BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23323_g1_i1 len=1924 path=[1:0-399 6282:400-466 468:467-504
6801:505-544 546:545-582 6372:583-742 744:743-771 6011:772-929
931:930-954 956:955-1245 1247:1246-1278 3912:1279-1923]

Length=1924
                                                                      Score     E

ref|XP_009784019.1|  PREDICTED: uncharacterized protein LOC104232494    820   0.0      
ref|XP_004239021.1|  PREDICTED: uncharacterized protein LOC101259744    817   0.0      
ref|XP_006348650.1|  PREDICTED: uncharacterized protein LOC102583967    816   0.0      
ref|XP_009613079.1|  PREDICTED: uncharacterized protein LOC104106280    815   0.0      
ref|XP_011102236.1|  PREDICTED: uncharacterized protein LOC105180...    811   0.0      
ref|XP_009627377.1|  PREDICTED: uncharacterized protein LOC104117...    804   0.0      
ref|XP_009793984.1|  PREDICTED: uncharacterized protein LOC104240...    802   0.0      
ref|XP_009627378.1|  PREDICTED: uncharacterized protein LOC104117...    800   0.0      
ref|XP_009793985.1|  PREDICTED: uncharacterized protein LOC104240...    799   0.0      
ref|XP_006367493.1|  PREDICTED: uncharacterized protein LOC102581...    794   0.0      
ref|XP_011102239.1|  PREDICTED: uncharacterized protein LOC105180...    793   0.0      
emb|CDP00474.1|  unnamed protein product                                793   0.0      
ref|XP_009793986.1|  PREDICTED: uncharacterized protein LOC104240...    791   0.0      
ref|XP_004228421.1|  PREDICTED: uncharacterized protein LOC101260...    786   0.0      
ref|XP_010324768.1|  PREDICTED: uncharacterized protein LOC101260...    783   0.0      
ref|XP_006367494.1|  PREDICTED: uncharacterized protein LOC102581...    782   0.0      
ref|XP_010324799.1|  PREDICTED: uncharacterized protein LOC101260...    775   0.0      
gb|KDP41357.1|  hypothetical protein JCGZ_15764                         767   0.0      
ref|XP_002314917.2|  hypothetical protein POPTR_0010s14840g             761   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011009617.1|  PREDICTED: uncharacterized protein LOC105114...    754   0.0      
ref|XP_010091626.1|  [Protein-PII] uridylyltransferase                  753   0.0      
ref|XP_002512031.1|  amino acid binding protein, putative               751   0.0      Ricinus communis
ref|XP_011020651.1|  PREDICTED: uncharacterized protein LOC105122...    748   0.0      
ref|XP_008243801.1|  PREDICTED: uncharacterized protein LOC103342019    747   0.0      
ref|XP_007222134.1|  hypothetical protein PRUPE_ppa005716mg             746   0.0      
ref|XP_008339767.1|  PREDICTED: uncharacterized protein LOC103402787    745   0.0      
ref|XP_010650073.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    744   0.0      
ref|XP_011020660.1|  PREDICTED: uncharacterized protein LOC105122...    744   0.0      
ref|XP_010066809.1|  PREDICTED: uncharacterized protein LOC104453...    743   0.0      
ref|XP_006484247.1|  PREDICTED: uncharacterized protein LOC102622082    742   0.0      
ref|XP_010066810.1|  PREDICTED: uncharacterized protein LOC104453...    741   0.0      
ref|XP_002312346.1|  hypothetical protein POPTR_0008s10860g             741   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO70279.1|  hypothetical protein CISIN_1g013090mg                   741   0.0      
ref|XP_008389382.1|  PREDICTED: uncharacterized protein LOC103451737    740   0.0      
ref|XP_007045767.1|  ACT domain repeat 4                                740   0.0      
ref|XP_006437860.1|  hypothetical protein CICLE_v10031536mg             737   0.0      
ref|XP_006573170.1|  PREDICTED: uncharacterized protein LOC100787...    736   0.0      
ref|XP_003516462.1|  PREDICTED: uncharacterized protein LOC100787...    735   0.0      
gb|KHN29949.1|  [Protein-PII] uridylyltransferase                       734   0.0      
ref|XP_003518790.2|  PREDICTED: uncharacterized protein LOC100813...    734   0.0      
ref|XP_009356452.1|  PREDICTED: uncharacterized protein LOC103947287    730   0.0      
gb|KHN02615.1|  [Protein-PII] uridylyltransferase                       729   0.0      
ref|XP_007153472.1|  hypothetical protein PHAVU_003G038400g             727   0.0      
gb|KHG00039.1|  [Protein-PII] uridylyltransferase                       727   0.0      
gb|KHG02132.1|  [Protein-PII] uridylyltransferase                       727   0.0      
ref|XP_010260920.1|  PREDICTED: uncharacterized protein LOC104599871    723   0.0      
ref|XP_010257936.1|  PREDICTED: uncharacterized protein LOC104597...    721   0.0      
ref|XP_010257938.1|  PREDICTED: uncharacterized protein LOC104597...    721   0.0      
gb|EPS70014.1|  hypothetical protein M569_04746                         720   0.0      
ref|XP_004297204.1|  PREDICTED: uncharacterized protein LOC101300715    718   0.0      
ref|XP_004490254.1|  PREDICTED: uncharacterized protein LOC101508...    716   0.0      
ref|XP_004490253.1|  PREDICTED: uncharacterized protein LOC101508...    716   0.0      
ref|XP_004490255.1|  PREDICTED: uncharacterized protein LOC101508...    714   0.0      
ref|XP_003614264.1|  ACR4                                               712   0.0      
ref|XP_009127699.1|  PREDICTED: uncharacterized protein LOC103852547    708   0.0      
ref|XP_006391062.1|  hypothetical protein EUTSA_v10018526mg             708   0.0      
ref|XP_009105454.1|  PREDICTED: uncharacterized protein LOC103831...    707   0.0      
emb|CDY65806.1|  BnaA02g35780D                                          705   0.0      
gb|EYU28889.1|  hypothetical protein MIMGU_mgv1a006953mg                703   0.0      
dbj|BAJ33767.1|  unnamed protein product                                704   0.0      
ref|XP_009105455.1|  PREDICTED: uncharacterized protein LOC103831...    703   0.0      
emb|CDX95965.1|  BnaA07g27660D                                          703   0.0      
ref|XP_002887219.1|  hypothetical protein ARALYDRAFT_476032             703   0.0      
ref|NP_974107.1|  ACT domain-containing protein                         703   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010681133.1|  PREDICTED: uncharacterized protein LOC104896128    699   0.0      
emb|CDX81587.1|  BnaC02g18910D                                          699   0.0      
ref|NP_177067.1|  ACT domain-containing protein                         699   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490250.1|  PREDICTED: uncharacterized protein LOC101508...    699   0.0      
ref|XP_004490251.1|  PREDICTED: uncharacterized protein LOC101508...    699   0.0      
ref|XP_010511930.1|  PREDICTED: uncharacterized protein LOC104787960    698   0.0      
ref|XP_006302244.1|  hypothetical protein CARUB_v10020277mg             696   0.0      
ref|XP_004490252.1|  PREDICTED: uncharacterized protein LOC101508...    697   0.0      
gb|ACG60681.1|  unknown protein                                         696   0.0      Brassica oleracea var. alboglabra [Chinese broccoli]
emb|CDY33557.1|  BnaC06g29950D                                          696   0.0      
ref|XP_010470880.1|  PREDICTED: uncharacterized protein LOC104750738    696   0.0      
ref|XP_010936425.1|  PREDICTED: uncharacterized protein LOC105056...    694   0.0      
ref|XP_010415531.1|  PREDICTED: uncharacterized protein LOC104701533    694   0.0      
gb|AAF27052.1|AC008262_1  F4N2.2                                        691   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936426.1|  PREDICTED: uncharacterized protein LOC105056...    691   0.0      
emb|CAN83103.1|  hypothetical protein VITISV_015490                     687   0.0      Vitis vinifera
gb|KGN47669.1|  hypothetical protein Csa_6G367150                       683   0.0      
ref|XP_004144160.1|  PREDICTED: uncharacterized protein LOC101218703    681   0.0      
ref|XP_008445429.1|  PREDICTED: uncharacterized protein LOC103488452    681   0.0      
ref|XP_009411127.1|  PREDICTED: uncharacterized protein LOC103992926    674   0.0      
ref|XP_010527984.1|  PREDICTED: uncharacterized protein LOC104805208    672   0.0      
ref|XP_009627379.1|  PREDICTED: uncharacterized protein LOC104117...    665   0.0      
ref|XP_007156374.1|  hypothetical protein PHAVU_003G280900g             666   0.0      
ref|XP_006856315.1|  hypothetical protein AMTR_s00047p00143120          665   0.0      
ref|XP_009793987.1|  PREDICTED: uncharacterized protein LOC104240...    660   0.0      
dbj|BAC43240.1|  unknown protein                                        648   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394314.1|  PREDICTED: uncharacterized protein LOC103979823    647   0.0      
ref|XP_010554272.1|  PREDICTED: uncharacterized protein LOC104824...    645   0.0      
gb|EAY90442.1|  hypothetical protein OsI_12028                          637   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001050359.1|  Os03g0413100                                       636   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27314.1|  hypothetical protein OsJ_11253                          635   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006395679.1|  hypothetical protein EUTSA_v10004191mg             633   0.0      
ref|XP_002876893.1|  hypothetical protein ARALYDRAFT_904656             627   0.0      
gb|ACG60673.1|  hypothetical protein BoB028L01.070                      624   0.0      Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_010554273.1|  PREDICTED: uncharacterized protein LOC104824...    623   0.0      
ref|NP_565304.1|  ACT domain-containing protein 5                       623   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129076.1|  PREDICTED: uncharacterized protein LOC103853936    621   0.0      
ref|XP_010502395.1|  PREDICTED: uncharacterized protein LOC104779692    620   0.0      
ref|XP_010514143.1|  PREDICTED: uncharacterized protein LOC104790131    619   0.0      
ref|XP_006650194.1|  PREDICTED: uncharacterized protein LOC102721346    619   0.0      
ref|XP_006291103.1|  hypothetical protein CARUB_v10017215mg             619   0.0      
emb|CDY49687.1|  BnaA02g27260D                                          616   0.0      
ref|XP_004984033.1|  PREDICTED: uncharacterized protein LOC101763...    614   0.0      
ref|XP_004984034.1|  PREDICTED: uncharacterized protein LOC101763...    614   0.0      
gb|AAM93430.1|  ACR5                                                    613   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009152150.1|  PREDICTED: uncharacterized protein LOC103875388    612   0.0      
ref|XP_002467694.1|  hypothetical protein SORBIDRAFT_01g032575          610   0.0      Sorghum bicolor [broomcorn]
emb|CDY45710.1|  BnaC02g35120D                                          610   0.0      
gb|KDO70280.1|  hypothetical protein CISIN_1g013090mg                   606   0.0      
emb|CDY51199.1|  BnaA06g39780D                                          602   0.0      
ref|XP_008668558.1|  PREDICTED: ACR4 isoform X1                         603   0.0      
ref|NP_001142223.1|  ACR4                                               602   0.0      Zea mays [maize]
emb|CDY02975.1|  BnaC07g22520D                                          600   0.0      
gb|ACG25547.1|  ACR4                                                    600   0.0      Zea mays [maize]
tpg|DAA45793.1|  TPA: hypothetical protein ZEAMMB73_762765              588   0.0      
gb|ACL53099.1|  unknown                                                 577   0.0      Zea mays [maize]
ref|XP_003622131.1|  Amino acid binding protein, putative               575   0.0      
ref|XP_002512902.1|  amino acid binding protein, putative               575   0.0      Ricinus communis
ref|XP_004514319.1|  PREDICTED: uncharacterized protein LOC101500937    573   0.0      
ref|XP_002272024.1|  PREDICTED: uncharacterized protein LOC100248040    572   0.0      Vitis vinifera
ref|XP_002466847.1|  hypothetical protein SORBIDRAFT_01g015160          572   0.0      Sorghum bicolor [broomcorn]
ref|NP_001130980.1|  uncharacterized protein LOC100192085               570   0.0      Zea mays [maize]
ref|NP_001050608.1|  Os03g0598100                                       570   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006369838.1|  hypothetical protein POPTR_0001s33460g             569   0.0      
ref|XP_011000958.1|  PREDICTED: uncharacterized protein LOC105108...    569   0.0      
ref|XP_008231090.1|  PREDICTED: uncharacterized protein LOC103330...    568   0.0      
ref|XP_006650292.1|  PREDICTED: uncharacterized protein LOC102702453    569   0.0      
ref|XP_004982474.1|  PREDICTED: uncharacterized protein LOC101774...    569   0.0      
gb|EEC75693.1|  hypothetical protein OsI_12504                          568   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006844620.1|  hypothetical protein AMTR_s00016p00225040          568   0.0      
ref|XP_003562315.1|  PREDICTED: uncharacterized protein LOC100840593    566   0.0      
gb|KDP41794.1|  hypothetical protein JCGZ_26812                         565   0.0      
ref|XP_008341281.1|  PREDICTED: uncharacterized protein LOC103404170    565   0.0      
ref|XP_010250632.1|  PREDICTED: uncharacterized protein LOC104592825    565   0.0      
ref|XP_010926807.1|  PREDICTED: uncharacterized protein LOC105048981    565   0.0      
ref|XP_002298641.1|  hypothetical protein POPTR_0001s33460g             564   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008804075.1|  PREDICTED: uncharacterized protein LOC103717456    565   0.0      
ref|XP_009344226.1|  PREDICTED: uncharacterized protein LOC103936115    564   0.0      
ref|XP_011009634.1|  PREDICTED: uncharacterized protein LOC105114...    561   0.0      
ref|XP_011009626.1|  PREDICTED: uncharacterized protein LOC105114...    561   0.0      
ref|XP_007215389.1|  hypothetical protein PRUPE_ppa005796mg             564   0.0      
ref|XP_009377996.1|  PREDICTED: uncharacterized protein LOC103966550    563   0.0      
ref|XP_008379088.1|  PREDICTED: uncharacterized protein LOC103442112    561   0.0      
ref|XP_007031924.1|  ACT domain repeat 6                                561   0.0      
ref|XP_009346780.1|  PREDICTED: uncharacterized protein LOC103938500    560   0.0      
ref|XP_008441313.1|  PREDICTED: uncharacterized protein LOC103485467    560   0.0      
ref|XP_008796580.1|  PREDICTED: uncharacterized protein LOC103711996    558   0.0      
ref|XP_003622132.1|  Amino acid binding protein, putative               558   0.0      
ref|XP_008231089.1|  PREDICTED: uncharacterized protein LOC103330...    557   0.0      
ref|XP_010929569.1|  PREDICTED: uncharacterized protein LOC105051...    556   0.0      
ref|XP_010249097.1|  PREDICTED: uncharacterized protein LOC104591778    556   0.0      
ref|XP_010250636.1|  PREDICTED: uncharacterized protein LOC104592829    555   0.0      
ref|XP_003553951.1|  PREDICTED: uncharacterized protein LOC100801859    555   0.0      
ref|XP_004304532.1|  PREDICTED: uncharacterized protein LOC101293911    554   0.0      
ref|XP_003549097.1|  PREDICTED: uncharacterized protein LOC100818...    554   0.0      
ref|XP_006447023.1|  hypothetical protein CICLE_v10015110mg             553   0.0      
gb|KHN02059.1|  [Protein-PII] uridylyltransferase                       552   0.0      
gb|KDO63881.1|  hypothetical protein CISIN_1g013535mg                   552   0.0      
ref|XP_003614265.1|  ACR4                                               548   0.0      
ref|XP_004158495.1|  PREDICTED: uncharacterized protein LOC101225681    551   0.0      
ref|XP_002280377.1|  PREDICTED: uncharacterized protein LOC100256112    550   0.0      Vitis vinifera
ref|XP_010912996.1|  PREDICTED: uncharacterized protein LOC105038791    551   0.0      
emb|CAN80840.1|  hypothetical protein VITISV_043834                     550   0.0      Vitis vinifera
ref|XP_007161677.1|  hypothetical protein PHAVU_001G089200g             549   0.0      
ref|XP_009405884.1|  PREDICTED: uncharacterized protein LOC103988920    549   0.0      
ref|XP_010028975.1|  PREDICTED: uncharacterized protein LOC104419...    548   0.0      
gb|KDP26845.1|  hypothetical protein JCGZ_18003                         547   0.0      
ref|XP_004138626.1|  PREDICTED: uncharacterized protein LOC101213097    546   0.0      
ref|XP_009383404.1|  PREDICTED: uncharacterized protein LOC103971170    546   0.0      
ref|XP_007038043.1|  ACT domain repeat 6 isoform 1                      549   0.0      
tpg|DAA50241.1|  TPA: hypothetical protein ZEAMMB73_737306              545   0.0      
ref|XP_002266641.1|  PREDICTED: uncharacterized protein LOC100250497    545   0.0      Vitis vinifera
ref|XP_002514875.1|  amino acid binding protein, putative               544   0.0      Ricinus communis
ref|XP_010025287.1|  PREDICTED: uncharacterized protein LOC104415658    543   0.0      
ref|XP_010024175.1|  PREDICTED: uncharacterized protein LOC104414711    542   0.0      
ref|XP_010929570.1|  PREDICTED: uncharacterized protein LOC105051...    541   0.0      
ref|XP_010112397.1|  [Protein-PII] uridylyltransferase                  540   0.0      
ref|XP_002884250.1|  hypothetical protein ARALYDRAFT_477311             538   0.0      
ref|XP_006447024.1|  hypothetical protein CICLE_v10015110mg             536   0.0      
emb|CAN83845.1|  hypothetical protein VITISV_001862                     535   0.0      Vitis vinifera
ref|XP_007222095.1|  hypothetical protein PRUPE_ppa005632mg             535   0.0      
ref|XP_010679989.1|  PREDICTED: uncharacterized protein LOC104895235    533   0.0      
ref|XP_011086839.1|  PREDICTED: uncharacterized protein LOC105168...    533   0.0      
ref|XP_008222209.1|  PREDICTED: uncharacterized protein LOC103322107    535   0.0      
ref|XP_009343127.1|  PREDICTED: uncharacterized protein LOC103935102    532   0.0      
gb|KHF98294.1|  [Protein-PII] uridylyltransferase                       532   0.0      
ref|XP_009599622.1|  PREDICTED: uncharacterized protein LOC104095244    532   2e-180   
ref|XP_006408561.1|  hypothetical protein EUTSA_v10020734mg             531   2e-180   
gb|KCW61913.1|  hypothetical protein EUGRSUZ_H04608                     531   2e-180   
ref|XP_010929567.1|  PREDICTED: uncharacterized protein LOC105051...    531   4e-180   
gb|KHG17797.1|  [Protein-PII] uridylyltransferase                       530   5e-180   
ref|XP_009404247.1|  PREDICTED: uncharacterized protein LOC103987...    530   6e-180   
ref|XP_008776535.1|  PREDICTED: uncharacterized protein LOC103696629    530   6e-180   
ref|XP_007043904.1|  ACT domain repeat 4 isoform 2                      530   8e-180   
ref|XP_008389912.1|  PREDICTED: uncharacterized protein LOC103452175    530   9e-180   
ref|XP_009785185.1|  PREDICTED: uncharacterized protein LOC104233484    530   1e-179   
ref|XP_009421053.1|  PREDICTED: uncharacterized protein LOC104000676    529   2e-179   
ref|XP_004310107.1|  PREDICTED: uncharacterized protein LOC101292961    528   4e-179   
ref|XP_006437973.1|  hypothetical protein CICLE_v10031521mg             528   7e-179   
ref|XP_002511139.1|  amino acid binding protein, putative               528   7e-179   Ricinus communis
ref|XP_008454022.1|  PREDICTED: uncharacterized protein LOC103494569    527   8e-179   
gb|KDO81815.1|  hypothetical protein CISIN_1g044728mg                   527   1e-178   
emb|CDP13377.1|  unnamed protein product                                527   2e-178   
emb|CDP20649.1|  unnamed protein product                                525   4e-178   
ref|XP_010090668.1|  [Protein-PII] uridylyltransferase                  526   4e-178   
ref|XP_011086838.1|  PREDICTED: uncharacterized protein LOC105168...    526   6e-178   
ref|XP_010927766.1|  PREDICTED: uncharacterized protein LOC105049725    524   9e-178   
gb|AAS07062.1|  putative ACT domain containing protein, ACR4, wit...    522   9e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004152119.1|  PREDICTED: uncharacterized protein LOC101215960    524   2e-177   
ref|XP_010249096.1|  PREDICTED: uncharacterized protein LOC104591777    524   2e-177   
ref|XP_010682711.1|  PREDICTED: uncharacterized protein LOC104897524    524   2e-177   
ref|NP_186848.1|  ACT domain-containing protein 6                       523   2e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036119.1|  PREDICTED: uncharacterized protein LOC105133725    523   4e-177   
gb|ADE77534.1|  unknown                                                 522   5e-177   
ref|XP_010496419.1|  PREDICTED: uncharacterized protein LOC104773493    522   6e-177   
gb|KHN13850.1|  [Protein-PII] uridylyltransferase                       522   1e-176   
ref|XP_004156949.1|  PREDICTED: uncharacterized LOC101215960            521   2e-176   
ref|XP_010929566.1|  PREDICTED: uncharacterized protein LOC105051...    521   3e-176   
ref|XP_002297856.1|  hypothetical protein POPTR_0001s13490g             521   3e-176   Populus trichocarpa [western balsam poplar]
gb|EMT11618.1|  (Protein-PII) uridylyltransferase                       523   5e-176   
ref|XP_008459880.1|  PREDICTED: uncharacterized protein LOC103498...    520   7e-176   
ref|XP_003552661.1|  PREDICTED: uncharacterized protein LOC100816426    520   1e-175   
gb|EYU42079.1|  hypothetical protein MIMGU_mgv1a006197mg                519   1e-175   
ref|XP_003621757.1|  hypothetical protein MTR_7g022470                  519   2e-175   
ref|XP_009792706.1|  PREDICTED: uncharacterized protein LOC104239695    518   4e-175   
ref|XP_007043903.1|  ACT domain repeat 4 isoform 1                      518   8e-175   
ref|XP_011098918.1|  PREDICTED: uncharacterized protein LOC105177449    516   1e-174   
ref|XP_006338714.1|  PREDICTED: uncharacterized protein LOC102582...    516   1e-174   
ref|XP_007038044.1|  ACT domain repeat 6 isoform 2                      515   2e-174   
ref|XP_010028976.1|  PREDICTED: uncharacterized protein LOC104419...    516   2e-174   
ref|XP_008459879.1|  PREDICTED: uncharacterized protein LOC103498...    515   4e-174   
ref|XP_006297724.1|  hypothetical protein CARUB_v10013759mg             514   7e-174   
ref|XP_010543092.1|  PREDICTED: uncharacterized protein LOC104816118    515   8e-174   
ref|XP_004140541.1|  PREDICTED: uncharacterized protein LOC101218687    514   1e-173   
ref|XP_009134574.1|  PREDICTED: uncharacterized protein LOC103858...    513   1e-173   
gb|EYU31837.1|  hypothetical protein MIMGU_mgv1a007510mg                512   2e-173   
ref|XP_009613029.1|  PREDICTED: uncharacterized protein LOC104106236    513   2e-173   
ref|XP_009372243.1|  PREDICTED: uncharacterized protein LOC103961427    513   2e-173   
ref|XP_008340245.1|  PREDICTED: uncharacterized protein LOC103403190    512   6e-173   
