   P+E ++ ++RGDTKDH
Sbjct  166  PVVIESYNEVVFPEPSEAFLARVQNHPAVVVPRLPDGLNLPSPVPVEPMNDKERGDTKDH  225

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
            PL+ WF NFSEADELLKL AARQQVQ HI +LRRQL+++ G  Q  +P+
Sbjct  226  PLNHWFLNFSEADELLKLAAARQQVQAHIVKLRRQLTLMEGLPQSKQPS  274



>ref|XP_004964476.1| PREDICTED: protein AF-9 homolog [Setaria italica]
Length=245

 Score =   308 bits (788),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 188/225 (84%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS PIVYG ++FWLGKKASEY SHKWT+Y+R A NEDL V++KR VFQLH SF
Sbjct  6    KKLKDVEISFPIVYGTISFWLGKKASEYNSHKWTVYVRSANNEDLSVIVKRVVFQLHPSF  65

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRVV+ PPFELSE GWGEFEIAITLYFH+DVC+K L L+H LKLYPE+E+GP STKK
Sbjct  66   QNPTRVVEQPPFELSESGWGEFEIAITLYFHSDVCEKRLDLFHQLKLYPEEEAGPQSTKK  125

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD-RRKRGDTKD  215
            P++VE+YDEIV  +P+EAF  RV NHPA +VPRLP  + LPP+  +E V   +KRGDTKD
Sbjct  126  PVIVETYDEIVFPEPTEAFFQRVQNHPAANVPRLPPGITLPPSGSMEIVPYEKKRGDTKD  185

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            H LSQWF+NFSEADELLKL AARQQVQ HIA+LRRQL+M+ G  Q
Sbjct  186  HALSQWFSNFSEADELLKLAAARQQVQAHIAKLRRQLTMMEGMPQ  230



>gb|EEE65052.1| hypothetical protein OsJ_20050 [Oryza sativa Japonica Group]
Length=400

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 190/225 (84%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS PIVYG ++FWLGKKASEY SHKWT+Y+R ATNEDL V++KR VFQLH SF
Sbjct  161  KKLKDVEISFPIVYGTISFWLGKKASEYNSHKWTVYVRSATNEDLSVIVKRVVFQLHPSF  220

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRVV+ PPFELSE GWGEFEIAITLYFH+DVC+K L L+H LKLYPE+++GP STKK
Sbjct  221  TNPTRVVEQPPFELSESGWGEFEIAITLYFHSDVCEKRLDLFHQLKLYPEEDTGPQSTKK  280

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD-RRKRGDTKD  215
            P+VVE+YDEIV  +P+EAF  RV NHPA +VPRLP  + LPP  P+E V   +KRGDTKD
Sbjct  281  PVVVETYDEIVFPEPTEAFFQRVQNHPAATVPRLPPGITLPPPGPMELVPHEKKRGDTKD  340

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            HPLSQWF+NFSEADELLKL AARQQVQ HIA+LRRQLSM+ G  Q
Sbjct  341  HPLSQWFSNFSEADELLKLAAARQQVQAHIAKLRRQLSMIDGMPQ  385



>ref|XP_004512129.1| PREDICTED: protein AF-9 homolog [Cicer arietinum]
Length=280

 Score =   308 bits (788),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AF+LG+KASE QSHKWT+Y+RGA+NEDL VV+K+ VFQLH SF
Sbjct  47   KRLKDVEICVPIVYGTIAFYLGRKASESQSHKWTVYVRGASNEDLSVVVKKVVFQLHPSF  106

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFE+SECGWGEFEIAITL+FH+D C+K L LYHHLKLYPEDESGP +TKK
Sbjct  107  NNPTRVVESPPFEISECGWGEFEIAITLFFHSDACEKQLDLYHHLKLYPEDESGPQTTKK  166

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+E+V  +PSE F+ARV NHPAV VPRLP  L LP   P + ++ ++RG TKDH
Sbjct  167  PVVVESYNEVVFPEPSEGFVARVQNHPAVVVPRLPVGLNLPSPVPFDPMNDKERGGTKDH  226

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
            PLSQWF NFSEADELLKL A+RQQVQ HI +LRRQL+++ G  Q  +P+
Sbjct  227  PLSQWFLNFSEADELLKLAASRQQVQAHIVKLRRQLNLLEGLPQSKQPS  275



>gb|EMT06696.1| Protein AF-9-like protein [Aegilops tauschii]
Length=329

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 186/225 (83%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS PIVYG ++FWLGKKASEY SHKWT+YIR ATNEDL V++KR VFQLH SF
Sbjct  21   KKLKDVEISFPIVYGTISFWLGKKASEYNSHKWTVYIRSATNEDLSVIVKRVVFQLHPSF  80

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRVV+ PPFELSE GWGEFEIAITLYFH+DVC+K L L+H LKLYPE+++GP STKK
Sbjct  81   TNPTRVVEQPPFELSESGWGEFEIAITLYFHSDVCEKRLDLFHQLKLYPEEDAGPQSTKK  140

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDR-RKRGDTKD  215
            P+VVE+YDE+V  +P+EAF  RV NHPA +VPRLP  + L    P+E +   +KR DTKD
Sbjct  141  PVVVETYDEVVFPEPTEAFFLRVQNHPAATVPRLPPGMTLSSPGPMELMSHDKKRFDTKD  200

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            H LSQWF+NFSEADELLKL AARQQVQ HIA+LRRQLSM+ G  Q
Sbjct  201  HSLSQWFSNFSEADELLKLAAARQQVQAHIAKLRRQLSMIEGMPQ  245



>ref|XP_003561209.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Brachypodium distachyon]
Length=311

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 188/225 (84%), Gaps = 1/225 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS PIVYG ++FWLGKKASEY SHKWT++IR ATNEDL V++KRAVFQLH SF
Sbjct  72   KKLKDVEISFPIVYGTISFWLGKKASEYNSHKWTVFIRSATNEDLSVIVKRAVFQLHPSF  131

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTRV++ PPFELSE GWGEFEIAITLYFH+DVC+K L L+H LKLYPE+++GP STKK
Sbjct  132  TNPTRVIEQPPFELSESGWGEFEIAITLYFHSDVCEKRLDLFHQLKLYPEEDAGPQSTKK  191

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDR-RKRGDTKD  215
            P+VVE+YDE+V  +P+E+F  RV NHPA +VPRLP  + LP   P+E +   +KR D KD
Sbjct  192  PVVVETYDEVVFPEPTESFFLRVQNHPAATVPRLPPGITLPSQGPMELMPHDKKRYDNKD  251

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQ  80
            HPLSQWF+NFSEADELLKL AARQQVQ HIA+LRRQLSM+ G  Q
Sbjct  252  HPLSQWFSNFSEADELLKLAAARQQVQAHIAKLRRQLSMIEGMPQ  296



>ref|XP_006425511.1| hypothetical protein CICLE_v10026276mg [Citrus clementina]
 gb|ESR38751.1| hypothetical protein CICLE_v10026276mg [Citrus clementina]
Length=269

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 192/230 (83%), Gaps = 0/230 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AF LG+KASE QSH+WT+Y+RGATNED+GVVIKR VFQLH SF
Sbjct  35   KRLKDVEICVPIVYGTMAFHLGRKASESQSHRWTVYVRGATNEDIGVVIKRVVFQLHPSF  94

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFEL ECGWGEFEIAI+L+FH+DVCDKPL LYHHLKLYPE ESGP STKK
Sbjct  95   NNPTRVVESPPFELQECGWGEFEIAISLFFHSDVCDKPLDLYHHLKLYPEAESGPKSTKK  154

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V+ESY+EIV  +P+E F ARV NHPAV VPRLPA   LP   P++ V  + RGDTK+H
Sbjct  155  PVVMESYNEIVFPEPAEGFFARVLNHPAVVVPRLPAGFVLPTPVPIDSVHEKGRGDTKNH  214

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            PLS WF NFSEADELLK+ +ARQQVQ HI +LRR+L+M+ G   P  PA+
Sbjct  215  PLSHWFMNFSEADELLKIASARQQVQAHIIKLRRELNMMNGLPPPPNPAS  264



>ref|XP_006466934.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Citrus sinensis]
Length=269

 Score =   306 bits (783),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 192/230 (83%), Gaps = 0/230 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AF LG+KASE QSH+WT+Y+RGATNED+GVVIKR VFQLH SF
Sbjct  35   KRLKDVEICVPIVYGTMAFHLGRKASESQSHRWTVYVRGATNEDIGVVIKRVVFQLHPSF  94

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFEL ECGWGEFEIAI+L+FH+DVCDKPL LYHHLKLYPE ESGP STKK
Sbjct  95   NNPTRVVESPPFELQECGWGEFEIAISLFFHSDVCDKPLDLYHHLKLYPEAESGPKSTKK  154

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V+ESY+EIV  +P+E F ARV NHPAV VPRLPA   LP   P++ V  + RGDTK+H
Sbjct  155  PVVMESYNEIVFPEPAEGFFARVLNHPAVVVPRLPAGFVLPTPVPIDSVHEKGRGDTKNH  214

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            PLS WF NFSEADELLK+ +ARQQVQ HI +LRR+L+M+ G   P  PA+
Sbjct  215  PLSHWFMNFSEADELLKIASARQQVQAHIIKLRRELNMMNGLPPPPNPAS  264



>ref|XP_008337037.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Malus domestica]
Length=277

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/232 (69%), Positives = 189/232 (81%), Gaps = 0/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK ++I VPIVYG VAF+LG+KASE QSHKWT+Y+RGATNEDLGVV+KR +FQLH SF
Sbjct  43   RRLKDVDICVPIVYGTVAFYLGRKASESQSHKWTVYVRGATNEDLGVVVKRVIFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RV+D+PPFEL+ECGWGEFEI+I+L+FHNDVC++ L LYHHLKLY EDESGP STKK
Sbjct  103  NNPMRVIDSPPFELTECGWGEFEISISLFFHNDVCERQLDLYHHLKLYTEDESGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDEIV   P EA  A V NHPAV VPRLPA   LP   P++  +  +RGDTKDH
Sbjct  163  PVVVESYDEIVFPDPLEACFAXVQNHPAVIVPRLPAGFNLPNPVPIDQKNDSERGDTKDH  222

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            PL QWF NFSEADELLKL AARQ+VQ HI  +RR++SM+ G  Q  KP + +
Sbjct  223  PLGQWFLNFSEADELLKLAAARQEVQAHIVSVRRKMSMMDGPPQLSKPPSGY  274



>gb|KDO71156.1| hypothetical protein CISIN_1g024341mg [Citrus sinensis]
Length=269

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 192/230 (83%), Gaps = 0/230 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AF LG+KASE QSH+WT+Y+RGATNED+GVVIKR VFQLH SF
Sbjct  35   KRLKDVEICVPIVYGTMAFHLGRKASESQSHRWTVYVRGATNEDIGVVIKRVVFQLHPSF  94

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFEL ECGWGEFEIAI+L+FH+DVCDKPL LYHHLKLYPE ESGP STKK
Sbjct  95   NNPTRVVESPPFELQECGWGEFEIAISLFFHSDVCDKPLDLYHHLKLYPEAESGPKSTKK  154

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V+ESY+EIV  +P+E F ARV NHPAV VPRLPA   LP   P++ V  + RGDTK+H
Sbjct  155  PVVMESYNEIVFPEPAEGFFARVLNHPAVVVPRLPAGFVLPTPVPIDSVHGKGRGDTKNH  214

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            PLS WF NFSEADELLK+ +ARQQVQ HI +LRR+L+M+ G   P  PA+
Sbjct  215  PLSHWFMNFSEADELLKIASARQQVQAHIIKLRRELNMMNGLPPPPNPAS  264



>ref|XP_003607096.1| YEATS domain-containing protein [Medicago truncatula]
Length=237

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 193/227 (85%), Gaps = 8/227 (4%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EISVPIVYGNV+FWLGKKASEYQSHKWT+Y+RGA+NEDLGV++KR VFQLH+SF
Sbjct  14   KKLKDVEISVPIVYGNVSFWLGKKASEYQSHKWTIYVRGASNEDLGVIVKRVVFQLHTSF  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTR+VDAPPFELSE GWGEFEIAITLYFH+DVCDKP++   ++++         S + 
Sbjct  74   NNPTRIVDAPPFELSEAGWGEFEIAITLYFHSDVCDKPVNFVMYIQIS--------SVEV  125

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE YDE+V   PSEAFLAR+ NHP V++PRLPA L LPP  P+ED  +R+RGDTKD+
Sbjct  126  PVVVEFYDEVVFPDPSEAFLARLQNHPVVNMPRLPAGLTLPPPIPIEDASKRRRGDTKDN  185

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PLSQWF NFSEADELL+L AARQQVQ HI++L+RQ+S++ GQH+ LK
Sbjct  186  PLSQWFLNFSEADELLQLAAARQQVQAHISKLKRQISLIDGQHKQLK  232



>gb|KCW56651.1| hypothetical protein EUGRSUZ_I02357 [Eucalyptus grandis]
Length=250

 Score =   303 bits (776),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/241 (70%), Positives = 193/241 (80%), Gaps = 1/241 (0%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            SA+K G  +P+  G AT   R K+ K S+D E K  +++LK  EIS+PIVYG +AF+LG+
Sbjct  2    SARKQGDGQPE-DGGATAGKRLKIAKFSEDPEKKGLSRRLKDAEISLPIVYGTIAFYLGR  60

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASE QSHKWT+Y+RGATNEDL  VIKR VFQLH SFNNPTRV++APPFELSECGWGEFE
Sbjct  61   KASESQSHKWTVYVRGATNEDLSAVIKRVVFQLHPSFNNPTRVMEAPPFELSECGWGEFE  120

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAI+L+FH DVCDK L LYHHLKLYPEDESGP STKKP+VVESYDEIV   PSEAF ARV
Sbjct  121  IAISLFFHPDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYDEIVFPDPSEAFYARV  180

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             N+PAV VPR+PA   +      E+   R+RGDTKDHPLSQWF NFSEADELLKL AARQ
Sbjct  181  QNNPAVIVPRMPAGFNISAPVAPENTSERERGDTKDHPLSQWFMNFSEADELLKLAAARQ  240

Query  142  Q  140
            Q
Sbjct  241  Q  241



>gb|AFK33694.1| unknown [Medicago truncatula]
Length=275

 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 193/229 (84%), Gaps = 0/229 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K + I VPIVYG +AF+LG+KASE QSHKWT+Y+RGA+NEDL  V+KR VFQLH SF
Sbjct  46   KRVKDVGICVPIVYGTIAFFLGRKASESQSHKWTVYVRGASNEDLSAVVKRVVFQLHPSF  105

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFE+SECGWGEFEIAITL+FH+D C+K L LYHHLKLYPEDESGP +TK+
Sbjct  106  NNPTRVVESPPFEISECGWGEFEIAITLFFHSDACEKQLDLYHHLKLYPEDESGPQNTKR  165

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V+ESY+E+V  +PSEAFLARV NHPAV VPRLP  L LP   P+E ++ ++RGDTKDH
Sbjct  166  PVVIESYNEVVFPEPSEAFLARVQNHPAVVVPRLPDGLNLPSPVPVEPMNDKERGDTKDH  225

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
            PL+ WF NFSEADELLKL AARQQVQ HI +L RQL+++ G  Q  +P+
Sbjct  226  PLNHWFLNFSEADELLKLAAARQQVQAHIVKLGRQLTLMEGLPQSKQPS  274



>ref|XP_010679864.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Beta vulgaris subsp. vulgaris]
Length=263

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 190/232 (82%), Gaps = 1/232 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+SVPIVYG +AFWLG+KA+E QSHKWT+Y+RGATNEDL  VIKR VFQLH SF
Sbjct  33   RRVKDVEVSVPIVYGTIAFWLGRKATESQSHKWTVYVRGATNEDLSGVIKRVVFQLHPSF  92

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP R VD+PPFELSECGWGEFEIAI+L+FH+D CD+ L L+HHLKLYP ++SGP STKK
Sbjct  93   ENPVRYVDSPPFELSECGWGEFEIAISLHFHSDACDRKLDLFHHLKLYPLEQSGPQSTKK  152

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDE+V   PSE FLAR+ N+PAV VPRLPA L LP +A +E+ + R RG+TKDH
Sbjct  153  PVVVESYDEVVFPDPSERFLARIQNYPAVIVPRLPAGLELPSSASVEENNDR-RGNTKDH  211

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATEF  56
            PL  WF NFSEADELLKL AARQQVQ HI +LRRQ+SMV G      PA+ F
Sbjct  212  PLGHWFMNFSEADELLKLAAARQQVQAHIVKLRRQMSMVDGSSGTADPASAF  263



>ref|XP_011025946.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Populus euphratica]
Length=293

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 189/231 (82%), Gaps = 0/231 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVP+VYG +AF+LGKKA+E QSHKWT+Y+RGATNEDLGVVIK+ VFQLH SF
Sbjct  44   KRLKDVEISVPVVYGTMAFYLGKKANELQSHKWTVYVRGATNEDLGVVIKQVVFQLHPSF  103

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            +NP RVV++PPFELSECGWGEFEI I++ FH+DVCDK + L+H LKLYP+ ESGP STKK
Sbjct  104  DNPIRVVESPPFELSECGWGEFEICISILFHDDVCDKHVDLFHLLKLYPDAESGPQSTKK  163

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA   LP   P  +++ + + D K+H
Sbjct  164  PVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNLPAPVPSPNMNVKGKYDAKNH  223

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            PL+ WF NFSEADELLKL +ARQQVQ HI +LRRQLSM+ G  QP K A E
Sbjct  224  PLNHWFINFSEADELLKLASARQQVQAHILKLRRQLSMLDGPPQPSKLAYE  274



>gb|KCW56652.1| hypothetical protein EUGRSUZ_I02357 [Eucalyptus grandis]
Length=249

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/241 (70%), Positives = 190/241 (79%), Gaps = 2/241 (1%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            SA+K G  +P+  G AT   R K+ K S+D E K  +++LK  EIS+PIVYG +AF+LG+
Sbjct  2    SARKQGDGQPEDGG-ATAGKRLKIAKFSEDPEKKGLSRRLKDAEISLPIVYGTIAFYLGR  60

Query  682  KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFE  503
            KASE QSHKWT+Y+RGATNEDL  VIKR VFQLH SFNNPTRV++APPFELSECGWGEFE
Sbjct  61   KASESQSHKWTVYVRGATNEDLSAVIKRVVFQLHPSFNNPTRVMEAPPFELSECGWGEFE  120

Query  502  IAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARV  323
            IAI+L+FH DVCDK L LYHHLKLYPEDESGP STKKP+VVESYDEIV   PSEAF ARV
Sbjct  121  IAISLFFHPDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYDEIVFPDPSEAFYARV  180

Query  322  HNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQ  143
             N+PAV VPR         A   E+   R+RGDTKDHPLSQWF NFSEADELLKL AARQ
Sbjct  181  QNNPAVIVPR-MPAGFNISAPAPENTSERERGDTKDHPLSQWFMNFSEADELLKLAAARQ  239

Query  142  Q  140
            Q
Sbjct  240  Q  240



>ref|XP_011025947.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Populus euphratica]
Length=292

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVP+VYG +AF+LGKKA+E QSHKWT+Y+RGATNEDLGVVIK+ VFQLH SF
Sbjct  44   KRLKDVEISVPVVYGTMAFYLGKKANELQSHKWTVYVRGATNEDLGVVIKQVVFQLHPSF  103