gb|ADE76039.1|  unknown                                                 513   7e-173   
ref|XP_008790789.1|  PREDICTED: uncharacterized protein LOC103707875    511   2e-172   
ref|XP_006338713.1|  PREDICTED: uncharacterized protein LOC102582...    510   4e-172   
emb|CDX74326.1|  BnaA03g27210D                                          509   6e-172   
ref|XP_007139290.1|  hypothetical protein PHAVU_008G016800g             510   6e-172   
ref|XP_009611121.1|  PREDICTED: uncharacterized protein LOC104104...    509   2e-171   
gb|KDO64432.1|  hypothetical protein CISIN_1g013722mg                   508   2e-171   
gb|AAF03449.1|AC010797_25  unknown protein                              509   2e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231764.1|  PREDICTED: uncharacterized protein LOC101263860    508   3e-171   
ref|XP_006436882.1|  hypothetical protein CICLE_v10031571mg             507   5e-171   
emb|CDX91919.1|  BnaC03g32210D                                          506   7e-171   
ref|XP_010927752.1|  PREDICTED: uncharacterized protein LOC105049714    506   2e-170   
gb|KHG16874.1|  hypothetical protein F383_22441                         526   2e-170   
ref|XP_008790740.1|  PREDICTED: uncharacterized protein LOC103707843    506   2e-170   
ref|XP_010556116.1|  PREDICTED: uncharacterized protein LOC104825486    506   3e-170   
ref|XP_004492064.1|  PREDICTED: uncharacterized protein LOC101498352    505   4e-170   
gb|KHN27192.1|  [Protein-PII] uridylyltransferase                       504   5e-170   
ref|XP_009134572.1|  PREDICTED: uncharacterized protein LOC103858...    504   1e-169   
ref|XP_004982475.1|  PREDICTED: uncharacterized protein LOC101774...    500   7e-169   
ref|XP_002304667.1|  hypothetical protein POPTR_0003s16620g             501   2e-168   Populus trichocarpa [western balsam poplar]
ref|XP_002990728.1|  hypothetical protein SELMODRAFT_132226             501   3e-168   
ref|XP_002986703.1|  hypothetical protein SELMODRAFT_124581             501   3e-168   
ref|XP_011020811.1|  PREDICTED: uncharacterized protein LOC105123048    497   8e-167   
ref|XP_006367527.1|  PREDICTED: uncharacterized protein LOC102594553    496   2e-166   
ref|XP_006574875.1|  PREDICTED: uncharacterized protein LOC100798999    495   2e-166   
ref|XP_009134571.1|  PREDICTED: uncharacterized protein LOC103858...    496   2e-166   
ref|XP_009799495.1|  PREDICTED: uncharacterized protein LOC104245...    495   4e-166   
ref|XP_009413600.1|  PREDICTED: uncharacterized protein LOC103994872    494   8e-166   
ref|XP_006493237.1|  PREDICTED: uncharacterized protein LOC102624...    494   1e-165   
ref|XP_004228427.1|  PREDICTED: uncharacterized protein LOC101262744    493   4e-165   
ref|XP_002318060.1|  hypothetical protein POPTR_0012s08480g             489   6e-164   Populus trichocarpa [western balsam poplar]
ref|XP_010277393.1|  PREDICTED: uncharacterized protein LOC104611...    489   8e-164   
gb|EYU37402.1|  hypothetical protein MIMGU_mgv1a005812mg                489   2e-163   
ref|XP_009134569.1|  PREDICTED: uncharacterized protein LOC103858...    488   9e-163   
dbj|BAJ95140.1|  predicted protein                                      486   9e-163   
ref|XP_011000959.1|  PREDICTED: uncharacterized protein LOC105108...    484   1e-162   
ref|XP_006369837.1|  hypothetical protein POPTR_0001s33460g             483   2e-162   
ref|XP_002321721.2|  hypothetical protein POPTR_0015s11240g             484   5e-162   
ref|XP_003614266.1|  ACR4                                               479   6e-162   
ref|XP_010276411.1|  PREDICTED: uncharacterized protein LOC104611164    483   2e-161   
ref|XP_011023953.1|  PREDICTED: uncharacterized protein LOC105125277    477   2e-159   
gb|ACJ84936.1|  unknown                                                 474   5e-159   
ref|XP_004974013.1|  PREDICTED: uncharacterized protein LOC101766...    476   1e-158   
ref|XP_011081096.1|  PREDICTED: uncharacterized protein LOC105164190    475   2e-158   
ref|XP_010270359.1|  PREDICTED: uncharacterized protein LOC104606716    474   9e-158   
ref|XP_002302203.1|  hypothetical protein POPTR_0002s07550g             473   2e-157   
ref|XP_002281251.1|  PREDICTED: uncharacterized protein LOC100242743    473   2e-157   
emb|CBI34815.3|  unnamed protein product                                472   2e-157   
ref|XP_004974012.1|  PREDICTED: uncharacterized protein LOC101766...    473   2e-157   
ref|XP_011027407.1|  PREDICTED: uncharacterized protein LOC105127...    470   1e-156   
gb|KDP43084.1|  hypothetical protein JCGZ_25270                         470   2e-156   
ref|XP_002986453.1|  hypothetical protein SELMODRAFT_124305             470   2e-156   
ref|XP_002318147.1|  hypothetical protein POPTR_0012s10390g             470   3e-156   
ref|XP_003538563.1|  PREDICTED: uncharacterized protein LOC100806283    469   4e-156   
ref|XP_008373875.1|  PREDICTED: uncharacterized protein LOC103437194    469   6e-156   
ref|XP_006368726.1|  ACT domain-containing family protein               468   7e-156   
ref|XP_002978936.1|  hypothetical protein SELMODRAFT_109915             469   8e-156   
ref|XP_006599014.1|  PREDICTED: uncharacterized protein LOC100818...    466   2e-155   
ref|XP_002268570.1|  PREDICTED: uncharacterized protein LOC100250...    468   2e-155   
ref|XP_006472891.1|  PREDICTED: uncharacterized protein LOC102609...    468   2e-155   
ref|XP_010664860.1|  PREDICTED: uncharacterized protein LOC100250...    468   2e-155   
ref|XP_009373348.1|  PREDICTED: uncharacterized protein LOC103962372    467   2e-155   
ref|XP_003634395.1|  PREDICTED: uncharacterized protein LOC100250...    468   2e-155   
ref|XP_011029105.1|  PREDICTED: uncharacterized protein LOC105128946    467   3e-155   
ref|XP_002509632.1|  amino acid binding protein, putative               466   4e-155   
ref|XP_006440437.1|  hypothetical protein CICLE_v10020159mg             466   4e-155   
ref|XP_010260456.1|  PREDICTED: uncharacterized protein LOC104599...    466   6e-155   
ref|XP_011101934.1|  PREDICTED: uncharacterized protein LOC105179968    466   8e-155   
gb|ABK22147.1|  unknown                                                 466   1e-154   
ref|XP_006434331.1|  hypothetical protein CICLE_v10001100mg             466   1e-154   
ref|XP_007137510.1|  hypothetical protein PHAVU_009G133100g             465   1e-154   
ref|XP_002304443.1|  ACT domain-containing family protein               465   2e-154   
ref|XP_002974009.1|  hypothetical protein SELMODRAFT_100599             465   4e-154   
ref|XP_003523410.1|  PREDICTED: uncharacterized protein LOC100789...    464   6e-154   
gb|KHG09126.1|  [Protein-PII] uridylyltransferase                       464   6e-154   
ref|XP_006477308.1|  PREDICTED: uncharacterized protein LOC102613...    464   6e-154   
ref|XP_007161678.1|  hypothetical protein PHAVU_001G089200g             461   8e-154   
ref|XP_010679322.1|  PREDICTED: uncharacterized protein LOC104894719    463   9e-154   
ref|XP_011033868.1|  PREDICTED: uncharacterized protein LOC105132218    463   9e-154   
ref|XP_002306671.1|  ACT domain-containing family protein               462   1e-153   
ref|XP_008238666.1|  PREDICTED: uncharacterized protein LOC103337282    462   2e-153   
ref|XP_007019285.1|  ACT domain repeat 3 isoform 1                      462   3e-153   
gb|EYU32470.1|  hypothetical protein MIMGU_mgv1a006244mg                462   4e-153   
ref|XP_007208916.1|  hypothetical protein PRUPE_ppa1027134mg            461   8e-153   
ref|XP_004298708.1|  PREDICTED: uncharacterized protein LOC101304477    460   1e-152   
ref|XP_003517440.1|  PREDICTED: uncharacterized protein LOC100780903    460   1e-152   
gb|KDP25581.1|  hypothetical protein JCGZ_20737                         460   2e-152   
ref|XP_009767148.1|  PREDICTED: uncharacterized protein LOC104218369    459   3e-152   
ref|XP_009385211.1|  PREDICTED: uncharacterized protein LOC103972582    460   4e-152   
ref|XP_008808483.1|  PREDICTED: uncharacterized protein LOC103720...    459   5e-152   
ref|XP_009588356.1|  PREDICTED: uncharacterized protein LOC104085940    458   7e-152   
ref|XP_010108109.1|  [Protein-PII] uridylyltransferase                  458   8e-152   
ref|XP_004975424.1|  PREDICTED: uncharacterized protein LOC101777096    459   9e-152   
ref|XP_004974011.1|  PREDICTED: uncharacterized protein LOC101766285    459   1e-151   
ref|XP_010053392.1|  PREDICTED: uncharacterized protein LOC104441845    457   1e-151   
ref|XP_010260453.1|  PREDICTED: uncharacterized protein LOC104599...    458   1e-151   
ref|XP_009780757.1|  PREDICTED: uncharacterized protein LOC104229755    457   2e-151   
ref|XP_006847223.1|  hypothetical protein AMTR_s00017p00256400          457   2e-151   
ref|NP_001052645.1|  Os04g0391500                                       458   2e-151   
ref|XP_010537315.1|  PREDICTED: uncharacterized protein LOC104812060    457   2e-151   
dbj|BAJ99866.1|  predicted protein                                      457   2e-151   
gb|EYU40556.1|  hypothetical protein MIMGU_mgv1a006507mg                457   2e-151   
ref|XP_010999853.1|  PREDICTED: uncharacterized protein LOC105107576    457   3e-151   
ref|XP_004498366.1|  PREDICTED: uncharacterized protein LOC101494...    457   3e-151   
ref|XP_004244583.1|  PREDICTED: uncharacterized protein LOC101243731    457   3e-151   
ref|XP_006363718.1|  PREDICTED: uncharacterized protein LOC102603691    457   3e-151   
ref|XP_008437163.1|  PREDICTED: uncharacterized protein LOC103482670    457   3e-151   
ref|XP_010062190.1|  PREDICTED: uncharacterized protein LOC104449657    456   4e-151   
ref|XP_007201032.1|  hypothetical protein PRUPE_ppa005671mg             456   5e-151   
ref|XP_003526664.1|  PREDICTED: uncharacterized protein LOC100797...    456   7e-151   
ref|XP_009339717.1|  PREDICTED: uncharacterized protein LOC103931913    455   8e-151   
ref|XP_004245697.1|  PREDICTED: uncharacterized protein LOC101260460    456   8e-151   
ref|XP_008237781.1|  PREDICTED: uncharacterized protein LOC103336...    456   1e-150   
gb|AGT16038.1|  hypothetical protein SHCRBa_044_D02_F_200               456   1e-150   
ref|XP_004147566.1|  PREDICTED: uncharacterized protein LOC101209959    455   1e-150   
ref|XP_008448923.1|  PREDICTED: uncharacterized protein LOC103490944    455   1e-150   
gb|KHN34976.1|  [Protein-PII] uridylyltransferase                       454   2e-150   
ref|XP_006581605.1|  PREDICTED: uncharacterized protein LOC100797...    456   2e-150   
tpg|DAA38119.1|  TPA: ACR4                                              454   3e-150   
ref|XP_008804003.1|  PREDICTED: uncharacterized protein LOC103717...    454   6e-150   
ref|XP_009104635.1|  PREDICTED: uncharacterized protein LOC103830578    453   8e-150   
emb|CDP09866.1|  unnamed protein product                                453   9e-150   
emb|CDX79183.1|  BnaC06g21200D                                          453   9e-150   
ref|XP_010930652.1|  PREDICTED: uncharacterized protein LOC105051758    452   1e-149   
ref|XP_006851819.1|  hypothetical protein AMTR_s00041p00050300          452   1e-149   
ref|XP_007040015.1|  ACT domain repeat 8                                452   2e-149   
emb|CDX87550.1|  BnaA07g33230D                                          452   2e-149   
emb|CDX88335.1|  BnaC06g37790D                                          452   3e-149   
ref|NP_565146.1|  ACT domain-containing protein 3                       452   3e-149   
ref|XP_010416625.1|  PREDICTED: uncharacterized protein LOC104702470    452   3e-149   
ref|NP_001147811.1|  ACR4                                               451   5e-149   
ref|XP_009623593.1|  PREDICTED: uncharacterized protein LOC104114...    451   6e-149   
gb|AGT16037.1|  hypothetical protein SHCRBa_044_D02_F_100               452   6e-149   
ref|XP_002520259.1|  amino acid binding protein, putative               451   7e-149   
ref|XP_010905893.1|  PREDICTED: uncharacterized protein LOC105032...    450   9e-149   
ref|XP_007155605.1|  hypothetical protein PHAVU_003G216100g             450   1e-148   
ref|XP_010428767.1|  PREDICTED: uncharacterized protein LOC104713366    450   1e-148   
ref|XP_004511642.1|  PREDICTED: uncharacterized protein LOC101488930    449   1e-148   
ref|XP_009385445.1|  PREDICTED: uncharacterized protein LOC103972808    450   2e-148   
gb|AAM65519.1|  unknown                                                 450   2e-148   
gb|KHN23444.1|  [Protein-PII] uridylyltransferase                       452   2e-148   
gb|KGN55928.1|  hypothetical protein Csa_3G036540                       450   2e-148   
ref|XP_003541896.1|  PREDICTED: uncharacterized protein LOC100797...    449   2e-148   
ref|XP_006358366.1|  PREDICTED: uncharacterized protein LOC102578578    449   3e-148   
ref|XP_009360670.1|  PREDICTED: uncharacterized protein LOC103951...    449   3e-148   
ref|XP_004171478.1|  PREDICTED: uncharacterized LOC101205369            449   3e-148   
ref|XP_010676642.1|  PREDICTED: uncharacterized protein LOC104892413    449   3e-148   
emb|CDX68068.1|  BnaA07g21080D                                          449   3e-148   
ref|XP_009106363.1|  PREDICTED: uncharacterized protein LOC103832156    449   4e-148   
ref|NP_001152134.1|  ACR4                                               449   4e-148   
tpg|DAA48236.1|  TPA: ACR4                                              449   4e-148   
ref|XP_008804002.1|  PREDICTED: uncharacterized protein LOC103717...    449   4e-148   
gb|EPS66237.1|  hypothetical protein M569_08538                         449   4e-148   
ref|XP_002445806.1|  hypothetical protein SORBIDRAFT_07g026090          449   6e-148   
ref|XP_008237779.1|  PREDICTED: uncharacterized protein LOC103336...    448   8e-148   
ref|XP_010055557.1|  PREDICTED: uncharacterized protein LOC104443739    448   8e-148   
ref|XP_004147955.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    447   1e-147   
ref|XP_006390132.1|  hypothetical protein EUTSA_v10018530mg             447   1e-147   
gb|KHN42726.1|  [Protein-PII] uridylyltransferase                       446   2e-147   
gb|KHG13930.1|  [Protein-PII] uridylyltransferase                       447   2e-147   
ref|XP_006493239.1|  PREDICTED: uncharacterized protein LOC102624...    445   3e-147   
ref|XP_007158417.1|  hypothetical protein PHAVU_002G151300g             446   3e-147   
ref|XP_009393011.1|  PREDICTED: uncharacterized protein LOC103978802    446   5e-147   
ref|XP_010934544.1|  PREDICTED: uncharacterized protein LOC105054670    447   5e-147   
ref|XP_009368404.1|  PREDICTED: uncharacterized protein LOC103957905    446   5e-147   
ref|XP_008381705.1|  PREDICTED: uncharacterized protein LOC103444...    446   6e-147   
ref|XP_003525780.1|  PREDICTED: uncharacterized protein LOC100802262    445   1e-146   
ref|XP_002887664.1|  hypothetical protein ARALYDRAFT_476859             445   1e-146   
ref|XP_003549893.2|  PREDICTED: uncharacterized protein LOC100794729    445   1e-146   
gb|KHN09770.1|  [Protein-PII] uridylyltransferase                       445   1e-146   
emb|CDP11981.1|  unnamed protein product                                445   1e-146   
ref|XP_009611122.1|  PREDICTED: uncharacterized protein LOC104104...    444   1e-146   
ref|XP_003608787.1|  hypothetical protein MTR_4g101950                  444   1e-146   
ref|XP_004982476.1|  PREDICTED: uncharacterized protein LOC101774...    441   2e-146   
ref|XP_009790961.1|  PREDICTED: uncharacterized protein LOC104238336    444   2e-146   
ref|NP_001062346.1|  Os08g0533600                                       445   2e-146   
ref|XP_006596251.1|  PREDICTED: uncharacterized protein LOC100789...    444   2e-146   
ref|XP_002445807.1|  hypothetical protein SORBIDRAFT_07g026100          445   3e-146   
gb|EAZ07778.1|  hypothetical protein OsI_30031                          444   5e-146   
gb|KHG23892.1|  [Protein-PII] uridylyltransferase                       443   6e-146   
ref|XP_008811478.1|  PREDICTED: uncharacterized protein LOC103722634    443   7e-146   
ref|XP_006447025.1|  hypothetical protein CICLE_v10015110mg             440   7e-146   
ref|XP_008791268.1|  PREDICTED: uncharacterized protein LOC103708225    442   2e-145   
gb|KDO63882.1|  hypothetical protein CISIN_1g013535mg                   439   2e-145   
ref|XP_004290721.1|  PREDICTED: uncharacterized protein LOC101309692    442   2e-145   
ref|XP_004515757.1|  PREDICTED: uncharacterized protein LOC101496193    441   3e-145   
ref|XP_003611221.1|  hypothetical protein MTR_5g011580                  441   4e-145   
gb|EYU29019.1|  hypothetical protein MIMGU_mgv1a006539mg                441   5e-145   
ref|XP_004502566.1|  PREDICTED: uncharacterized protein LOC101511775    440   1e-144   
gb|KEH35390.1|  four ACT domain ACT domain protein which protein        440   1e-144   
ref|XP_011070876.1|  PREDICTED: uncharacterized protein LOC105156446    439   1e-144   
gb|EEC83941.1|  hypothetical protein OsI_30028                          440   2e-144   
ref|XP_001775245.1|  predicted protein                                  439   2e-144   
gb|KHG16540.1|  [Protein-PII] uridylyltransferase                       437   1e-143   
ref|XP_004242056.1|  PREDICTED: uncharacterized protein LOC101244...    437   1e-143   
ref|XP_010940980.1|  PREDICTED: uncharacterized protein LOC105059401    437   1e-143   
ref|XP_006356716.1|  PREDICTED: uncharacterized protein LOC102587087    434   2e-142   
ref|XP_010028977.1|  PREDICTED: uncharacterized protein LOC104419...    430   6e-142   
ref|XP_008346542.1|  PREDICTED: uncharacterized protein LOC103409499    437   1e-141   
ref|XP_010533743.1|  PREDICTED: uncharacterized protein LOC104809438    431   2e-141   
ref|XP_009799496.1|  PREDICTED: uncharacterized protein LOC104245...    430   3e-141   
ref|XP_011027413.1|  PREDICTED: uncharacterized protein LOC105127...    429   4e-141   
ref|XP_009391099.1|  PREDICTED: uncharacterized protein LOC103977327    431   5e-141   
ref|XP_009416935.1|  PREDICTED: uncharacterized protein LOC103997445    430   6e-141   
ref|XP_009382898.1|  PREDICTED: uncharacterized protein LOC103970718    431   6e-141   
ref|XP_006297726.1|  hypothetical protein CARUB_v10013759mg             426   7e-141   
gb|KDO63883.1|  hypothetical protein CISIN_1g013535mg                   424   3e-140   
ref|XP_009623594.1|  PREDICTED: uncharacterized protein LOC104114...    427   3e-140   
ref|XP_009391844.1|  PREDICTED: uncharacterized protein LOC103977913    429   3e-140   
ref|XP_010546201.1|  PREDICTED: uncharacterized protein LOC104818340    428   3e-140   
dbj|BAD11660.1|  uridylyl transferase-like                              429   4e-140   
gb|ACN34303.1|  unknown                                                 426   2e-139   
gb|AES78350.2|  four ACT domain ACT domain protein which protein        422   2e-139   
ref|NP_001169709.1|  hypothetical protein                               426   6e-139   
ref|XP_001764811.1|  predicted protein                                  424   2e-138   
ref|XP_001769236.1|  predicted protein                                  423   4e-138   
ref|XP_009404248.1|  PREDICTED: uncharacterized protein LOC103987...    420   4e-138   
ref|XP_009389180.1|  PREDICTED: uncharacterized protein LOC103975814    422   8e-138   
ref|XP_009416235.1|  PREDICTED: uncharacterized protein LOC103996875    421   2e-137   
ref|XP_010089340.1|  [Protein-PII] uridylyltransferase                  421   4e-137   
ref|NP_001062345.1|  Os08g0533300                                       420   3e-136   
gb|KEH40482.1|  four ACT domain ACT domain protein which protein        426   4e-136   
ref|XP_009110649.1|  PREDICTED: uncharacterized protein LOC103836164    417   4e-136   
ref|XP_002265013.2|  PREDICTED: uncharacterized protein LOC100264...    417   3e-135   
ref|XP_010273298.1|  PREDICTED: uncharacterized protein LOC104608...    417   4e-135   
emb|CDY21051.1|  BnaA08g24740D                                          414   9e-135   
gb|KFK43503.1|  hypothetical protein AALP_AA1G133800                    412   5e-134   
emb|CDX98065.1|  BnaA06g08160D                                          412   7e-134   
ref|XP_002892686.1|  hypothetical protein ARALYDRAFT_471392             411   1e-133   
gb|KDP32101.1|  hypothetical protein JCGZ_12562                         412   2e-133   
ref|XP_006302326.1|  hypothetical protein CARUB_v10020382mg             410   2e-133   
emb|CDY30079.1|  BnaC05g09410D                                          411   2e-133   
ref|XP_010476213.1|  PREDICTED: uncharacterized protein LOC104755509    410   3e-133   
ref|XP_009148593.1|  PREDICTED: uncharacterized protein LOC103872005    410   4e-133   
ref|NP_172704.1|  ACT domain repeat 8 protein                           410   5e-133   
ref|NP_001148163.1|  LOC100281771                                       410   7e-133   
ref|XP_010273258.1|  PREDICTED: uncharacterized protein LOC104608...    411   7e-133   
ref|XP_001759051.1|  predicted protein                                  409   1e-132   
ref|XP_010494153.1|  PREDICTED: uncharacterized protein LOC104771333    408   2e-132   
ref|XP_010458670.1|  PREDICTED: uncharacterized protein LOC104739891    408   3e-132   
gb|ACL53688.1|  unknown                                                 408   5e-132   
ref|XP_006307537.1|  hypothetical protein CARUB_v10009162mg             407   8e-132   
ref|XP_002525301.1|  amino acid binding protein, putative               406   3e-131   
ref|XP_010435682.1|  PREDICTED: uncharacterized protein LOC104719442    402   5e-131   
ref|XP_010936170.1|  PREDICTED: uncharacterized protein LOC105055...    407   5e-131   
ref|XP_011007844.1|  PREDICTED: uncharacterized protein LOC105113386    405   7e-131   
ref|XP_010538770.1|  PREDICTED: uncharacterized protein LOC104813003    404   8e-131   
gb|EPS60319.1|  hypothetical protein M569_14485                         402   1e-130   
gb|EPS65790.1|  hypothetical protein M569_08987                         404   1e-130   
ref|XP_010540109.1|  PREDICTED: uncharacterized protein LOC104813...    404   1e-130   
ref|XP_002320665.2|  hypothetical protein POPTR_0014s00840g             404   2e-130   
ref|XP_003575136.1|  PREDICTED: uncharacterized protein LOC100839017    402   4e-130   
ref|XP_010936169.1|  PREDICTED: uncharacterized protein LOC105055...    406   7e-130   
ref|XP_006297725.1|  hypothetical protein CARUB_v10013759mg             396   1e-129   
ref|XP_004952805.1|  PREDICTED: uncharacterized protein LOC101775...    400   4e-129   
ref|NP_001047123.1|  Os02g0555600                                       400   7e-129   
ref|XP_002310330.2|  hypothetical protein POPTR_0007s14780g             400   8e-129   



>ref|XP_009784019.1| PREDICTED: uncharacterized protein LOC104232494 [Nicotiana sylvestris]
Length=449

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/449 (87%), Positives = 420/449 (94%), Gaps = 2/449 (0%)
 Frame = +3

Query  258   MEATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             MEATVSYSQN MDDEYEK IRRMNPPRVVIDNE+CKNATVIQVDSANK G LLEVVQ+LT
Sbjct  1     MEATVSYSQNIMDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKRGILLEVVQILT  60

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVG  614
             DLNLIITKAYICSDGGWFMDVFNVTNQEG+KI +E +LDYIMKSLGP+SCFASSMRRSVG
Sbjct  61    DLNLIITKAYICSDGGWFMDVFNVTNQEGNKITEEPILDYIMKSLGPESCFASSMRRSVG  120

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             VT+G DHTSIELIGSDRPGLLSEVSAVLTNL+CNVVNAEVWTHNTRAAAIMQVTD+E GG
Sbjct  121   VTTGMDHTSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDENGG  180

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             AV+DPE L+M+KKLLCNVL+GSNKSR AKT ++HG THT+RRLHQLMFADRDYERA+ + 
Sbjct  181   AVSDPERLTMVKKLLCNVLRGSNKSRDAKTLVSHGVTHTERRLHQLMFADRDYERATGDG  240

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
              +  +RPNV+V NW D+DYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVD EGPEAY
Sbjct  241   SDDKERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDTEGPEAY  300

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEYCIRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRE
Sbjct  301   QEYCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  360

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT  1514
             NSLTVTRAEV TR GKA+NTFYV D+SGYPVDA+IIESVRQTIGQTIL+VKGNPEE NP 
Sbjct  361   NSLTVTRAEVTTRAGKALNTFYVSDSSGYPVDAKIIESVRQTIGQTILRVKGNPEELNPV  420

Query  1515  -QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              QESPTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  421   QQESPTRFLFGGLFKSRSFCNFGLVRSYS  449



>ref|XP_004239021.1| PREDICTED: uncharacterized protein LOC101259744 [Solanum lycopersicum]
Length=449

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/449 (87%), Positives = 418/449 (93%), Gaps = 2/449 (0%)
 Frame = +3

Query  258   MEATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             MEAT+SYSQN MDDEYEK IRRMNPPRVVIDNE+CKNATVIQVDSANKHG LLEVVQ+LT
Sbjct  1     MEATMSYSQNIMDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQILT  60

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVG  614
             DLN IITKAYICSDGGWFMDVFNVTNQEG+KI +E +LDYIMKSLGPDSCFASSMRRSVG
Sbjct  61    DLNFIITKAYICSDGGWFMDVFNVTNQEGNKITEEPILDYIMKSLGPDSCFASSMRRSVG  120

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             VT+G DHTSIELIGSDRPGLLSEVSAVLTNL+CNVVNAEVWTHNTRAAAIMQVTD+ETGG
Sbjct  121   VTTGMDHTSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDETGG  180

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             A+ D E LSMIKKLLCNVL+GSNKSR AKT ++HG THTDRRLHQLMFADRDYERA+ + 
Sbjct  181   AIADAEKLSMIKKLLCNVLRGSNKSRDAKTLLSHGVTHTDRRLHQLMFADRDYERATGDG  240

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
              +  +RPNV+V NW D+DYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVD EGPEAY
Sbjct  241   SDDKERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDTEGPEAY  300

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEYCIRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE
Sbjct  301   QEYCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  360

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT  1514
             NSLTVTRAEV+TR GKA+NTFYV D+SGYPVD +IIESVRQTIGQTIL+VKG+PEE NP 
Sbjct  361   NSLTVTRAEVSTRAGKALNTFYVRDSSGYPVDTKIIESVRQTIGQTILRVKGSPEELNPV  420

Query  1515  -QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              QESPTR LFGG+FKSRSFCNFG VRSYS
Sbjct  421   QQESPTRFLFGGLFKSRSFCNFGSVRSYS  449



>ref|XP_006348650.1| PREDICTED: uncharacterized protein LOC102583967 [Solanum tuberosum]
Length=449

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/449 (87%), Positives = 418/449 (93%), Gaps = 2/449 (0%)
 Frame = +3

Query  258   MEATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             MEAT+SYSQN MDDEYEK IRRMNPPRVVIDNE+CKNATVIQVDSANKHG LLEVVQ+LT
Sbjct  1     MEATMSYSQNIMDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQILT  60

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVG  614
             DLN IITKAYICSDGGWFMDVFNVTNQ+G+KI +E +LDYIMKSLGPDSCFASSMRRSVG
Sbjct  61    DLNFIITKAYICSDGGWFMDVFNVTNQDGNKITEEPILDYIMKSLGPDSCFASSMRRSVG  120

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             VT+G DHTSIELIGSDRPGLLSEVSAVLTNL+CNVVNAEVWTHNTRAAAIMQVTD+ETGG
Sbjct  121   VTTGMDHTSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDETGG  180

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             A+ D E LSMIKKLLCNVL+GSNKSR AKT ++HG THTDRRLHQLMFADRDYERA+ + 
Sbjct  181   AIADAEKLSMIKKLLCNVLRGSNKSRDAKTLLSHGVTHTDRRLHQLMFADRDYERAAGDG  240

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
              +  +RPNV+V NW D+DYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVD EGPEAY
Sbjct  241   SDDKERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDTEGPEAY  300

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEYCIRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE
Sbjct  301   QEYCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  360

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT  1514
             NSLTVTRAEV+TR GKA+NTFYV D+SGYPVD +IIESVRQTIGQTIL+VKG+PEE NP 
Sbjct  361   NSLTVTRAEVSTRAGKALNTFYVRDSSGYPVDTKIIESVRQTIGQTILRVKGSPEELNPV  420

Query  1515  -QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              QESPTR LFGG+FKSRSFCNFG VRSYS
Sbjct  421   QQESPTRFLFGGLFKSRSFCNFGSVRSYS  449



>ref|XP_009613079.1| PREDICTED: uncharacterized protein LOC104106280 [Nicotiana tomentosiformis]
Length=449

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/449 (87%), Positives = 418/449 (93%), Gaps = 2/449 (0%)
 Frame = +3

Query  258   MEATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             MEATVSYSQN MDDEYEK IRRMNPPRVVIDNE+CKNATVIQVDSANKHG LLEVVQVLT
Sbjct  1     MEATVSYSQNIMDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQVLT  60

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVG  614
             DLNL ITKAYICSDGGWFMDVFNVTNQEG+KI +E +LDYIMKSLGPDSCFASSMRRSVG
Sbjct  61    DLNLTITKAYICSDGGWFMDVFNVTNQEGNKITEEPILDYIMKSLGPDSCFASSMRRSVG  120

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             VT+G +HTSIELIGSDRPGLLSEVSAVLTNL+CNVVNAEVWTHNTRAAAIMQVTD+E GG
Sbjct  121   VTTGMNHTSIELIGSDRPGLLSEVSAVLTNLRCNVVNAEVWTHNTRAAAIMQVTDDENGG  180

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             AV+D E L+M+KKLLCNVL+GSNKSR AKT ++HG THT+RRLHQLMFADRDYERA  + 
Sbjct  181   AVSDLERLTMVKKLLCNVLRGSNKSRDAKTLVSHGVTHTERRLHQLMFADRDYERAMGDG  240

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
              +  +RPNV+V NW D+DYSVVTIRCKDRPKLLFD ICT+TDM+YVVFHGNVD EGPEAY
Sbjct  241   SDDKERPNVNVVNWQDKDYSVVTIRCKDRPKLLFDTICTMTDMQYVVFHGNVDTEGPEAY  300

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEYCIRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRE
Sbjct  301   QEYCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  360

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT  1514
             NSLTVTRAEV TR GKA+NTFYV D+SGYPVDA+IIESVRQTIGQTIL+VKGNPEE NP 
Sbjct  361   NSLTVTRAEVTTRAGKALNTFYVSDSSGYPVDAKIIESVRQTIGQTILRVKGNPEELNPV  420

Query  1515  -QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              QESPTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  421   QQESPTRFLFGGLFKSRSFCNFGLVRSYS  449



>ref|XP_011102236.1| PREDICTED: uncharacterized protein LOC105180260 isoform X1 [Sesamum 
indicum]
 ref|XP_011102238.1| PREDICTED: uncharacterized protein LOC105180260 isoform X1 [Sesamum 
indicum]
Length=448

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/448 (85%), Positives = 420/448 (94%), Gaps = 1/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             MEA+VS+SQNMDDEYEKLIRRMNPPRVVIDNE+CKNATVIQVDSANK G LLEVVQVLTD
Sbjct  1     MEASVSFSQNMDDEYEKLIRRMNPPRVVIDNESCKNATVIQVDSANKQGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL+ITKAYICSDGGWFMDVFNVT+ +G+KI DE +LDYI KSLGPDSCFASSMRRSVGV
Sbjct  61    LNLMITKAYICSDGGWFMDVFNVTDHDGNKITDEGILDYIQKSLGPDSCFASSMRRSVGV  120

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
             TSG DHTSIELIGSDRPGLLSEVSAVLT+LKCNVVNAEVWTHNTRAAA+MQVTDEE GGA
Sbjct  121   TSGMDHTSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDEENGGA  180

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDPE L+M+K+LLCNVLKGSNKSR AKT ++ GATHT+RRLHQ+MF DRDYER  +++ 
Sbjct  181   ITDPERLAMVKRLLCNVLKGSNKSREAKTVVSVGATHTERRLHQMMFDDRDYERMGNDSA  240

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +  +RPNV+V NWHD+DYSVVTIRCKDRPKLLFD++CTLTDM+YVVFHGNVDAEGPEAYQ
Sbjct  241   DEKERPNVNVVNWHDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVDAEGPEAYQ  300

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EYCIRHIDGSPVKSDAERQRVI CLEAAI+RRVSEGLKLELCT+DRVGLLS+VTRIFREN
Sbjct  301   EYCIRHIDGSPVKSDAERQRVIQCLEAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFREN  360

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-  1514
             SLTVTRAEVATR GKAVNTFYV DASGYPVD +II+S+RQTIGQTIL+VKG+PEE N   
Sbjct  361   SLTVTRAEVATRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTILRVKGSPEESNQVP  420

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  421   QESPTRFLFGGLFKSRSFCNFGLVRSYS  448



>ref|XP_009627377.1| PREDICTED: uncharacterized protein LOC104117932 isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/447 (86%), Positives = 414/447 (93%), Gaps = 2/447 (0%)
 Frame = +3

Query  264   ATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             ATVSYS N MDDEYEK IRRMNPPRVVIDNE+CKNAT+IQVDSANKHG LLEVVQVLTDL
Sbjct  2     ATVSYSHNIMDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDL  61

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NL+ITKAYI SDGGWFMDVFNVTNQEG+KI DEA+LDYIM+SLGPDSCFASSMRRSVGVT
Sbjct  62    NLVITKAYISSDGGWFMDVFNVTNQEGNKITDEAMLDYIMRSLGPDSCFASSMRRSVGVT  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
             SG DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEE GGA+
Sbjct  122   SGMDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEENGGAI  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALN  980
              DPE LSM+K+LLCNVL+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER +DE L+
Sbjct  182   NDPERLSMMKQLLCNVLRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTADEGLD  241

Query  981   HPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
               +RPNV+V NW D+DYSVVTI CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGPEA+QE
Sbjct  242   DKERPNVNVVNWQDKDYSVVTINCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPEAHQE  301

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             YCIRH+DGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENS
Sbjct  302   YCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENS  361

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-Q  1517
             LTVTRAEV TR GKA+N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN +E NP  Q
Sbjct  362   LTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNVKELNPVRQ  421

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ESPTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  422   ESPTRFLFGGLFKSRSFCNFGLVRSYS  448



>ref|XP_009793984.1| PREDICTED: uncharacterized protein LOC104240797 isoform X1 [Nicotiana 
sylvestris]
Length=448

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/447 (86%), Positives = 414/447 (93%), Gaps = 2/447 (0%)
 Frame = +3

Query  264   ATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             ATVSYSQN MDDEYEK IRRMNPPRVVIDNE+CKNAT+IQVDSANKHG LLEVVQVLTDL
Sbjct  2     ATVSYSQNIMDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDL  61

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NL+ITKAYI SDGGWFMDVFNVTNQEG+KI DEA+LDYIMKSLGPDSCFASSMRRSVGVT
Sbjct  62    NLVITKAYISSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMRRSVGVT  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
             +G DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQV DEE GGA+
Sbjct  122   AGMDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAI  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALN  980
             TDPE LS +K+LLCNVL+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER + E L+
Sbjct  182   TDPERLSTMKQLLCNVLRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLD  241

Query  981   HPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
               DRPNV+V NW D+DYSVVTI+CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP+A+QE
Sbjct  242   DKDRPNVNVVNWQDKDYSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQE  301

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             YCIRH+DGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENS
Sbjct  302   YCIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENS  361

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-Q  1517
             LTVTRAEV TR GKA+N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN EE NP  Q
Sbjct  362   LTVTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIEELNPVPQ  421

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ESPTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  422   ESPTRFLFGGLFKSRSFCNFGLVRSYS  448



>ref|XP_009627378.1| PREDICTED: uncharacterized protein LOC104117932 isoform X2 [Nicotiana 
tomentosiformis]
Length=446

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/445 (86%), Positives = 412/445 (93%), Gaps = 2/445 (0%)
 Frame = +3

Query  270   VSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNL  446
             VSYS N MDDEYEK IRRMNPPRVVIDNE+CKNAT+IQVDSANKHG LLEVVQVLTDLNL
Sbjct  2     VSYSHNIMDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNL  61

Query  447   IITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSG  626
             +ITKAYI SDGGWFMDVFNVTNQEG+KI DEA+LDYIM+SLGPDSCFASSMRRSVGVTSG
Sbjct  62    VITKAYISSDGGWFMDVFNVTNQEGNKITDEAMLDYIMRSLGPDSCFASSMRRSVGVTSG  121

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
              DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEE GGA+ D
Sbjct  122   MDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEENGGAIND  181

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
             PE LSM+K+LLCNVL+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER +DE L+  
Sbjct  182   PERLSMMKQLLCNVLRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTADEGLDDK  241

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
             +RPNV+V NW D+DYSVVTI CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGPEA+QEYC
Sbjct  242   ERPNVNVVNWQDKDYSVVTINCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPEAHQEYC  301

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLT
Sbjct  302   IRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  361

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QES  1523
             VTRAEV TR GKA+N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN +E NP  QES
Sbjct  362   VTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNVKELNPVRQES  421

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
             PTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  422   PTRFLFGGLFKSRSFCNFGLVRSYS  446



>ref|XP_009793985.1| PREDICTED: uncharacterized protein LOC104240797 isoform X2 [Nicotiana 
sylvestris]
Length=446

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/445 (86%), Positives = 412/445 (93%), Gaps = 2/445 (0%)
 Frame = +3

Query  270   VSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNL  446
             VSYSQN MDDEYEK IRRMNPPRVVIDNE+CKNAT+IQVDSANKHG LLEVVQVLTDLNL
Sbjct  2     VSYSQNIMDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNL  61

Query  447   IITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSG  626
             +ITKAYI SDGGWFMDVFNVTNQEG+KI DEA+LDYIMKSLGPDSCFASSMRRSVGVT+G
Sbjct  62    VITKAYISSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMRRSVGVTAG  121

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
              DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQV DEE GGA+TD
Sbjct  122   MDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAITD  181

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
             PE LS +K+LLCNVL+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER + E L+  
Sbjct  182   PERLSTMKQLLCNVLRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLDDK  241

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
             DRPNV+V NW D+DYSVVTI+CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP+A+QEYC
Sbjct  242   DRPNVNVVNWQDKDYSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQEYC  301

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLT
Sbjct  302   IRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  361

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QES  1523
             VTRAEV TR GKA+N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN EE NP  QES
Sbjct  362   VTRAEVTTRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIEELNPVPQES  421

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
             PTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  422   PTRFLFGGLFKSRSFCNFGLVRSYS  446



>ref|XP_006367493.1| PREDICTED: uncharacterized protein LOC102581080 isoform X1 [Solanum 
tuberosum]
Length=448

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/447 (86%), Positives = 410/447 (92%), Gaps = 2/447 (0%)
 Frame = +3

Query  264   ATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             ATVSYSQN MDDEYEK IRRMNPPRVVIDN++CKNATVIQVDSANKHG LLEVVQVLTDL
Sbjct  2     ATVSYSQNIMDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQVLTDL  61

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NL+ITKAYI SDGGWFMDVFNVTNQEG+KI DEA+LDYIMKSLGPDS FASSMRRSVGVT
Sbjct  62    NLVITKAYISSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSSFASSMRRSVGVT  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
             +G D+TSIELIGSDRPGLLSE+SAVLTNLKCNVVNAEVWTHNTRAAAIMQV DEETGG +
Sbjct  122   AGMDYTSIELIGSDRPGLLSEMSAVLTNLKCNVVNAEVWTHNTRAAAIMQVKDEETGGTI  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALN  980
              DPE LSM+K+LLCNVL+ SNK R AKT ++ G +HT+RRLHQLMFADRDYERA+ E L+
Sbjct  182   NDPERLSMMKQLLCNVLRCSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVLD  241

Query  981   HPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
               +RPNVSV NWHD+DYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP A QE
Sbjct  242   EKERPNVSVVNWHDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPVAQQE  301

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             YCIRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENS
Sbjct  302   YCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENS  361

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-Q  1517
             LTVTRAEV TR GKAVN FYV D+SGYPVDA+IIES+RQTIGQTIL VKGN  E NP  Q
Sbjct  362   LTVTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESIRQTIGQTILSVKGNIAELNPVPQ  421

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ESPTR LFGG+FKSRSFCNFGLV+SYS
Sbjct  422   ESPTRFLFGGLFKSRSFCNFGLVKSYS  448



>ref|XP_011102239.1| PREDICTED: uncharacterized protein LOC105180260 isoform X2 [Sesamum 
indicum]
 ref|XP_011102240.1| PREDICTED: uncharacterized protein LOC105180260 isoform X2 [Sesamum 
indicum]
Length=438

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/438 (86%), Positives = 410/438 (94%), Gaps = 1/438 (0%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEKLIRRMNPPRVVIDNE+CKNATVIQVDSANK G LLEVVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNESCKNATVIQVDSANKQGILLEVVQVLTDLNLMITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
             CSDGGWFMDVFNVT+ +G+KI DE +LDYI KSLGPDSCFASSMRRSVGVTSG DHTSIE
Sbjct  61    CSDGGWFMDVFNVTDHDGNKITDEGILDYIQKSLGPDSCFASSMRRSVGVTSGMDHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             LIGSDRPGLLSEVSAVLT+LKCNVVNAEVWTHNTRAAA+MQVTDEE GGA+TDPE L+M+
Sbjct  121   LIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDEENGGAITDPERLAMV  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNVLKGSNKSR AKT ++ GATHT+RRLHQ+MF DRDYER  +++ +  +RPNV+V
Sbjct  181   KRLLCNVLKGSNKSREAKTVVSVGATHTERRLHQMMFDDRDYERMGNDSADEKERPNVNV  240

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              NWHD+DYSVVTIRCKDRPKLLFD++CTLTDM+YVVFHGNVDAEGPEAYQEYCIRHIDGS
Sbjct  241   VNWHDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVDAEGPEAYQEYCIRHIDGS  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PVKSDAERQRVI CLEAAI+RRVSEGLKLELCT+DRVGLLS+VTRIFRENSLTVTRAEVA
Sbjct  301   PVKSDAERQRVIQCLEAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFRENSLTVTRAEVA  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFG  1544
             TR GKAVNTFYV DASGYPVD +II+S+RQTIGQTIL+VKG+PEE N   QESPTR LFG
Sbjct  361   TRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTILRVKGSPEESNQVPQESPTRFLFG  420

Query  1545  GIFKSRSFCNFGLVRSYS  1598
             G+FKSRSFCNFGLVRSYS
Sbjct  421   GLFKSRSFCNFGLVRSYS  438



>emb|CDP00474.1| unnamed protein product [Coffea canephora]
Length=473

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/446 (85%), Positives = 409/446 (92%), Gaps = 1/446 (0%)
 Frame = +3

Query  264   ATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLN  443
             A  SYSQ MDDEYEK IRRMNPPRVVIDNE+CKNATVIQVDSANKHG LLEVVQVLTDLN
Sbjct  28    AWASYSQTMDDEYEKFIRRMNPPRVVIDNESCKNATVIQVDSANKHGILLEVVQVLTDLN  87

Query  444   LIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTS  623
             LIITKAYICSDGGWFMDVF VT+Q+G+KI DE VLDYI KSLGPDSCFASSMRRSVGV  
Sbjct  88    LIITKAYICSDGGWFMDVFKVTDQDGNKITDEGVLDYIQKSLGPDSCFASSMRRSVGVVP  147

Query  624   GTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVT  803
               DHTSIELIGSDRPGLLSEVSAVLT+LKCNVVNAEVWTHNTRAAA+MQVTD+ETG A+T
Sbjct  148   AMDHTSIELIGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNTRAAAVMQVTDKETGAAIT  207

Query  804   DPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNH  983
             DPE L+MIK+LLCNVLKGSNKSR AKT ++HG THT+RRLHQ+MFADRDYER   E LN 
Sbjct  208   DPERLAMIKQLLCNVLKGSNKSREAKTVVSHGVTHTERRLHQMMFADRDYERTGHETLNE  267

Query  984   PDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEY  1163
              +RPNV+V NW D+DYSVVTIRCKDRPKLLFD+ICTLTDM+YVVFHGNVDAEGPEA+QEY
Sbjct  268   RERPNVNVVNWCDKDYSVVTIRCKDRPKLLFDIICTLTDMQYVVFHGNVDAEGPEAHQEY  327

Query  1164  CIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  1343
             C+RH+DGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSL
Sbjct  328   CVRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSL  387

Query  1344  TVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QE  1520
             TVTRAEV+TR GKA NTFYV DASGYP+D +II+S+RQTIGQTIL+VKG PEE N T QE
Sbjct  388   TVTRAEVSTRAGKASNTFYVSDASGYPIDGKIIDSIRQTIGQTILRVKGCPEELNQTPQE  447

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             SPTR LFGG+FKSRSF NFGLVRSYS
Sbjct  448   SPTRFLFGGLFKSRSFVNFGLVRSYS  473



>ref|XP_009793986.1| PREDICTED: uncharacterized protein LOC104240797 isoform X3 [Nicotiana 
sylvestris]
Length=438

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/438 (86%), Positives = 406/438 (93%), Gaps = 1/438 (0%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEK IRRMNPPRVVIDNE+CKNAT+IQVDSANKHG LLEVVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYEKFIRRMNPPRVVIDNESCKNATIIQVDSANKHGILLEVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVTNQEG+KI DEA+LDYIMKSLGPDSCFASSMRRSVGVT+G DHTSIE
Sbjct  61    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMRRSVGVTAGMDHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQV DEE GGA+TDPE LS +
Sbjct  121   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAITDPERLSTM  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNVL+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER + E L+  DRPNV+V
Sbjct  181   KQLLCNVLRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLDDKDRPNVNV  240

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              NW D+DYSVVTI+CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP+A+QEYCIRH+DGS
Sbjct  241   VNWQDKDYSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQEYCIRHVDGS  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTVTRAEV 
Sbjct  301   PVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTVTRAEVT  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFG  1544
             TR GKA+N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN EE NP  QESPTR LFG
Sbjct  361   TRAGKALNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIEELNPVPQESPTRFLFG  420

Query  1545  GIFKSRSFCNFGLVRSYS  1598
             G+FKSRSFCNFGLVRSYS
Sbjct  421   GLFKSRSFCNFGLVRSYS  438



>ref|XP_004228421.1| PREDICTED: uncharacterized protein LOC101260963 isoform X1 [Solanum 
lycopersicum]
Length=448