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            +NP RVV++PPFELSECGWGEFEI I++ FH+DVCDK + L+H LKLYP+ ESGP STKK
Sbjct  104  DNPIRVVESPPFELSECGWGEFEICISILFHDDVCDKHVDLFHLLKLYPDAESGPQSTKK  163

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA   LP   P  +++ + + D K+H
Sbjct  164  PVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNLPAPVPSPNMNVKGKYDAKNH  223

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
            PL+ WF NFSEADELLKL +ARQQVQ HI +LRRQLSM+ G  QP K A
Sbjct  224  PLNHWFINFSEADELLKLASARQQVQAHILKLRRQLSMLDGPPQPSKLA  272



>ref|XP_011025948.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X3 [Populus euphratica]
Length=282

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 188/229 (82%), Gaps = 0/229 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVP+VYG +AF+LGKKA+E QSHKWT+Y+RGATNEDLGVVIK+ VFQLH SF
Sbjct  44   KRLKDVEISVPVVYGTMAFYLGKKANELQSHKWTVYVRGATNEDLGVVIKQVVFQLHPSF  103

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            +NP RVV++PPFELSECGWGEFEI I++ FH+DVCDK + L+H LKLYP+ ESGP STKK
Sbjct  104  DNPIRVVESPPFELSECGWGEFEICISILFHDDVCDKHVDLFHLLKLYPDAESGPQSTKK  163

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA   LP   P  +++ + + D K+H
Sbjct  164  PVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNLPAPVPSPNMNVKGKYDAKNH  223

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
            PL+ WF NFSEADELLKL +ARQQVQ HI +LRRQLSM+ G  QP K A
Sbjct  224  PLNHWFINFSEADELLKLASARQQVQAHILKLRRQLSMLDGPPQPSKLA  272



>ref|XP_010246406.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X2 [Nelumbo nucifera]
Length=247

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/268 (64%), Positives = 202/268 (75%), Gaps = 27/268 (10%)
 Frame = -1

Query  865  NSAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLG  686
            +SA+KHG D+ + +G    S R KM   ++DSE K S+++LK +EISVPIVYG V+FWLG
Sbjct  5    SSARKHGGDQSEGSGSVLKSQRAKMGGIANDSEKKGSSKRLKDVEISVPIVYGTVSFWLG  64

Query  685  KKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEF  506
            K+ASEY SHKWT+Y+RG TNEDLGVVI+RAVFQLH+SFNNPTRVVD+PPFELSE GWGEF
Sbjct  65   KRASEYNSHKWTVYVRGTTNEDLGVVIRRAVFQLHTSFNNPTRVVDSPPFELSESGWGEF  124

Query  505  EIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLAR  326
            EIAITLYFH+DVCDK L LYHHLKLYPED+SGP STKKP+VVESYDEIV S+PSE+F AR
Sbjct  125  EIAITLYFHSDVCDKQLDLYHHLKLYPEDDSGPQSTKKPVVVESYDEIVFSEPSESFFAR  184

Query  325  VHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAAR  146
            V NHPAV VPRLPA                    T + P         EADELLKL AAR
Sbjct  185  VQNHPAVIVPRLPA--------------------TFNLPP-------PEADELLKLAAAR  217

Query  145  QQVQGHIARLRRQLSMVGGQHQPLKPAT  62
            QQVQ +I +LRRQ+S++ GQ Q   P +
Sbjct  218  QQVQAYIVKLRRQMSLIDGQPQQSLPTS  245



>ref|XP_011099822.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X2 [Sesamum indicum]
Length=247

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 175/206 (85%), Gaps = 3/206 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVPIVYG +AFWLG+KA+E QSHKWT+Y+RGATNEDLGVVIKRAVFQLH SF
Sbjct  41   KRLKDVEISVPIVYGTIAFWLGRKATETQSHKWTVYVRGATNEDLGVVIKRAVFQLHPSF  100

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV++PPFELSECGWGEFEIAI+L+FHNDVC+K L LYHHLKLY EDESGP STKK
Sbjct  101  NNPVRVVESPPFELSECGWGEFEIAISLFFHNDVCEKQLDLYHHLKLYSEDESGPQSTKK  160

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPR--lpadlalppaapLEDVDRRKRGDTK  218
            P+VVE+Y+EIV   PSE F ARV  HPAV VPR  +  +L    A  +ED++  KRGDTK
Sbjct  161  PVVVETYNEIVFPDPSEDFYARVQKHPAVIVPRLPVTINLPSVLATNVEDLN-EKRGDTK  219

Query  217  DHPLSQWFTNFSEADELLKLTAARQQ  140
            DHPLSQWF NFSEADELLKL AARQQ
Sbjct  220  DHPLSQWFNNFSEADELLKLAAARQQ  245



>gb|KCW56650.1| hypothetical protein EUGRSUZ_I02357 [Eucalyptus grandis]
Length=259

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 193/250 (77%), Gaps = 10/250 (4%)
 Frame = -1

Query  862  SAKKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGK  683
            SA+K G  +P+  G AT   R K+ K S+D E K  +++LK  EIS+PIVYG +AF+LG+
Sbjct  2    SARKQGDGQPE-DGGATAGKRLKIAKFSEDPEKKGLSRRLKDAEISLPIVYGTIAFYLGR  60

Query  682  KASE---------YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFEL  530
            KAS+          QSHKWT+Y+RGATNEDL  VIKR VFQLH SFNNPTRV++APPFEL
Sbjct  61   KASDGLFVSTVIRSQSHKWTVYVRGATNEDLSAVIKRVVFQLHPSFNNPTRVMEAPPFEL  120

Query  529  SECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSK  350
            SECGWGEFEIAI+L+FH DVCDK L LYHHLKLYPEDESGP STKKP+VVESYDEIV   
Sbjct  121  SECGWGEFEIAISLFFHPDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYDEIVFPD  180

Query  349  PSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADE  170
            PSEAF ARV N+PAV VPR+PA   +      E+   R+RGDTKDHPLSQWF NFSEADE
Sbjct  181  PSEAFYARVQNNPAVIVPRMPAGFNISAPVAPENTSERERGDTKDHPLSQWFMNFSEADE  240

Query  169  LLKLTAARQQ  140
            LLKL AARQQ
Sbjct  241  LLKLAAARQQ  250



>ref|XP_007046721.1| YEATS family protein isoform 2 [Theobroma cacao]
 gb|EOX90878.1| YEATS family protein isoform 2 [Theobroma cacao]
Length=232

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -1

Query  667  QSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITL  488
            QSHKWT+Y+RGATNEDLGVV+K  VFQLH SFNNPTR+V++PPFELSECGWGEFEI I+L
Sbjct  26   QSHKWTVYVRGATNEDLGVVVKHVVFQLHPSFNNPTRLVESPPFELSECGWGEFEIGISL  85

Query  487  YFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPA  308
            +FH+DVCDK L LYHHLKLYPEDESGP STKKP+VVESY+EIV   PSE F +RV NHPA
Sbjct  86   FFHSDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYNEIVFPDPSECFFSRVQNHPA  145

Query  307  VSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGH  128
            V VPRLPA  +LP   P E+++ R RGDTKDHPLSQWF NFSEADELLKL AARQQVQ H
Sbjct  146  VLVPRLPAGFSLPAPVPFENMNERGRGDTKDHPLSQWFMNFSEADELLKLAAARQQVQAH  205

Query  127  IARLRRQLSMVGGQHQPLKPATEF  56
            I +LRRQLS++ G  QPLKPA+ +
Sbjct  206  IVKLRRQLSVIDGMPQPLKPASSY  229



>ref|XP_009611985.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Nicotiana tomentosiformis]
Length=272

 Score =   293 bits (749),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 183/227 (81%), Gaps = 1/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AFWLG+KA+E QSH+W++Y+RGATNEDL  VIK+ VFQLH SF
Sbjct  43   KRLKDVEIYVPIVYGTIAFWLGRKATETQSHRWSVYVRGATNEDLSGVIKKVVFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV++PPFELSECGWGEFEIAI+L+FH+DV +K L LYHHLKLY E+ESGP STKK
Sbjct  103  NNPVRVVESPPFELSECGWGEFEIAISLHFHDDVGEKKLDLYHHLKLYAENESGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+E+V   P E F +R+ NHPAV VPR        P AP+ED+   KRGDTK+H
Sbjct  163  PVVVETYNEVVFPDPPEDFFSRIQNHPAVIVPR-LPATFKFPPAPIEDLHVLKRGDTKNH  221

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PLSQWF NFSEADELLKLTAARQ VQ HI +LRRQLS++    Q  K
Sbjct  222  PLSQWFINFSEADELLKLTAARQTVQAHIVKLRRQLSVMDELPQTFK  268



>ref|XP_008440808.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
isoform X1 [Cucumis melo]
Length=297

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EI VPIV G +AF+LG+KASE QSHKWT+Y+RGATNEDLGVVIKR VFQLH SF
Sbjct  42   RKLKDMEICVPIVCGTIAFYLGRKASESQSHKWTVYVRGATNEDLGVVIKRVVFQLHPSF  101

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFELSECGWGEFEIAITL+FH+DVCDK L L+HHLKLYPEDESGP +TKK
Sbjct  102  NNPTRVVESPPFELSECGWGEFEIAITLFFHSDVCDKQLDLFHHLKLYPEDESGPQTTKK  161

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   PSE F +RV NHPAV VPRLPA   LP  A +E++  R++GDTKDH
Sbjct  162  PVVVESYNEIVFPDPSEIFFSRVQNHPAVVVPRLPAGFNLPNPASIENMAEREKGDTKDH  221

Query  211  PLSQWFTNFSEADELLKLTAARQQ  140
            PLSQWF NFSEADELLKL AARQQ
Sbjct  222  PLSQWFLNFSEADELLKLAAARQQ  245



>ref|XP_006340726.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Solanum tuberosum]
Length=272

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 182/227 (80%), Gaps = 1/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIV+G +AFWLGKKA+E QSH+W++Y+RGATNEDL  VIK+ VFQLH SF
Sbjct  43   KRLKDVEIYVPIVFGTIAFWLGKKATETQSHRWSVYVRGATNEDLSGVIKKVVFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV++PPFELSECGWGEFEIAI+L FH+DV +K L LYHHLKLY E+E GP STKK
Sbjct  103  NNPVRVVESPPFELSECGWGEFEIAISLLFHDDVGEKKLDLYHHLKLYAENEPGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            PIVVE+Y+EIV   P E F +R+ NHPAV VPR        P AP+ED+   KRGDTK+H
Sbjct  163  PIVVETYNEIVFPDPPEDFFSRIQNHPAVVVPR-LPATFKLPPAPIEDLHALKRGDTKNH  221

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PLSQWF NFSEADELLKLTAARQ+VQ HI +LRRQLS++    Q  K
Sbjct  222  PLSQWFINFSEADELLKLTAARQRVQAHIVKLRRQLSVMDELPQTFK  268



>ref|XP_004232482.1| PREDICTED: transcription initiation factor TFIID subunit 14b 
[Solanum lycopersicum]
Length=268

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 182/227 (80%), Gaps = 1/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIV+G +AFWLGKKA+E QSH+W++Y+RGATNEDL  VIK+ VFQLH SF
Sbjct  39   KRLKDVEIYVPIVFGTIAFWLGKKATETQSHRWSVYVRGATNEDLSGVIKKVVFQLHPSF  98

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV++PPFELSECGWGEFEIAI+L FH+DV +K L LYHHLKLY E+E GP STKK
Sbjct  99   NNPVRVVESPPFELSECGWGEFEIAISLLFHDDVGEKKLDLYHHLKLYAENEPGPQSTKK  158

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            PIVVE+Y+EIV   P E F +R+ NHP+V VPR        P AP+ED+   KRGDTK+H
Sbjct  159  PIVVETYNEIVFPDPPEDFFSRIQNHPSVVVPR-LPTTFKLPPAPIEDLHALKRGDTKNH  217

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PLSQWF NFSEADELLKLTAARQ+VQ HI +LRRQLS++    Q  K
Sbjct  218  PLSQWFINFSEADELLKLTAARQRVQAHIVKLRRQLSVMDELPQTFK  264



>ref|XP_009781834.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Nicotiana sylvestris]
Length=272

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 182/227 (80%), Gaps = 1/227 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AFWLG+KA+E QSH+W++Y+RGATNEDL  VIK+ VFQLH SF
Sbjct  43   KRLKDVEIYVPIVYGTIAFWLGRKATETQSHRWSVYVRGATNEDLSGVIKKVVFQLHPSF  102

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV++PPFELSECGWGEFEIAI+L+FH+DV +K L LYHHLKLY E+E GP STKK
Sbjct  103  NNPVRVVESPPFELSECGWGEFEIAISLHFHDDVGEKKLDLYHHLKLYAENEPGPQSTKK  162

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+E+V   P E F +R+ NHPAV VPR  +     P AP+ED+   KR DTK+H
Sbjct  163  PVVVETYNEVVFPDPPEDFFSRIQNHPAVIVPR-LSATFKFPPAPIEDLHVLKRVDTKNH  221

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            PLSQWF NFSEADELLKLTAARQ VQ HI +LRRQLS++    Q  K
Sbjct  222  PLSQWFINFSEADELLKLTAARQTVQAHIVKLRRQLSVMDELPQTFK  268



>gb|EPS71197.1| hypothetical protein M569_03561, partial [Genlisea aurea]
Length=248

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 192/226 (85%), Gaps = 5/226 (2%)
 Frame = -1

Query  736  IEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTR  557
            +E+ VP VYGN+AFWLGKKA+E+ SHKWT+Y+RGATNEDLGVVIKR VFQLHSSFNNPTR
Sbjct  25   VELCVPFVYGNIAFWLGKKATEFVSHKWTVYVRGATNEDLGVVIKRVVFQLHSSFNNPTR  84

Query  556  VVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVE  377
            VVD+PPFELSE GWGEFEIAITL+FH+DV DKPLHL+HHLKLYPEDE GP STK+P+VVE
Sbjct  85   VVDSPPFELSESGWGEFEIAITLHFHSDVSDKPLHLFHHLKLYPEDEPGP-STKRPVVVE  143

Query  376  SYDEIVLSKPSEAFLARVHNHPAVSVPRl---padlalppaapLEDVDRRKRGDTKDHPL  206
            SYDEIV+S+PSE+  +RV NH AV VPRL          PAA  + VD +KRGDTKDHP 
Sbjct  144  SYDEIVISEPSESLFSRVQNHHAVIVPRLPPGFNLPPPAPAAGEDAVDGKKRGDTKDHPH  203

Query  205  SQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKP  68
            +QWFT+FSEADELLKL AARQQVQ  IARLRRQLS++ GQ Q LKP
Sbjct  204  AQWFTSFSEADELLKLAAARQQVQAQIARLRRQLSLIDGQRQ-LKP  248



>ref|XP_010548291.1| PREDICTED: transcription initiation factor TFIID subunit 14 [Tarenaya 
hassleriana]
Length=270

 Score =   282 bits (722),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++++ +EI VPIV G++AF LG+KA+E QSHKWT+Y+RGATNE+LGVVIKR +FQLH SF
Sbjct  37   RRVRDVEICVPIVCGSIAFHLGRKATETQSHKWTVYVRGATNENLGVVIKRVIFQLHPSF  96

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFELSECGWGEFEI ITL+FH++ C+K L+L H+LKLY E ESGP STK+
Sbjct  97   NNPTRVVESPPFELSECGWGEFEIGITLFFHDNACEKQLNLLHNLKLYAEYESGPQSTKR  156

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESY+EIV   P E FL  VHNHPAV V +   D  + P+A  E  + R +GDTK H
Sbjct  157  PVVVESYNEIVFPNPFEDFLTHVHNHPAVFVSK-LPDGLILPSAVTEIYNLRDKGDTKAH  215

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
            PL+QWF +FSEADELLKL AARQQVQ HI +L+RQLS+V
Sbjct  216  PLNQWFMSFSEADELLKLAAARQQVQAHITKLKRQLSIV  254



>ref|XP_008337030.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X1 [Malus domestica]
Length=314

 Score =   282 bits (721),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 155/245 (63%), Positives = 188/245 (77%), Gaps = 4/245 (2%)
 Frame = -1

Query  862  SAKKHGADRP----DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAF  695
            S +K G   P    +  G A +S   +    ++  + K ++++LK ++I VPIVYG VAF
Sbjct  2    SVRKXGETEPPQPEEGGGSAQLSQPVRTSXPAEXXDKKSTSRRLKDVDICVPIVYGTVAF  61

Query  694  WLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGW  515
            +LG+KASE QSHKWT+Y+RGATNEDLGVV+KR +FQLH SFNNP RV+D+PPFEL+ECGW
Sbjct  62   YLGRKASESQSHKWTVYVRGATNEDLGVVVKRVIFQLHPSFNNPMRVIDSPPFELTECGW  121

Query  514  GEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAF  335
            GEFEI+I+L+FHNDVC++ L LYHHLKLY EDESGP STKKP+VVESYDEIV   P EA 
Sbjct  122  GEFEISISLFFHNDVCERQLDLYHHLKLYTEDESGPQSTKKPVVVESYDEIVFPDPLEAC  181

Query  334  LARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLT  155
             A V NHPAV VPRLPA   LP   P++  +  +RGDTKDHPL QWF NFSEADELLKL 
Sbjct  182  FAXVQNHPAVIVPRLPAGFNLPNPVPIDQKNDSERGDTKDHPLGQWFLNFSEADELLKLA  241

Query  154  AARQQ  140
            AARQ+
Sbjct  242  AARQE  246



>ref|XP_006298345.1| hypothetical protein CARUB_v10014413mg [Capsella rubella]
 gb|EOA31243.1| hypothetical protein CARUB_v10014413mg [Capsella rubella]
Length=264

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 178/228 (78%), Gaps = 2/228 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++KG+E+ VPIV G+VAF+LGK+A++Y++HKWT+Y+RGATNEDLGVVIKR +F LH SF
Sbjct  37   RRIKGVEVYVPIVCGSVAFFLGKRATDYKTHKWTVYVRGATNEDLGVVIKRVIFHLHPSF  96

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPL--ST  398
             NPTRVVD+PPF LSECGWGEF+I IT++   DVC+K L L H LKL PE+E GP+  S 
Sbjct  97   KNPTRVVDSPPFALSECGWGEFKIDITVFLQTDVCEKTLELSHVLKLNPENEYGPIPKSI  156

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTK  218
            K PIV ESY+EIV   P E+FL RVHNHPAV + +LP    LPP+   E   + ++GDTK
Sbjct  157  KIPIVAESYNEIVFPDPFESFLTRVHNHPAVHISKLPDGFNLPPSGVAESYHQLRKGDTK  216

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPL  74
            DHPLSQWF  FSEADEL KLTA RQ+VQ  IA+LRRQL M+ GQ + L
Sbjct  217  DHPLSQWFLTFSEADELFKLTAVRQKVQADIAKLRRQLIMIDGQPEGL  264



>ref|XP_002310857.2| hypothetical protein POPTR_0007s14070g [Populus trichocarpa]
 gb|EEE91307.2| hypothetical protein POPTR_0007s14070g [Populus trichocarpa]
Length=254

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVP+VYG +AF+LGKKA+E QSHKWT+Y+RGATNEDLGVVIK+ VFQLH SF
Sbjct  44   KRLKDVEISVPVVYGTMAFYLGKKANELQSHKWTVYVRGATNEDLGVVIKQVVFQLHPSF  103

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            +NP RVV++PPFELSECGWGEFEI I++ FH+DVCDK + L+H LKLYP+ ESGP STKK
Sbjct  104  DNPIRVVESPPFELSECGWGEFEICISILFHDDVCDKHVDLFHLLKLYPDAESGPQSTKK  163