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/447 (85%), Positives = 408/447 (91%), Gaps = 2/447 (0%)
 Frame = +3

Query  264   ATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             ATVSYSQN MDDEYEK IRRMNPPRVVIDN++CKNATVIQVDSANKHG LLEVVQ+LTDL
Sbjct  2     ATVSYSQNIMDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQILTDL  61

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NL+ITKAYI SDGGWFMDVFNVT Q+G+KI DEA+LDYIMKSLGPDS FASSMRRSVG+T
Sbjct  62    NLVITKAYISSDGGWFMDVFNVTTQDGNKITDEAMLDYIMKSLGPDSSFASSMRRSVGLT  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
             +G D+TSIELIGSDRPGLLSE+ AVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG +
Sbjct  122   TGMDYTSIELIGSDRPGLLSEMRAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGTI  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALN  980
              DPE LSM+K+LLCNVL+ SNK R AKT ++ G +HT+RRLHQLMFADRDYERA+ E  +
Sbjct  182   NDPERLSMMKQLLCNVLRCSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVSD  241

Query  981   HPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
                RPNVSV NW DRDYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP A+QE
Sbjct  242   EKGRPNVSVVNWQDRDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPIAHQE  301

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             YCIRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS
Sbjct  302   YCIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  361

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-Q  1517
             LTVTRAEV TR GKAVN FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN  E NP  Q
Sbjct  362   LTVTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIGELNPVPQ  421

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ESPTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  422   ESPTRFLFGGLFKSRSFCNFGLVRSYS  448



>ref|XP_010324768.1| PREDICTED: uncharacterized protein LOC101260963 isoform X2 [Solanum 
lycopersicum]
Length=446

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/445 (85%), Positives = 406/445 (91%), Gaps = 2/445 (0%)
 Frame = +3

Query  270   VSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNL  446
             VSYSQN MDDEYEK IRRMNPPRVVIDN++CKNATVIQVDSANKHG LLEVVQ+LTDLNL
Sbjct  2     VSYSQNIMDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQILTDLNL  61

Query  447   IITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSG  626
             +ITKAYI SDGGWFMDVFNVT Q+G+KI DEA+LDYIMKSLGPDS FASSMRRSVG+T+G
Sbjct  62    VITKAYISSDGGWFMDVFNVTTQDGNKITDEAMLDYIMKSLGPDSSFASSMRRSVGLTTG  121

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
              D+TSIELIGSDRPGLLSE+ AVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG + D
Sbjct  122   MDYTSIELIGSDRPGLLSEMRAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGTIND  181

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
             PE LSM+K+LLCNVL+ SNK R AKT ++ G +HT+RRLHQLMFADRDYERA+ E  +  
Sbjct  182   PERLSMMKQLLCNVLRCSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVSDEK  241

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              RPNVSV NW DRDYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP A+QEYC
Sbjct  242   GRPNVSVVNWQDRDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPIAHQEYC  301

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT
Sbjct  302   IRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  361

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QES  1523
             VTRAEV TR GKAVN FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN  E NP  QES
Sbjct  362   VTRAEVTTRAGKAVNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIGELNPVPQES  421

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
             PTR LFGG+FKSRSFCNFGLVRSYS
Sbjct  422   PTRFLFGGLFKSRSFCNFGLVRSYS  446



>ref|XP_006367494.1| PREDICTED: uncharacterized protein LOC102581080 isoform X2 [Solanum 
tuberosum]
Length=438

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/438 (86%), Positives = 402/438 (92%), Gaps = 1/438 (0%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEK IRRMNPPRVVIDN++CKNATVIQVDSANKHG LLEVVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVTNQEG+KI DEA+LDYIMKSLGPDS FASSMRRSVGVT+G D+TSIE
Sbjct  61    SSDGGWFMDVFNVTNQEGNKITDEAMLDYIMKSLGPDSSFASSMRRSVGVTAGMDYTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             LIGSDRPGLLSE+SAVLTNLKCNVVNAEVWTHNTRAAAIMQV DEETGG + DPE LSM+
Sbjct  121   LIGSDRPGLLSEMSAVLTNLKCNVVNAEVWTHNTRAAAIMQVKDEETGGTINDPERLSMM  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNVL+ SNK R AKT ++ G +HT+RRLHQLMFADRDYERA+ E L+  +RPNVSV
Sbjct  181   KQLLCNVLRCSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVLDEKERPNVSV  240

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              NWHD+DYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP A QEYCIRHIDGS
Sbjct  241   VNWHDKDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPVAQQEYCIRHIDGS  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTVTRAEV 
Sbjct  301   PVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTVTRAEVT  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFG  1544
             TR GKAVN FYV D+SGYPVDA+IIES+RQTIGQTIL VKGN  E NP  QESPTR LFG
Sbjct  361   TRAGKAVNIFYVRDSSGYPVDAKIIESIRQTIGQTILSVKGNIAELNPVPQESPTRFLFG  420

Query  1545  GIFKSRSFCNFGLVRSYS  1598
             G+FKSRSFCNFGLV+SYS
Sbjct  421   GLFKSRSFCNFGLVKSYS  438



>ref|XP_010324799.1| PREDICTED: uncharacterized protein LOC101260963 isoform X3 [Solanum 
lycopersicum]
Length=438

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/438 (85%), Positives = 400/438 (91%), Gaps = 1/438 (0%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEK IRRMNPPRVVIDN++CKNATVIQVDSANKHG LLEVVQ+LTDLNL+ITKAYI
Sbjct  1     MDDEYEKFIRRMNPPRVVIDNDSCKNATVIQVDSANKHGILLEVVQILTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT Q+G+KI DEA+LDYIMKSLGPDS FASSMRRSVG+T+G D+TSIE
Sbjct  61    SSDGGWFMDVFNVTTQDGNKITDEAMLDYIMKSLGPDSSFASSMRRSVGLTTGMDYTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             LIGSDRPGLLSE+ AVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG + DPE LSM+
Sbjct  121   LIGSDRPGLLSEMRAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGTINDPERLSMM  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNVL+ SNK R AKT ++ G +HT+RRLHQLMFADRDYERA+ E  +   RPNVSV
Sbjct  181   KQLLCNVLRCSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERAAGEVSDEKGRPNVSV  240

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              NW DRDYSVVTIRCKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP A+QEYCIRHIDGS
Sbjct  241   VNWQDRDYSVVTIRCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPIAHQEYCIRHIDGS  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV 
Sbjct  301   PVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVT  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFG  1544
             TR GKAVN FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN  E NP  QESPTR LFG
Sbjct  361   TRAGKAVNIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIGELNPVPQESPTRFLFG  420

Query  1545  GIFKSRSFCNFGLVRSYS  1598
             G+FKSRSFCNFGLVRSYS
Sbjct  421   GLFKSRSFCNFGLVRSYS  438



>gb|KDP41357.1| hypothetical protein JCGZ_15764 [Jatropha curcas]
Length=447

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/448 (82%), Positives = 405/448 (90%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDEYEKL RR+NPPRVVIDNE+CKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSHDMDDEYEKLFRRLNPPRVVIDNESCKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNV +Q+G+KI+DEA+LDYI KSLGP+SCF SSMR SVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVRDQDGNKIIDEAILDYIRKSLGPESCFISSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                T HT+IEL GSDRPGLLSEVSAVLT+LKC+VVNAEVWTHNTRAAA+MQVTDEETG A
Sbjct  120   KPSTGHTAIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMQVTDEETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDPE LS IK LLCNVLKGSNKSR AKT ++HGATHT+RRLHQ+MFADRDYERA D+ L
Sbjct  180   ITDPERLSRIKGLLCNVLKGSNKSRGAKTVVSHGATHTERRLHQMMFADRDYERADDDVL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNVSV N +D+DYSVVTIR KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEAYQ
Sbjct  240   DEKQRPNVSVVNLYDKDYSVVTIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDR+GLLS+VTRIFREN
Sbjct  300   EYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPT  1514
             SLTVTRAEV TR GKA+NTFYV DASGYPVDA+ I+S+RQ IGQTIL+VKGNPEE +  +
Sbjct  360   SLTVTRAEVTTRDGKALNTFYVRDASGYPVDAKTIDSIRQVIGQTILKVKGNPEEVKQVS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRSF NFGLVRSYS
Sbjct  420   QESPTRFLFGGLFKSRSFVNFGLVRSYS  447



>ref|XP_002314917.2| hypothetical protein POPTR_0010s14840g [Populus trichocarpa]
 gb|EEF01088.2| hypothetical protein POPTR_0010s14840g [Populus trichocarpa]
Length=447

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/448 (81%), Positives = 402/448 (90%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDEYEKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSNDMDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+ +G+K+ DEA+LDYI KSLGP+SCF SSMR SVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFTSSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLT+LKCNVVNAEVWTHN RAAA+MQVTDEETG A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             + DPE LS IK+LLCNVLKGSNKSR AKT ++HG THT+RRLHQ+MFADRDYERA+++ L
Sbjct  180   IIDPEKLSRIKELLCNVLKGSNKSRGAKTVVSHGVTHTERRLHQMMFADRDYERANNDEL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNVSV NW ++DYSVVTI  KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+Q
Sbjct  240   DEKQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKS+AERQR+I CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEV TR GKAVNTFYV DASGYPVDA+ I+S+RQ IGQTIL+VK +PEEQ P +
Sbjct  360   SLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTILKVKSSPEEQKPVS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRSF NFGLVRSYS
Sbjct  420   QESPTRFLFGGLFKSRSFVNFGLVRSYS  447



>ref|XP_011009617.1| PREDICTED: uncharacterized protein LOC105114683 isoform X1 [Populus 
euphratica]
Length=447

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/448 (81%), Positives = 401/448 (90%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDE EKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSNDMDDECEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+ +G+K+ DEA+LDYI KSLGP+SCF SSMR SVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFISSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLT+LKCNVVNAEVWTHN RAAA+MQVTDEETG A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             + DPE LS IK+LLCNVLKGSNKSR AKT ++HG THT+RRLHQ+MFADRDYERA+++ L
Sbjct  180   IIDPEKLSRIKELLCNVLKGSNKSRGAKTVVSHGVTHTERRLHQMMFADRDYERANNDEL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNVSV NW ++DYSVVTI  KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+Q
Sbjct  240   DEKQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKS+AERQR+I CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEV TR GKAVNTFYV DASGYPVDA+ I+S+RQ IGQTIL+VKG+PEE  P +
Sbjct  360   SLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTILKVKGSPEELKPVS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRSF NFGLVRSYS
Sbjct  420   QESPTRFLFGGLFKSRSFVNFGLVRSYS  447



>ref|XP_010091626.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB44892.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=443

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/444 (81%), Positives = 404/444 (91%), Gaps = 2/444 (0%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MDDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN+HG LLEVVQVLTDLNLI
Sbjct  1     MSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEHGILLEVVQVLTDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDG WFMDVFNVT+Q+G+K+ DE VLDYI KSLGP+SCF SSMR SVGVT   
Sbjct  61    ITKAYISSDGCWFMDVFNVTDQDGNKVTDEGVLDYIQKSLGPESCFMSSMR-SVGVTPSM  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHT+IEL GSDRPGLLSEV AVLT+LKCNVV+AEVWTHNTRAA+IM VTDEETG A++DP
Sbjct  120   DHTAIELTGSDRPGLLSEVCAVLTHLKCNVVSAEVWTHNTRAASIMHVTDEETGSAISDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS IK+LLCNVLKGSNKSR AKT ++H  THT+RRLHQ+MFADRDYER  D+AL+   
Sbjct  180   ERLSRIKELLCNVLKGSNKSRGAKTVVSHEVTHTERRLHQMMFADRDYERLDDDALDERQ  239

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNVSV NW+D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQEY I
Sbjct  240   RPNVSVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMKYVVFHANIDAEGPEAYQEYYI  299

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DGSPVKS+AERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTV
Sbjct  300   RHVDGSPVKSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTV  359

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESP  1526
             TRAEV T+GGKA+NTFYV DASGYPVD++ I+S+RQ IGQTIL+VKG+PEE ++ +QESP
Sbjct  360   TRAEVTTKGGKAMNTFYVSDASGYPVDSKTIDSIRQAIGQTILKVKGSPEELKSGSQESP  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
             TR LFGG+FKSRSF NFGLVRSYS
Sbjct  420   TRFLFGGLFKSRSFVNFGLVRSYS  443



>ref|XP_002512031.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF50700.1| amino acid binding protein, putative [Ricinus communis]
Length=443

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/444 (81%), Positives = 395/444 (89%), Gaps = 2/444 (0%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+S +MDDEYEKL RR+NPPRVVIDNE+CKNATVI+VDSANKHG LLEVVQVLTDLNLI
Sbjct  1     MSFSNDMDDEYEKLFRRLNPPRVVIDNESCKNATVIRVDSANKHGILLEVVQVLTDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNV +Q+G+KI DEA+LDYI KSLGP+S F SSMR SVGV    
Sbjct  61    ITKAYISSDGGWFMDVFNVRDQDGNKITDEAILDYIRKSLGPESRFTSSMR-SVGVIPSM  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHTSIEL GSDRPGLLSE+SAVLT+LKCNVV+AEVWTHN RAAA+MQVTDEETG A+ DP
Sbjct  120   DHTSIELTGSDRPGLLSELSAVLTHLKCNVVSAEVWTHNMRAAAVMQVTDEETGSAIIDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS IK+LLCNVLKGSNK R AKT ++HG THT+RRLHQ+MFADRDYERA DE L+   
Sbjct  180   ERLSRIKELLCNVLKGSNKFRGAKTVVSHGVTHTERRLHQMMFADRDYERADDEVLDEKQ  239

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNVSV NW+D+DYSVVTIR KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEAYQEY I
Sbjct  240   RPNVSVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAYQEYYI  299

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RHIDGSPVKSDAER RVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTV
Sbjct  300   RHIDGSPVKSDAERMRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTV  359

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESP  1526
             TRAEV TR GKA+NTFYV DASGY VD + IES+RQ IGQTIL+VK NP+E  P +QESP
Sbjct  360   TRAEVTTRDGKAINTFYVRDASGYLVDGKTIESIRQVIGQTILKVKSNPDELKPVSQESP  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
             TR LFGG+FKSRSF NFGLVRSYS
Sbjct  420   TRFLFGGLFKSRSFVNFGLVRSYS  443



>ref|XP_011020651.1| PREDICTED: uncharacterized protein LOC105122947 isoform X1 [Populus 
euphratica]
Length=447

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/448 (78%), Positives = 400/448 (89%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDEYEKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSNDMDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGKLLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAY+ SDGGWFMDVFNVT+Q+G+K+ DEA+LDYI KSLG + CF SS +RS GV
Sbjct  61    LNLIITKAYVSSDGGWFMDVFNVTDQDGNKVTDEAILDYITKSLGTEPCFTSS-KRSFGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVL +LKCNV+NAEVWTHN RAAA+MQVTD+ETG A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDPE LS IK+LLCN+LKGSNK R A+T ++HG THT+RRLHQ+MFADRDYERA+++ L
Sbjct  180   ITDPEKLSKIKELLCNLLKGSNKYRGARTVVSHGVTHTERRLHQMMFADRDYERANNDVL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNVSV NW+++DYSV+TIR KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+Q
Sbjct  240   DEKQRPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKS+AERQR+I CLEAAIERRVSEGLKLELCTTDR+GLLS+VTRIFREN
Sbjct  300   EYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEV TR GKAVNTFYV DASGYPVDA+ I+S+RQ IGQTIL+VKG+PEE  P +
Sbjct  360   SLTVTRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTILKVKGSPEELKPVS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRSF NFG V+SYS
Sbjct  420   QESPTRFLFGGLFKSRSFVNFGSVKSYS  447



>ref|XP_008243801.1| PREDICTED: uncharacterized protein LOC103342019 [Prunus mume]
Length=447

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/448 (79%), Positives = 403/448 (90%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME ++S+S +MDDEYEKLIRRMNPPRVVIDN+ACKNATVI+VDSAN++G LLEVVQVLTD
Sbjct  1     MEVSMSFSHDMDDEYEKLIRRMNPPRVVIDNKACKNATVIRVDSANEYGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGP++CFASSMR SVGV
Sbjct  61    LNLIVTKAYISSDGGWFMDVFNVTDQDGNKVTDEGVLEYIQKSLGPEACFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLTNLKCNVV+AEVWTHNTRAA++M VTDEETG A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMHVTDEETGLA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             VTDP+ L+ IK+LLCNVLKGSNK+R A+T ++H  THT+RRLHQ+MFADRDYER  D  L
Sbjct  180   VTDPQRLARIKELLCNVLKGSNKTRGARTVVSHAVTHTERRLHQMMFADRDYERVDDGLL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH ++DAEGPEAYQ
Sbjct  240   DDNQRPNVNVVNWQDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEVAT+ GKAVNTFYV DASGYPVD++ IE++R+ IGQTIL+VKG+PE+  P +
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIEAIREVIGQTILKVKGSPEDPKPGS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +ESPTR LFGG+FKSRSF NF L+RSYS
Sbjct  420   EESPTRFLFGGLFKSRSFVNFKLIRSYS  447



>ref|XP_007222134.1| hypothetical protein PRUPE_ppa005716mg [Prunus persica]
 gb|EMJ23333.1| hypothetical protein PRUPE_ppa005716mg [Prunus persica]
Length=447

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/448 (79%), Positives = 403/448 (90%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME ++S+S +MDDEYEKLIRRMNPPRVVIDN+ACKNATVI+VDSAN++G LLEVVQVLTD
Sbjct  1     MEVSMSFSHDMDDEYEKLIRRMNPPRVVIDNKACKNATVIRVDSANEYGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGP++CFASSMR +VGV
Sbjct  61    LNLIVTKAYISSDGGWFMDVFNVTDQDGNKVTDEGVLEYIQKSLGPEACFASSMR-TVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TDHT+IEL GSDRPGLLSEVSAVLTNLKCNVV+AEVWTHNTRAA++M VTDEETG A
Sbjct  120   KQSTDHTAIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMHVTDEETGLA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             VTDP+ L+ IK+LLCNVLKGSNK+R A+T ++H  THT+RRLHQ+MFADRDYER  D  L
Sbjct  180   VTDPQRLARIKELLCNVLKGSNKTRGARTVVSHAVTHTERRLHQMMFADRDYERVDDGLL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH ++DAEGPEAYQ
Sbjct  240   DDNQRPNVNVVNWQDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCT+DRVGLLS+VTRIFREN
Sbjct  300   EYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEVAT+ GKAVNTFYV D SGYPVD++ IE++RQ IGQTIL+VKG+PE+  P +
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDTSGYPVDSKTIEAIRQVIGQTILKVKGSPEDPKPGS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +ESPTR LFGG+FKSRSF NF LVRSYS
Sbjct  420   EESPTRFLFGGLFKSRSFVNFKLVRSYS  447



>ref|XP_008339767.1| PREDICTED: uncharacterized protein LOC103402787 [Malus domestica]
Length=447

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/448 (79%), Positives = 399/448 (89%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME ++S+S +MDDEY KLIRRMNPPRVVIDNEACKNATVI+VDSANK+G LLEVVQVLTD
Sbjct  1     MEVSMSFSHDMDDEYGKLIRRMNPPRVVIDNEACKNATVIRVDSANKYGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI SDGGWFMDVFNVT+ +G+K+ DE VLDYI KSLGP++CFASSMR SVGV
Sbjct  61    LNLIVTKAYISSDGGWFMDVFNVTDHDGNKVTDEEVLDYIQKSLGPEACFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D T IEL GSDRPGLLSEVSAVLTN KCNVV+AEVWTHNTRAA++M VTDEETG A
Sbjct  120   KQSMDSTVIELTGSDRPGLLSEVSAVLTNHKCNVVSAEVWTHNTRAASVMHVTDEETGLA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDP+ L+ IK+LLCNVLKGSNK+R A+T ++H  THT+RRLHQ+MFADRDYER  D  L
Sbjct  180   ITDPQRLAXIKELLCNVLKGSNKARGARTVVSHAVTHTERRLHQMMFADRDYERVHDGVL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RP+VSV NWHD+DYSVVTIR KDRPKLLFD +CTLTDM+YV+FH ++DAEGPEAYQ
Sbjct  240   DDKQRPDVSVVNWHDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVIFHASIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH+DGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEVAT+ GKAVNTFYV DASGYPVD++ IES+RQ IGQTIL+VKGNPE+  P +
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQVIGQTILKVKGNPEDTKPGS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +ESPTR LFGG+FKSRSF NF L+RSYS
Sbjct  420   EESPTRFLFGGLFKSRSFVNFKLIRSYS  447



>ref|XP_010650073.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100259472 
[Vitis vinifera]
Length=442

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/443 (80%), Positives = 396/443 (89%), Gaps = 3/443 (1%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MDDEYEKLIRRMNPPRVVIDNE CKNA+VI+VDSANKHG LLEVVQVL DLNLI
Sbjct  1     MSFSQDMDDEYEKLIRRMNPPRVVIDNETCKNASVIRVDSANKHGILLEVVQVLIDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+KI DE +LDYI KSLG D+CF SSMRRSVGV   T
Sbjct  61    ITKAYISSDGGWFMDVFNVTDQDGNKITDEEILDYIQKSLGSDACFISSMRRSVGVIPST  120

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHTSIEL GSDRPGLLSEVSAVLT+LKC+VVNAEVWTHNTRAAA+M VTDEETG A+TDP
Sbjct  121   DHTSIELTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMHVTDEETGCAITDP  180

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS +K+LLCNVLKGSNKSR AKT ++HG THT+RRLHQ+MFADRDYER  ++  +   
Sbjct  181   ERLSKVKQLLCNVLKGSNKSREAKTVVSHGVTHTERRLHQMMFADRDYERIYNDGSDEAQ  240

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNV+V NW+D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH NVDAEGPEAYQEY I
Sbjct  241   RPNVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVDAEGPEAYQEYYI  300

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSL+V
Sbjct  301   RHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLSV  360

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE--QNPTQES  1523
             TRAEV TR GKAVNTF+V DASGYPVDA+ I+S+R+ IGQTILQVKG+PEE  Q P QES
Sbjct  361   TRAEVTTRAGKAVNTFHVRDASGYPVDAKTIDSIREAIGQTILQVKGSPEEIKQIP-QES  419

Query  1524  PTRSLFGGIFKSRSFCNFGLVRS  1592
             PTR L  G+F+SR +CNFGL +S
Sbjct  420   PTRFLLVGLFRSRXYCNFGLFKS  442



>ref|XP_011020660.1| PREDICTED: uncharacterized protein LOC105122947 isoform X2 [Populus 
euphratica]
Length=443

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/444 (78%), Positives = 398/444 (90%), Gaps = 2/444 (0%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+S +MDDEYEKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTDLNLI
Sbjct  1     MSFSNDMDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGKLLEVVQVLTDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAY+ SDGGWFMDVFNVT+Q+G+K+ DEA+LDYI KSLG + CF SS +RS GV    
Sbjct  61    ITKAYVSSDGGWFMDVFNVTDQDGNKVTDEAILDYITKSLGTEPCFTSS-KRSFGVKQSM  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHT+IEL GSDRPGLLSEVSAVL +LKCNV+NAEVWTHN RAAA+MQVTD+ETG A+TDP
Sbjct  120   DHTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS IK+LLCN+LKGSNK R A+T ++HG THT+RRLHQ+MFADRDYERA+++ L+   
Sbjct  180   EKLSKIKELLCNLLKGSNKYRGARTVVSHGVTHTERRLHQMMFADRDYERANNDVLDEKQ  239

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNVSV NW+++DYSV+TIR KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+QEY I
Sbjct  240   RPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEYYI  299

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             +HIDGSPVKS+AERQR+I CLEAAIERRVSEGLKLELCTTDR+GLLS+VTRIFRENSLTV
Sbjct  300   KHIDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTTDRIGLLSDVTRIFRENSLTV  359

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESP  1526
             TRAEV TR GKAVNTFYV DASGYPVDA+ I+S+RQ IGQTIL+VKG+PEE  P +QESP
Sbjct  360   TRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQAIGQTILKVKGSPEELKPVSQESP  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
             TR LFGG+FKSRSF NFG V+SYS
Sbjct  420   TRFLFGGLFKSRSFVNFGSVKSYS  443



>ref|XP_010066809.1| PREDICTED: uncharacterized protein LOC104453874 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64855.1| hypothetical protein EUGRSUZ_G02423 [Eucalyptus grandis]
Length=446

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/447 (79%), Positives = 394/447 (88%), Gaps = 1/447 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  + +S NMDDEYEKLIRRMNPPRVVIDNE CKNATVIQVDSAN+ G LLEVVQVLTD
Sbjct  1     MDINMRFSPNMDDEYEKLIRRMNPPRVVIDNETCKNATVIQVDSANRPGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+Q+G+KIM++ +LDYI K LGPDSCF SS+R SVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDQDGNKIMNDEILDYIKKVLGPDSCFTSSLR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+M VTDEETG A
Sbjct  120   KPSDDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDEETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             VTDPE L+ I++LLCNVLKGSNKSR AKT ++HG T T RRLHQ+MFADRDYER  D+ L
Sbjct  180   VTDPERLTRIRELLCNVLKGSNKSRGAKTVVSHGVTLTTRRLHQMMFADRDYERTDDDML  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV V NW+D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQ
Sbjct  240   DEKQRPNVEVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH DGSPV SDAER+R++HCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN
Sbjct  300   EYYIRHQDGSPVNSDAERERLMHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQ  1517
             SLTVTRAEV+T+ GKAVNTFYV DASGYPVD + I+S+R+TIGQTIL VKGN  E  P Q
Sbjct  360   SLTVTRAEVSTKDGKAVNTFYVRDASGYPVDPKTIDSIRETIGQTILHVKGNSGESKPAQ  419

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ESP+R LFGG+FKSRSF NFGLVRSYS
Sbjct  420   ESPSRFLFGGLFKSRSFVNFGLVRSYS  446



>ref|XP_006484247.1| PREDICTED: uncharacterized protein LOC102622082 [Citrus sinensis]
Length=449

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/450 (79%), Positives = 405/450 (90%), Gaps = 4/450 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME ++SYS + DDEYEKLIRRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MELSMSYSHDSDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI SDG WFMDVFNVT+++G+KI DE +LDYI K LGP++CFASSM+ SVGV
Sbjct  61    LNLIVTKAYISSDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMK-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEV+AVLT+LKCNVV+AEVWTHNTRAAA+MQVTDEETGGA
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVTAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS--DE  971
             +TDPE LS+IK+LLCNVLKGSNKS  AKT+++   THT+RRLHQ+MFADRDYER    D+
Sbjct  180   ITDPERLSVIKELLCNVLKGSNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTGDD  239

Query  972   ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
             +L+   RPNV+V N +D+DYSVVTI  KDRPKL+FD +CTLTDM+YVVFH N+DAEGPEA
Sbjct  240   SLDEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEA  299

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             YQEY IRHIDGSPVKSDAER+RVI CL+AAIERRVSEGLKLELCTTDRVGLLSNVTRIFR
Sbjct  300   YQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP  1511
             ENSLTVTRAEVAT+ GKAVNTFYVG ASGYPVDA+II+S+RQ+IGQTIL+VKGNPE+  P
Sbjct  360   ENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTILKVKGNPEDLKP  419

Query  1512  -TQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              +Q+SPTR LFGG+FKSRSF NFGLVRS S
Sbjct  420   ASQDSPTRFLFGGLFKSRSFVNFGLVRSCS  449



>ref|XP_010066810.1| PREDICTED: uncharacterized protein LOC104453874 isoform X2 [Eucalyptus 
grandis]
Length=442

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/441 (80%), Positives = 391/441 (89%), Gaps = 1/441 (0%)
 Frame = +3

Query  276   YSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIIT  455
             +S NMDDEYEKLIRRMNPPRVVIDNE CKNATVIQVDSAN+ G LLEVVQVLTDLNLIIT
Sbjct  3     FSPNMDDEYEKLIRRMNPPRVVIDNETCKNATVIQVDSANRPGILLEVVQVLTDLNLIIT  62

Query  456   KAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDH  635
             KAYI SDGGWFMDVFNVT+Q+G+KIM++ +LDYI K LGPDSCF SS+R SVGV    DH
Sbjct  63    KAYISSDGGWFMDVFNVTDQDGNKIMNDEILDYIKKVLGPDSCFTSSLR-SVGVKPSDDH  121

Query  636   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPET  815
             T+IEL GSDRPGLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+M VTDEETG AVTDPE 
Sbjct  122   TAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDEETGSAVTDPER  181

Query  816   LSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRP  995
             L+ I++LLCNVLKGSNKSR AKT ++HG T T RRLHQ+MFADRDYER  D+ L+   RP
Sbjct  182   LTRIRELLCNVLKGSNKSRGAKTVVSHGVTLTTRRLHQMMFADRDYERTDDDMLDEKQRP  241

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
             NV V NW+D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQEY IRH
Sbjct  242   NVEVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEYYIRH  301

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
              DGSPV SDAER+R++HCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR
Sbjct  302   QDGSPVNSDAERERLMHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  361

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRS  1535
             AEV+T+ GKAVNTFYV DASGYPVD + I+S+R+TIGQTIL VKGN  E  P QESP+R 
Sbjct  362   AEVSTKDGKAVNTFYVRDASGYPVDPKTIDSIRETIGQTILHVKGNSGESKPAQESPSRF  421

Query  1536  LFGGIFKSRSFCNFGLVRSYS  1598
             LFGG+FKSRSF NFGLVRSYS
Sbjct  422   LFGGLFKSRSFVNFGLVRSYS  442



>ref|XP_002312346.1| hypothetical protein POPTR_0008s10860g [Populus trichocarpa]
 gb|EEE89713.1| hypothetical protein POPTR_0008s10860g [Populus trichocarpa]
Length=443

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/444 (78%), Positives = 397/444 (89%), Gaps = 2/444 (0%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+S ++DDEYEKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTDLNLI
Sbjct  1     MSFSNDLDDEYEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGKLLEVVQVLTDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAY+ SDGGWFMDVFNVT+Q+G+K+ DEA+LDYI KSLG +SCF SSM  S GV    
Sbjct  61    ITKAYVSSDGGWFMDVFNVTDQDGNKVTDEAILDYITKSLGTESCFTSSMG-SFGVKQSI  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHT+IEL GSDRPGLLSEVSAVL +LKCNV+NAEVWTHN RAAA+MQVTD+ETG A+TDP
Sbjct  120   DHTAIELTGSDRPGLLSEVSAVLAHLKCNVLNAEVWTHNMRAAAVMQVTDDETGSAITDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS +K+LLCNVLKGSNK R A+T ++HG THT+RRLHQ+MFADRDYERA+++ L+   
Sbjct  180   EKLSRVKELLCNVLKGSNKYRGARTVVSHGVTHTERRLHQMMFADRDYERANNDVLDEKQ  239

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNVSV NW+++DYSV+TIR KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+QEY I
Sbjct  240   RPNVSVVNWYEKDYSVITIRSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQEYYI  299

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             +H+DGSPVKS+AERQR+I CLEAAIERRVSEGLKLELCT DR+GLLS+VTRIFRENSLTV
Sbjct  300   KHVDGSPVKSEAERQRIIQCLEAAIERRVSEGLKLELCTKDRIGLLSDVTRIFRENSLTV  359

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESP  1526
             TRAEV TR GKAVNTFYV DASGYPVDA+ I+S+RQ  GQTIL+VKG+PEE  P +QESP
Sbjct  360   TRAEVTTRAGKAVNTFYVSDASGYPVDAKTIDSIRQATGQTILKVKGSPEELKPVSQESP  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
             TR LFGG+FKSRSF NFGLV+SYS
Sbjct  420   TRFLFGGLFKSRSFVNFGLVKSYS  443



>gb|KDO70279.1| hypothetical protein CISIN_1g013090mg [Citrus sinensis]
Length=449

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/450 (79%), Positives = 406/450 (90%), Gaps = 4/450 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME ++SYS + DDEYEKLIRRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MELSMSYSHDSDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI SDG WFMDVFNVT+++G+KI DE +LDYI K LGP++CFASSMR SVGV
Sbjct  61    LNLIVTKAYISSDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+MQVTDEETGGA
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS--DE  971
             ++DPE LS+IK+LLCNVLKGSNKS  AKT+++   THT+RRLHQ+MFADRDYER    D+
Sbjct  180   ISDPERLSVIKELLCNVLKGSNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTDDD  239

Query  972   ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
             +L+   RPNV+V N +D+DYSVVTI  KDRPKL+FD +CTLTDM+YVVFH N+DAEGPEA
Sbjct  240   SLDEKQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEA  299

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             YQEY IRHIDGSPVKSDAER+RVI CL+AAIERRVSEGLKLELCTTDRVGLLSNVTRIFR
Sbjct  300   YQEYFIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QN  1508
             ENSLTVTRAEVAT+ GKAVNTFYVG ASGYPVDA+II+S+RQ+IGQTIL+VKGNPE+ ++
Sbjct  360   ENSLTVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTILKVKGNPEDLKS  419

Query  1509  PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              +Q+SPTR LFGG+FKSRSF NFGLVRS S
Sbjct  420   ASQDSPTRFLFGGLFKSRSFVNFGLVRSCS  449



>ref|XP_008389382.1| PREDICTED: uncharacterized protein LOC103451737 [Malus domestica]
 ref|XP_008350884.1| PREDICTED: uncharacterized protein LOC103414267 [Malus domestica]
Length=447

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/448 (79%), Positives = 398/448 (89%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDEYEKLIRRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSHDMDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             L+LI+TKAYI SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGP++CFASSMR SVGV
Sbjct  61    LDLIVTKAYISSDGGWFMDVFNVTDQDGNKVTDEEVLEYIHKSLGPEACFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D T IEL GSDRPGLLSEVSAVLTNLKCNVV+AEVWTHNTRAA++M+VTDEETG A
Sbjct  120   KQSMDSTVIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMRVTDEETGLA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TD + L+ IK+LLCNVLKGSNK+R A+T ++H  THTDRRLHQ+MFADRDYER  D+ L
Sbjct  180   ITDSQRLARIKELLCNVLKGSNKARGARTVVSHAVTHTDRRLHQMMFADRDYERVDDDVL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RP+VSV N  D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH ++DAEGPEAYQ
Sbjct  240   DDKQRPDVSVVNLLDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH+DGSPVKSDAERQRVI CLEAAIERRVSE LKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIRHVDGSPVKSDAERQRVIQCLEAAIERRVSEDLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEVAT+ GKAVNTFYV DASGYPVD++ IES+RQ IGQTIL+VKGN E+  P +
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQAIGQTILKVKGNTEDTKPGS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +ESPTR LFGG+FKSRSF NF L+RSYS
Sbjct  420   EESPTRFLFGGLFKSRSFVNFKLIRSYS  447



>ref|XP_007045767.1| ACT domain repeat 4 [Theobroma cacao]
 gb|EOY01599.1| ACT domain repeat 4 [Theobroma cacao]
Length=485

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/448 (79%), Positives = 393/448 (88%), Gaps = 2/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDEYEK IRRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTD
Sbjct  1     MEMNMSFSHDMDDEYEKFIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLII KAYI SDG WFMDVFNVT+Q+G+KI+DE +LDYIMKSLGP+SCF SSMR S+GV
Sbjct  61    LNLIINKAYISSDGNWFMDVFNVTDQDGNKIVDEGILDYIMKSLGPESCFTSSMR-SIGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVL +LKCNVVNAEVWTHNTRAAA+MQVTDEE G A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLRHLKCNVVNAEVWTHNTRAAAVMQVTDEEKGTA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDPE LS IK LLCNVLKGSNKS  AKT ++H  THT+RRLHQ+MFADRDYER  D+ L
Sbjct  180   ITDPERLSRIKALLCNVLKGSNKSSLAKTVVSHSVTHTERRLHQMMFADRDYERTGDDVL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV V NW+D+DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFH N+D EGPE+YQ
Sbjct  240   DDKQRPNVDVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMDYVVFHANIDTEGPESYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRHIDGSPVKSDAERQRV  CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIRHIDGSPVKSDAERQRVTQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPT  1514
             SLTVTRAEV T+ GKAVNTFYV D SGYPVDA+ I+S+RQ IGQTIL+VKG+PE+ ++ +
Sbjct  360   SLTVTRAEVTTKAGKAVNTFYVRDTSGYPVDAKTIDSIRQVIGQTILKVKGSPEDSKSVS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRSF NF L   +S
Sbjct  420   QESPTRFLFGGLFKSRSFVNFSLRLRFS  447



>ref|XP_006437860.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
 gb|ESR51100.1| hypothetical protein CICLE_v10031536mg [Citrus clementina]
Length=445

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/446 (80%), Positives = 402/446 (90%), Gaps = 4/446 (1%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +SYS + DDEYEKLIRRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTDLNLI
Sbjct  1     MSYSHDSDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             +TKAYI SDG WFMDVFNVT+++G+KI DE +LDYI K LGP++CFASSM+ SVGV    
Sbjct  61    VTKAYISSDGCWFMDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMK-SVGVKQSM  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHT+IEL GSDRPGLLSEV+AVLT+LKCNVV+AEVWTHNTRAAA+MQVTDEETGGA+TDP
Sbjct  120   DHTAIELTGSDRPGLLSEVTAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAITDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS--DEALNH  983
             E LS+IK+LLCNVLKGSNKS  AKT+++   THT+RRLHQ+MFADRDYER    D++L+ 
Sbjct  180   ERLSVIKELLCNVLKGSNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTGDDSLDE  239

Query  984   PDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEY  1163
               RPNV+V N +D+DYSVVTI  KDRPKL+FD +CTLTDM+YVVFH N+DAEGPEAYQEY
Sbjct  240   KQRPNVNVVNCYDKDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEY  299

Query  1164  CIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  1343
              IRHIDGSPVKSDAER+RVI CL+AAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL
Sbjct  300   FIRHIDGSPVKSDAERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  359

Query  1344  TVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQE  1520
             TVTRAEVAT+ GKAVNTFYVG ASGYPVDA+II+S+RQ+IGQTIL+VKGNPE+  P +Q+
Sbjct  360   TVTRAEVATKSGKAVNTFYVGGASGYPVDAKIIDSIRQSIGQTILKVKGNPEDLKPASQD  419

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             SPTR LFGG+FKSRSF NFGLVRS S
Sbjct  420   SPTRFLFGGLFKSRSFVNFGLVRSCS  445



>ref|XP_006573170.1| PREDICTED: uncharacterized protein LOC100787134 isoform X2 [Glycine 
max]
Length=452

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/448 (78%), Positives = 395/448 (88%), Gaps = 3/448 (1%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             E  +S+S  MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDL
Sbjct  6     EVNMSFSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDL  65

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NLIITKAYI SDGGWFMDVFNVT Q+G+K+ DEA+LDYI KSLGP+SC  S MR SVGV 
Sbjct  66    NLIITKAYISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCVTSPMR-SVGVK  124

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
               TDH +IEL+G+DRPGLLSEVSAVLTNLKCN+VNAEVWTHNTRAAA+M VTDEE+G A+
Sbjct  125   QTTDHIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAI  184

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-L  977
             TDP+ LS+IK+LLCNVL G NK R AKT +T  ATHT+RRLHQ+MFADRDYER +D+   
Sbjct  185   TDPQRLSIIKELLCNVLGGGNKKRGAKTVVTDEATHTERRLHQMMFADRDYERVNDDDDF  244

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW D+DYSVVTI+CKDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQ
Sbjct  245   DEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  304

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKSDAERQRVI CL AAI+RRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  305   EYYIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFREN  364

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-  1514
             SLTVTRAEVAT+GGKAVNTFYV  ASG+PVD++ IES+RQTIG TIL+VKG+PEE     
Sbjct  365   SLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTILKVKGSPEEMKSVP  424

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             Q+SPTRSLF G+FKSRSF NFGLV+SYS
Sbjct  425   QDSPTRSLFSGLFKSRSFVNFGLVKSYS  452



>ref|XP_003516462.1| PREDICTED: uncharacterized protein LOC100787134 isoform X1 [Glycine 
max]
Length=449

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/448 (78%), Positives = 395/448 (88%), Gaps = 3/448 (1%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             E  +S+S  MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDL
Sbjct  3     EVNMSFSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDL  62

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NLIITKAYI SDGGWFMDVFNVT Q+G+K+ DEA+LDYI KSLGP+SC  S MR SVGV 
Sbjct  63    NLIITKAYISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCVTSPMR-SVGVK  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
               TDH +IEL+G+DRPGLLSEVSAVLTNLKCN+VNAEVWTHNTRAAA+M VTDEE+G A+
Sbjct  122   QTTDHIAIELMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAI  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-L  977
             TDP+ LS+IK+LLCNVL G NK R AKT +T  ATHT+RRLHQ+MFADRDYER +D+   
Sbjct  182   TDPQRLSIIKELLCNVLGGGNKKRGAKTVVTDEATHTERRLHQMMFADRDYERVNDDDDF  241

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW D+DYSVVTI+CKDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQ
Sbjct  242   DEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  301

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKSDAERQRVI CL AAI+RRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  302   EYYIKHIDGSPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFREN  361

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-  1514
             SLTVTRAEVAT+GGKAVNTFYV  ASG+PVD++ IES+RQTIG TIL+VKG+PEE     
Sbjct  362   SLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTILKVKGSPEEMKSVP  421

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             Q+SPTRSLF G+FKSRSF NFGLV+SYS
Sbjct  422   QDSPTRSLFSGLFKSRSFVNFGLVKSYS  449



>gb|KHN29949.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=452

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/448 (78%), Positives = 394/448 (88%), Gaps = 3/448 (1%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             E  +S+S  MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDL
Sbjct  6     EVNMSFSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDL  65

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NLIITKAYI SDGGWFMDVFNVT Q+G+K+ DEA+LDYI KSLGP+SC  S MR SVGV 
Sbjct  66    NLIITKAYISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCVTSPMR-SVGVK  124

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
                DHT+IEL+G+DRPGLLSEVSAVLTNLKCN++NAEVWTHNTRAAA+M VTDEE+G A+
Sbjct  125   QTMDHTAIELMGTDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVMHVTDEESGSAI  184

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-L  977
             TDP+ LS+IK+LLCNVL G NK R AKT +T  ATHT+RRLHQ+MFADRDYER +D+   
Sbjct  185   TDPQRLSIIKELLCNVLGGGNKKRGAKTVVTDEATHTERRLHQMMFADRDYERVNDDDDF  244

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                 RPNV+V NW D+DYSVVTI+CKDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQ
Sbjct  245   AEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  304

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKSDAERQRVI CL AAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  305   EYYIKHIDGSPVKSDAERQRVIQCLAAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  364

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-  1514
             SLTVTRAEVAT+GGKAVNTFYV  ASG+PVD++ IES+RQTIG TIL+VKG+PEE     
Sbjct  365   SLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTILKVKGSPEEMKSVP  424

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             Q+SPTRSLF G+FKSRSF NFGLV+SYS
Sbjct  425   QDSPTRSLFSGLFKSRSFVNFGLVKSYS  452



>ref|XP_003518790.2| PREDICTED: uncharacterized protein LOC100813551 isoform 1 [Glycine 
max]
Length=452

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/448 (78%), Positives = 394/448 (88%), Gaps = 3/448 (1%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             E  +S+S  MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDL
Sbjct  6     EVNMSFSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDL  65

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NLIITKAYI SDGGWFMDVFNVT Q+G+K+ DEA+LDYI KSLGP+SC  S MR SVGV 
Sbjct  66    NLIITKAYISSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCVTSPMR-SVGVK  124

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
                DHT+IEL+G+DRPGLLSEVSAVLTNLKCN++NAEVWTHNTRAAA+M VTDEETG A+
Sbjct  125   QTMDHTAIELMGTDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVMHVTDEETGSAI  184

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-L  977
             +DP+ LS+IK+LLCNVL G NK R AKT +T  ATHT+RRLHQ+MFADRDYER +D+   
Sbjct  185   SDPQRLSIIKELLCNVLGGGNKKRGAKTVVTDEATHTERRLHQMMFADRDYERVNDDDDF  244

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                 RPNV+V NW D+DYSVVTI+CKDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQ
Sbjct  245   AEKQRPNVNVVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQ  304

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKSDAERQRVI CL AAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  305   EYYIKHIDGSPVKSDAERQRVIQCLAAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  364

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-  1514
             SLTVTRAEVAT+GGKAVNTFYV  ASG+PVD++ IES+RQTIG TIL+VKG+PEE     
Sbjct  365   SLTVTRAEVATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTILKVKGSPEEMKSVP  424

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             Q+SPTRSLF G+FKSRSF NFGLV+SYS
Sbjct  425   QDSPTRSLFSGLFKSRSFVNFGLVKSYS  452



>ref|XP_009356452.1| PREDICTED: uncharacterized protein LOC103947287 [Pyrus x bretschneideri]
Length=447

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/447 (78%), Positives = 395/447 (88%), Gaps = 2/447 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +S+S +MDDEYEKLIRRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MQVNMSFSHDMDDEYEKLIRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             L+LI+ KAYI SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGP++ FASSMR SVGV
Sbjct  61    LDLIVRKAYIASDGGWFMDVFNVTDQDGNKVADEEVLEYIHKSLGPEARFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D T IEL GSDRPGLLSEVSAVLTNLKCNVV+AEVWTHNTRAA++M+VTDEETG A
Sbjct  120   KQSMDSTVIELTGSDRPGLLSEVSAVLTNLKCNVVSAEVWTHNTRAASVMRVTDEETGLA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TD + L+ IK+LLCNVLKGSNK+R A+T ++H  THTDRRLHQ+MFADRDYER  D  L
Sbjct  180   ITDSQRLARIKELLCNVLKGSNKTRGARTVVSHAVTHTDRRLHQMMFADRDYERVDDNVL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RP+VSV N HD+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH ++DAEGPEAYQ
Sbjct  240   DDKQRPDVSVVNLHDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHASIDAEGPEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+H+DGSPVKSDAERQRVI CLEAAIERRVSE LKLELCTTDRVGLLS+VTRIFREN
Sbjct  300   EYYIKHVDGSPVKSDAERQRVIQCLEAAIERRVSEDLKLELCTTDRVGLLSDVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPT  1514
             SLTVTRAEVAT+ GKAVNTFYV DASGYPVD++ IES+RQ IGQTIL+VKGN E+ +  +
Sbjct  360   SLTVTRAEVATKAGKAVNTFYVRDASGYPVDSKTIESIRQAIGQTILKVKGNTEDTKTGS  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSY  1595
             +ESPTR LFGG+FKSRSF NF L+RSY
Sbjct  420   EESPTRFLFGGLFKSRSFVNFKLIRSY  446



>gb|KHN02615.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=438

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/439 (79%), Positives = 390/439 (89%), Gaps = 3/439 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDLNLIITKAYI
Sbjct  1     MDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT Q+G+K+ DEA+LDYI KSLGP+SC  S MR SVGV   TDH +IE
Sbjct  61    SSDGGWFMDVFNVTGQDGNKVTDEAILDYIRKSLGPESCVTSPMR-SVGVKQTTDHIAIE  119

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L+G+DRPGLLSEVSAVLTNLKCN+VNAEVWTHNTRAAA+M VTDEE+G A+TDP+ LS+I
Sbjct  120   LMGTDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEESGSAITDPQRLSII  179

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-LNHPDRPNVS  1004
             K+LLCNVL G NK R AKT +T  ATHT+RRLHQ+MFADRDYER +D+   +   RPNV+
Sbjct  180   KELLCNVLGGGNKKRGAKTVVTDEATHTERRLHQMMFADRDYERVNDDDDFDEKQRPNVN  239

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V NW D+DYSVVTI+CKDRPKLLFD +CTLTDM+YVVFH N+DAEGPEAYQEY I+HIDG
Sbjct  240   VVNWSDKDYSVVTIQCKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPEAYQEYYIKHIDG  299

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SPVKSDAERQRVI CL AAI+RRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTVTRAEV
Sbjct  300   SPVKSDAERQRVIQCLAAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTVTRAEV  359