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA    P   P  +++ + + DTK+H
Sbjct  164  PVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNFPAPVPSPNMNVKGKDDTKNH  223

Query  211  PLSQWFTNFSEADELLKLTAARQQVQG  131
            PL+ WF NFSEADELLKL +ARQQ+  
Sbjct  224  PLNHWFINFSEADELLKLASARQQISA  250



>ref|NP_001189547.1| TBP-associated factor 14 [Arabidopsis thaliana]
 sp|F4IPK2.1|TAF14_ARATH RecName: Full=Transcription initiation factor TFIID subunit 14; 
AltName: Full=Protein AF-9 homolog b; AltName: Full=TBP-associated 
factor 14; Short=AtTAF14 [Arabidopsis thaliana]
 gb|AEC06714.1| TBP-associated factor 14 [Arabidopsis thaliana]
Length=268

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 193/261 (74%), Gaps = 2/261 (1%)
 Frame = -1

Query  832  DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQSHKW  653
            +I   A  S+R   I   DD E ++  +++K +E+ VPIV G++AF+LGKKA+EY++HKW
Sbjct  6    EILSEADASMRKLRIFGIDDREDENGRRRIKDVEVYVPIVCGSIAFYLGKKATEYRTHKW  65

Query  652  TLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHND  473
            T+Y+RGATNEDLGVVIKR +F LH SFNNPTRVVDAPPF LSECGWGEF+I IT++FH D
Sbjct  66   TVYVRGATNEDLGVVIKRVIFHLHPSFNNPTRVVDAPPFALSECGWGEFKIDITVFFHTD  125

Query  472  VCDkplhlyhhlklyPEDESGPL--STKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            VC+K L L H LKL PE+  GP+  S K P+V ESY+E+V   P E+F+ARVHNHPA+ +
Sbjct  126  VCEKKLELSHVLKLNPENAYGPIPKSIKIPVVAESYNEVVFPDPFESFVARVHNHPAIQI  185

Query  298  PRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIAR  119
              +P  L LPP    +     ++GDTK+HPLS WF  FSE +EL KLTAARQ+VQ  IA+
Sbjct  186  SNIPDGLNLPPPGVADTYYLMEKGDTKEHPLSPWFLKFSEVEELFKLTAARQKVQADIAK  245

Query  118  LRRQLSMVGGQHQPLKPATEF  56
            L+RQL MV GQ + L+ ++ +
Sbjct  246  LKRQLIMVDGQPEGLESSSGY  266



>ref|XP_011025949.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X4 [Populus euphratica]
Length=253

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVP+VYG +AF+LGKKA+E QSHKWT+Y+RGATNEDLGVVIK+ VFQLH SF
Sbjct  44   KRLKDVEISVPVVYGTMAFYLGKKANELQSHKWTVYVRGATNEDLGVVIKQVVFQLHPSF  103

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            +NP RVV++PPFELSECGWGEFEI I++ FH+DVCDK + L+H LKLYP+ ESGP STKK
Sbjct  104  DNPIRVVESPPFELSECGWGEFEICISILFHDDVCDKHVDLFHLLKLYPDAESGPQSTKK  163

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA   LP   P  +++ + + D K+H
Sbjct  164  PVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNLPAPVPSPNMNVKGKYDAKNH  223

Query  211  PLSQWFTNFSEADELLKLTAARQQ  140
            PL+ WF NFSEADELLKL +ARQQ
Sbjct  224  PLNHWFINFSEADELLKLASARQQ  247



>ref|XP_011025950.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X5 [Populus euphratica]
Length=252

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EISVP+VYG +AF+LGKKA+E QSHKWT+Y+RGATNEDLGVVIK+ VFQLH SF
Sbjct  44   KRLKDVEISVPVVYGTMAFYLGKKANELQSHKWTVYVRGATNEDLGVVIKQVVFQLHPSF  103

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            +NP RVV++PPFELSECGWGEFEI I++ FH+DVCDK + L+H LKLYP+ ESGP STKK
Sbjct  104  DNPIRVVESPPFELSECGWGEFEICISILFHDDVCDKHVDLFHLLKLYPDAESGPQSTKK  163

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA   LP   P  +++ + + D K+H
Sbjct  164  PVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNLPAPVPSPNMNVKGKYDAKNH  223

Query  211  PLSQWFTNFSEADELLKLTAARQQ  140
            PL+ WF NFSEADELLKL +ARQQ
Sbjct  224  PLNHWFINFSEADELLKLASARQQ  247



>ref|XP_010489443.1| PREDICTED: transcription initiation factor TFIID subunit 14 [Camelina 
sativa]
Length=265

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 174/228 (76%), Gaps = 2/228 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+ +PIV G+VAF+LGK+A+EY++HKWT+Y+RGATNEDLGVVIKR +F LH SF
Sbjct  38   RRIKDVEVYLPIVCGSVAFFLGKRATEYRTHKWTVYVRGATNEDLGVVIKRVIFHLHPSF  97

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESG--PLST  398
             NPTRVVD+PPF LSECGWGEF+I IT++ H DVC+K L L H LKL PE+E G  P S 
Sbjct  98   KNPTRVVDSPPFALSECGWGEFKIDITVFLHTDVCEKKLELSHVLKLNPENEYGSVPKSI  157

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTK  218
            K P+V ESY+EIV   P E+FL RV+NHPAV +  LP    LPP    +   + + GDTK
Sbjct  158  KIPVVAESYNEIVFPDPFESFLTRVYNHPAVHISNLPDGFNLPPTGVADTYHQLRNGDTK  217

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPL  74
            DHPLSQWF  FSEADEL  LTAARQ+VQ  IA+L+RQL MV GQ + L
Sbjct  218  DHPLSQWFLTFSEADELFTLTAARQKVQADIAKLKRQLIMVDGQPEGL  265



>ref|XP_010467597.1| PREDICTED: transcription initiation factor TFIID subunit 14-like 
isoform X1 [Camelina sativa]
Length=265

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 174/228 (76%), Gaps = 2/228 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++++ +E+ +PIV G+VAF+LGK+A+EY++HKWT+Y+RGATNEDLGVVIKR +F LH SF
Sbjct  38   RRIRDVEVYLPIVCGSVAFFLGKRATEYRTHKWTVYVRGATNEDLGVVIKRVIFHLHPSF  97

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESG--PLST  398
             NPTRVVD+PPF L+ECGWGEF+I IT++ H DVC+K L L H LKL PE+E G  P S 
Sbjct  98   KNPTRVVDSPPFALTECGWGEFKIDITVFLHTDVCEKKLDLSHVLKLNPENEYGSVPKSI  157

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTK  218
            K P+V ESY+EIV   P E+FL RV+NHPAV +  LP    L P    +   + + GDTK
Sbjct  158  KIPVVAESYNEIVFPDPFESFLTRVYNHPAVHISNLPDGFNLRPTGVADTYHQLRNGDTK  217

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPL  74
            DHPLSQWF  FSEADEL +LTAARQ+VQ  IA+L+RQL MV GQ + L
Sbjct  218  DHPLSQWFWTFSEADELFQLTAARQKVQADIAKLKRQLIMVDGQPEGL  265



>ref|XP_010413214.1| PREDICTED: transcription initiation factor TFIID subunit 14-like 
[Camelina sativa]
Length=265

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 171/224 (76%), Gaps = 2/224 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+ VPIV G+VAF+LGK+A+EY++HKWT+Y+RGAT+ED+GVVIKR +F LH SF
Sbjct  38   RRIKDVEVYVPIVCGSVAFFLGKRATEYRTHKWTVYVRGATDEDIGVVIKRVIFHLHPSF  97

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESG--PLST  398
             NPTRVVD+PPF LSECGWGEF+I IT++ H DVC+K L L H LKL PE+E G  P S 
Sbjct  98   KNPTRVVDSPPFALSECGWGEFKIDITVFLHTDVCEKKLELSHVLKLNPENEYGSVPKSI  157

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTK  218
            K P+V ESY+E+V   P E+FL RV+NHPAV +  LP    LP +   +   + + GDTK
Sbjct  158  KIPVVAESYNEVVFPDPFESFLTRVYNHPAVHISNLPDGFILPSSGVADTYHQLRNGDTK  217

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
            DHPLSQWF  F EADEL +L AARQ+VQ  IA+L+RQL MV GQ
Sbjct  218  DHPLSQWFWTFLEADELFQLNAARQKVQADIAKLKRQLIMVDGQ  261



>ref|XP_006409209.1| hypothetical protein EUTSA_v10022830mg [Eutrema salsugineum]
 gb|ESQ50662.1| hypothetical protein EUTSA_v10022830mg [Eutrema salsugineum]
Length=240

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 168/226 (74%), Gaps = 0/226 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+SVPIV G++AF+ GK+A EY++H WT+Y+RGATNEDLGVVIK+ +F LH SF
Sbjct  15   RRVKDVEVSVPIVCGSIAFFRGKRAQEYRTHNWTVYVRGATNEDLGVVIKKVIFHLHPSF  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RVVD+PPF LSECGWGEF+I IT++ H DVC+K L L H LKL PE  SGP +   
Sbjct  75   KNPIRVVDSPPFTLSECGWGEFKIDITIFLHTDVCEKKLDLSHMLKLNPEIYSGPQNPNV  134

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V E Y+EIV   P E+FLAR HNHPAV + +LP    LPP    E     ++GDTK+H
Sbjct  135  PVVAEFYNEIVFPSPFESFLARAHNHPAVHISKLPDGFNLPPPGLAETFYEMRKGDTKNH  194

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPL  74
            PLSQWF  FSEADELLKLTA R +VQ  IA L+RQL +V GQ + L
Sbjct  195  PLSQWFLKFSEADELLKLTAVRHKVQADIAELKRQLIVVDGQPEEL  240



>emb|CDY56588.1| BnaC07g48130D [Brassica napus]
Length=256

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 170/224 (76%), Gaps = 2/224 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++ G+E+SVPIV G++AF+ GKKA EY++H WT+Y+RGATNEDLGVVI++ +F LH SF
Sbjct  31   RRVNGVEVSVPIVCGSIAFYRGKKAKEYRTHNWTVYVRGATNEDLGVVIRKVIFHLHPSF  90

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             +PTRVVD+PPF LSECGWGEF+I IT++FH D C++ L L H LKL PE  SGP S   
Sbjct  91   KSPTRVVDSPPFTLSECGWGEFKIDITIFFHADACERKLELSHLLKLNPEIYSGPQSPNV  150

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD--RRKRGDTK  218
            P+V ESY+EIV   P E FL+RV+NHPAV V +LP  L LPP    +D    + K+GDTK
Sbjct  151  PVVTESYNEIVFPDPFECFLSRVNNHPAVHVSKLPEGLNLPPPGDADDESYYKMKKGDTK  210

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
            DHPLS WF  FS+ADEL +LTA RQ+VQ  IA+L+RQL MV  Q
Sbjct  211  DHPLSHWFLKFSDADELFRLTATRQKVQADIAKLKRQLVMVDAQ  254



>ref|XP_009102291.1| PREDICTED: transcription initiation factor TFIID subunit 14 isoform 
X2 [Brassica rapa]
Length=258

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++ G+E+SVPIV G++AF+ GKKA EY++H WT+Y+RGATNEDLG VI++ +F LH SF
Sbjct  31   RRVNGVEVSVPIVCGSIAFFRGKKAKEYRTHNWTVYVRGATNEDLGAVIRKVIFHLHPSF  90

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             +PTRVVD+PPF LSECGWGEF+I IT++FH D C++ L L H LKL PE  SGP S   
Sbjct  91   KSPTRVVDSPPFTLSECGWGEFKIDITIFFHADACERKLELSHLLKLNPEIYSGPQSPNV  150

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalpp--aapLEDVDRRKRGDTK  218
            P+V ESY+EIV   P E FL+RV NHPAV VP+LP    LPP   A  E   + K+GDTK
Sbjct  151  PVVTESYNEIVFPDPFECFLSRVINHPAVHVPKLPEGFNLPPPGDAGDESYYKMKKGDTK  210

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
            DHPLS WF+ FSEADEL KLTA RQ+VQ  IA L+RQL MV  Q
Sbjct  211  DHPLSHWFSKFSEADELFKLTATRQKVQADIAELKRQLVMVDVQ  254



>ref|XP_009102290.1| PREDICTED: transcription initiation factor TFIID subunit 14 isoform 
X1 [Brassica rapa]
Length=260

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 168/226 (74%), Gaps = 4/226 (2%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++ G+E+SVPIV G++AF+ GKKA EY++H WT+Y+RGATNEDLG VI++ +F LH SF
Sbjct  31   RRVNGVEVSVPIVCGSIAFFRGKKAKEYRTHNWTVYVRGATNEDLGAVIRKVIFHLHPSF  90

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             +PTRVVD+PPF LSECGWGEF+I IT++FH D C++ L L H LKL PE  SGP S   
Sbjct  91   KSPTRVVDSPPFTLSECGWGEFKIDITIFFHADACERKLELSHLLKLNPEIYSGPQSPNV  150

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVD----RRKRGD  224
            P+V ESY+EIV   P E FL+RV NHPAV VP+LP    LPP    +  D    + K+GD
Sbjct  151  PVVTESYNEIVFPDPFECFLSRVINHPAVHVPKLPEGFNLPPPVAGDAGDESYYKMKKGD  210

Query  223  TKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
            TKDHPLS WF+ FSEADEL KLTA RQ+VQ  IA L+RQL MV  Q
Sbjct  211  TKDHPLSHWFSKFSEADELFKLTATRQKVQADIAELKRQLVMVDVQ  256



>emb|CDY38168.1| BnaA07g02150D [Brassica napus]
Length=258

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 168/224 (75%), Gaps = 2/224 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++ G+E+SVPIV G++AF+ GKKA EY++H WT+Y+RGATNEDLG VI++ +F LH SF
Sbjct  31   RRVNGVEVSVPIVCGSIAFFRGKKAKEYRTHNWTVYVRGATNEDLGAVIRKVIFHLHPSF  90

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             +PTRVVD+PPF LSECGWGEF+I IT++FH D C++ L L H LKL PE  SGP S   
Sbjct  91   KSPTRVVDSPPFTLSECGWGEFKIDITIFFHADACERKLELSHLLKLNPEIYSGPQSPNV  150

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalpp--aapLEDVDRRKRGDTK  218
            P+V ESY+EIV   P E FL+RV+NHPAV V  LP  L LPP   A  E   + K+GDTK
Sbjct  151  PVVTESYNEIVFPDPFECFLSRVYNHPAVHVSMLPEGLNLPPPGDAGDESYYKMKKGDTK  210

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
            DHPLS WF+ FSEADEL +LTA RQ+VQ  IA L+RQL MV  Q
Sbjct  211  DHPLSHWFSKFSEADELFRLTATRQKVQADIAELKRQLVMVDAQ  254



>gb|KFK40176.1| hypothetical protein AALP_AA3G340200 [Arabis alpina]
Length=258

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 167/228 (73%), Gaps = 2/228 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+SVPIVYG++A + GK A E ++H W +Y+RGATNEDLGVVIK+ +FQLH SF
Sbjct  31   RRVKDVEVSVPIVYGSIALYRGKNAKENRTHNWIVYVRGATNEDLGVVIKKVIFQLHPSF  90

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPL--ST  398
             NPTRV+D+PPF LSECGWGEFEI IT++ H DVC+K L L H LKL PE+E GP   ST
Sbjct  91   KNPTRVIDSPPFTLSECGWGEFEIDITVFLHTDVCEKKLELSHMLKLNPENEYGPTPKST  150

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTK  218
            K P+V E Y+EIV   P E+FLARV+NHPAV V +LP    + P    E      +GDTK
Sbjct  151  KIPVVTEFYNEIVFLDPFESFLARVYNHPAVHVSKLPDGFKISPTGVAETYREMVKGDTK  210

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPL  74
            DHPLSQWF  FS+A+ELL ++AARQ+V+  I  L++QL    GQ + L
Sbjct  211  DHPLSQWFLKFSDAEELLNISAARQKVRADITALKKQLIKADGQPEKL  258



>ref|XP_002862271.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38529.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=179

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -1

Query  670  YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAIT  491
            YQSHKW +Y+RGATNED+ VV+K+ VFQLHSSFNNPTRV++ PPFE+SE GWGEFEIA+T
Sbjct  1    YQSHKWAVYVRGATNEDISVVVKKVVFQLHSSFNNPTRVIEEPPFEVSESGWGEFEIAMT  60

Query  490  LYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHP  311
            L+FH+DVCDKPL LYHHLKLYPEDESGPL+ KKP+VVESYDEIV   PSE+FL+RV NHP
Sbjct  61   LHFHSDVCDKPLSLYHHLKLYPEDESGPLTMKKPVVVESYDEIVFPDPSESFLSRVQNHP  120

Query  310  AVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            A++ PRLP+   LP    +ED  ++KRGDTKDH L QWF +FSEADELL+L AARQQV
Sbjct  121  ALTFPRLPSGYNLPAPMQVEDTGKKKRGDTKDHSLGQWFMSFSEADELLQLAAARQQV  178



>ref|XP_002985664.1| hypothetical protein SELMODRAFT_122900, partial [Selaginella 
moellendorffii]
 gb|EFJ13242.1| hypothetical protein SELMODRAFT_122900, partial [Selaginella 
moellendorffii]
Length=227

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+SVPI YG ++FWLGKKA +  SHKWT+YIR ATNEDLG +I + VFQLH SF
Sbjct  1    KRVKNVELSVPIAYGTISFWLGKKADDLHSHKWTVYIRSATNEDLGPIISKVVFQLHPSF  60

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++ PFELSE GWGEFEI++T++F  D  +K L L+HHLKLY ED++ P STKK
Sbjct  61   NNPTRVVESAPFELSESGWGEFEISMTVFFQKDAAEKTLELFHHLKLYHEDDNAPQSTKK  120

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDE+V  +P+EAF +RV N PAV V           +  LE  + RKRGDTKDH
Sbjct  121  PVVVESYDELVFQEPTEAFYSRVKNLPAVHV-NGSPGELNVSSGALEISNERKRGDTKDH  179

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
             L QWF  +SE DEL  +  ARQQVQ  IA+L+   SM+  +   LKP+
Sbjct  180  QLGQWFGKYSETDELTSIMGARQQVQKEIAKLK---SMLDSEAMKLKPS  225



>ref|XP_002974290.1| hypothetical protein SELMODRAFT_174113 [Selaginella moellendorffii]
 gb|EFJ24512.1| hypothetical protein SELMODRAFT_174113 [Selaginella moellendorffii]
Length=268

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+SVPI YG ++FWLGKKA +  SHKWT+YIR ATNEDLG +I + VFQLH SF
Sbjct  42   KRVKNVELSVPIAYGTISFWLGKKADDLHSHKWTVYIRSATNEDLGPIISKVVFQLHPSF  101

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++ PFELSE GWGEFEI++T++F  D  +K L L+HHLKLY ED++ P STKK
Sbjct  102  NNPTRVVESAPFELSESGWGEFEISMTVFFQKDAAEKTLELFHHLKLYHEDDNAPQSTKK  161

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+VVESYDE+V  +P+EAF +RV N PAV V           +  LE  + RKRGDTKDH
Sbjct  162  PVVVESYDELVFQEPTEAFYSRVKNLPAVHV-NGSPGELNVSSGALEISNERKRGDTKDH  220

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
             L QWF  +SE DEL  +  ARQQVQ  IA+L+   SM+  +   LKP+
Sbjct  221  QLGQWFGKYSETDELTSIMGARQQVQKEIAKLK---SMLDSEAMKLKPS  266