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLF  1541
             AT+GGKAVNTFYV  ASG+PVD++ IES+RQTIG TIL+VKG+PEE     Q+SPTRSLF
Sbjct  360   ATKGGKAVNTFYVRGASGFPVDSKTIESIRQTIGNTILKVKGSPEEMKSVPQDSPTRSLF  419

Query  1542  GGIFKSRSFCNFGLVRSYS  1598
              G+FKSRSF NFGLV+SYS
Sbjct  420   SGLFKSRSFVNFGLVKSYS  438



>ref|XP_007153472.1| hypothetical protein PHAVU_003G038400g [Phaseolus vulgaris]
 gb|ESW25466.1| hypothetical protein PHAVU_003G038400g [Phaseolus vulgaris]
Length=451

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/447 (77%), Positives = 389/447 (87%), Gaps = 2/447 (0%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             E  +S+S  MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDL
Sbjct  6     EVNMSFSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDL  65

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             NLIITKAYI SDGGWFMD FNVT Q+G+K+ DEA+LDYI KSLGP+SC  S +R SVGV 
Sbjct  66    NLIITKAYISSDGGWFMDAFNVTGQDGNKVTDEAILDYIRKSLGPESCVTSPIR-SVGVE  124

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
                DHT IEL+GSDRPGLLSEVSAVLTNLKCN+VNAEVWTHNTRAAA+M VTDEETG A+
Sbjct  125   QTMDHTVIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNTRAAAVMHVTDEETGSAI  184

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALN  980
             TDP+ LS++K+LLCNVL G NK R AKT +T   THT+RRLHQ+MFADRDYER SD+A +
Sbjct  185   TDPKRLSIVKELLCNVLGGGNKKRGAKTVVTDEVTHTERRLHQMMFADRDYERDSDDAFD  244

Query  981   HPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
                RPNV+V NW D +YSVVTI+CKDRPKLLFD +CTLTDMEYVVFH  +DAEGPEAYQE
Sbjct  245   EKQRPNVNVVNWSDNNYSVVTIQCKDRPKLLFDTVCTLTDMEYVVFHAKIDAEGPEAYQE  304

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             Y I+HIDGSP+KSDAERQRVI CL AAIERRVS+GLKLELCTTDRVGLLS+VTRIFRENS
Sbjct  305   YFIKHIDGSPMKSDAERQRVIQCLAAAIERRVSDGLKLELCTTDRVGLLSDVTRIFRENS  364

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-Q  1517
             LTVTRAEV+T+GGKAVNTFYV  ASG+PVD + IES+RQTIG TIL+VKG+P E     Q
Sbjct  365   LTVTRAEVSTKGGKAVNTFYVRGASGFPVDLKTIESIRQTIGNTILKVKGSPSEMKSVPQ  424

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +SP+RSLF G+FKSRSF NFGLV+SYS
Sbjct  425   DSPSRSLFSGLFKSRSFVNFGLVKSYS  451



>gb|KHG00039.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=445

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/444 (78%), Positives = 387/444 (87%), Gaps = 2/444 (0%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+S +M DEYEK IRRMNPPRVVIDNEACKNATVI+VD AN+HG LLEVVQ+LTDLNLI
Sbjct  3     MSFSHDMGDEYEKFIRRMNPPRVVIDNEACKNATVIRVDCANEHGILLEVVQILTDLNLI  62

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             I KAYI +DG WFMDVFNVTNQ+G+KI DE +LDYI KSLGP+SCF S+MR SVGV    
Sbjct  63    INKAYISADGNWFMDVFNVTNQDGNKITDEGILDYITKSLGPESCFTSAMR-SVGVKQTM  121

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHT IEL GSDRPGLLSE+SAVL +LKCNVVNAEVWTHNTRAAA+MQVTDEETG ++TD 
Sbjct  122   DHTEIELTGSDRPGLLSELSAVLKHLKCNVVNAEVWTHNTRAAAVMQVTDEETGTSITDL  181

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LSMIK LLCNVLKGSNKS  AKT ++H  THTDRRLHQ+MFADRDYE+  D+ L    
Sbjct  182   ERLSMIKALLCNVLKGSNKSSLAKTIVSHSVTHTDRRLHQMMFADRDYEQTGDDVLEDRQ  241

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNV V NW+D+DYSVVTIRCKDRPKLLFD +CTLTDM YVVFH  +D EGPE+YQEY I
Sbjct  242   RPNVDVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMGYVVFHAKIDTEGPESYQEYYI  301

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RHIDGSPVKSDAERQRV  CLEAAI+RRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTV
Sbjct  302   RHIDGSPVKSDAERQRVTQCLEAAIKRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTV  361

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESP  1526
             +RAEV T+ GKAVNTFYV DASGYPVDA+ IE +RQ IGQTIL+VKG+PE+ ++ +QESP
Sbjct  362   SRAEVTTKDGKAVNTFYVRDASGYPVDAKTIEFIRQVIGQTILKVKGSPEDVKSVSQESP  421

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
             TR LFGG+FKSRSF NF LVRSYS
Sbjct  422   TRFLFGGLFKSRSFVNFSLVRSYS  445



>gb|KHG02132.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=445

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/444 (77%), Positives = 390/444 (88%), Gaps = 2/444 (0%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+S++MDDEYEK IRRMNPPRVVIDNE+CKNATVI+VDSAN+HG LLEVVQ+LTD+NLI
Sbjct  3     MSFSRDMDDEYEKFIRRMNPPRVVIDNESCKNATVIRVDSANRHGILLEVVQILTDINLI  62

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDG WFMDVFNVT+Q+G+KI+DE +LDYI KSLGP+SCF  S+R SVG+    
Sbjct  63    ITKAYISSDGNWFMDVFNVTDQDGNKILDEGILDYIRKSLGPESCFMPSIR-SVGMKQSM  121

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             DHT+IEL GSDRPGLLSEVSAVL +LKCNVVNAEVWTHNTRAAA+MQVTDEET  A++DP
Sbjct  122   DHTAIELTGSDRPGLLSEVSAVLRHLKCNVVNAEVWTHNTRAAAVMQVTDEETETAISDP  181

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS IK LLCNVLKGSNKS  AKT ++H  THT+RRLHQ+MFADRDYER   + L+   
Sbjct  182   ERLSRIKSLLCNVLKGSNKSSLAKTVVSHSVTHTERRLHQMMFADRDYERTGGDVLDDRQ  241

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RPNV V NWHD+DYSVVTI CKDRPKLLFD +CTLTDM+YVVFH N+D  GP++YQEY I
Sbjct  242   RPNVDVVNWHDKDYSVVTIGCKDRPKLLFDTVCTLTDMDYVVFHANIDTLGPDSYQEYYI  301

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DGSPVKSDAERQRV  CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTV
Sbjct  302   RHLDGSPVKSDAERQRVTQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTV  361

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESP  1526
             TRAEV T+ GKAVNTFYV DASGYPVD + I+S+RQ +GQTIL+VKGNP++  P +QESP
Sbjct  362   TRAEVTTKAGKAVNTFYVRDASGYPVDVKTIDSIRQVLGQTILKVKGNPDDSKPVSQESP  421

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
             TR LFGG+FKS+SF NF LVRSYS
Sbjct  422   TRFLFGGLFKSKSFVNFSLVRSYS  445



>ref|XP_010260920.1| PREDICTED: uncharacterized protein LOC104599871 [Nelumbo nucifera]
Length=448

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/448 (77%), Positives = 389/448 (87%), Gaps = 1/448 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M A ++ S +MDDEYEK +RRMNPPRVVIDNE CKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MGADMNSSWDMDDEYEKFVRRMNPPRVVIDNETCKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT++EG+K+ DE +L+YI KSLG DS F  ++ R+VGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDREGNKLKDEGILEYIRKSLGADSSFVPTLGRNVGV  120

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                T+HTSIEL G+DRPGLLSEV AVLT LKCNVVNAEVWTHNTRAAA+M VTDEETG A
Sbjct  121   EQSTNHTSIELTGTDRPGLLSEVCAVLTGLKCNVVNAEVWTHNTRAAAVMHVTDEETGSA  180

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDPE+LS IK LLCNVLKG+NK+R AKT ++ G THT+RRLHQ+MFADRDYER  D A 
Sbjct  181   ITDPESLSKIKALLCNVLKGNNKTRGAKTAVSLGVTHTERRLHQMMFADRDYERLDDHAF  240

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW+D+DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFH NVDAE PEAYQ
Sbjct  241   DEKQRPNVTVVNWYDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEQPEAYQ  300

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             E+ IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  301   EFYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  360

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPT  1514
              L VTRAEV TR GKA+NTFYV DA+G PVDA+ I+S+RQ IGQTILQV+G  E  ++ +
Sbjct  361   GLAVTRAEVTTRAGKAINTFYVRDAAGNPVDAKTIDSIRQVIGQTILQVRGCSENTKSSS  420

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QESPTR LFGG+FKSRS CNFGLVRSYS
Sbjct  421   QESPTRFLFGGLFKSRSLCNFGLVRSYS  448



>ref|XP_010257936.1| PREDICTED: uncharacterized protein LOC104597875 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/452 (77%), Positives = 393/452 (87%), Gaps = 5/452 (1%)
 Frame = +3

Query  252   ISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVL  431
              S+E  ++ S +MDDEYEK +RRMNPPRVVIDNEACK+ATVI+VDSANKHG LLEVVQVL
Sbjct  13    FSIETGLNSSWDMDDEYEKFVRRMNPPRVVIDNEACKSATVIRVDSANKHGILLEVVQVL  72

Query  432   TDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSV  611
             TDLNLIITKAYI SDGGWFMDVFNVT++EG+K+ DE +L+YI KSLG DS +  SMRRSV
Sbjct  73    TDLNLIITKAYISSDGGWFMDVFNVTDREGNKLKDECLLEYISKSLGADSSYVPSMRRSV  132

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV   T+HTSIEL G+DRPGLLSEV AVLT LKCNVVN EVWTHNTRAAA+M VTDEETG
Sbjct  133   GVEQSTNHTSIELTGTDRPGLLSEVCAVLTCLKCNVVNGEVWTHNTRAAAVMLVTDEETG  192

Query  792   GAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDE  971
              A+TDPE LS IK++LCNVLKG+NK+R AKT ++ G THT+RRLHQ+MFADRDYER+  +
Sbjct  193   AAITDPERLSKIKEMLCNVLKGNNKTREAKTVVSLGVTHTERRLHQMMFADRDYERSDSD  252

Query  972   ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
              L+   RPNV+V NWHD+DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFH NVDAEG EA
Sbjct  253   TLDEKLRPNVTVVNWHDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEGAEA  312

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             YQEY IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFR
Sbjct  313   YQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFR  372

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG---NPEE  1502
             ENSL+VTRAEV TR GKA+NTFYV DA+G PVDA+ I+S+R+ IGQTILQV+G   +P+ 
Sbjct  373   ENSLSVTRAEVMTRAGKAINTFYVRDAAGNPVDAKTIDSIREAIGQTILQVRGCFESPKS  432

Query  1503  QNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             Q   QESPTR LFGG+FKSRS  NFGLVRSYS
Sbjct  433   Q--AQESPTRFLFGGLFKSRSLYNFGLVRSYS  462



>ref|XP_010257938.1| PREDICTED: uncharacterized protein LOC104597875 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/450 (77%), Positives = 392/450 (87%), Gaps = 5/450 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  ++ S +MDDEYEK +RRMNPPRVVIDNEACK+ATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     METGLNSSWDMDDEYEKFVRRMNPPRVVIDNEACKSATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT++EG+K+ DE +L+YI KSLG DS +  SMRRSVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDREGNKLKDECLLEYISKSLGADSSYVPSMRRSVGV  120

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                T+HTSIEL G+DRPGLLSEV AVLT LKCNVVN EVWTHNTRAAA+M VTDEETG A
Sbjct  121   EQSTNHTSIELTGTDRPGLLSEVCAVLTCLKCNVVNGEVWTHNTRAAAVMLVTDEETGAA  180

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDPE LS IK++LCNVLKG+NK+R AKT ++ G THT+RRLHQ+MFADRDYER+  + L
Sbjct  181   ITDPERLSKIKEMLCNVLKGNNKTREAKTVVSLGVTHTERRLHQMMFADRDYERSDSDTL  240

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NWHD+DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFH NVDAEG EAYQ
Sbjct  241   DEKLRPNVTVVNWHDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHANVDAEGAEAYQ  300

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFREN
Sbjct  301   EYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFREN  360

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG---NPEEQN  1508
             SL+VTRAEV TR GKA+NTFYV DA+G PVDA+ I+S+R+ IGQTILQV+G   +P+ Q 
Sbjct  361   SLSVTRAEVMTRAGKAINTFYVRDAAGNPVDAKTIDSIREAIGQTILQVRGCFESPKSQ-  419

Query  1509  PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
               QESPTR LFGG+FKSRS  NFGLVRSYS
Sbjct  420   -AQESPTRFLFGGLFKSRSLYNFGLVRSYS  448



>gb|EPS70014.1| hypothetical protein M569_04746, partial [Genlisea aurea]
Length=447

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/449 (77%), Positives = 390/449 (87%), Gaps = 9/449 (2%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVI------QVDSANKHGTLLEVV  422
             E +VS SQNMDDEYEK IRRMNPPRVVIDNE+CKNAT        QVDSANK G LLEVV
Sbjct  1     ETSVSSSQNMDDEYEKFIRRMNPPRVVIDNESCKNATSFFVKMLGQVDSANKQGILLEVV  60

Query  423   QVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMR  602
             QVLTDLNL+I KAY+CSDGGWFMDVFNVT+ +G+KI DE +L+YI KSLGPDSCFASSMR
Sbjct  61    QVLTDLNLVILKAYMCSDGGWFMDVFNVTDLDGNKITDEGILEYIQKSLGPDSCFASSMR  120

Query  603   RSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDE  782
             RSVGVTS T+HTSIELIG+DRPGLLSEV AVLTNLKCNVVNAEVWTHNTRAAA+MQVT+E
Sbjct  121   RSVGVTSSTNHTSIELIGTDRPGLLSEVCAVLTNLKCNVVNAEVWTHNTRAAAVMQVTEE  180

Query  783   ETGGAVTDPETLSMIKKLLCNVLKGSN-KSRHAKTQITHGATHTDRRLHQLMFADRDYER  959
             + GGA+TDPE LS++KKLLCNVLKGS+ KSR AKT ++HGATHT+RRLHQ+MF DRDYER
Sbjct  181   DAGGAITDPEKLSLVKKLLCNVLKGSSSKSREAKTGVSHGATHTERRLHQMMFDDRDYER  240

Query  960   ASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAE  1139
               D    H  RPNV++ +WHDRDYSVV IRCKDRPKLLFDV+CTLTDM+YVVFHG+V++ 
Sbjct  241   MGDNESAH--RPNVTIDDWHDRDYSVVMIRCKDRPKLLFDVVCTLTDMQYVVFHGSVESR  298

Query  1140  GPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVT  1319
             G EAYQEYCIRH+DGS VKSDAERQRV+ CLEAAI RRVSEGLKLELCT DRVGLLS+VT
Sbjct  299   GSEAYQEYCIRHVDGSSVKSDAERQRVVQCLEAAIRRRVSEGLKLELCTNDRVGLLSDVT  358

Query  1320  RIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE  1499
             RIFRENSLTVTRAEV+TRGGKAVNTFYV DASGY VD +II+S+RQ+IGQT+L+VKG   
Sbjct  359   RIFRENSLTVTRAEVSTRGGKAVNTFYVRDASGYAVDPKIIDSIRQSIGQTVLRVKGGGG  418

Query  1500  EQNPTQESPTRSLFGGIFKSRSFCNFGLV  1586
                    + +R LFGG+FKS+S  NFGLV
Sbjct  419   GGEEDAAARSRFLFGGLFKSKSLVNFGLV  447



>ref|XP_004297204.1| PREDICTED: uncharacterized protein LOC101300715 [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/449 (76%), Positives = 396/449 (88%), Gaps = 3/449 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME ++S+S +MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANK G LLEVVQ+LTD
Sbjct  1     MEVSMSFSNDMDDEYEKLCRRMNPPRVVIDNEACKNATVIRVDSANKLGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP+SCFASSMR SVGV
Sbjct  61    LNLIVTKAYISSDGGWFMDVFNVTDQDGNKVTDEGVLDYIRKSLGPESCFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT++EL G+DRPGLLSEVSAVL  LKCNVV A+VWTHNTRAA++M +T+EETG A
Sbjct  120   IQSMDHTTLELSGTDRPGLLSEVSAVLAILKCNVVGAQVWTHNTRAASVMHITNEETGLA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-  974
             +TDPE L+ I++ +CNVLKGS KSR ++T ++H  TH +RRLHQ+MFADRDY+R  DE+ 
Sbjct  180   ITDPERLASIRESVCNVLKGSIKSRGSRTVVSHTVTHPERRLHQMMFADRDYDRIKDESV  239

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
             L+   RP+V+V NW+D+DYSVVTIR KDRPKLLFD +CTLTDM+YVV+H N+DAEGPEAY
Sbjct  240   LDDKQRPDVNVVNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVYHANIDAEGPEAY  299

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEY IRHIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRE
Sbjct  300   QEYYIRHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRE  359

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-  1511
             NSLTVTRAEV T+ GKAVNTFYV +ASG PVD++ IES+RQ IGQTIL+VKG PE+ NP 
Sbjct  360   NSLTVTRAEVTTKAGKAVNTFYVREASGNPVDSKTIESIRQEIGQTILKVKGTPEDFNPG  419

Query  1512  TQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +QESPTR LFGG+FKSRSF NF L+RSYS
Sbjct  420   SQESPTRFLFGGLFKSRSFVNFKLIRSYS  448



>ref|XP_004490254.1| PREDICTED: uncharacterized protein LOC101508719 isoform X5 [Cicer 
arietinum]
Length=450

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/448 (77%), Positives = 390/448 (87%), Gaps = 5/448 (1%)
 Frame = +3

Query  261   EATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             E  +S+S + MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTD
Sbjct  6     EVNMSFSSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTD  65

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+Q+G+K+ DEA+LDYI KSLGP+SCF S   RSVGV
Sbjct  66    LNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEAILDYIRKSLGPESCFPSP-GRSVGV  124

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL+GSDRPGLLSEVSAVLTNLKCN+VNAEVWTHN RAAA+M V DEETG A
Sbjct  125   KQTMDHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVNDEETGSA  184

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDP+ LS+IK+LLCNVL G N+ R AKT +T  +THTDRRLHQ+MFADRDYER  D+  
Sbjct  185   ITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDSTHTDRRLHQMMFADRDYERVDDDDF  244

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW D+DYSVVTI  KDRPKLLFD +CTLTDM+YVVFH N+DAEGP+AYQ
Sbjct  245   DEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPQAYQ  304

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLE+CTTDRVGLLSNVTRIFREN
Sbjct  305   EYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFREN  364

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQ  1517
             SLTVTRAEV T+GGKAVNTFYV  ASG  VD++ IES+RQTIG TIL+VKG+PE  +  Q
Sbjct  365   SLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTILKVKGSPE--SVPQ  422

Query  1518  ESPTR-SLFGGIFKSRSFCNFGLVRSYS  1598
             +SPTR S+F G+FKSRSF NFGLV+SYS
Sbjct  423   DSPTRSSIFSGLFKSRSFVNFGLVKSYS  450



>ref|XP_004490253.1| PREDICTED: uncharacterized protein LOC101508719 isoform X4 [Cicer 
arietinum]
Length=450

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/448 (77%), Positives = 390/448 (87%), Gaps = 5/448 (1%)
 Frame = +3

Query  261   EATVSYSQN-MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             E  +S+S + MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTD
Sbjct  6     EVNMSFSSHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTD  65

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+Q+G+K+ DEA+LDYI KSLGP+SCF S   RSVGV
Sbjct  66    LNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEAILDYIRKSLGPESCFPSP-GRSVGV  124

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL+GSDRPGLLSEVSAVLTNLKCN+VNAEVWTHN RAAA+M V DEETG A
Sbjct  125   KQTMDHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVNDEETGSA  184

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             +TDP+ LS+IK+LLCNVL G N+ R AKT +T  +THTDRRLHQ+MFADRDYER  D+  
Sbjct  185   ITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDSTHTDRRLHQMMFADRDYERVDDDDF  244

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNV+V NW D+DYSVVTI  KDRPKLLFD +CTLTDM+YVVFH N+DAEGP+AYQ
Sbjct  245   DEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPQAYQ  304

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY I+HIDGSPVKSDAERQRVI CLEAAIERRVSEGLKLE+CTTDRVGLLSNVTRIFREN
Sbjct  305   EYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFREN  364

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQ  1517
             SLTVTRAEV T+GGKAVNTFYV  ASG  VD++ IES+RQTIG TIL+VKG+PE  +  Q
Sbjct  365   SLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTILKVKGSPE--SVPQ  422

Query  1518  ESPTR-SLFGGIFKSRSFCNFGLVRSYS  1598
             +SPTR S+F G+FKSRSF NFGLV+SYS
Sbjct  423   DSPTRSSIFSGLFKSRSFVNFGLVKSYS  450



>ref|XP_004490255.1| PREDICTED: uncharacterized protein LOC101508719 isoform X6 [Cicer 
arietinum]
Length=442

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/441 (78%), Positives = 385/441 (87%), Gaps = 4/441 (1%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S  MDDEYEKL RRMNPPRVVIDNEACKNATVI+VDSANKHG LLEVVQ+LTDLNLIITK
Sbjct  5     SHYMDDEYEKLFRRMNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQILTDLNLIITK  64

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             AYI SDGGWFMDVFNVT+Q+G+K+ DEA+LDYI KSLGP+SCF S   RSVGV    DHT
Sbjct  65    AYISSDGGWFMDVFNVTDQDGNKVTDEAILDYIRKSLGPESCFPSP-GRSVGVKQTMDHT  123

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
             +IEL+GSDRPGLLSEVSAVLTNLKCN+VNAEVWTHN RAAA+M V DEETG A+TDP+ L
Sbjct  124   AIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVNDEETGSAITDPQRL  183

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPN  998
             S+IK+LLCNVL G N+ R AKT +T  +THTDRRLHQ+MFADRDYER  D+  +   RPN
Sbjct  184   SLIKELLCNVLGGGNRKRGAKTVVTDDSTHTDRRLHQMMFADRDYERVDDDDFDEKQRPN  243

Query  999   VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHI  1178
             V+V NW D+DYSVVTI  KDRPKLLFD +CTLTDM+YVVFH N+DAEGP+AYQEY I+HI
Sbjct  244   VNVVNWSDKDYSVVTIESKDRPKLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHI  303

Query  1179  DGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRA  1358
             DGSPVKSDAERQRVI CLEAAIERRVSEGLKLE+CTTDRVGLLSNVTRIFRENSLTVTRA
Sbjct  304   DGSPVKSDAERQRVIQCLEAAIERRVSEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRA  363

Query  1359  EVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR-S  1535
             EV T+GGKAVNTFYV  ASG  VD++ IES+RQTIG TIL+VKG+PE  +  Q+SPTR S
Sbjct  364   EVTTKGGKAVNTFYVRGASGCVVDSKTIESIRQTIGNTILKVKGSPE--SVPQDSPTRSS  421

Query  1536  LFGGIFKSRSFCNFGLVRSYS  1598
             +F G+FKSRSF NFGLV+SYS
Sbjct  422   IFSGLFKSRSFVNFGLVKSYS  442



>ref|XP_003614264.1| ACR4 [Medicago truncatula]
 gb|AES97222.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=451

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/449 (77%), Positives = 390/449 (87%), Gaps = 6/449 (1%)
 Frame = +3

Query  261   EATVSYSQN--MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             E  +SYSQ+  MDDEYEKL RRMNPPRVVIDN A +NATVI+VDSANK G LLEVVQ+LT
Sbjct  6     EVNMSYSQSHYMDDEYEKLFRRMNPPRVVIDNGASQNATVIRVDSANKQGILLEVVQILT  65