>ref|XP_010467598.1| PREDICTED: transcription initiation factor TFIID subunit 14-like 
isoform X2 [Camelina sativa]
Length=252

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++++ +E+ +PIV G+VAF+LGK+A+EY++HKWT+Y+RGATNEDLGVVIKR +F LH SF
Sbjct  38   RRIRDVEVYLPIVCGSVAFFLGKRATEYRTHKWTVYVRGATNEDLGVVIKRVIFHLHPSF  97

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESG--PLST  398
             NPTRVVD+PPF L+ECGWGEF+I IT++ H DVC+K L L H LKL PE+E G  P S 
Sbjct  98   KNPTRVVDSPPFALTECGWGEFKIDITVFLHTDVCEKKLDLSHVLKLNPENEYGSVPKSI  157

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTK  218
            K P+V ESY+EIV   P E+FL RV+NHPAV +  LP    L P    +   + + GDTK
Sbjct  158  KIPVVAESYNEIVFPDPFESFLTRVYNHPAVHISNLPDGFNLRPTGVADTYHQLRNGDTK  217

Query  217  DHPLSQWFTNFSEADELLKLTAARQQVQGHIARLR  113
            DHPLSQWF  FSEADEL +LTAARQ++Q  + +L+
Sbjct  218  DHPLSQWFWTFSEADELFQLTAARQKLQFPLLKLK  252



>gb|ACU21300.1| unknown [Glycine max]
Length=178

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGNVAFWLGKKASE+QSHKWT+Y+RGATNEDLG +IK AVFQLHSSF
Sbjct  8    KKLKDVEISIPIVYGNVAFWLGKKASEHQSHKWTVYVRGATNEDLGTIIKHAVFQLHSSF  67

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRV ++PPFELSE GWGEFE++ITLYFH+DVCDKPL+LYHHLKLYPEDE+  +STKK
Sbjct  68   NNPTRVAESPPFELSESGWGEFEVSITLYFHSDVCDKPLNLYHHLKLYPEDENSSMSTKK  127

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPR  293
            P+VVE YDEIV   PSEAFLARV NHPAV++PR
Sbjct  128  PVVVEFYDEIVFPDPSEAFLARVQNHPAVNLPR  160



>ref|XP_001783775.1| predicted protein [Physcomitrella patens]
 gb|EDQ51427.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 159/221 (72%), Gaps = 5/221 (2%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++KG+EI+VPIVYG+++FWLGKKA+E  +HKWT Y+R ATNEDL V+IK+ VFQLH SF 
Sbjct  4    RIKGVEITVPIVYGSISFWLGKKAAE-STHKWTTYVRSATNEDLSVLIKKVVFQLHPSFE  62

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKP  389
             PTR  DA PFELSE GWGEFEI IT+YFH DV +KP+ L+HHLKLY +DE+ P +TKKP
Sbjct  63   KPTRTADAAPFELSESGWGEFEIGITIYFHPDVGEKPMELFHHLKLYADDETIPQTTKKP  122

Query  388  IVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHP  209
            +VVESYDEIVLS P EA   R+ NHPAV V            A  E+   R+  DTKDH 
Sbjct  123  VVVESYDEIVLSDPMEASFGRLRNHPAVRV----TGNPPSQLALPENSLERRGCDTKDHA  178

Query  208  LSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
            L+QWF   SE +++  LTA RQQV    A+L++ L  + G+
Sbjct  179  LAQWFLKHSETEDMNSLTAVRQQVYAAAAKLKKDLGSLEGE  219



>ref|XP_008344256.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like, 
partial [Malus domestica]
Length=222

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  661  HKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYF  482
            HKWT+Y+RGATNEDLGVV+KR +FQLH SFNNP RV+D+PPFEL+ECGWGEFEI+I+L+F
Sbjct  5    HKWTVYVRGATNEDLGVVVKRVIFQLHPSFNNPMRVIDSPPFELTECGWGEFEISISLFF  64

Query  481  HNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVS  302
            HNDVC++ L LYHHLKLY EDESGP STKKP+VVESYDEIV   P EA  A V NHPAV 
Sbjct  65   HNDVCERQLDLYHHLKLYTEDESGPQSTKKPVVVESYDEIVFPDPLEACFACVQNHPAVI  124

Query  301  VPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQ  134
            VPRLPA   LP   P++  + R+RGD K+HP  QWF NFSEADELLK  AARQ+V+
Sbjct  125  VPRLPAGFNLPNPVPIDQKNDRERGDMKEHPHGQWFLNFSEADELLKHAAARQEVR  180



>gb|KDO71157.1| hypothetical protein CISIN_1g024341mg [Citrus sinensis]
Length=228

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +EI VPIVYG +AF LG+KASE QSH+WT+Y+RGATNED+GVVIKR VFQLH SF
Sbjct  35   KRLKDVEICVPIVYGTMAFHLGRKASESQSHRWTVYVRGATNEDIGVVIKRVVFQLHPSF  94

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNPTRVV++PPFEL ECGWGEFEIAI+L+FH+DVCDKPL LYHHLKLYPE ESGP STKK
Sbjct  95   NNPTRVVESPPFELQECGWGEFEIAISLFFHSDVCDKPLDLYHHLKLYPEAESGPKSTKK  154

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPR  293
            P+V+ESY+EIV  +P+E F ARV NHPAV VPR
Sbjct  155  PVVMESYNEIVFPEPAEGFFARVLNHPAVVVPR  187



>ref|XP_001761097.1| predicted protein [Physcomitrella patens]
 gb|EDQ74164.1| predicted protein [Physcomitrella patens]
Length=214

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 147/204 (72%), Gaps = 6/204 (3%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++KG+E+++PIVYG++AFWLGKKA+E  +HKWT Y+R A NEDL V+IK+ VFQLH SF 
Sbjct  4    RVKGVEVTIPIVYGSIAFWLGKKAAE-STHKWTTYVRSANNEDLSVLIKKVVFQLHPSFE  62

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKP  389
             PTR V+A PFELSE GWGEFEI ITL+FH DV +KPL L+HHLKLY +DES P +TKKP
Sbjct  63   KPTRTVEAAPFELSESGWGEFEIGITLHFHPDVGEKPLELFHHLKLYADDESIPQTTKKP  122

Query  388  IVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHP  209
            +VVESYDEIVLS+P EA   R+ NHP   V       +      L     R  GDTKDH 
Sbjct  123  VVVESYDEIVLSEPMEASFGRLRNHPVARV-----IGSPASPLVLPGSFERNGGDTKDHS  177

Query  208  LSQWFTNFSEADELLKLTAARQQV  137
            L QWF   SEA++L  L  ARQQV
Sbjct  178  LLQWFMKHSEAEDLNLLATARQQV  201



>ref|NP_179391.1| TBP-associated factor 14 [Arabidopsis thaliana]
 gb|AAD20126.1| unknown protein [Arabidopsis thaliana]
 gb|AAR28018.1| TAF14 [Arabidopsis thaliana]
 gb|AEC06713.1| TBP-associated factor 14 [Arabidopsis thaliana]
Length=202

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  832  DITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKASEYQSHKW  653
            +I   A  S+R   I   DD E ++  +++K +E+ VPIV G++AF+LGKKA+EY++HKW
Sbjct  6    EILSEADASMRKLRIFGIDDREDENGRRRIKDVEVYVPIVCGSIAFYLGKKATEYRTHKW  65

Query  652  TLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHND  473
            T+Y+RGATNEDLGVVIKR +F LH SFNNPTRVVDAPPF LSECGWGEF+I IT++FH D
Sbjct  66   TVYVRGATNEDLGVVIKRVIFHLHPSFNNPTRVVDAPPFALSECGWGEFKIDITVFFHTD  125

Query  472  VCDkplhlyhhlklyPEDESGPL--STKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            VC+K L L H LKL PE+  GP+  S K P+V ESY+E+V   P E+F+ARVHNHPA+ +
Sbjct  126  VCEKKLELSHVLKLNPENAYGPIPKSIKIPVVAESYNEVVFPDPFESFVARVHNHPAIQI  185



>ref|XP_002884095.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60354.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=208

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 2/153 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++K +E+ VPIV G++AF+LGKKA+EY++HKWT+Y+RGATNEDLGVVIKR +F LH SF
Sbjct  33   RRIKDVEVYVPIVCGSIAFYLGKKATEYRTHKWTVYVRGATNEDLGVVIKRVIFHLHPSF  92

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPL--ST  398
             NPTRVVD+PPF LSECGWGEF+I IT+  H DVC+K L L H LKL PE+E GP+  S 
Sbjct  93   KNPTRVVDSPPFALSECGWGEFKIDITVILHTDVCEKKLELSHVLKLNPENEYGPIPKSI  152

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            K P+V ESY+EIV   P E+FLARVHNHPAV +
Sbjct  153  KIPVVAESYNEIVFPDPFESFLARVHNHPAVHI  185



>ref|XP_003607097.1| YEATS domain-containing protein [Medicago truncatula]
Length=182

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  538  FELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIV  359
            F LSE GWGEFEIAITLYFH+DVCDKP++LYH L+LYP+DES   STKKP+VVE YDE+V
Sbjct  22   FSLSEAGWGEFEIAITLYFHSDVCDKPVNLYHQLRLYPDDESSSYSTKKPVVVEFYDEVV  81

Query  358  LSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSE  179
               PSEAFLAR+ NHP V++PRLPA L LPP  P+ED  +R+RGDTKD+PLSQWF NFSE
Sbjct  82   FPDPSEAFLARLQNHPVVNMPRLPAGLTLPPPIPIEDASKRRRGDTKDNPLSQWFLNFSE  141

Query  178  ADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLK  71
            ADELL+L AARQQVQ HI++L+RQ+S++ GQH+ LK
Sbjct  142  ADELLQLAAARQQVQAHISKLKRQISLIDGQHKQLK  177



>ref|XP_009772041.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X4 [Nicotiana sylvestris]
Length=203

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -1

Query  424  EDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDV  245
            EDESGPLSTKKP+VVESYDEIVL++PSEAF ARV NHPAVSVPRLP  L LPP  P+EDV
Sbjct  81   EDESGPLSTKKPVVVESYDEIVLAEPSEAFFARVQNHPAVSVPRLPPGLNLPPPVPIEDV  140

Query  244  DRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPA  65
            DRRKR D+KDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLS++ GQHQ LKPA
Sbjct  141  DRRKRSDSKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSLIEGQHQQLKPA  200

Query  64   TEF  56
             + 
Sbjct  201  DDL  203


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 5/79 (6%)
 Frame = -1

Query  871  KANSAKKHGADRPDITGPATMSLRTKMIkssddsea---kdsAQKLKGIEISVPIVYGNV  701
            +++S KKH  + PD+TGP   S RTKM+KSSDDS+    +++ +KLK +E+ VPIVYGN+
Sbjct  3    QSSSTKKHVQEPPDVTGPNPKSQRTKMVKSSDDSDKKFVQNTGKKLKELEVGVPIVYGNI  62

Query  700  AFWLGKKASEYQSHKWTLY  644
            AFWLGKKASEY  H   LY
Sbjct  63   AFWLGKKASEY--HHLKLY  79



>gb|KHN11753.1| Protein AF-9 like [Glycine soja]
Length=104

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +KLK +EIS+PIVYGN+A WLGKKASEYQSHKWT+ +RGATNEDLG +IK AVFQLHSSF
Sbjct  14   KKLKDVEISIPIVYGNIAIWLGKKASEYQSHKWTVNVRGATNEDLGTIIKHAVFQLHSSF  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH  479
            NNPTRVV++PPFELSE GWGEFE+AITLYF 
Sbjct  74   NNPTRVVESPPFELSESGWGEFEVAITLYFQ  104



>ref|XP_005844386.1| hypothetical protein CHLNCDRAFT_36861 [Chlorella variabilis]
 gb|EFN52284.1| hypothetical protein CHLNCDRAFT_36861 [Chlorella variabilis]
Length=222

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 128/205 (62%), Gaps = 28/205 (14%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +++KG  I+VP+V G  AF+LGKKASEYQSHKWT+Y+R  +NEDL  V+K+  F LH SF
Sbjct  20   KRMKGRTITVPVVTGTCAFYLGKKASEYQSHKWTVYMRSPSNEDLSHVLKKVTFGLHESF  79

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP R V+ PP+EL+E GWGEF+I +TL+F  D+ + P+ LYH LKLY  D++G  + KK
Sbjct  80   QNPKRDVEFPPYELTETGWGEFDIVVTLHFREDIQEAPVELYHRLKLY--DDTGAANPKK  137

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V+E YDE+V  +P+EAF +R+  H A   P                            
Sbjct  138  PVVLEIYDEVVFWQPTEAFFSRMATHTARPAPPSQ-------------------------  172

Query  211  PLSQWFTNFSEADELLKLTAARQQV  137
             L+Q++T F+   E  ++  ARQ++
Sbjct  173  -LAQFYTAFAPDSEYQRIQRARQRL  196



>gb|KDD76454.1| hypothetical protein H632_c220p1 [Helicosporidium sp. ATCC 50920]
Length=213

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            Q++KG+ IS+P+V G++AF+LGKKA+E+ SH+WT YIR AT ED+  +IK+  F LHSSF
Sbjct  15   QRMKGVSISLPVVTGSIAFYLGKKATEHASHRWTCYIRSATGEDMSHIIKKVQFGLHSSF  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             N  R+V+  PFEL+E GWGEF IA+T++FH+D C               D SG  + K+
Sbjct  75   PNANRMVEYAPFELTEVGWGEFNIAVTVFFHDD-CGTESVELTQHLALY-DSSGGNNAKR  132

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            PI  E +DEIV  +P+EAF  R+  H     P
Sbjct  133  PIASEVFDEIVFYEPTEAFYRRIMGHEPTPAP  164



>ref|XP_003060346.1| YEATS domain-containing protein, partial [Micromonas pusilla 
CCMP1545]
 gb|EEH55115.1| YEATS domain-containing protein, partial [Micromonas pusilla 
CCMP1545]
Length=149

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++KG E+ VPI YG  A+WLGKKA EY SHKWT+Y+RGA +EDL   I++ VF LH SF 
Sbjct  1    RVKGKELVVPICYGTCAYWLGKKADEYHSHKWTVYLRGAEHEDLSHCIEKVVFNLHPSFK  60

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPED-ESGPLST--  398
             P RV++ PP+E++E GWGEFEI +T++F +D  +KPL L   LKLY ED E G   +  
Sbjct  61   EPVRVLEKPPYEVTETGWGEFEIGVTVHFASDAGEKPLELSAPLKLYLEDTEKGKAESKA  120

Query  397  -KKPIVVESYDEIVLSKPSEAFLARVHNH  314
             KKP+V E Y+EIV  +P E F  R+  H
Sbjct  121  AKKPVVKEKYEEIVFHEPREEFAKRIEGH  149



>ref|XP_005832246.1| hypothetical protein GUITHDRAFT_163356 [Guillardia theta CCMP2712]
 gb|EKX45266.1| hypothetical protein GUITHDRAFT_163356 [Guillardia theta CCMP2712]
Length=244

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 113/209 (54%), Gaps = 25/209 (12%)
 Frame = -1

Query  730  ISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVV  551
            ++VP  YG +AFW GK+A EYQ+HKW +Y+RGA NEDL  +I+R +FQLH SFNNPTRV+
Sbjct  33   VTVPFAYGTIAFWQGKRAQEYQTHKWHVYVRGANNEDLTPLIERVIFQLHPSFNNPTRVI  92

Query  550  DAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESY  371
            D  PF + E GWGEFEI I ++FH+         +         E    S KKP+V E +
Sbjct  93   DTAPFHVCELGWGEFEITIRIFFHDGPEQGLEIKHMLKLFPRVGEP---SQKKPVVSERH  149

Query  370  DEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFT  191
            DE V + P+E  L R+                           R   G      +  +F+
Sbjct  150  DEFVFNAPNEGLLQRIGMCNT----------------------RMPNGGPAWATIEPFFS  187

Query  190  NFSEADELLKLTAARQQVQGHIARLRRQL  104
              +E +ELL++ AA+++VQ  I  ++ +L
Sbjct  188  PLNEHEELLRIQAAQRRVQAEITLVKEEL  216



>ref|XP_005651231.1| yeats-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26687.1| yeats-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=206

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 128/217 (59%), Gaps = 28/217 (13%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++L+  E   P+V G  AF+LGKKA+E QSHKW LY+RG + ED+G ++K+ VF LH +F
Sbjct  13   RRLRHKEFVYPVVVGTCAFYLGKKATETQSHKWYLYVRGVSGEDIGHIVKKVVFNLHPTF  72

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NPTR V   PFE+ E GWGEFE+ +TL+F +D  ++P+ +YH LKLY E +    STKK
Sbjct  73   PNPTREVTVHPFEIEEHGWGEFELNVTLHFADDAQEQPVEIYHKLKLYSEVDPTIQSTKK  132

Query  391  PIVVESYDEIVLSKPSEAFLARVHNH-PAVSVPRlpadlalppaapLEDVDRRKRGDTKD  215
            P+V E Y+E++ S+P EAF  RV N+ P V+   +                         
Sbjct  133  PVVNEQYEELIFSEPVEAFYQRVSNYTPPVAFQPV-------------------------  167

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQL  104
              ++  F  +  AD+L K+  ARQ+V   +A  +RQ 
Sbjct  168  --IAPHFRTYEPADDLQKINHARQRVAQLMATTKRQF  202



>gb|AFK47910.1| unknown [Lotus japonicus]
Length=117

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -1

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
            ++TKKP+VVE YDEIV   PSEAFL+RV  HPAV++PRLPA + LPP  P+ED  +R++G
Sbjct  1    MTTKKPVVVELYDEIVFPDPSEAFLSRVQGHPAVNLPRLPAGVTLPPPIPVEDASKRRKG  60

Query  226  DTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            DTKDH L+QWFTNFSEADELL+L AARQ+VQ HIA+LRRQ+S++ GQ Q  K   E
Sbjct  61   DTKDHSLTQWFTNFSEADELLQLAAARQRVQAHIAKLRRQISLIDGQQQQFKSTPE  116



>ref|XP_002505271.1| YEATS domain-containing protein [Micromonas sp. RCC299]
 gb|ACO66529.1| YEATS domain-containing protein [Micromonas sp. RCC299]
Length=215

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 121/222 (55%), Gaps = 29/222 (13%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++ K  E+ VPI YG  A+WLGKKA EY SHKWT+Y+RG  NEDL  VI + VF LH SF
Sbjct  19   KRKKDTELVVPICYGTCAYWLGKKADEYHSHKWTVYLRGPENEDLSHVISKVVFNLHPSF  78

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESG---PLS  401
                R ++ PP+E++E GWGEFEI IT++F +D  +K + L   LKLY E   G      
Sbjct  79   KEAQRTLEKPPYEVTETGWGEFEIGITVHFSDDSGEKSVDLSAPLKLYEESADGKQEKKE  138

Query  400  TKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDT  221
             KKP++ E Y+E+V  +P E+FL RV +H     P       L            KR DT
Sbjct  139  QKKPVIKEKYEEMVFHEPDESFLKRVKSHKTKQAPTTEITPVLG-----------KRDDT  187

Query  220  KDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
                           DELL++  AR+ V   ++ L+ QL  +
Sbjct  188  ---------------DELLRIATARKVVAERVSVLKAQLDAL  214



>ref|XP_011025951.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
isoform X6 [Populus euphratica]
Length=219

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -1

Query  418  ESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDR  239
            ESGP STKKP+VVE+Y+EIV   PSE FLARV NHPAV VPRLPA   LP   P  +++ 
Sbjct  81   ESGPQSTKKPVVVETYNEIVFPDPSENFLARVLNHPAVYVPRLPAGFNLPAPVPSPNMNV  140

Query  238  RKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQHQPLKPATE  59
            + + D K+HPL+ WF NFSEADELLKL +ARQQVQ HI +LRRQLSM+ G  QP K A E
Sbjct  141  KGKYDAKNHPLNHWFINFSEADELLKLASARQQVQAHILKLRRQLSMLDGPPQPSKLAYE  200



>ref|XP_002958730.1| hypothetical protein VOLCADRAFT_84613 [Volvox carteri f. nagariensis]
 gb|EFJ40186.1| hypothetical protein VOLCADRAFT_84613 [Volvox carteri f. nagariensis]
Length=205

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 106/173 (61%), Gaps = 1/173 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++L+  E  +P+V G  A+W+GKKAS+  +H+WT+Y++ A NED+  ++++  F+LH +F
Sbjct  13   RRLRDTEFILPVVVGTCAWWMGKKASDTVTHRWTVYLKSANNEDISHIVQKVTFELHHTF  72

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            NNP RVV  PP+E++E GWGEF+I +TL F  D   +      H     E+ES P +TKK
Sbjct  73   NNPHRVVLQPPYEVTEQGWGEFDINVTLSFTPD-SREKDVSILHRLKLYENESTPNTTKK  131

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRK  233
            P++ E Y+E+V S+P EAF  RV +      P L            E++D+ K
Sbjct  132  PVMSEVYEELVFSEPVEAFFRRVTSTMPRPAPELSCQPYTSQYDEREELDKLK  184



>ref|XP_004367627.1| YEATS family protein [Acanthamoeba castellanii str. Neff]
 gb|ELR22371.1| YEATS family protein [Acanthamoeba castellanii str. Neff]
Length=309

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 100/150 (67%), Gaps = 1/150 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++KG  +  PI+YGN+++WLGKKA + ++H+WT Y+RG  NEDL   IK+ VF LH SF 
Sbjct  72   RVKGALVERPIIYGNISWWLGKKADDTKTHRWTTYVRGPHNEDLSYFIKKVVFTLHPSFP  131

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKP  389
            NP RV++ PP+E++E GWGEFE+ I ++F + +      ++  +   PE   G LSTKKP
Sbjct  132  NPVRVIETPPYEITEHGWGEFELNIKIHFVDPLEVPVDLVHALVLYPPEGNVG-LSTKKP  190

Query  388  IVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            ++ E YDEI    P+E+F   + +H  +SV
Sbjct  191  VIKEIYDEIEFHDPTESFYKILKDHEMMSV  220



>ref|XP_008893122.1| hypothetical protein PPTG_01545 [Phytophthora parasitica INRA-310]
 gb|ETN21320.1| hypothetical protein PPTG_01545 [Phytophthora parasitica INRA-310]
Length=233

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK + +S PI+YG+VA +LG+KA E ++H+W++Y+RGA NEDL  +I + V  LH SF
Sbjct  4    ERLKSVVVSKPILYGSVATYLGRKAEETKTHRWSIYLRGADNEDLSYMISKVVISLHVSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E++E GWGEF+  I +YFH+   ++      H  +     S P STKK
Sbjct  64   ANPVRVLTEPPYEVTELGWGEFDTLIQIYFHD--PNERPISVIHHLVLFPPNSQPASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHP  311
            P+V E YDE+V ++P+E F  ++   P
Sbjct  122  PVVSEFYDELVFNEPTEFFYKKLMAGP  148



>gb|ETI45331.1| hypothetical protein F443_10061 [Phytophthora parasitica P1569]
 gb|ETK85301.1| hypothetical protein L915_09855 [Phytophthora parasitica]
 gb|ETL38720.1| hypothetical protein L916_09762 [Phytophthora parasitica]
 gb|ETL91850.1| hypothetical protein L917_09683 [Phytophthora parasitica]
 gb|ETM45124.1| hypothetical protein L914_09731 [Phytophthora parasitica]
 gb|ETO73973.1| hypothetical protein F444_10159 [Phytophthora parasitica P1976]
 gb|ETP15147.1| hypothetical protein F441_10004 [Phytophthora parasitica CJ01A1]
 gb|ETP43244.1| hypothetical protein F442_09969 [Phytophthora parasitica P10297]
Length=233

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK + +S PI+YG+VA +LG+KA E ++H+W++Y+RGA NEDL  +I + V  LH SF
Sbjct  4    ERLKSVVVSKPILYGSVATYLGRKAEETKTHRWSIYLRGADNEDLSYMISKVVISLHVSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E++E GWGEF+  I +YFH+   ++      H  +     S P STKK
Sbjct  64   ANPVRVLTEPPYEVTELGWGEFDTLIQIYFHD--PNERPISVIHHLVLFPPNSQPASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHP  311
            P+V E YDE+V ++P+E F  ++   P
Sbjct  122  PVVSEFYDELVFNEPTEFFYKKLMAGP  148



>ref|XP_001695345.1| transcription factor IIF [Chlamydomonas reinhardtii]
 gb|EDP01603.1| transcription factor IIF [Chlamydomonas reinhardtii]
Length=206

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 111/216 (51%), Gaps = 27/216 (13%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++L+  E+ VP+V G  A+WLGKKA++  +H+WT+Y R A  EDL  +I +  F+LH +F
Sbjct  13   RRLRDTELVVPVVVGTCAWWLGKKANDSVTHRWTVYFRSANGEDLSHIISKVTFELHHTF  72

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV    P+E++E GWGEF+I ITL F  D  +       H     E ES P +TKK
Sbjct  73   TNPHRVCLQAPYEVTEQGWGEFDINITLTFTPDARE-KDVSIMHRLKLYESESTPNTTKK  131

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P++ E Y+E+V S+P E+F  RV   P                       RR      + 
Sbjct  132  PVMSEVYEELVFSEPVESFYRRVVAEP----------------------QRR----ATEL  165

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQL  104
                W   F E +E+ KL   R +V   +A +R+  
Sbjct  166  SCQAWILTFDEREEVEKLKECRARVAAMVAEVRKDF  201



>ref|XP_009526277.1| hypothetical protein PHYSODRAFT_354558, partial [Phytophthora 
sojae]
 gb|EGZ17219.1| hypothetical protein PHYSODRAFT_354558 [Phytophthora sojae]
Length=225

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = -1

Query  742  KGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNP  563
            K + +S PI+YG+VA +LG+KA E ++H+W++Y+RG  NEDL  +I + V  LH SF NP
Sbjct  7    KNVVVSKPILYGSVATYLGRKAEETKTHRWSIYLRGMDNEDLSYMISKVVISLHVSFANP  66

Query  562  TRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIV  383
             RV+  PP+E++E GWGEFE  I +YFH+    +      HL +     S P STKKP+V
Sbjct  67   VRVLTEPPYEVTELGWGEFETRIQIYFHDPT--ERPISIIHLLVLYPPNSQPASTKKPVV  124

Query  382  VESYDEIVLSKPSEAFLARVHNHPAVSVP  296
             E YDE+V ++P+E F  ++   P    P
Sbjct  125  SEFYDELVFNEPTEFFYKKLMAGPDRQAP  153



>gb|ACU17358.1| unknown [Glycine max]
Length=117

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = -1

Query  856  KKHGADRPDITGPATMSLRTKMIkssddseakdsAQKLKGIEISVPIVYGNVAFWLGKKA  677
            K+ G    D    A    R K+   S+DS+ K++ ++LK +EI VPIVYG +AF+LG+KA
Sbjct  10   KRQGEQSSDDGASAIKPSRLKIAIPSEDSDKKNANRRLKDVEICVPIVYGTIAFYLGRKA  69

Query  676  SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFE  533
            SE QSHKWT+Y+RGA+NEDLGVV+KR VFQLH SFNNPTRVV++PPFE
Sbjct  70   SESQSHKWTVYVRGASNEDLGVVVKRVVFQLHPSFNNPTRVVESPPFE  117



>emb|CCA18213.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=215

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 93/136 (68%), Gaps = 2/136 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++K + +S PI YG++A +LG+K+ E ++H+WT+Y+RG  NEDL  +I +    LHSSF 
Sbjct  5    RMKNVVVSKPIAYGSIATYLGRKSEETKTHRWTIYLRGVENEDLSYMISKVEIHLHSSFA  64

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKP  389
            NP RV   PP+E++E GWGEFE  I ++FH+ +  +      H+ +     + P+STKKP
Sbjct  65   NPIRVFTEPPYEVTELGWGEFETKIHIHFHDSL--EKPVEILHMLVLYPPSTQPISTKKP  122

Query  388  IVVESYDEIVLSKPSE  341
            ++ E+YDE+V ++P++
Sbjct  123  VISENYDELVFNEPTD  138



>ref|XP_008865500.1| hypothetical protein H310_03424 [Aphanomyces invadans]
 gb|ETW05723.1| hypothetical protein H310_03424 [Aphanomyces invadans]
Length=254

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 122/223 (55%), Gaps = 15/223 (7%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++ KG+ +S  I YG+VA +LG+K+ E ++H+W +Y+RG  NEDL  +I + V  LHSSF
Sbjct  4    ERQKGVVVSKAIAYGSVATYLGRKSEETKTHRWHIYVRGIANEDLSYMISKVVISLHSSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E+SE GWGEFE  I ++F +   D+      H+ +     +   STKK
Sbjct  64   ANPVRVLTEPPYEVSEYGWGEFETRIQIHFQDP--DEKPVDKIHMLVLYPPGNQIASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHN----HPAVSVPRlpadlalppaapLEDVDRRKRGD  224
            P+V E YDE+V ++P+E    ++      HP    P     L L       D    K+  
Sbjct  122  PVVSEFYDELVFNEPTEFMYKKLMTGTVLHPLTPCPDRMRFLNLACFKLDHDTGPEKQAP  181

Query  223  TKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
               +PL +++  +SEA +L  L  A        A + R+L+MV
Sbjct  182  P--NPLQEYWPVYSEAQDLKLLADAD-------AFISRELAMV  215



>emb|CCI10060.1| unnamed protein product [Albugo candida]
Length=210

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = -1

Query  745  LKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNN  566
            +K + +S PI YG++A +LG+K+ E ++H+WT+Y+RG  NEDL  +I +    LHSSF N
Sbjct  1    MKNVIVSKPIAYGSIASYLGRKSEETKTHRWTIYLRGIENEDLSYMISKVEIHLHSSFAN  60

Query  565  PTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPI  386
            P RV   PP+E++E GWGEFE  I L+FH+ +  +      H+ +     + P+STKKP+
Sbjct  61   PVRVFTEPPYEVTELGWGEFETKIRLHFHDSL--EKPVEILHMLVLYPPSTQPISTKKPV  118

Query  385  VVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            + E YDE+V  +P++    ++   P  + P
Sbjct  119  ISEYYDELVFHEPTDFSYRKLMAGPDRAAP  148



>ref|XP_007509795.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18910.1| predicted protein [Bathycoccus prasinos]
Length=273

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 97/137 (71%), Gaps = 4/137 (3%)
 Frame = -1

Query  733  EISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRV  554
            E  +PI YG+VA+WLGKKA EY SH+WT+++RG  N D+  V++   FQLH SF  P RV
Sbjct  35   EFILPISYGSVAYWLGKKADEYHSHEWTVFVRGQNNIDVQEVVESVTFQLHPSFAEPKRV  94

Query  553  VDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPE-DE---SGPLSTKKPI  386
            +  PP+E++E GWGEFEI I + F  +V ++   L  +LKL+P+ DE   +GP +TKKP+
Sbjct  95   LTEPPYEVTETGWGEFEIGIEIKFRPEVGEEKEKLMANLKLFPDADEIAKTGPQTTKKPL  154

Query  385  VVESYDEIVLSKPSEAF  335
            VVE+ +E++  KP ++F
Sbjct  155  VVENREELIFHKPRKSF  171



>ref|XP_009035381.1| hypothetical protein AURANDRAFT_6211, partial [Aureococcus anophagefferens]
 gb|EGB09753.1| hypothetical protein AURANDRAFT_6211, partial [Aureococcus anophagefferens]
Length=135

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 3/136 (2%)
 Frame = -1

Query  742  KGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNP  563
            K   +  P+VYG+VAFWLG+KA EY +HKWTL++RG   EDLG  +++ VF+LH SF  P
Sbjct  3    KNTAVCCPLVYGSVAFWLGRKADEYHTHKWTLFVRGPHGEDLGYFVEKVVFKLHPSFAQP  62

Query  562  TRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIV  383
             R +  PP+E++E GWGEFE ++ ++F +        +     +   D + P    +P+V
Sbjct  63   VREIHEPPYEVTEKGWGEFEASVRVHFRD---PSERPVEFSHVVKLYDGTTPQVATQPVV  119

Query  382  VESYDEIVLSKPSEAF  335
             E YDE+V ++P EA 
Sbjct  120  SEVYDEVVFTEPHEAL  135



>gb|KHN05303.1| hypothetical protein glysoja_048995 [Glycine soja]
Length=125

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  424  EDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDV  245
            EDE GP S KKP+VVESY+EIV  +PSE FLARV NHPAV+VPRLPA L L  + P + V
Sbjct  17   EDEYGPQSMKKPVVVESYNEIVFPEPSEVFLARVQNHPAVNVPRLPAGLNLSCSVPSDVV  76

Query  244  DRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQV  137
            +  +RGDTKDHPL+QWF NFSE DE+LKL AARQQV
Sbjct  77   NDMERGDTKDHPLTQWFLNFSEDDEILKLAAARQQV  112



>ref|XP_006582646.1| PREDICTED: transcription initiation factor TFIID subunit 14b-like 
[Glycine max]
Length=123

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = -1

Query  424  EDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDV  245
            EDE GP S KKP+VVESY+EIV  +PSE FLARV NHPAV+VPRLPA L L  + P + V
Sbjct  17   EDEYGPQSMKKPVVVESYNEIVFPEPSEVFLARVQNHPAVNVPRLPAGLNLSCSVPSDVV  76

Query  244  DRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIA  122
            +  +RGDTKDHPL+QWF NFSE DE+LKL AARQQ+  + A
Sbjct  77   NDMERGDTKDHPLTQWFLNFSEDDEILKLAAARQQMLCYSA  117



>ref|XP_002184079.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44257.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=152

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 91/152 (60%), Gaps = 5/152 (3%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++++     +PIVYG+VAF+LGKKA EY +H+WTL++RG  NEDL  VI + VF LH SF
Sbjct  1    RRMEHTTACLPIVYGSVAFYLGKKADEYNTHQWTLHLRGPNNEDLSPVISKVVFHLHPSF  60

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHN--DVCDkplhlyhhlklyPEDESGPLST  398
              PTR +  PP+E++E GWGEFE  + + + +  +      H            + P  T
Sbjct  61   AQPTRELTEPPYEVTERGWGEFEAQVRIVWKDSSERPILISHGIKLYPPGTAPNAAPTDT  120

Query  397  KKPIVVESYDEIVLSKPSEAF---LARVHNHP  311
            +  +V ESYDE+V + PSE F   L RV N P
Sbjct  121  ETAVVAESYDEVVFTDPSETFYTQLLRVANLP  152



>ref|XP_008865501.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETW05724.1| hypothetical protein, variant [Aphanomyces invadans]
Length=226

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 116/219 (53%), Gaps = 35/219 (16%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++ KG+ +S  I YG+VA +LG+K+ E ++H+W +Y+RG  NEDL  +I + V  LHSSF
Sbjct  4    ERQKGVVVSKAIAYGSVATYLGRKSEETKTHRWHIYVRGIANEDLSYMISKVVISLHSSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E+SE GWGEFE  I ++F +   D+      H+ +     +   STKK
Sbjct  64   ANPVRVLTEPPYEVSEYGWGEFETRIQIHFQD--PDEKPVDKIHMLVLYPPGNQIASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
            P+V E YDE+V ++P+E    ++   P    P                           +
Sbjct  122  PVVSEFYDELVFNEPTEFMYKKLMTGPEKQAP--------------------------PN  155

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
            PL +++  +SEA +L  L  A        A + R+L+MV
Sbjct  156  PLQEYWPVYSEAQDLKLLADAD-------AFISRELAMV  187



>gb|EPB87916.1| hypothetical protein HMPREF1544_05323 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=211

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 133/222 (60%), Gaps = 24/222 (11%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWL-GKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHS  578
            +++KGI +S P  YG++A+ L GKKAS+   +HKWT+ ++G  NEDL   IK+ VF+LH 
Sbjct  6    KRIKGISVSRPFYYGSIAYPLNGKKASDADHTHKWTVMVKGLDNEDLSYYIKKVVFKLHE  65

Query  577  SFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlkl--yPEDESG-P  407
            ++ NP R V+ PPFE+SE GWGEFEI I ++F N V +KP+ LYHHL+L  Y +D +G P
Sbjct  66   TYPNPLRSVEQPPFEVSETGWGEFEIMIKIHFQNVVSEKPVVLYHHLRLHPYEDDVNGQP  125

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
                KP++   YDE+V ++P+E+      +H A++V                ++  +K  
Sbjct  126  WPKDKPVMSLLYDELVFNEPTESLYQVFADHNALNV----------------NLPNKKTI  169

Query  226  DTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLS  101
                 PL   F+   E +E ++L  A  ++   IA L++++S
Sbjct  170  KDPSLPL---FSTQLEQEENVRLDNALDEIHSQIATLQQKIS  208



>ref|XP_002907902.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY60985.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=344

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 93/144 (65%), Gaps = 5/144 (3%)
 Frame = -1

Query  742  KGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNP  563
            K + +S PI+YG+VA +LG+KA E ++H+W++Y+RG  NEDL  +I + V  LH SF NP
Sbjct  7    KNVVVSKPILYGSVATYLGRKAEETKTHRWSIYLRGVDNEDLSYMISKVVISLHVSFANP  66

Query  562  TRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIV  383
             R    PP+E++E GWGEFE  I +YFH+   ++      HL +     S P STKKP+V
Sbjct  67   VR---EPPYEVTELGWGEFETRIQIYFHDP--NERPISIIHLLVLYPPNSQPASTKKPVV  121

Query  382  VESYDEIVLSKPSEAFLARVHNHP  311
             E YDE+V ++P+E F  ++   P
Sbjct  122  SEFYDELVFNEPTEFFYKKLMAGP  145



>ref|XP_009823837.1| hypothetical protein H257_02048 [Aphanomyces astaci]
 gb|ETV87038.1| hypothetical protein H257_02048 [Aphanomyces astaci]
Length=229

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 94/152 (62%), Gaps = 2/152 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++ KG+ +S  I YG+VA +LG+K+ E ++H+W +Y+RG  NEDL  +I + V  LHSSF
Sbjct  4    ERQKGVVVSKAIAYGSVATYLGRKSEETKTHRWHIYVRGIENEDLSYMISKVVISLHSSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E+SE GWGEFE  I ++F +   D+      H+ +     +   STKK
Sbjct  64   ANPVRVLTEPPYEVSEYGWGEFETRIQIHFQD--PDEKPVDKIHMLVLYPPGNQIASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            P+V E YDE+V ++P+E    ++   P    P
Sbjct  122  PVVSEFYDELVFNEPTEFMYKKLMTGPEKQAP  153



>gb|KDO34285.1| hypothetical protein SPRG_19102 [Saprolegnia parasitica CBS 223.65]
Length=224