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVG  614
             DLNLIITKAYI SDGGWFMDVFNVT+Q+G+K+ DE +LDYI KSLGP+SCFA++MR SVG
Sbjct  66    DLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEVILDYIRKSLGPESCFATTMR-SVG  124

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             V    DHT+IEL+GSDRPGLLSEVSAVLTNLKCN+VNAEVWTHN RAAA+M VTDEETG 
Sbjct  125   VKQTPDHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVTDEETGS  184

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             A+TD + LS+IK+LLCNVL G N+ R AKT +T  +THTDRRLHQ+MF DRDYER  D+ 
Sbjct  185   AITDSQRLSLIKELLCNVLGGGNRKRGAKTVVTDDSTHTDRRLHQMMFDDRDYERVDDDD  244

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
              +   RPNV V NW D+DYSVVTI C+DRPKL+FD +CTLTDM+YVVFH N+DAEGP+AY
Sbjct  245   FDEKQRPNVDVVNWSDKDYSVVTIECRDRPKLVFDTVCTLTDMQYVVFHANIDAEGPQAY  304

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEY I+HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE
Sbjct  305   QEYYIKHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  364

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT  1514
             NSLTVTRAEV T+GGKAVNTFYV  ASG  VD++ IES+RQTIG TIL+VKG+PE  +  
Sbjct  365   NSLTVTRAEVTTKGGKAVNTFYVRGASGCIVDSKTIESIRQTIGNTILKVKGSPE--SLP  422

Query  1515  QESPTR-SLFGGIFKSRSFCNFGLVRSYS  1598
             Q+SPTR S+F G+FKSRSF NFGLV+SYS
Sbjct  423   QDSPTRSSIFSGLFKSRSFVNFGLVKSYS  451



>ref|XP_009127699.1| PREDICTED: uncharacterized protein LOC103852547 [Brassica rapa]
Length=457

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/458 (74%), Positives = 395/458 (86%), Gaps = 12/458 (3%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MDDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++ MR ++GV
Sbjct  61    LNLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTPMR-TIGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
             T  TD T IEL G DRPGLLSE++AVLT+L+C+V+NAEVWTHNTRAAA+MQVTD+ TG A
Sbjct  120   TPSTDSTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RA----  962
             ++DPE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE RA    
Sbjct  180   ISDPERLSRIKNLLRNVLKGSNTPREAKTVLSHGEVHTDRRLHQMMFEDRDYEHRAVVDD  239

Query  963   -SDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAE  1139
              S    +   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD E
Sbjct  240   DSSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTE  299

Query  1140  GPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVT  1319
             G EAYQEY +RHIDGSPVKS+AE+QRV+ CLEAAI RRVSEGLKLELCTTDRVGLLSNVT
Sbjct  300   GTEAYQEYYVRHIDGSPVKSEAEKQRVVQCLEAAINRRVSEGLKLELCTTDRVGLLSNVT  359

Query  1320  RIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE  1499
             RIFRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NPE
Sbjct  360   RIFRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPE  419

Query  1500  EQN-----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             EQ      P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   EQQQRQKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  457



>ref|XP_006391062.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
 gb|ESQ28348.1| hypothetical protein EUTSA_v10018526mg [Eutrema salsugineum]
Length=455

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/456 (75%), Positives = 397/456 (87%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ++DDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDVDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF+SSMR +VGV
Sbjct  61    LNLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSSSMR-TVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+MQVTD+ TG A
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEA  974
             ++DPE LS IK LL NVLKGSN  R AKT ++ G  HTDRRLHQ+MF DRDYE R  D+ 
Sbjct  180   ISDPERLSRIKNLLRNVLKGSNTPREAKTVVSQGEVHTDRRLHQMMFEDRDYEHRVVDDD  239

Query  975   LNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD +G 
Sbjct  240   SSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTDGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRI
Sbjct  300   EAYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ ++S+RQTIGQTIL+VK NPEEQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTLDSIRQTIGQTILKVKNNPEEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|XP_009105454.1| PREDICTED: uncharacterized protein LOC103831311 isoform X1 [Brassica 
rapa]
Length=454

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/455 (74%), Positives = 394/455 (87%), Gaps = 9/455 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MDDEYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             L+L ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV
Sbjct  61    LDLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+M+VTD+ TG A
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             V+DPE LS IK LL NVLKGSN  + AKT ++ G  HTDRRLHQ+MF DRDYE   DE+ 
Sbjct  180   VSDPERLSRIKSLLRNVLKGSNTPKEAKTVVSLGEVHTDRRLHQMMFEDRDYENLDDESS  239

Query  978   NHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE  1148
             N  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG E
Sbjct  240   NVQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTE  299

Query  1149  AYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIF  1328
             AYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIF
Sbjct  300   AYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIF  359

Query  1329  RENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN  1508
             RENSLTVTRAEV T+GGKAVNTFYV DASGY +DA+ I+S+RQTIG+TIL+VK  P+EQ 
Sbjct  360   RENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTILKVKNKPKEQQ  419

Query  1509  -----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QREKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  454



>emb|CDY65806.1| BnaA02g35780D [Brassica napus]
Length=453

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/454 (75%), Positives = 392/454 (86%), Gaps = 12/454 (3%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MDDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN++G LLEVVQ+LTDLNL 
Sbjct  1     MSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLT  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++ MR ++GVT  T
Sbjct  61    ITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTPMR-TIGVTPST  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             D T IEL G DRPGLLSE++AVLT+L+C+V+NAEVWTHNTRAAA+MQVTD+ TG A++DP
Sbjct  120   DSTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RA-----SDE  971
             E LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE RA     S  
Sbjct  180   ERLSRIKNLLRNVLKGSNTPREAKTVLSHGEVHTDRRLHQMMFEDRDYEHRAVVDDDSSS  239

Query  972   ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
               +   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EA
Sbjct  240   IQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  299

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             YQEY +RHIDGSPVKS+AE+QRV+ CLEAAI RRVSEGLKLELCTTDRVGLLSNVTRIFR
Sbjct  300   YQEYYVRHIDGSPVKSEAEKQRVVQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-  1508
             ENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NPEEQ  
Sbjct  360   ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPEEQQQ  419

Query  1509  ----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   RQKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  453



>gb|EYU28889.1| hypothetical protein MIMGU_mgv1a006953mg [Erythranthe guttata]
Length=424

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/438 (77%), Positives = 381/438 (87%), Gaps = 15/438 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY+KLIRRMNPPRVVIDNE+CKNATVIQVDSANK G LLEVVQ+LTDLNL+ITKA I
Sbjct  1     MDDEYQKLIRRMNPPRVVIDNESCKNATVIQVDSANKQGILLEVVQILTDLNLMITKAMI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
                  + M              DE +L+YI KSLGPDSCFASSMRRSVGV S ++HT+IE
Sbjct  61    HDVPDYVM-------------TDEGILEYIEKSLGPDSCFASSMRRSVGVKSESNHTAIE  107

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVL +LKCNVVNAEVWTHNTRAAA+MQVTDE TGG + D E L+M+
Sbjct  108   LTGTDRPGLLSEVSAVLAHLKCNVVNAEVWTHNTRAAAVMQVTDETTGGPIADQERLTMV  167

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNVLKGSNKSR AKT ++HG+THT+RRLHQ+MF DRDYER   E  +  +RP+V+V
Sbjct  168   KRLLCNVLKGSNKSREAKTVVSHGSTHTERRLHQMMFDDRDYERMDGED-DSSERPSVNV  226

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              NW+D+DYSVVTIRCKDRPKLLFD++CTLTDM+YVVFHGNV+ +GPEAYQEYCIRHIDGS
Sbjct  227   VNWNDKDYSVVTIRCKDRPKLLFDIVCTLTDMQYVVFHGNVETQGPEAYQEYCIRHIDGS  286

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PVKSDAERQRV+ CLEAAI+RRVSEGLKLELCTTDRVGLLS+VTRIFRENSL+VTRAEV 
Sbjct  287   PVKSDAERQRVVQCLEAAIQRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLSVTRAEVT  346

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFG  1544
             TR GKAVNTFYV DASGYPVD +II+S+RQTIGQTIL+VKG PEE N   QESPTR LFG
Sbjct  347   TRAGKAVNTFYVRDASGYPVDPKIIDSIRQTIGQTILRVKGTPEESNQAPQESPTRFLFG  406

Query  1545  GIFKSRSFCNFGLVRSYS  1598
             G+FKSRSFCNFGLVRSYS
Sbjct  407   GLFKSRSFCNFGLVRSYS  424



>dbj|BAJ33767.1| unnamed protein product [Thellungiella halophila]
Length=451

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/452 (75%), Positives = 394/452 (87%), Gaps = 10/452 (2%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ++DDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN++G LLEVVQ+LTDLNL 
Sbjct  1     MSFSQDVDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLT  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF+SSMR +VGV   T
Sbjct  61    ITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSSSMR-TVGVIPST  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             D T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+MQVTD+ TG A++DP
Sbjct  120   DSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHP  986
             E LS IK LL NVLKGSN  R AKT ++ G  HTDRRLHQ+MF DRDYE R  D+  +  
Sbjct  180   ERLSRIKNLLRNVLKGSNTPREAKTVVSQGEVHTDRRLHQMMFEDRDYEHRVVDDDSSIQ  239

Query  987   D---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD +G EAYQ
Sbjct  240   DERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTDGTEAYQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIFREN
Sbjct  300   EYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ----  1505
             SLTVTRAEV T+GGKA+NTFYV DASGY +DA+ ++S+RQTIGQTIL+VK NPEEQ    
Sbjct  360   SLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTLDSIRQTIGQTILKVKNNPEEQQQRQ  419

Query  1506  -NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              +P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   KSPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  451



>ref|XP_009105455.1| PREDICTED: uncharacterized protein LOC103831311 isoform X2 [Brassica 
rapa]
Length=450

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/451 (75%), Positives = 391/451 (87%), Gaps = 9/451 (2%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MDDEYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTDL+L 
Sbjct  1     MSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLT  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV   T
Sbjct  61    ITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGVIPST  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             D T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+M+VTD+ TG AV+DP
Sbjct  120   DSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD  989
             E LS IK LL NVLKGSN  + AKT ++ G  HTDRRLHQ+MF DRDYE   DE+ N  D
Sbjct  180   ERLSRIKSLLRNVLKGSNTPKEAKTVVSLGEVHTDRRLHQMMFEDRDYENLDDESSNVQD  239

Query  990   ---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
                RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EAYQE
Sbjct  240   ERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQE  299

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             Y +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIFRENS
Sbjct  300   YYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENS  359

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN----  1508
             LTVTRAEV T+GGKAVNTFYV DASGY +DA+ I+S+RQTIG+TIL+VK  P+EQ     
Sbjct  360   LTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTILKVKNKPKEQQQREK  419

Query  1509  -PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   PPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  450



>emb|CDX95965.1| BnaA07g27660D [Brassica napus]
Length=455

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/454 (74%), Positives = 393/454 (87%), Gaps = 9/454 (2%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             + ++S+SQ+MDDEYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTDL
Sbjct  3     DVSMSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDL  62

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             +L ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV 
Sbjct  63    DLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGVI  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
               TD T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+M+VTD+ TG AV
Sbjct  122   PSTDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAV  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALN  980
             +DPE LS IK LL NVLKGSN  + AKT ++ G  HTDRRLHQ+MF DRDY+   DE+ N
Sbjct  182   SDPERLSRIKSLLRNVLKGSNTPKEAKTVVSLGEVHTDRRLHQMMFEDRDYKNLDDESSN  241

Query  981   HPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
               D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EA
Sbjct  242   VQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  301

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             +QEY +RHIDGSPVKSDAE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIFR
Sbjct  302   FQEYYVRHIDGSPVKSDAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  361

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-  1508
             ENSLTVTRAEV T+GGKAVNTFYV DASGY +DA+ I+S+RQTIG+TIL+VK  P+EQ  
Sbjct  362   ENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTILKVKNKPKEQQQ  421

Query  1509  ----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  422   REKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|XP_002887219.1| hypothetical protein ARALYDRAFT_476032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63478.1| hypothetical protein ARALYDRAFT_476032 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/456 (74%), Positives = 394/456 (86%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +S+SQ+MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVGMSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++SMR SVGV
Sbjct  61    LNLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE+SAVLT+LKC+V+NAEVWTHNTRAAA+MQVTD+ TG  
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEVWTHNTRAAAVMQVTDDSTGCG  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEA  974
             ++DPE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  D+ 
Sbjct  180   ISDPERLSRIKNLLRNVLKGSNTPREAKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDD  239

Query  975   LNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG 
Sbjct  240   SSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCT+DRVGLLSNVTRI
Sbjct  300   EAYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTSDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +P+ ESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPSHESPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|NP_974107.1| ACT domain-containing protein [Arabidopsis thaliana]
 gb|AEE34879.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=455

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/456 (74%), Positives = 395/456 (87%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++SMR SVGV
Sbjct  61    LNLTITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE+SAVLT+LKC+V+NAE+WTHNTRAAA+MQVTD+ TG  
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCG  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEA  974
             ++DPE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  D+ 
Sbjct  180   ISDPERLSRIKNLLRNVLKGSNTPREAKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDD  239

Query  975   LNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG 
Sbjct  240   SSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EA+QEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRI
Sbjct  300   EAFQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +P+ ESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPSHESPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|XP_010681133.1| PREDICTED: uncharacterized protein LOC104896128 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/453 (75%), Positives = 392/453 (87%), Gaps = 11/453 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+SQ+MDDEYEKLIRRMNPPRVVIDNE+CKNATVIQVDSAN+HG LLEVVQ+LTD
Sbjct  1     MEPNMSFSQDMDDEYEKLIRRMNPPRVVIDNESCKNATVIQVDSANRHGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVG  614
             LNL+ITKAYI SDGGWFMDVFNV +Q+G+KI DE +LDYI KSLGPDS CF     RSV 
Sbjct  61    LNLVITKAYISSDGGWFMDVFNVIDQDGNKITDEEILDYIQKSLGPDSSCFG----RSVD  116

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             V S T+HT+IELIG DRPGLLSE++AVLT+LKCNVV+AE+WTHNTRAAA+MQ+TD+ TG 
Sbjct  117   VLSSTEHTAIELIGRDRPGLLSELTAVLTHLKCNVVSAEIWTHNTRAAAVMQITDQGTGY  176

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDE  971
             A+TD E LS IK+LLCNVL GS++S+ AKT++ TH A H +RRLHQ+MF DRDYE+  DE
Sbjct  177   AITDEERLSRIKELLCNVL-GSSQSKEAKTEVNTHVAIHAERRLHQMMFDDRDYEQIGDE  235

Query  972   A-LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE  1148
                +   RPNVSV NW+D+DYSVV++RCKDRPKLLFD +CTLTDM+YVVFHG+VDAEG E
Sbjct  236   EDEDERQRPNVSVVNWYDKDYSVVSVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDAEGSE  295

Query  1149  AYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIF  1328
             AYQEY IRH+DGSPVKS+AERQRVI CLEAAI+RRVSEGLKLELCTTDR GLLS+VTRIF
Sbjct  296   AYQEYYIRHVDGSPVKSEAERQRVIQCLEAAIKRRVSEGLKLELCTTDRAGLLSDVTRIF  355

Query  1329  RENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN---PE  1499
             RENSLTVT+AEV TRGGKAVN FYV DASGY VDA+ I+S+RQ IGQTIL+VKGN     
Sbjct  356   RENSLTVTQAEVTTRGGKAVNIFYVRDASGYNVDAKTIDSIRQVIGQTILKVKGNGSKER  415

Query  1500  EQNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +Q   QE+ +  LFGG+FKSRSFCNFGLVRSYS
Sbjct  416   KQKVAQETQSGFLFGGLFKSRSFCNFGLVRSYS  448



>emb|CDX81587.1| BnaC02g18910D [Brassica napus]
Length=453

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/454 (74%), Positives = 393/454 (87%), Gaps = 12/454 (3%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MDDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN++G LLEVVQ+LTDLNL 
Sbjct  1     MSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLT  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++ MR ++GVT  T
Sbjct  61    ITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTPMR-TIGVTPST  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVT-DEETGGAVTD  806
             + T IEL G DRPGLLSE++AVLT+L+C+V+NAEVWTHNTRAAA+MQVT D+ TG A++D
Sbjct  120   ESTVIELTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTTDDSTGCAISD  179

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS----DEA  974
             PE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE  +    D +
Sbjct  180   PERLSRIKNLLRNVLKGSNTPREAKTVLSHGEVHTDRRLHQMMFEDRDYEHRAVVDDDSS  239

Query  975   L-NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
             + +   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EA
Sbjct  240   IQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  299

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             YQEY +RHIDGSPVKS+AE+QRVI CLEAAI RRVSEGLKLELCTTDRVGLLSNVTRIFR
Sbjct  300   YQEYYVRHIDGSPVKSEAEKQRVIQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-  1508
             ENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NPEEQ  
Sbjct  360   ENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPEEQQQ  419

Query  1509  ----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   RQKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  453



>ref|NP_177067.1| ACT domain-containing protein [Arabidopsis thaliana]
 sp|Q8LJW3.1|ACR4_ARATH RecName: Full=ACT domain-containing protein ACR4; AltName: Full=Protein 
ACT DOMAIN REPEATS 4 [Arabidopsis thaliana]
 gb|AAM93429.1| ACR4 [Arabidopsis thaliana]
 gb|ABJ17112.1| At1g69040 [Arabidopsis thaliana]
 gb|AEE34878.1| ACT domain-containing protein [Arabidopsis thaliana]
Length=451

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/452 (75%), Positives = 392/452 (87%), Gaps = 10/452 (2%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTDLNL 
Sbjct  1     MSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLT  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++SMR SVGV   T
Sbjct  61    ITKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMR-SVGVIPST  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             D T IEL G DRPGLLSE+SAVLT+LKC+V+NAE+WTHNTRAAA+MQVTD+ TG  ++DP
Sbjct  120   DSTVIELTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHP  986
             E LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  D+  +  
Sbjct  180   ERLSRIKNLLRNVLKGSNTPREAKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQ  239

Query  987   D---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EA+Q
Sbjct  240   DERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIFREN
Sbjct  300   EYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFREN  359

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ----  1505
             SLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ    
Sbjct  360   SLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQQQRQ  419

Query  1506  -NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              +P+ ESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   KSPSHESPTRFLFGGLFKSKSFVNFGLVRSYS  451



>ref|XP_004490250.1| PREDICTED: uncharacterized protein LOC101508719 isoform X1 [Cicer 
arietinum]
Length=480

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 390/478 (82%), Gaps = 35/478 (7%)
 Frame = +3

Query  261   EATVSYSQN-MDDEYEKLIRRMNPPR------------------------------VVID  347
             E  +S+S + MDDEYEKL RRMNPPR                              VVID
Sbjct  6     EVNMSFSSHYMDDEYEKLFRRMNPPRYQFLFPFFPFNKKIQNFNDYDSLLLTCLFRVVID  65

Query  348   NEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSK  527
             NEACKNATVI+VDSANKHG LLEVVQ+LTDLNLIITKAYI SDGGWFMDVFNVT+Q+G+K
Sbjct  66    NEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNK  125

Query  528   IMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNL  707
             + DEA+LDYI KSLGP+SCF S   RSVGV    DHT+IEL+GSDRPGLLSEVSAVLTNL
Sbjct  126   VTDEAILDYIRKSLGPESCFPSP-GRSVGVKQTMDHTAIELMGSDRPGLLSEVSAVLTNL  184

Query  708   KCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQ  887
             KCN+VNAEVWTHN RAAA+M V DEETG A+TDP+ LS+IK+LLCNVL G N+ R AKT 
Sbjct  185   KCNIVNAEVWTHNMRAAAVMHVNDEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTV  244

Query  888   ITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPK  1067
             +T  +THTDRRLHQ+MFADRDYER  D+  +   RPNV+V NW D+DYSVVTI  KDRPK
Sbjct  245   VTDDSTHTDRRLHQMMFADRDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPK  304

Query  1068  LLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIE  1247
             LLFD +CTLTDM+YVVFH N+DAEGP+AYQEY I+HIDGSPVKSDAERQRVI CLEAAIE
Sbjct  305   LLFDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQCLEAAIE  364

Query  1248  RRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPV  1427
             RRVSEGLKLE+CTTDRVGLLSNVTRIFRENSLTVTRAEV T+GGKAVNTFYV  ASG  V
Sbjct  365   RRVSEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCVV  424

Query  1428  DARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR-SLFGGIFKSRSFCNFGLVRSYS  1598
             D++ IES+RQTIG TIL+VKG+PE  +  Q+SPTR S+F G+FKSRSF NFGLV+SYS
Sbjct  425   DSKTIESIRQTIGNTILKVKGSPE--SVPQDSPTRSSIFSGLFKSRSFVNFGLVKSYS  480


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 102/219 (47%), Gaps = 22/219 (10%)
 Frame = +3

Query  228  DPYHNPSRIS--MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKH  401
            D  H   R+   M A   Y +  DD++++  R    P V + N + K+ +V+ ++S ++ 
Sbjct  248  DSTHTDRRLHQMMFADRDYERVDDDDFDEKQR----PNVNVVNWSDKDYSVVTIESKDRP  303

Query  402  GTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS  581
              L + V  LTD+  ++  A I ++G      + + + +GS +  +A    +++      
Sbjct  304  KLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQ------  357

Query  582  CFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAA  761
            C  +++ R V     ++   +E+  +DR GLLS V+ +       V  AEV T   +A  
Sbjct  358  CLEAAIERRV-----SEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVN  412

Query  762  IMQVTDEETGGAVTDPETLSMIKKLLCNVL---KGSNKS  869
               V      G V D +T+  I++ + N +   KGS +S
Sbjct  413  TFYV--RGASGCVVDSKTIESIRQTIGNTILKVKGSPES  449



>ref|XP_004490251.1| PREDICTED: uncharacterized protein LOC101508719 isoform X2 [Cicer 
arietinum]
Length=480

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 390/478 (82%), Gaps = 35/478 (7%)
 Frame = +3

Query  261   EATVSYSQN-MDDEYEKLIRRMNPPR------------------------------VVID  347
             E  +S+S + MDDEYEKL RRMNPPR                              VVID
Sbjct  6     EVNMSFSSHYMDDEYEKLFRRMNPPRYQFLFPFFPFNKKIQNFNDYDSLLLTCLFRVVID  65

Query  348   NEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSK  527
             NEACKNATVI+VDSANKHG LLEVVQ+LTDLNLIITKAYI SDGGWFMDVFNVT+Q+G+K
Sbjct  66    NEACKNATVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNK  125

Query  528   IMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNL  707
             + DEA+LDYI KSLGP+SCF S   RSVGV    DHT+IEL+GSDRPGLLSEVSAVLTNL
Sbjct  126   VTDEAILDYIRKSLGPESCFPSP-GRSVGVKQTMDHTAIELMGSDRPGLLSEVSAVLTNL  184

Query  708   KCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQ  887
             KCN+VNAEVWTHN RAAA+M V DEETG A+TDP+ LS+IK+LLCNVL G N+ R AKT 
Sbjct  185   KCNIVNAEVWTHNMRAAAVMHVNDEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTV  244

Query  888   ITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPK  1067
             +T  +THTDRRLHQ+MFADRDYER  D+  +   RPNV+V NW D+DYSVVTI  KDRPK
Sbjct  245   VTDDSTHTDRRLHQMMFADRDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPK  304

Query  1068  LLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIE  1247
             LLFD +CTLTDM+YVVFH N+DAEGP+AYQEY I+HIDGSPVKSDAERQRVI CLEAAIE
Sbjct  305   LLFDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQCLEAAIE  364

Query  1248  RRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPV  1427
             RRVSEGLKLE+CTTDRVGLLSNVTRIFRENSLTVTRAEV T+GGKAVNTFYV  ASG  V
Sbjct  365   RRVSEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCVV  424

Query  1428  DARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR-SLFGGIFKSRSFCNFGLVRSYS  1598
             D++ IES+RQTIG TIL+VKG+PE  +  Q+SPTR S+F G+FKSRSF NFGLV+SYS
Sbjct  425   DSKTIESIRQTIGNTILKVKGSPE--SVPQDSPTRSSIFSGLFKSRSFVNFGLVKSYS  480