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 93/152 (61%), Gaps = 2/152 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++ KG+ +S  I YG+VA +LG+K+ E ++H+W +Y+RG   EDL  +I + V  LH+SF
Sbjct  4    ERQKGVVVSKAIAYGSVAMYLGRKSEETKTHRWHIYVRGLAGEDLSYMISKVVISLHNSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E+SE GWGEFE  I ++F +   D+      H+ +     +   STKK
Sbjct  64   ANPVRVLTEPPYEVSEYGWGEFETKIQIHFQD--PDEKPVDIIHMLILYPPGNQIASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            P+V E YDE+V ++PSE    ++   P    P
Sbjct  122  PVVSEFYDELVFNEPSELMYKKLMAGPEKQAP  153



>ref|XP_008621452.1| hypothetical protein SDRG_16997 [Saprolegnia diclina VS20]
 gb|EQC25118.1| hypothetical protein SDRG_16997 [Saprolegnia diclina VS20]
Length=224

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 93/152 (61%), Gaps = 2/152 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++ KG+ +S  I YG+VA +LG+K+ E ++H+W +Y+RG   EDL  +I + V  LH+SF
Sbjct  4    ERQKGVVVSKAIAYGSVAMYLGRKSEETKTHRWHIYVRGLAGEDLSYMISKVVISLHNSF  63

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E+SE GWGEFE  I ++F +   D+      H+ +     +   STKK
Sbjct  64   ANPVRVLTEPPYEVSEYGWGEFETKIQIHFQD--PDEKPVDIIHMLILYPPGNQIASTKK  121

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            P+V E YDE+V ++PSE    ++   P    P
Sbjct  122  PVVSEFYDELVFNEPSELMYKKLMAGPEKQAP  153



>ref|XP_001423790.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK56392.1| unnamed protein product [Paramecium tetraurelia]
Length=234

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 85/142 (60%), Gaps = 1/142 (1%)
 Frame = -1

Query  736  IEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTR  557
            ++I+ PI+YG +A WLG+++ E ++H W  Y+RGA NEDL   I + +F LHSSF N  R
Sbjct  1    MQIAKPIIYGTIATWLGRRSDEKKTHSWICYVRGANNEDLSYFIDKVIFVLHSSFENTNR  60

Query  556  VVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVE  377
            VV   PF ++E GWG+F+I I +Y   D     + ++       + ++ PL TKKP+V E
Sbjct  61   VVSQHPFVIAETGWGQFDIIIKVYLKGDYDQPLIAVHPLKLYQNQTQNIPL-TKKPVVSE  119

Query  376  SYDEIVLSKPSEAFLARVHNHP  311
             YDEIV   P    L  ++  P
Sbjct  120  QYDEIVFINPKPELLEILNAKP  141



>ref|XP_005703056.1| YEATS domain-containing protein 4 [Galdieria sulphuraria]
 gb|EME26536.1| YEATS domain-containing protein 4 [Galdieria sulphuraria]
Length=218

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 2/150 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            + KG  ++VP++ G++AFWLG +A E+ SH+WT YIRG  NEDL   I+   F LH SF+
Sbjct  10   RTKGATVAVPVIQGSIAFWLGPEADEWHSHRWTAYIRGPKNEDLSYFIRYVEFHLHESFH  69

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKP  389
               RVV  PPFEL+E GWGEF++ I L+F +++      ++         +    S ++P
Sbjct  70   PSKRVVTRPPFELTETGWGEFDLIIRLFFIDNLESPIELVHPLRLFPNPPKDQ--SVEEP  127

Query  388  IVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            +V E Y+E+V   P E  LA +   P  +V
Sbjct  128  VVNEYYEELVFQDPPEELLAILRMGPQRTV  157



>emb|CBJ32065.1| conserved unknown protein [Ectocarpus siliculosus]
Length=242

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 112/207 (54%), Gaps = 27/207 (13%)
 Frame = -1

Query  742  KGIEISVPIVYGNVAFWLG-KKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNN  566
            KG+ ++ PI YG++AF L  KK SE+ +HKWTL++RG   ED+   + + VF LH SF  
Sbjct  17   KGLSVACPIAYGSLAFLLERKKQSEFVTHKWTLFVRGPNGEDISYFVSKVVFTLHPSFAE  76

Query  565  PTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPI  386
             TR + +PPFE++E GWGEFE  +T++F  D  +KP+ + H L+LY +  +G    KK +
Sbjct  77   ATREITSPPFEVTEMGWGEFEAKMTMHF-KDPNEKPVDVLHQLRLYHDPATGTTQPKKAV  135

Query  385  VVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPL  206
            V E YDE+V + P E F   +                         +  +K    + H  
Sbjct  136  VAEFYDEVVFTDPYEEFYNTL-------------------------MQGQKLLPQRKHEH  170

Query  205  SQWFTNFSEADELLKLTAARQQVQGHI  125
             + F+ FS+ D L +L AAR+ V   +
Sbjct  171  QEHFSTFSDGDTLQRLAAAREWVHNQL  197



>emb|CEG63855.1| hypothetical protein RMATCC62417_00931 [Rhizopus microsporus]
 emb|CEI98009.1| hypothetical protein RMCBS344292_12127 [Rhizopus microsporus]
Length=210

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 129/222 (58%), Gaps = 24/222 (11%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWL-GKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHS  578
            ++LKG+ +S P  YG++A+ L GKK ++   +H+WT+ ++G  NEDL  +IK+ VF+LH 
Sbjct  5    KRLKGVVVSRPFYYGSIAYSLNGKKVADPDHTHRWTVMVKGINNEDLSYLIKKVVFKLHE  64

Query  577  SFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlkl--yPEDESG-P  407
            ++ NP R V+ PPFE+SE GWGEFEI I +YFH    +K + LYHHL+L  Y +D +G P
Sbjct  65   TYPNPLRTVEQPPFEVSETGWGEFEIMIKIYFHQHTGEKQVILYHHLRLHPYEDDLNGQP  124

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
                KP++   YDE V ++P+E        H A++                   +   + 
Sbjct  125  WPKDKPVMSLLYDEFVFNEPTEQLYQLFSEHNALT------------------PNLPLKK  166

Query  226  DTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLS  101
             +KD  + ++     E +E+ +L  A++++   IA L+++L+
Sbjct  167  TSKDITMPEFSVQLEE-EEMKRLDKAQREIDSQIASLKQKLA  207



>emb|CEI89760.1| hypothetical protein RMCBS344292_04108 [Rhizopus microsporus]
Length=210

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 130/224 (58%), Gaps = 24/224 (11%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWL-GKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHS  578
            ++LKG+ +S P  YG++A+ L GKK ++   +H+WT+ ++G  NEDL  +IK+ VF+LH 
Sbjct  5    KRLKGVVVSRPFYYGSIAYSLNGKKVADPDHTHRWTVMVKGINNEDLSYLIKKVVFKLHE  64

Query  577  SFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlkl--yPEDESG-P  407
            ++ NP R V+ PPFE+SE GWGEFEI I +YFH    +K + LYHHL+L  Y +D +G P
Sbjct  65   TYPNPLRTVEQPPFEVSETGWGEFEIMIKIYFHQHTGEKQVILYHHLRLHPYEDDLNGQP  124

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
                KP++   YDE V ++P+E        H A++                   +   + 
Sbjct  125  WPKDKPVMSLLYDEFVFNEPTEQLYQLFSEHNALT------------------PNLPLKK  166

Query  226  DTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
             +KD  + ++     E +E+ +L  A++++   IA L+++L+ +
Sbjct  167  TSKDITIPEFSVQLEE-EEMKRLDKAQKEIDSQIASLKQKLAAL  209



>emb|CEG78079.1| hypothetical protein RMATCC62417_12736 [Rhizopus microsporus]
Length=210

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/224 (35%), Positives = 130/224 (58%), Gaps = 24/224 (11%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWL-GKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHS  578
            ++LKG+ +S P  YG++A+ L GKK ++   +H+WT+ ++G  NEDL  +IK+ VF+LH 
Sbjct  5    KRLKGVVVSRPFYYGSIAYSLNGKKVADPDHTHRWTVMVKGINNEDLSYLIKKVVFKLHE  64

Query  577  SFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlkl--yPEDESG-P  407
            ++ NP R V+ PPFE+SE GWGEFEI I +YFH    +K + LYHHL+L  Y +D +G P
Sbjct  65   TYPNPLRTVEQPPFEVSETGWGEFEIMIKIYFHQHTGEKQVILYHHLRLHPYEDDLNGQP  124

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
                KP++   YDE V ++P+E        H A++                   +   + 
Sbjct  125  WPKDKPVMSLLYDEFVFNEPTEQLYQLFSEHNALT------------------PNLPLKK  166

Query  226  DTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
             +KD  + ++     E +E+ +L  A++++   IA L+++L+ +
Sbjct  167  TSKDITIPEFSVQLEE-EEMKRLDKAQREIDSQIATLKQKLAAL  209



>ref|XP_005109184.1| PREDICTED: YEATS domain-containing protein 4-like [Aplysia californica]
Length=226

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 94/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ +  P+VYGN+A + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  11   RLKGVTVVKPVVYGNIARYFGKKREEDGHTHQWTVYVKPYKNEDMSAYVKKINFKLHDSY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RVV  PP+E++E GWGEFEI I +YF ND  +      +HL    + E+  +  KK
Sbjct  71   PNPNRVVTKPPYEVTETGWGEFEIIIKIYF-NDPAE-RPVTIYHLLKLFQSETDVMLGKK  128

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
             +VVE YDE+V   P+ A  + + N  ++ +
Sbjct  129  SLVVEYYDEMVFQDPTTAMNSMLANTTSLGI  159



>gb|EXX57078.1| Yaf9p [Rhizophagus irregularis DAOM 197198w]
Length=218

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 123/219 (56%), Gaps = 9/219 (4%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKA--SEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHS  578
            ++ KG+ +  PIVYGNVA  L +K       +HKWT+ +RG  NED+   +K+  F+LH 
Sbjct  4    KRTKGVTVVRPIVYGNVATLLPQKKIPDSDHTHKWTVSVRGLNNEDISFFVKKVTFKLHE  63

Query  577  SFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLST  398
            ++ NP RV++ PPFEL+E GWGEFE+ + L F  +  +KP+ LYH+L+L+P +E G +ST
Sbjct  64   TYANPQRVIEHPPFELTETGWGEFELTMKLQFVPESGEKPVTLYHNLRLHPYEEDGSIST  123

Query  397  ---KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
                KP+    YDE+V ++P+E   +    HP+  +P               D  R+   
Sbjct  124  ANKNKPVQSFQYDELVFTEPTEYLHSLFLQHPSAGLPPRSTPTNPYSVQAEVDEIRKIEE  183

Query  226  DTKDHPLSQWFTNFSEADELLKLTAARQQVQGHIARLRR  110
             TK   + +  T +   ++L K T     V+G + R+++
Sbjct  184  ATKK--VQEQLTIYK--NKLEKTTKELDDVKGELERIKK  218



>ref|XP_001452404.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK85007.1| unnamed protein product [Paramecium tetraurelia]
Length=234

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 84/143 (59%), Gaps = 1/143 (1%)
 Frame = -1

Query  736  IEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTR  557
            ++IS  I+YG +A WLG+++ E ++H W  Y+RGA NEDL   I + VF LHSSF N  R
Sbjct  1    MQISKAIIYGTIATWLGRRSDEKKTHSWICYVRGAHNEDLSYFIDKVVFVLHSSFENTNR  60

Query  556  VVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVE  377
            VV   PF ++E GWG+F+I I +Y   D     + ++       + ++ PL T+KP+V E
Sbjct  61   VVSQHPFVIAETGWGQFDIIIKIYLKGDYDQPLVTVHPLKLYQNQTQNIPL-TRKPVVSE  119

Query  376  SYDEIVLSKPSEAFLARVHNHPA  308
             YDEIV   P    L  ++  P 
Sbjct  120  QYDEIVFINPKPELLEILNAKPT  142



>gb|KFH68141.1| YEATS domain-containing protein 4 [Mortierella verticillata NRRL 
6337]
Length=207

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 100/154 (65%), Gaps = 2/154 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWL-GKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHS  578
            +++K I +S PI+YGN A  L GKK ++   +H+WT+ +RG  NED+   IK+  F+LH 
Sbjct  5    KRMKNIAVSRPIIYGNSATPLNGKKVTDPDHTHRWTISVRGVNNEDISYFIKKVAFKLHD  64

Query  577  SFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLST  398
            ++ NP RV++ PPFE+SE GWGEF++ I L+FH    +KP  LYHHLKL+P +E G    
Sbjct  65   TYENPNRVIEKPPFEVSETGWGEFDVIIKLHFHPVSGEKPQTLYHHLKLHPYEEDGLGIK  124

Query  397  KKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
             KP+    YDEIV ++P + F   +  +   SVP
Sbjct  125  SKPVTSYLYDEIVFNEPVDTFYQVLQENSTSSVP  158



>ref|XP_009054020.1| hypothetical protein LOTGIDRAFT_203873 [Lottia gigantea]
 gb|ESO95518.1| hypothetical protein LOTGIDRAFT_203873 [Lottia gigantea]
Length=233

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 90/139 (65%), Gaps = 1/139 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ +  PIVYGN+A + GKK  E   +H+WT+Y++   NED+ + +KR  F+LH S+
Sbjct  14   RIKGLTVVKPIVYGNLARYFGKKREEDGHTHQWTVYVKPYKNEDMSIYVKRVSFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP R+V  PP+E++E GWGEFEI + ++F++   ++    ++HL    + E+  +  KK
Sbjct  74   PNPNRIVTKPPYEVTETGWGEFEIIVKIFFNDPNGNERPVTFYHLLKLFQSETDIMLGKK  133

Query  391  PIVVESYDEIVLSKPSEAF  335
             +V E YDE+V   P+ A 
Sbjct  134  SLVAELYDELVFQDPTPAM  152



>ref|XP_003959402.1| hypothetical protein KAFR_0J02030 [Kazachstania africana CBS 
2517]
 emb|CCF60267.1| hypothetical protein KAFR_0J02030 [Kazachstania africana CBS 
2517]
Length=209

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGK----KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQL  584
            +++K + +S PI+YGN A  +G+     A    +H WT+++RG  NED+   +K+ VF+L
Sbjct  7    KRIKTLSVSRPIIYGNTAKKMGEIKPPNAPAEHTHLWTIFVRGPNNEDISYYVKKVVFKL  66

Query  583  HSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPL  404
            H ++NNPTR+++APPFEL+E GWGEF+I + +YFH D  ++    ++H       E+G  
Sbjct  67   HDTYNNPTRIIEAPPFELTETGWGEFDINVKIYFH-DEANEKNLNFYHRLRLHPYEAG-Q  124

Query  403  STKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            S    I    +DE+V ++P+E+F   +   P   +P
Sbjct  125  SKDDEISSIFFDEVVFNEPNESFFKILMTKPGNLLP  160



>ref|XP_011065633.1| PREDICTED: YEATS domain-containing protein 4 [Acromyrmex echinatior]
 gb|EGI58535.1| YEATS domain-containing protein 4 [Acromyrmex echinatior]
Length=227

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RIKGVTIIKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYNNEDMSTYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R+V  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  74   NNPNRIVTKPPYELTETGWGEFEIVIKIYFHDPNERPVTVYHILKLFQSTPEIQLG----  129

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  130  KKSLVSEFYEEIVFQDPT  147



>emb|CEG00603.1| YEATS [Ostreococcus tauri]
Length=204

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/212 (33%), Positives = 107/212 (50%), Gaps = 30/212 (14%)
 Frame = -1

Query  718  IVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPP  539
            ++ G +A++LGKKA EY SH+WT+Y+RG   EDL   ++   F LH SF+ PTR ++  P
Sbjct  12   VIVGTIAYYLGKKADEYHSHRWTVYVRGVDGEDLSRCVRAVTFALHPSFDEPTRRLEHAP  71

Query  538  FELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDES----GPLSTKKPIVVESY  371
            +E++E GWGEF+I + + F  D     +     LKL+P  E     G  +TKKP++ E Y
Sbjct  72   YEVTETGWGEFDIGVKIEFTEDSGAGFVETTTPLKLFPSAEEIAKHGQQTTKKPLIKERY  131

Query  370  DEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFT  191
            +EIV  +    F  R+    A   P+   D                            + 
Sbjct  132  EEIVFHECESGFYKRMKGQAAKKAPKSEHDAV--------------------------WG  165

Query  190  NFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
            +F E  EL+ + AAR+  +  I  L++QL ++
Sbjct  166  SFKEKPELVSIYAAREVTRERIKVLKQQLEVL  197



>ref|XP_396159.2| PREDICTED: YEATS domain-containing protein 4 isoform X2 [Apis 
mellifera]
Length=230

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  17   RVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYLNEDMSTYVKKVHFKLHESY  76

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R++  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  77   NNPNRIMTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----  132

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  133  KKSLVSEFYEEIVFQDPT  150



>ref|XP_006621607.1| PREDICTED: YEATS domain-containing protein 4-like isoform X1 
[Apis dorsata]
Length=230

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  17   RVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYLNEDMSTYVKKVHFKLHESY  76

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R++  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  77   NNPNRIMTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----  132

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  133  KKSLVSEFYEEIVFQDPT  150



>ref|XP_004350973.1| hypothetical protein DFA_12034 [Dictyostelium fasciculatum]
 gb|EGG14264.1| hypothetical protein DFA_12034 [Dictyostelium fasciculatum]
Length=262

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 108/223 (48%), Gaps = 31/223 (14%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHSS  575
            +K+KG      IV G+++ WLGKKA  +  +HKWT Y+RG  NEDL   IK+ VF LH+S
Sbjct  3    KKVKG-RFERSIVVGSISHWLGKKADGHTHTHKWTAYLRGLNNEDLPF-IKKVVFHLHAS  60

Query  574  FNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTK  395
            F NP R V+ PP+E+SE GWGEF++ +T+YF     D          L        + TK
Sbjct  61   FKNPNRTVEVPPYEMSETGWGEFDLGVTIYF----TDPNEKPLDLFHLLRLHPPDGIKTK  116

Query  394  KPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKD  215
            +P+V E+ D +V   P+EAF      +  V +P                 D+R   +   
Sbjct  117  QPVVSETLDVVVFHDPTEAF------YNLVKLP-----------------DKRPESNASK  153

Query  214  HPLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQLSMVGGQ  86
                Q  T   E  E+ K+   R +V   IA+ R       G+
Sbjct  154  KLTEQSLT-LQEQTEINKIVDGRTKVLADIAKYRDSCKQTEGE  195



>ref|XP_001605429.2| PREDICTED: YEATS domain-containing protein 4 [Nasonia vitripennis]
Length=227

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG  I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RIKGTTIIKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYHNEDMSAYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R+V  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  74   NNPNRIVTKPPYELTETGWGEFEIVIKVYFHDPNERPVTIYHILKLFQTPPEVQIG----  129

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E YDEI+   PS
Sbjct  130  KKNLVSEFYDEIIFQDPS  147



>ref|NP_985323.1| AFL227Cp [Ashbya gossypii ATCC 10895]
 sp|Q755P0.1|AF9_ASHGO RecName: Full=Protein AF-9 homolog [Ashbya gossypii ATCC 10895]
 gb|AAS53147.1| AFL227Cp [Ashbya gossypii ATCC 10895]
 gb|AEY97457.1| FAFL227Cp [Ashbya gossypii FDAG1]
Length=208

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 109/181 (60%), Gaps = 6/181 (3%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKK----ASEYQSHKWTLYIRGATNEDLGVVIKRAVFQL  584
            +++K + ++ PIVYGN A  +G      A    +H WT+++RG   ED+   IK+ VF+L
Sbjct  7    KRIKTLSVARPIVYGNTAKKMGDVRPAIAPSEHTHMWTIFVRGPQGEDISYFIKKVVFKL  66

Query  583  HSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlkly-PEDESGP  407
            H ++ NP RVVDAPPFEL+E GWGEFEI + ++F ++  +K L+ YHHL+L+   +E G 
Sbjct  67   HETYPNPVRVVDAPPFELTETGWGEFEINVKVHFVDEANEKMLNFYHHLRLHPYTEEDGR  126

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpa-dlalppaapLEDVDRRKR  230
             S    +    YDEIV ++P+EAF A++   P   +P     D         E++DR ++
Sbjct  127  RSDGDEVSSVFYDEIVFNEPNEAFFAKMIEQPGNLLPSNKTPDCVFSLQLEQEEIDRIQQ  186

Query  229  G  227
            G
Sbjct  187  G  187



>ref|XP_004930356.1| PREDICTED: YEATS domain-containing protein 4-like isoform X1 
[Bombyx mori]
Length=230

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 2/138 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGN+A + GKK  E   +H+WT+Y++   NED+   IK+  F+LH S+
Sbjct  14   RVKGLTIVKPIVYGNIARYFGKKREEDGHTHQWTVYVKPYANEDMSTYIKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHN-DVCDkplhlyhhlklyPEDESGPLSTK  395
             NP R+V  PP+EL E GWGEFEI I LYFH+ +     L+    L   P  E  P +  
Sbjct  74   ANPNRIVTKPPYELMETGWGEFEIVIKLYFHDPNERPLTLYHILKLFQSPVTEGTPPTFG  133

Query  394  KPIVVESYDEIVLSKPSE  341
              +V ESY+EIV  +P++
Sbjct  134  HALVSESYEEIVFQEPTQ  151



>ref|XP_003691941.1| PREDICTED: YEATS domain-containing protein 4-like [Apis florea]
Length=230

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  17   RVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKVHFKLHESY  76

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R++  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  77   NNPNRIMTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----  132

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  133  KKSLVSEFYEEIVFQDPT  150



>ref|XP_003083940.1| putative TAF14b (ISS) [Ostreococcus tauri]
Length=277

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 107/212 (50%), Gaps = 30/212 (14%)
 Frame = -1

Query  718  IVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPP  539
            ++ G +A++LGKKA EY SH+WT+Y+RG   EDL   ++   F LH SF+ PTR ++  P
Sbjct  85   VIVGTIAYYLGKKADEYHSHRWTVYVRGVDGEDLSRCVRAVTFALHPSFDEPTRRLEHAP  144

Query  538  FELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDES----GPLSTKKPIVVESY  371
            +E++E GWGEF+I + + F  D     +     LKL+P  E     G  +TKKP++ E Y
Sbjct  145  YEVTETGWGEFDIGVKIEFTEDSGAGFVETTTPLKLFPSAEEIAKHGQQTTKKPLIKERY  204

Query  370  DEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFT  191
            +EIV  +    F  R+    A   P                         K    + W  
Sbjct  205  EEIVFHECESGFYKRMKGQAAKKAP-------------------------KSEHDAVW-G  238

Query  190  NFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
            +F E  EL+ + AAR+  +  I  L++QL ++
Sbjct  239  SFKEKPELVSIYAAREVTRERIKVLKQQLEVL  270



>ref|XP_003700619.1| PREDICTED: YEATS domain-containing protein 4-like [Megachile 
rotundata]
Length=228

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  15   RVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKVHFKLHESY  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R++  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  75   NNPNRIMTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----  130

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  131  KKSLVSEFYEEIVFQDPT  148



>ref|XP_001421897.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00191.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=194

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 104/213 (49%), Gaps = 31/213 (15%)
 Frame = -1

Query  718  IVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPP  539
            ++ G +A +LGK+A EY SH+WT+Y+RG   EDL   ++   F LH SF+ PTRV+   P
Sbjct  1    MIVGTIAHYLGKRADEYHSHRWTVYVRGLDGEDLSHCVESVEFALHPSFDEPTRVLTQAP  60

Query  538  FELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPED-----ESGPLSTKKPIVVES  374
            +E++E GWGEF+I + + F +D  +                      GP +TKKP++ E 
Sbjct  61   YEVTETGWGEFDIGVKITFSSDCGEARTVTTTTPLKLFPSAEEIARHGPQTTKKPLIKER  120

Query  373  YDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWF  194
            Y+EIV  +    F  R+ +H     P+   D A                          +
Sbjct  121  YEEIVFHECDGGFYKRMKSHAWKRAPKSAHDDA--------------------------W  154

Query  193  TNFSEADELLKLTAARQQVQGHIARLRRQLSMV  95
            ++F +  EL+ + AAR+  +  I  L +QL ++
Sbjct  155  SSFKDKPELVGIYAAREVTKERIKILEQQLEVL  187



>gb|EFZ20235.1| hypothetical protein SINV_09145 [Solenopsis invicta]
Length=227

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNV+ + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RVKGVTIVKPIVYGNVSRYFGKKREEDGHTHQWTVYVKPYNNEDMSSYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R+V  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  74   NNPNRIVTKPPYELTETGWGEFEIVIKIYFHDPNERPVTVYHILKLFQSTPELQLG----  129

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  130  KKSLVSEFYEEIVFQDPT  147



>ref|XP_005181237.1| PREDICTED: YEATS domain-containing protein 4-like [Musca domestica]
Length=233

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 91/152 (60%), Gaps = 9/152 (6%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ V +K+  F+LH S+
Sbjct  17   RVKGLTIVKPIVYGNIARSFGKKREEDGHTHQWKVYVKPYHNEDMSVYVKKVHFKLHESY  76

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPEDESGP  407
             NP R+V  PP+E++E GWGEFE+ I +YFH+       C   L L+    +  E  +  
Sbjct  77   ANPNRIVTKPPYEITETGWGEFEVVIKIYFHDPTERPVTCYHILKLFQSPIVDGELSATT  136

Query  406  LSTKKPIVVESYDEIVLSKPSEA---FLARVH  320
            +  KK +V ESY+EIV  +P++    FL  V 
Sbjct  137  MDPKKGLVSESYEEIVFQEPTQLMQHFLMNVQ  168



>ref|XP_002129300.1| PREDICTED: YEATS domain-containing protein 4-like [Ciona intestinalis]
Length=233

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 115/216 (53%), Gaps = 29/216 (13%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGN A + GKK  E   +H WT+Y++   NED+ V +K+  F+LH S+
Sbjct  16   RVKGVCIIKPIVYGNSARYFGKKREEDGHTHTWTVYLKPYHNEDMSVYVKKIQFKLHESY  75

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RVV  PP+E++E GWGEFEI I ++FH D  D+PL +YH L+L+  + +  +  KK
Sbjct  76   ANPIRVVTKPPYEVTETGWGEFEIVIKIFFH-DPNDRPLTIYHGLRLFQTENNIIVGNKK  134

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDH  212
             ++ E YDE+V   PS         H  ++  R     A       E+            
Sbjct  135  AVISEFYDEMVFQDPSTMM------HSLLTSNRQLTLGAHKHETDFEE------------  176

Query  211  PLSQWFTNFSEADELLKLTAARQQVQGHIARLRRQL  104
                      EA  L +L +A+Q++Q  +  L+ +L
Sbjct  177  ---------KEATTLAQLQSAKQKIQNEVEELKERL  203



>gb|KFM59185.1| YEATS domain-containing protein 4, partial [Stegodyphus mimosarum]
Length=240

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 90/149 (60%), Gaps = 2/149 (1%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKK-ASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+++  PIVYGNVA++LGKK   +  +H+WT+Y++   N+D+ V +KR  F+LH S+
Sbjct  36   RLKGVQVVKPIVYGNVAWYLGKKREDDGHTHQWTVYLKPYDNDDMSVYVKRVHFKLHESY  95

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
            ++P RV  APP+ ++E GWGEFEI I ++F +         +       E +        
Sbjct  96   SDPNRVFHAPPYSITETGWGEFEIVIKIFFQDSNERPVTIYHFLKLFDREKDGNVKMGTV  155

Query  391  PIVVESYDEIVLSKPSEAFLARVHNHPAV  305
            P+  ESYDE+V   P+   + R+ +HP +
Sbjct  156  PVNSESYDELVFMDPT-VKMHRLLSHPKL  183



>ref|XP_003286649.1| hypothetical protein DICPUDRAFT_150634 [Dictyostelium purpureum]
 gb|EGC36851.1| hypothetical protein DICPUDRAFT_150634 [Dictyostelium purpureum]
Length=317

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHSS  575
            +K++G E   PIV G+++ WLGKK      +H+WT Y+RG  NEDL   IKR VF LHSS
Sbjct  5    KKVRG-EFERPIVVGSISNWLGKKGDGLTHTHRWTAYLRGMNNEDLPF-IKRVVFHLHSS  62

Query  574  FNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTK  395
            F NP RVV+ PP+E+SE GWGEF++ ITL+F +   ++      HL      E     TK
Sbjct  63   FKNPNRVVETPPYEISETGWGEFDLKITLHFTD--PNEKSIELFHLLRLHPPEGVNTKTK  120

Query  394  KPIVVESYDEIVLSKPSEAF  335
             P+V E+ D +V   P+E+F
Sbjct  121  HPVVSETLDTLVFKDPTESF  140



>gb|EWM26089.1| protein af-9 [Nannochloropsis gaditana]
Length=343

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 85/140 (61%), Gaps = 1/140 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQ-SHKWTLYIRGATNEDLGVVIKRAVFQLHSS  575
            +++KG+ + +PI YG++A+ + KK  + Q +H+WTLY+R     DLG V+K+ VF LHSS
Sbjct  54   RRMKGVTVCLPIAYGSIAWHMTKKTEQDQCTHQWTLYVRSPHGHDLGAVLKKTVFTLHSS  113

Query  574  FNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTK  395
            FNN  R   A PFE++E GWGEFE  I +YF +         +     +    +   + K
Sbjct  114  FNNHIREASAHPFEVTEKGWGEFEALIDVYFKDAHEKSVELRHFVKLFHGNSATSQPNNK  173

Query  394  KPIVVESYDEIVLSKPSEAF  335
            KP+V E YDE+V + P+E F
Sbjct  174  KPVVHEYYDEVVFTDPTEEF  193



>ref|XP_006621608.1| PREDICTED: YEATS domain-containing protein 4-like isoform X2 
[Apis dorsata]
Length=219

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = -1

Query  745  LKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            L G+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+N
Sbjct  7    LVGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYLNEDMSTYVKKVHFKLHESYN  66

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLSTK  395
            NP R++  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    K
Sbjct  67   NPNRIMTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----K  122

Query  394  KPIVVESYDEIVLSKPS  344
            K +V E Y+EIV   P+
Sbjct  123  KSLVSEFYEEIVFQDPT  139



>ref|XP_006570350.1| PREDICTED: YEATS domain-containing protein 4 isoform X1 [Apis 
mellifera]
Length=219

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 7/137 (5%)
 Frame = -1

Query  745  LKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            L G+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+N
Sbjct  7    LVGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYLNEDMSTYVKKVHFKLHESYN  66

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLSTK  395
            NP R++  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    K
Sbjct  67   NPNRIMTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----K  122

Query  394  KPIVVESYDEIVLSKPS  344
            K +V E Y+EIV   P+
Sbjct  123  KSLVSEFYEEIVFQDPT  139



>gb|EZA58670.1| YEATS domain-containing protein [Cerapachys biroi]
Length=227

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R+V  PP+EL+E GWGEFEI I +YFH  N+      H+    +  P+ + G    
Sbjct  74   NNPNRIVMKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQSTPDIQLG----  129

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  130  KKSLVSEFYEEIVFQDPT  147



>gb|EJK74990.1| hypothetical protein THAOC_03304 [Thalassiosira oceanica]
Length=269

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 92/164 (56%), Gaps = 14/164 (9%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKAS-EYQSHKWTLYIRGATNE-DLGVVIKRAVFQLHSS  575
            +L  +   +PI YG++AF+LG  A  E+++H+WTLY+R      DL   I + VFQLH S
Sbjct  12   RLADVTACLPIAYGSIAFYLGPNAKGEFKTHRWTLYVRSPDQTFDLSRAISKVVFQLHPS  71

Query  574  FNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyh--------hlklyPED  419
            F  PTR +  PPFE++ECGWGEFE +I + +  ++ D+   +          +      D
Sbjct  72   FPQPTRELTEPPFEITECGWGEFEASIRIVW-KEIADERSTIVTHGIRLYPKNTPQKNAD  130

Query  418  ESGPLSTKKPIVVESYDEIVLSKPSEAF---LARVHNHPAVSVP  296
             S  ++T+ P+V E YDE+V + P E F   LA  H    +S P
Sbjct  131  PSTYMNTQVPVVSEKYDEVVFTNPKEEFHISLADAHKVKKLSYP  174



>ref|XP_003668702.1| hypothetical protein NDAI_0B04250 [Naumovozyma dairenensis CBS 
421]
 emb|CCD23459.1| hypothetical protein NDAI_0B04250 [Naumovozyma dairenensis CBS 
421]
Length=219

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 109/194 (56%), Gaps = 16/194 (8%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGK----KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQL  584
            +++K + +  PI+YGN A  LG+     A    +H WT+++RG  NED+   IK+ VF+L
Sbjct  7    KRIKTLSVRRPIIYGNTAKKLGEVRPENAPAEHTHLWTIFVRGPQNEDITYFIKKVVFKL  66

Query  583  HSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPL  404
            H ++ NPTRVV+ PPFEL+E GWGEF+I I +YF ++  +K L  YH L+L+P    GP 
Sbjct  67   HETYPNPTRVVETPPFELTETGWGEFDINIKIYFVDEANEKMLSFYHRLRLHPYVIPGPE  126

Query  403  STKKP----IVVES-------YDEIVLSKPSEAFLARVHNHPAVSVP-Rlpadlalppaa  260
              + P     V E+       YDEIV ++P+E F   +   P   +P  +  +       
Sbjct  127  GQQNPARNITVTENGEIRSTFYDEIVFNEPNEEFFKTLMTKPGNLLPANITENQVFSRQL  186

Query  259  pLEDVDRRKRGDTK  218
              E++DR   G TK
Sbjct  187  EQEEIDRIDIGMTK  200



>ref|NP_001155688.1| YEATS domain containing 4-like [Acyrthosiphon pisum]
 dbj|BAH71556.1| ACYPI006940 [Acyrthosiphon pisum]
Length=221

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG  I  PI+YGN A + G+K  E   +HKW +Y+R   NED+G  +K+  F+LH S+
Sbjct  8    RVKGTSIVKPIIYGNTAKYFGQKRHEDGHTHKWCVYVRPYVNEDIGTWVKKVHFKLHDSY  67

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             +PTRVV  PPFE+SE GWGEFE+ I ++F  D  ++P+ LYH LKLY   +   LS +K
Sbjct  68   ESPTRVVQKPPFEVSETGWGEFELVIKIFFQ-DTSERPVTLYHVLKLYSNGQDSELS-EK  125

Query  391  PIVVESYDEIVLSKPSEAFLARVHN  317
            P++ E Y+EI+   PS  F+  + N
Sbjct  126  PVLSEFYEEIIFQDPS-TFMKFILN  149



>ref|XP_973381.1| PREDICTED: YEATS domain-containing protein 4 [Tribolium castaneum]
 gb|EFA10451.1| hypothetical protein TcasGA2_TC012697 [Tribolium castaneum]
Length=227

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 110/227 (48%), Gaps = 45/227 (20%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RLKGVCIVKPIVYGNIARYFGKKREEDGHTHQWTVYVKPYNNEDISCYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESG-----P  407
             N  R+V  PP+E+SE GWGEFEI I ++FH    D          +     SG      
Sbjct  74   ANQNRIVVKPPYEISETGWGEFEIVIKIHFH----DPNERPVTMYHILKLFHSGGTMDIG  129

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRKRG  227
            +   K ++ ESYDEIV   P++     + N                              
Sbjct  130  MEQGKGLLSESYDEIVFQDPTQLMHHLLTN------------------------------  159

Query  226  DTKDHPLSQW--FTNFSEADE--LLKLTAARQQVQGHIARLRRQLSM  98
             TK   L++W   TNF E  E  L  +T A+Q+V+  I  L+ +L +
Sbjct  160  -TKQLTLARWEHNTNFEEKKEKTLKSITEAKQKVKAEIGVLKNRLKL  205



>gb|EFN61963.1| YEATS domain-containing protein 4 [Camponotus floridanus]
Length=227

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KGI I  PIVYGNVA +  KK  E   +H+WT+Y++   NE++ V +K+  F+LH S+
Sbjct  14   RMKGITIVKPIVYGNVARYFDKKREEDGHTHQWTVYVKPYHNEEMSVYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R+V  PP+EL+E GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  74   NNPNRIVTKPPYELTETGWGEFEIVIKIYFHDPNERPVTIYHVLKLFQSTPEIQLG----  129

Query  397  KKPIVVESYDEIVLSKPS  344
            K+ +V E Y+EIV   P+
Sbjct  130  KESLVSEFYEEIVFQDPT  147



>ref|XP_001962382.1| GF14466 [Drosophila ananassae]
 gb|EDV31603.1| GF14466 [Drosophila ananassae]
Length=227

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 7/150 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+   +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYYNEDMSAYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVVIKIYFNDQSERPVTCYHILKLFQSPVVDGELTSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSEAFLARVH  320
             + TKK +V ESY+EIV  +P++     +H
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQIMQHYLH  160



>ref|XP_003399133.1| PREDICTED: YEATS domain-containing protein 4-like [Bombus terrestris]
Length=173

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGN+A + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  15   RVKGVTIVKPIVYGNIARYFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKVHFKLHESY  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R++   P+ELSE GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  75   NNPNRIMTKAPYELSETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----  130

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  131  KKSLVSEFYEEIVFQDPT  148



>gb|EFN79787.1| YEATS domain-containing protein 4 [Harpegnathos saltator]
Length=216

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 18/138 (13%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGP--LST  398
            NNP R+V  PP+EL+E GWGEF+I I +YFH+                 E  S P     
Sbjct  74   NNPNRIVMKPPYELTETGWGEFDIVIKIYFHDP---------------NERPSTPEIQLG  118

Query  397  KKPIVVESYDEIVLSKPS  344
            KK ++ E Y+EIV   P+
Sbjct  119  KKSLISEFYEEIVFQDPT  136



>ref|NP_609086.1| Gas41 [Drosophila melanogaster]
 gb|AAF52462.2| Gas41 [Drosophila melanogaster]
 gb|AAL28762.1| LD16161p [Drosophila melanogaster]
 gb|ACL83891.1| Gas41-PA, partial [synthetic construct]
 gb|ACL92688.1| Gas41-PA [synthetic construct]
Length=227

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 7/143 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELSSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSE  341
             + TKK +V ESY+EIV  +P++
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQ  153



>ref|XP_002078449.1| GD22526 [Drosophila simulans]
 gb|EDX04034.1| GD22526 [Drosophila simulans]
Length=227

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 7/143 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELTSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSE  341
             + TKK +V ESY+EIV  +P++
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQ  153



>ref|XP_002088102.1| GE18389 [Drosophila yakuba]
 gb|EDW87814.1| GE18389 [Drosophila yakuba]
Length=227

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 7/143 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELTSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSE  341
             + TKK +V ESY+EIV  +P++
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQ  153



>ref|XP_002036011.1| GM13720 [Drosophila sechellia]
 gb|EDW51934.1| GM13720 [Drosophila sechellia]
Length=227

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 89/143 (62%), Gaps = 7/143 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELTSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSE  341
             + TKK +V ESY+EIV  +P++
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQ  153



>ref|XP_003487813.1| PREDICTED: YEATS domain-containing protein 4-like [Bombus impatiens]
Length=228

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  PIVYGN+A + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  15   RVKGVTIVKPIVYGNIARYFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKVHFKLHESY  74

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NNP R++   P+ELSE GWGEFEI I +YFH  N+      H+    +  PE + G    
Sbjct  75   NNPNRIMTKAPYELSETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQTTPEIQLG----  130

Query  397  KKPIVVESYDEIVLSKPS  344
            KK +V E Y+EIV   P+
Sbjct  131  KKSLVSEFYEEIVFQDPT  148



>ref|XP_002067022.1| GK24245 [Drosophila willistoni]
 gb|EDW78008.1| GK24245 [Drosophila willistoni]
Length=248

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVVIKIYFNDQSERPVTCYHILKLFQSPVVDGELTSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSEAF  335
             + TKK +V ESY+EIV  +P++  
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQVM  155



>ref|XP_008553107.1| PREDICTED: YEATS domain-containing protein 4 [Microplitis demolitor]
Length=233

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 88/139 (63%), Gaps = 7/139 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  P+VYGNVA + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  20   RVKGVTIVKPLVYGNVARFFGKKREEDGHTHQWTVYVKPYNNEDMSTYVKKVHFKLHESY  79

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFH--NDVCDkplhlyhhlklyPEDESGPLST  398
            NN  R+V  PP+E++E GWGEFEI I +YFH  N+      H+    +  PE ++G    
Sbjct  80   NNQNRIVTKPPYEVTETGWGEFEIVIKIYFHDPNERPVTIYHILKLFQSPPEAQNG----  135

Query  397  KKPIVVESYDEIVLSKPSE  341
            KK +V E Y+EIV   P++
Sbjct  136  KKNLVSEFYEEIVFQDPTQ  154



>ref|XP_001970096.1| GG23565 [Drosophila erecta]
 gb|EDV59155.1| GG23565 [Drosophila erecta]
Length=228

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 7/143 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+       E   S 
Sbjct  71   ANPNRIVVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVGDGELTSST  130

Query  409  PLSTKKPIVVESYDEIVLSKPSE  341
             + TKK +V ESY+EIV  +P++
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQ  153



>dbj|GAM27571.1| hypothetical protein SAMD00019534_107470 [Acytostelium subglobosum 
LB1]
Length=262

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -1

Query  718  IVYGNVAFWLGKKASEY-QSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAP  542
            I+ G+++ WLGKKA  +  +HKW+ YIRG  NE+L   IK+ VF LH+SF NP R V++P
Sbjct  13   IIVGSISHWLGKKADGHTHTHKWSAYIRGINNEELPF-IKKVVFHLHASFKNPNRAVESP  71

Query  541  PFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEI  362
            PFE+SE GWGEF++ +TLYF     D          L        + TK+P+V E+ D I
Sbjct  72   PFEMSETGWGEFDLGVTLYF----ADPAEKPLDLFHLLRLHPPDGIKTKQPVVSETLDVI  127

Query  361  VLSKPSEAF  335
            +   P+E+F
Sbjct  128  LFRDPTESF  136



>ref|XP_001633555.1| predicted protein [Nematostella vectensis]
 gb|EDO41492.1| predicted protein [Nematostella vectensis]
Length=249

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 86/139 (62%), Gaps = 3/139 (2%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKK-ASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  P++YGNV+ + GKK  ++  +H WT+YIR   NED+   +K+  F+LH S+
Sbjct  9    RVKGVTIVKPVIYGNVSHYFGKKRETDGHTHGWTVYIRPFNNEDMSSYVKKVHFKLHESY  68

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E++E GWGEFEI I ++F +    +     +HL    + ES   S KK
Sbjct  69   ANPLRVITKPPYEVNESGWGEFEITIKIFFMDP--QERPVTLYHLLKLFQTESALASGKK  126

Query  391  PIVVESYDEIVLSKPSEAF  335
             +V E YDEI+   P++  
Sbjct  127  QLVAEFYDEIIFQDPTQMM  145



>gb|KFM28541.1| AF-9-like protein [Auxenochlorella protothecoides]
Length=185

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 106/195 (54%), Gaps = 28/195 (14%)
 Frame = -1

Query  679  ASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNNPTRVVDAPPFELSECGWGEFEI  500
            A+++ SHKWT+Y+R A NEDL  ++ +  F LHSSF NP R V+  PFEL+E GWGEF+I
Sbjct  15   ATDHASHKWTIYLRHAKNEDLAHLVSKVTFGLHSSFANPNRDVEYQPFELTEVGWGEFDI  74

Query  499  AITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPIVVESYDEIVLSKPSEAFLARVH  320
             I ++F  DV + P+ LYHHL LY  D SG  + K+P+V E YDEIVL +P E    R+ 
Sbjct  75   TIKVHFREDVREGPVELYHHLTLY--DASGSNNAKRPVVHEVYDEIVLWEPPEEVHRRLA  132

Query  319  NHPAVSVPRlpadlalppaapLEDVDRRKRGDTKDHPLSQWFTNFSEADELLKLTAARQQ  140
             H     P+                            L+Q+ T F+   E  +L  ARQ+
Sbjct  133  AHTPAPAPQSQ--------------------------LAQFHTQFNPDYEYRRLQHARQR  166

Query  139  VQGHIARLRRQLSMV  95
            V      ++ QL+ +
Sbjct  167  VAAITNNVKVQLAAL  181



>ref|XP_002019119.1| GL25598 [Drosophila persimilis]
 ref|XP_001355777.2| GA21613 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW37315.1| GL25598 [Drosophila persimilis]
 gb|EAL32836.2| GA21613 [Drosophila pseudoobscura pseudoobscura]
Length=227

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            +LKG+ I  PIVYGN+A   GKK  E   +H+W +Y++   NED+ + +K+  F+LH S+
Sbjct  11   RLKGVTIVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIYVKKVHFKLHESY  70

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPE-DESG  410
             NP R+V  PP+E++E GWGEFE+ I +YF++       C   L L+    +  E   + 
Sbjct  71   ANPNRIVVKPPYEVTETGWGEFEVVIKIYFNDQSERPVTCYHILKLFQSPVVDGELTSTT  130

Query  409  PLSTKKPIVVESYDEIVLSKPSEAF  335
             + TKK +V ESY+EIV  +P++  
Sbjct  131  TMDTKKGLVSESYEEIVFQEPTQVM  155



>gb|EHJ75966.1| YEATS domain containing protein 4 [Danaus plexippus]
Length=231

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 91/146 (62%), Gaps = 3/146 (2%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I   IVYGN+A + GKK  E   +H+WT+Y++   NED+   IK+  F+LH S+
Sbjct  14   RVKGLVIVKAIVYGNIARYFGKKREEDGHTHQWTVYVKPYANEDMSAYIKKVHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHN-DVCDkplhlyhhlklyPEDESGPLSTK  395
             NP R+V  PP+EL+E GWGEFEI I +YFH+ +     L+    L   P  E+ P +  
Sbjct  74   ANPNRIVTKPPYELTETGWGEFEIVIKIYFHDSNERPVTLYHILKLFQSPVSETAP-TVG  132

Query  394  KPIVVESYDEIVLSKPSEAFLARVHN  317
            + +V ESY+EIV  +P++     ++N
Sbjct  133  RSLVSESYEEIVFQEPTQLMQHLLNN  158



>ref|XP_002430189.1| YEATS domain-containing protein, putative [Pediculus humanus 
corporis]
 gb|EEB17451.1| YEATS domain-containing protein, putative [Pediculus humanus 
corporis]
Length=223

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 94/152 (62%), Gaps = 5/152 (3%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG  I  P+VYGN++ + GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  13   RVKGCTIIKPLVYGNISRYFGKKREEDGHTHQWTVYVKPYHNEDMSAYVKKIQFKLHESY  72

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVC-DkplhlyhhlklyPEDESGPLSTK  395
             N TR+V  PP+E++E GWGEFEI I ++FH   C ++     +H+    +  S    +K
Sbjct  73   TNQTRIVTKPPYEVTETGWGEFEIIIKIFFH---CPNEKPVTIYHILKLFQTGSEIAVSK  129

Query  394  KPIVVESYDEIVLSKPSEAFLARVHNHPAVSV  299
            KP+V E Y+EI+  +P++     ++N   +SV
Sbjct  130  KPLVSEFYEEIIFQEPTQLMKHLLNNVRPISV  161



>emb|CCH41080.1| hypothetical protein BN7_617 [Wickerhamomyces ciferrii]
Length=214

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 106/182 (58%), Gaps = 7/182 (4%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKK----ASEYQSHKWTLYIRGATNEDLGVVIKRAVFQL  584
            +++K + IS PI+YGN A   G+K      +  +H WT+++RG   EDL   IK+ VF+L
Sbjct  7    KRIKTLSISRPIIYGNTAEPFGEKRPPNCPDEHTHNWTVFVRGPNGEDLSYFIKKVVFKL  66

Query  583  HSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPED-ESGP  407
            H ++NNPTR +++PPF+++E GWGEFEI I +YF N+  +K + LYHHL+L+P       
Sbjct  67   HDTYNNPTRSIESPPFQVTETGWGEFEIGIKIYFVNEANEKNISLYHHLRLHPYGFPPDA  126

Query  406  LSTKKPIVVES--YDEIVLSKPSEAFLARVHNHPAVSVPRlpadlalppaapLEDVDRRK  233
            + T K   V S  YDEIV ++P+E     +   P   +P L            E++ R +
Sbjct  127  VLTDKDRNVRSVQYDEIVFNEPTEQLFEIMTQKPGNRLPELKKQSEFSREVEYEEIARLE  186

Query  232  RG  227
             G
Sbjct  187  NG  188



>ref|XP_008178714.1| PREDICTED: YEATS domain containing 4-like isoform X1 [Acyrthosiphon 
pisum]
Length=219

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 93/143 (65%), Gaps = 4/143 (3%)
 Frame = -1

Query  742  KGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFNN  566
            +G  I  PI+YGN A + G+K  E   +HKW +Y+R   NED+G  +K+  F+LH S+ +
Sbjct  8    RGTSIVKPIIYGNTAKYFGQKRHEDGHTHKWCVYVRPYVNEDIGTWVKKVHFKLHDSYES  67

Query  565  PTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKKPI  386
            PTRVV  PPFE+SE GWGEFE+ I ++F  D  ++P+ LYH LKLY   +   LS +KP+
Sbjct  68   PTRVVQKPPFEVSETGWGEFELVIKIFFQ-DTSERPVTLYHVLKLYSNGQDSELS-EKPV  125

Query  385  VVESYDEIVLSKPSEAFLARVHN  317
            + E Y+EI+   PS  F+  + N
Sbjct  126  LSEFYEEIIFQDPS-TFMKFILN  147



>gb|KFB42262.1| YEATS domain containing protein 4 [Anopheles sinensis]
Length=199

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 6/155 (4%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  P+VYGNVA   GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RVKGLTIVKPVVYGNVARSFGKKREEDGHTHQWTVYVKPYKNEDMQTYVKKIHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLST--  398
             NP R++  PP+E++E GWGEFEI I ++FH+         +           G +ST  
Sbjct  74   ANPNRIITKPPYEVTETGWGEFEIVIKIHFHDPTERPVTMYHILKLFQSPILDGEVSTQI  133

Query  397  --KKPIVVESYDEIVLSKPSEAFLARVHN-HPAVS  302
              KK +V E Y+EIV  +P++     + N  P VS
Sbjct  134  EGKKGLVSEQYEEIVFQEPTQLMQQLLTNVQPVVS  168



>ref|XP_001842030.1| YEATS domain containing protein 4 [Culex quinquefasciatus]
 gb|EDS37568.1| YEATS domain containing protein 4 [Culex quinquefasciatus]
Length=231

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 6/150 (4%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  P++YGNVA   GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RVKGLTIVKPLIYGNVARSFGKKREEDGHTHQWTVYVKPYQNEDMSTYVKKIHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLST--  398
             NP RVV  PPFE++E GWGEFEI I ++FH+         +           G ++T  
Sbjct  74   ANPNRVVTKPPFEVTETGWGEFEIVIKIHFHDPTERPVTMYHILKLFQSPILDGEVTTTQ  133

Query  397  ---KKPIVVESYDEIVLSKPSEAFLARVHN  317
               KK +V E Y+EIV  +P++     + N
Sbjct  134  IEGKKGLVSEQYEEIVFQEPTQLMQQLLTN  163



>ref|XP_004525578.1| PREDICTED: YEATS domain-containing protein 4-like [Ceratitis 
capitata]
Length=238

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 92/156 (59%), Gaps = 14/156 (9%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSFN  569
            ++KG+ I  PIVYGN+A   GKK  +  +H+W +Y++   NED+ V +K+  F+LH S+ 
Sbjct  17   RVKGLVIVKPIVYGNIARSFGKKNEDGHTHQWKVYVKPYHNEDMSVYVKKVHFKLHESYA  76

Query  568  NPTRVVDAPPFELSECGWGEFEIAITLYFHND-----VCDkplhlyhhlklyPEDESGPL  404
            NP R+V  PP+E++E GWGEFE+ I +YFH+       C   L L+    +  E  S   
Sbjct  77   NPNRIVTKPPYEITETGWGEFEVVIKIYFHDPTERPVTCYHILKLFQSPVVDGELSSNLD  136

Query  403  STKK------PIVVESYDEIVLSKPSEA---FLARV  323
            +TK+       +V ESY+EIV  +P++    FL  V
Sbjct  137  NTKRLGAANVHLVSESYEEIVFQEPTQLMQHFLMNV  172



>ref|XP_002737992.1| PREDICTED: YEATS domain-containing protein 4-like [Saccoglossus 
kowalevskii]
Length=236

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 90/145 (62%), Gaps = 3/145 (2%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KGI I  P+VYGN+A + GKK  E   +H+WT+Y++   NED+ V +K+  F+LH S+
Sbjct  20   RVKGISIIKPVVYGNLARYFGKKREEDGHTHQWTVYLKPFRNEDISVYVKKIQFKLHESY  79

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
             NP RV+  PP+E++E GWGEFE+ I ++F++   ++     +HL    + E+  +   K
Sbjct  80   PNPLRVLTKPPYEVTETGWGEFEVVIKIFFND--PNERPVTLYHLLKLFQSETNIMLGNK  137

Query  391  PIVVESYDEIVLSKPSEAFLARVHN  317
             +V E YDE++   P++     + N
Sbjct  138  TLVAEQYDELIFQDPTQMMQQLLTN  162



>ref|XP_002495372.1| ZYRO0B09724p [Zygosaccharomyces rouxii]
 emb|CAR26439.1| ZYRO0B09724p [Zygosaccharomyces rouxii]
Length=217

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGK----KASEYQSHKWTLYIRGATNEDLGVVIKRAVFQL  584
            +++K + ++ PIVYGN A  LG+     A    +H WT+++RG  NED+   IK+ VF+L
Sbjct  14   KRVKTLSVTRPIVYGNTAKKLGEIKPPNAPAEHTHIWTIFVRGPQNEDISYYIKKVVFKL  73

Query  583  HSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPL  404
            H ++ N TR V+APPFEL+E GWGEFEI + ++F ++  +K L  YHHL+L+P     P 
Sbjct  74   HDTYPNATRTVEAPPFELTETGWGEFEINVKIHFVDEANEKMLSFYHHLRLHPYHNVNPD  133

Query  403  STKKP---IVVESYDEIVLSKPSEAFLARVHNHPAVSVP  296
            S ++P   I    YDEIV ++P+E F   + + P   +P
Sbjct  134  SPQQPDDEISSVFYDEIVFNEPNEQFFKTLLSTPGNLLP  172



>gb|EJY86976.1| Transcription initiation factor IIF, auxiliary subunit [Oxytricha 
trifallax]
Length=284

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKKASEYQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++LK +   VPI  G+++ W GKKA E  +HKW  Y+RG   ED+   IK+  F LH SF
Sbjct  8    RRLKNVTKYVPIAVGSISLWQGKKAHEEHTHKWACYVRGLNEEDISYFIKKVQFSLHPSF  67

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPEDESGPLSTKK  392
              P R ++  PFE+   GWGEF+I I ++F +         +        ++    STKK
Sbjct  68   PEPVRTIEKFPFEICLTGWGEFDIGIKIFFTDPAEKPVEMGHLLKLYPGNNQQQ--STKK  125

Query  391  PIVVESYDEIVLSKPSEAF  335
            P++ E YDEIV  +P+E F
Sbjct  126  PVISEKYDEIVFFEPTEHF  144



>ref|XP_001662633.1| YEATS domain containing protein 4 [Aedes aegypti]
 gb|EAT35303.1| AAEL012525-PA [Aedes aegypti]
Length=230

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 87/149 (58%), Gaps = 5/149 (3%)
 Frame = -1

Query  748  KLKGIEISVPIVYGNVAFWLGKKASE-YQSHKWTLYIRGATNEDLGVVIKRAVFQLHSSF  572
            ++KG+ I  P+VYGNVA   GKK  E   +H+WT+Y++   NED+   +K+  F+LH S+
Sbjct  14   RVKGLTIVKPLVYGNVARSFGKKREEDGHTHQWTVYVKPYHNEDMSTYVKKIHFKLHESY  73

Query  571  NNPTRVVDAPPFELSECGWGEFEIAITLYFHN----DVCDkplhlyhhlklyPEDESGPL  404
             NP RVV  PPFE++E GWGEFEI I ++FH+     V    +       +   + +  L
Sbjct  74   ANPNRVVTKPPFEVTETGWGEFEIVIKIHFHDPTERPVTMYHILKLFQSPIVDGEVANQL  133

Query  403  STKKPIVVESYDEIVLSKPSEAFLARVHN  317
              KK +V E Y+EIV  +P++     + N
Sbjct  134  EGKKVLVSEQYEEIVFQEPTQLMQQLLTN  162



>gb|AGO14274.1| AaceriAFL227Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=208

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 108/181 (60%), Gaps = 6/181 (3%)
 Frame = -1

Query  751  QKLKGIEISVPIVYGNVAFWLGKK----ASEYQSHKWTLYIRGATNEDLGVVIKRAVFQL  584
            +++K + ++ PI+YGN A  +G      A    +H WT+++RG   ED+   IK+ VF+L
Sbjct  7    KRIKTLSLARPIIYGNTAKKMGDVRPAIAPSEHTHMWTIFVRGPQGEDISYFIKKVVFKL  66

Query  583  HSSFNNPTRVVDAPPFELSECGWGEFEIAITLYFHNDVCDkplhlyhhlklyPE-DESGP  407
            H ++ NP R V+APPFEL+E GWGEFEI + ++F  +  +K L+ YHHL+L+P  +E G 
Sbjct  67   HETYPNPVRAVEAPPFELTETGWGEFEINVKIHFVEEANEKMLNFYHHLRLHPYVEEDGR  126

Query  406  LSTKKPIVVESYDEIVLSKPSEAFLARVHNHPAVSVPRlpa-dlalppaapLEDVDRRKR  230
             S    +    YDEIV ++P+EAF A++   P   +P     D         E++DR ++
Sbjct  127  RSDGDEVSSVFYDEIVFNEPNEAFFAKMIEQPGNLLPSNKTPDCVFSLQLEQEEIDRIQQ  186

Query  229  G  227
            G
Sbjct  187  G  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2460719396736