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 102/219 (47%), Gaps = 22/219 (10%)
 Frame = +3

Query  228  DPYHNPSRIS--MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKH  401
            D  H   R+   M A   Y +  DD++++  R    P V + N + K+ +V+ ++S ++ 
Sbjct  248  DSTHTDRRLHQMMFADRDYERVDDDDFDEKQR----PNVNVVNWSDKDYSVVTIESKDRP  303

Query  402  GTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS  581
              L + V  LTD+  ++  A I ++G      + + + +GS +  +A    +++      
Sbjct  304  KLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQ------  357

Query  582  CFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAA  761
            C  +++ R V     ++   +E+  +DR GLLS V+ +       V  AEV T   +A  
Sbjct  358  CLEAAIERRV-----SEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVN  412

Query  762  IMQVTDEETGGAVTDPETLSMIKKLLCNVL---KGSNKS  869
               V      G V D +T+  I++ + N +   KGS +S
Sbjct  413  TFYV--RGASGCVVDSKTIESIRQTIGNTILKVKGSPES  449



>ref|XP_010511930.1| PREDICTED: uncharacterized protein LOC104787960 [Camelina sativa]
Length=455

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/456 (74%), Positives = 395/456 (87%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I+KAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV
Sbjct  61    LNLTISKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE+SAVLT+LKC+V++AEVWTHNTRAAA+MQVTD+ TG  
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMQVTDDLTGCG  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEA  974
             V+DPE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  ++ 
Sbjct  180   VSDPERLSRIKNLLRNVLKGSNTPREAKTLVSHGEVHTDRRLHQMMFEDRDYELRVVEDD  239

Query  975   LNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  D   +P+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG 
Sbjct  240   SSIQDERQKPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRI
Sbjct  300   EAYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +PT +SPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPTHDSPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|XP_006302244.1| hypothetical protein CARUB_v10020277mg [Capsella rubella]
 gb|EOA35142.1| hypothetical protein CARUB_v10020277mg [Capsella rubella]
Length=455

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/456 (73%), Positives = 393/456 (86%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I+KAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++SMR SVGV
Sbjct  61    LNLTISKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE+SAVL +LKC+V++AEVWTHNTRAAA+MQVTD+ TG  
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELSAVLNHLKCSVLSAEVWTHNTRAAAVMQVTDDLTGCG  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA---SD  968
             ++DPE LS IK LL NVLKGSN  R AKT ++ G  HTDRRLHQ+MF DRDYE+     D
Sbjct  180   ISDPERLSRIKNLLRNVLKGSNTPREAKTVVSQGEVHTDRRLHQMMFEDRDYEQTVVDDD  239

Query  969   EAL-NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              ++ +   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG 
Sbjct  240   SSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRI
Sbjct  300   EAYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +P+ +SPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPSHDSPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|XP_004490252.1| PREDICTED: uncharacterized protein LOC101508719 isoform X3 [Cicer 
arietinum]
Length=472

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/471 (73%), Positives = 385/471 (82%), Gaps = 34/471 (7%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPR------------------------------VVIDNEACKNA  368
             S  MDDEYEKL RRMNPPR                              VVIDNEACKNA
Sbjct  5     SHYMDDEYEKLFRRMNPPRYQFLFPFFPFNKKIQNFNDYDSLLLTCLFRVVIDNEACKNA  64

Query  369   TVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVL  548
             TVI+VDSANKHG LLEVVQ+LTDLNLIITKAYI SDGGWFMDVFNVT+Q+G+K+ DEA+L
Sbjct  65    TVIRVDSANKHGILLEVVQILTDLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEAIL  124

Query  549   DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNA  728
             DYI KSLGP+SCF S   RSVGV    DHT+IEL+GSDRPGLLSEVSAVLTNLKCN+VNA
Sbjct  125   DYIRKSLGPESCFPSP-GRSVGVKQTMDHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNA  183

Query  729   EVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATH  908
             EVWTHN RAAA+M V DEETG A+TDP+ LS+IK+LLCNVL G N+ R AKT +T  +TH
Sbjct  184   EVWTHNMRAAAVMHVNDEETGSAITDPQRLSLIKELLCNVLGGGNRKRGAKTVVTDDSTH  243

Query  909   TDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVIC  1088
             TDRRLHQ+MFADRDYER  D+  +   RPNV+V NW D+DYSVVTI  KDRPKLLFD +C
Sbjct  244   TDRRLHQMMFADRDYERVDDDDFDEKQRPNVNVVNWSDKDYSVVTIESKDRPKLLFDTVC  303

Query  1089  TLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGL  1268
             TLTDM+YVVFH N+DAEGP+AYQEY I+HIDGSPVKSDAERQRVI CLEAAIERRVSEGL
Sbjct  304   TLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQCLEAAIERRVSEGL  363

Query  1269  KLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIES  1448
             KLE+CTTDRVGLLSNVTRIFRENSLTVTRAEV T+GGKAVNTFYV  ASG  VD++ IES
Sbjct  364   KLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVNTFYVRGASGCVVDSKTIES  423

Query  1449  VRQTIGQTILQVKGNPEEQNPTQESPTR-SLFGGIFKSRSFCNFGLVRSYS  1598
             +RQTIG TIL+VKG+PE  +  Q+SPTR S+F G+FKSRSF NFGLV+SYS
Sbjct  424   IRQTIGNTILKVKGSPE--SVPQDSPTRSSIFSGLFKSRSFVNFGLVKSYS  472


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 102/219 (47%), Gaps = 22/219 (10%)
 Frame = +3

Query  228  DPYHNPSRIS--MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKH  401
            D  H   R+   M A   Y +  DD++++  R    P V + N + K+ +V+ ++S ++ 
Sbjct  240  DSTHTDRRLHQMMFADRDYERVDDDDFDEKQR----PNVNVVNWSDKDYSVVTIESKDRP  295

Query  402  GTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS  581
              L + V  LTD+  ++  A I ++G      + + + +GS +  +A    +++      
Sbjct  296  KLLFDTVCTLTDMQYVVFHANIDAEGPQAYQEYYIKHIDGSPVKSDAERQRVIQ------  349

Query  582  CFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAA  761
            C  +++ R V     ++   +E+  +DR GLLS V+ +       V  AEV T   +A  
Sbjct  350  CLEAAIERRV-----SEGLKLEICTTDRVGLLSNVTRIFRENSLTVTRAEVTTKGGKAVN  404

Query  762  IMQVTDEETGGAVTDPETLSMIKKLLCNVL---KGSNKS  869
               V      G V D +T+  I++ + N +   KGS +S
Sbjct  405  TFYV--RGASGCVVDSKTIESIRQTIGNTILKVKGSPES  441



>gb|ACG60681.1| unknown protein [Brassica oleracea var. alboglabra]
Length=446

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/447 (75%), Positives = 387/447 (87%), Gaps = 11/447 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEKLIRRMNPPRVVIDN++CKNATVI+VDSAN++G LLEVVQ+LTDLNL ITKAYI
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNDSCKNATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++ MR ++GVT  TD T IE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTPMR-TIGVTPSTDSTVIE  119

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSE++AVLT+L+C+V+NAEVWTHNTRAAA+MQVTD+ TG A++DPE LS I
Sbjct  120   LTGCDRPGLLSELTAVLTHLRCSVLNAEVWTHNTRAAAVMQVTDDSTGCAISDPERLSRI  179

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS----DEAL-NHPDR  992
             K LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE  +    D ++ +   R
Sbjct  180   KNLLRNVLKGSNTPREAKTVLSHGEVHTDRRLHQMMFEDRDYEHRAVVDDDSSIQDERQR  239

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EAYQEY +R
Sbjct  240   PDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAYQEYYVR  299

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             HIDGSPVKS+AE+QRVI CLEAAI RRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT
Sbjct  300   HIDGSPVKSEAEKQRVIQCLEAAINRRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  359

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-----PTQ  1517
             RAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NPEEQ      P+Q
Sbjct  360   RAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPEEQQQRQKPPSQ  419

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             +SPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   DSPTRFLFGGLFKSKSFVNFGLVRSYS  446



>emb|CDY33557.1| BnaC06g29950D [Brassica napus]
Length=453

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/454 (73%), Positives = 392/454 (86%), Gaps = 12/454 (3%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +S+SQ+MDDEYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTDL+L 
Sbjct  1     MSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDLDLT  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV   T
Sbjct  61    ITKAYISSDGGWFMDVFNVTHQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGVIPST  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             D T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+M+VTD+ TG AV+DP
Sbjct  120   DSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAVSDP  179

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA---SDEALN  980
             E LS+IK LL NVLKGSN  + AKT ++ G  HTDRRLHQ+MF DRDYE      D++ N
Sbjct  180   ERLSLIKSLLRNVLKGSNTPKEAKTVVSQGEVHTDRRLHQMMFEDRDYENGVMVDDDSSN  239

Query  981   HPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
               D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EA
Sbjct  240   VQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEA  299

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             +QEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIFR
Sbjct  300   FQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFR  359

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-  1508
             ENSLTVTRAEV T+GGKAVNTFYV DASGY +DA+ I+S+RQTIG+T+L+VK  P++Q  
Sbjct  360   ENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTLLKVKNKPKDQQQ  419

Query  1509  ----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   REKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  453



>ref|XP_010470880.1| PREDICTED: uncharacterized protein LOC104750738 [Camelina sativa]
Length=455

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/456 (73%), Positives = 394/456 (86%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I+KAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV
Sbjct  61    LNLTISKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE+SAVLT+LKC+V++AEVWTHNTRAAA+M VTD+ TG  
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMHVTDDLTGCG  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEA  974
             V+DPE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  D+ 
Sbjct  180   VSDPERLSRIKNLLRNVLKGSNTPREAKTLVSHGEVHTDRRLHQMMFEDRDYELRVVDDD  239

Query  975   LNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD +G 
Sbjct  240   SSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTKGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRI
Sbjct  300   EAYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +P+ +SPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPSHDSPTRFLFGGLFKSKSFVNFGLVRSYS  455



>ref|XP_010936425.1| PREDICTED: uncharacterized protein LOC105056061 isoform X1 [Elaeis 
guineensis]
Length=453

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/452 (74%), Positives = 386/452 (85%), Gaps = 5/452 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S S + DDE+EK IRRMNPPRVVIDNE+C NATV++VDSANK+G LLEVVQVLTD
Sbjct  2     MEGDLSPSWDSDDEFEKFIRRMNPPRVVIDNESCANATVVRVDSANKYGILLEVVQVLTD  61

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRR  605
             LNLI  KAYI SDGGWFMDVFNVT+++G KI +E+ LD    YI KSLG DS F  S RR
Sbjct  62    LNLITKKAYISSDGGWFMDVFNVTDRDGKKIREESKLDEIGNYIRKSLGADSAFVPSCRR  121

Query  606   SVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEE  785
             SVGV   +D+T IEL G+DRPGLLSEVSAVLT+LKCNVVNAEVWTHNTRAA++MQVTDEE
Sbjct  122   SVGVAPSSDYTVIELTGTDRPGLLSEVSAVLTSLKCNVVNAEVWTHNTRAASVMQVTDEE  181

Query  786   TGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS  965
             TG A+ DPE LS IK+LLCNVLKG+N +R AKT ++ G THTDRRLHQ+MFADRDYER+ 
Sbjct  182   TGLAIIDPERLSRIKELLCNVLKGNNITRGAKTAVSMGVTHTDRRLHQMMFADRDYERSD  241

Query  966   DEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  N   RPNV+V NW D+DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFHGNVDAEGP
Sbjct  242   KDTANESHRPNVTVVNWFDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGP  301

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLELCT+DRVGLLS+VTRI
Sbjct  302   EAYQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRI  361

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-  1502
             FREN LTV RAEV+T+GGKA+NTFYV DA+G  VDA+ +E++RQ IG T+LQVKG+ ++ 
Sbjct  362   FRENGLTVIRAEVSTQGGKAINTFYVRDAAGNSVDAKTLEAIRQAIGLTVLQVKGHMDQS  421

Query  1503  QNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ++P Q+SPTR LFGG+FKS+S  NFGLVR YS
Sbjct  422   ESPPQDSPTRFLFGGLFKSKSLYNFGLVRPYS  453



>ref|XP_010415531.1| PREDICTED: uncharacterized protein LOC104701533 [Camelina sativa]
Length=455

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/456 (73%), Positives = 393/456 (86%), Gaps = 10/456 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+ ++S+SQ+MD+EYEKLIRRMNPPRVVIDN++ K ATVI+VDSAN++G LLEVVQ+LTD
Sbjct  1     MDVSMSFSQDMDNEYEKLIRRMNPPRVVIDNDSSKKATVIRVDSANEYGILLEVVQILTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I+KAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+R SVGV
Sbjct  61    LNLTISKAYISSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSLR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL G DRPGLLSE+SAVLT+LKC+V++AEVWTHNTRAAA+M VTD+ TG  
Sbjct  120   IPSTDSTVIELTGCDRPGLLSELSAVLTHLKCSVLSAEVWTHNTRAAAVMHVTDDLTGCG  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEA  974
             V+DPE LS IK LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  D+ 
Sbjct  180   VSDPERLSRIKNLLRNVLKGSNTPREAKTLVSHGEVHTDRRLHQMMFEDRDYELRVVDDD  239

Query  975   LNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG 
Sbjct  240   SSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGT  299

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY +RHIDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRI
Sbjct  300   EAYQEYYVRHIDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRI  359

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ  1505
             FRENSLTVTRAEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ
Sbjct  360   FRENSLTVTRAEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQ  419

Query  1506  -----NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  +P+ +SPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   QQRQKSPSHDSPTRFLFGGLFKSKSFVNFGLVRSYS  455



>gb|AAF27052.1|AC008262_1 F4N2.2 [Arabidopsis thaliana]
Length=445

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/446 (75%), Positives = 386/446 (87%), Gaps = 10/446 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MD+EYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTDLNL ITKAYI
Sbjct  1     MDNEYEKLIRRMNPPRVVIDNDSCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++SMR SVGV   TD T IE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEVVLDYIQKSLGPEACFSTSMR-SVGVIPSTDSTVIE  119

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSE+SAVLT+LKC+V+NAE+WTHNTRAAA+MQVTD+ TG  ++DPE LS I
Sbjct  120   LTGCDRPGLLSELSAVLTHLKCSVLNAEIWTHNTRAAAVMQVTDDLTGCGISDPERLSRI  179

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHPD---RP  995
             K LL NVLKGSN  R AKT ++HG  HTDRRLHQ+MF DRDYE R  D+  +  D   RP
Sbjct  180   KNLLRNVLKGSNTPREAKTVVSHGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQDERQRP  239

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
             +V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG EA+QEY +RH
Sbjct  240   DVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQEYYVRH  299

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             IDGSPVKS+AE+QRVI CLEAAI+RRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR
Sbjct  300   IDGSPVKSEAEKQRVIQCLEAAIKRRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  359

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ-----NPTQE  1520
             AEV T+GGKA+NTFYV DASGY +DA+ I+S+RQTIGQTIL+VK NP+EQ     +P+ E
Sbjct  360   AEVKTKGGKALNTFYVSDASGYSIDAKTIDSIRQTIGQTILKVKNNPQEQQQRQKSPSHE  419

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             SPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  420   SPTRFLFGGLFKSKSFVNFGLVRSYS  445


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/197 (24%), Positives = 88/197 (45%), Gaps = 14/197 (7%)
 Frame = +3

Query  276  YSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIIT  455
            Y   + D+   +      P V +DN   K+ +V+ V   ++   L + V  LTD+  ++ 
Sbjct  221  YEHRLVDDDSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVF  280

Query  456  KAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDH  635
               + ++G      + V + +GS +  EA    +++      C  ++++R V     ++ 
Sbjct  281  HGSVDTEGTEAFQEYYVRHIDGSPVKSEAEKQRVIQ------CLEAAIKRRV-----SEG  329

Query  636  TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPET  815
              +EL  +DR GLLS V+ +       V  AEV T   +A     V+D    G   D +T
Sbjct  330  LKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVKTKGGKALNTFYVSD--ASGYSIDAKT  387

Query  816  LSMIKKLLCN-VLKGSN  863
            +  I++ +   +LK  N
Sbjct  388  IDSIRQTIGQTILKVKN  404



>ref|XP_010936426.1| PREDICTED: uncharacterized protein LOC105056061 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/452 (74%), Positives = 385/452 (85%), Gaps = 5/452 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M   +S S + DDE+EK IRRMNPPRVVIDNE+C NATV++VDSANK+G LLEVVQVLTD
Sbjct  1     MMGDLSPSWDSDDEFEKFIRRMNPPRVVIDNESCANATVVRVDSANKYGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRR  605
             LNLI  KAYI SDGGWFMDVFNVT+++G KI +E+ LD    YI KSLG DS F  S RR
Sbjct  61    LNLITKKAYISSDGGWFMDVFNVTDRDGKKIREESKLDEIGNYIRKSLGADSAFVPSCRR  120

Query  606   SVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEE  785
             SVGV   +D+T IEL G+DRPGLLSEVSAVLT+LKCNVVNAEVWTHNTRAA++MQVTDEE
Sbjct  121   SVGVAPSSDYTVIELTGTDRPGLLSEVSAVLTSLKCNVVNAEVWTHNTRAASVMQVTDEE  180

Query  786   TGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS  965
             TG A+ DPE LS IK+LLCNVLKG+N +R AKT ++ G THTDRRLHQ+MFADRDYER+ 
Sbjct  181   TGLAIIDPERLSRIKELLCNVLKGNNITRGAKTAVSMGVTHTDRRLHQMMFADRDYERSD  240

Query  966   DEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGP  1145
              +  N   RPNV+V NW D+DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFHGNVDAEGP
Sbjct  241   KDTANESHRPNVTVVNWFDKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGP  300

Query  1146  EAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             EAYQEY IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLELCT+DRVGLLS+VTRI
Sbjct  301   EAYQEYYIRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRVGLLSDVTRI  360

Query  1326  FRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-  1502
             FREN LTV RAEV+T+GGKA+NTFYV DA+G  VDA+ +E++RQ IG T+LQVKG+ ++ 
Sbjct  361   FRENGLTVIRAEVSTQGGKAINTFYVRDAAGNSVDAKTLEAIRQAIGLTVLQVKGHMDQS  420

Query  1503  QNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             ++P Q+SPTR LFGG+FKS+S  NFGLVR YS
Sbjct  421   ESPPQDSPTRFLFGGLFKSKSLYNFGLVRPYS  452



>emb|CAN83103.1| hypothetical protein VITISV_015490 [Vitis vinifera]
Length=416

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/426 (78%), Positives = 369/426 (87%), Gaps = 11/426 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEKLIRRMNPPRVVIDNE CKNA+VI+VDSANKHG LLEVVQVL DLNLIITKAYI
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNETCKNASVIRVDSANKHGILLEVVQVLIDLNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+KI DE +LDYI KSLG D+CF SSMRRSVGV   TDHTSIE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKITDEEILDYIQKSLGSDACFISSMRRSVGVIPSTDHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L GSDRPGLLSEVSAVLT+LKC+VVNAEVWTHNTRAAA+M VTDEETG A+TDPE LS +
Sbjct  121   LTGSDRPGLLSEVSAVLTHLKCSVVNAEVWTHNTRAAAVMHVTDEETGCAITDPERLSKV  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCN+   S           HG THT+RRLHQ+MFADRDYER  ++  +   RPNV+V
Sbjct  181   KQLLCNLRLWS----------LHGVTHTERRLHQMMFADRDYERIYNDGSDEAQRPNVNV  230

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              NW+D+DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH NVDAEGPEAYQEY IRHIDGS
Sbjct  231   VNWYDKDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVDAEGPEAYQEYYIRHIDGS  290

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PVKSDAERQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSL+VTRAEV 
Sbjct  291   PVKSDAERQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLSVTRAEVT  350

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESPTRSLFG  1544
             TR GKAVNTF+V DASGYPVDA+ I+S+R+ IGQTILQVKG+PEE +   QESPTR L  
Sbjct  351   TRAGKAVNTFHVRDASGYPVDAKTIDSIREAIGQTILQVKGSPEEIKQIPQESPTRFLLV  410

Query  1545  GIFKSR  1562
             G+F+SR
Sbjct  411   GLFRSR  416



>gb|KGN47669.1| hypothetical protein Csa_6G367150 [Cucumis sativus]
Length=448

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/449 (74%), Positives = 384/449 (86%), Gaps = 5/449 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M   +++S ++DDEY KLIRRMNPPRVVIDN+ACK+ATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MAIDMNFSHDIDDEYVKLIRRMNPPRVVIDNDACKDATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI  DG WFMDVFNVT+Q+G+K+ DE VLDYI +SL  DSCFASSMR SVGV
Sbjct  61    LNLIVTKAYISCDGCWFMDVFNVTDQDGNKVTDEGVLDYIKRSLESDSCFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D+T IELIG+DR GLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+M VTD+ETG A
Sbjct  120   KPSVDYTVIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSN-KSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             +TD E LS IK LL NVL+GSN +S+ AKT ++HG TH +RRLHQ+MFADRDYE   ++ 
Sbjct  180   ITDLERLSRIKGLLSNVLRGSNSRSKGAKTVVSHGVTHIERRLHQMMFADRDYELLDEDV  239

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
             +    +PNV V NW D DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH NV AEG EAY
Sbjct  240   MEDQQKPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEAY  299

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEY IRHIDGSPVKSDAERQRVIHCLEAAI RRVSEGLKLELCTTDRVGLLS+VTRIFRE
Sbjct  300   QEYYIRHIDGSPVKSDAERQRVIHCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFRE  359

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG--NPEEQ-  1505
             NSLTVTRAEV T+ GKA+NTFYV D SGYPVD++ I+S+R+ IGQTIL+VKG  +P+EQ 
Sbjct  360   NSLTVTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTILKVKGSSSPKEQK  419

Query  1506  NPTQESPTRSLFGGIFKSRSFCNFGLVRS  1592
               +Q+SPTR LFGG+F+SRSF NFGL+RS
Sbjct  420   QASQDSPTRFLFGGLFRSRSFVNFGLIRS  448



>ref|XP_004144160.1| PREDICTED: uncharacterized protein LOC101218703 [Cucumis sativus]
 ref|XP_004169337.1| PREDICTED: uncharacterized protein LOC101228960 [Cucumis sativus]
Length=444

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/445 (75%), Positives = 383/445 (86%), Gaps = 5/445 (1%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +++S ++DDEY KLIRRMNPPRVVIDN+ACK+ATVI+VDSANKHG LLEVVQVLTDLNLI
Sbjct  1     MNFSHDIDDEYVKLIRRMNPPRVVIDNDACKDATVIRVDSANKHGILLEVVQVLTDLNLI  60

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             +TKAYI  DG WFMDVFNVT+Q+G+K+ DE VLDYI +SL  DSCFASSMR SVGV    
Sbjct  61    VTKAYISCDGCWFMDVFNVTDQDGNKVTDEGVLDYIKRSLESDSCFASSMR-SVGVKPSV  119

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             D+T IELIG+DR GLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+M VTD+ETG A+TD 
Sbjct  120   DYTVIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSAITDL  179

Query  810   ETLSMIKKLLCNVLKGSN-KSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
             E LS IK LL NVL+GSN +S+ AKT ++HG TH +RRLHQ+MFADRDYE   ++ +   
Sbjct  180   ERLSRIKGLLSNVLRGSNSRSKGAKTVVSHGVTHIERRLHQMMFADRDYELLDEDVMEDQ  239

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +PNV V NW D DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH NV AEG EAYQEY 
Sbjct  240   QKPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEAYQEYY  299

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRHIDGSPVKSDAERQRVIHCLEAAI RRVSEGLKLELCTTDRVGLLS+VTRIFRENSLT
Sbjct  300   IRHIDGSPVKSDAERQRVIHCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFRENSLT  359

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG--NPEEQ-NPTQ  1517
             VTRAEV T+ GKA+NTFYV D SGYPVD++ I+S+R+ IGQTIL+VKG  +P+EQ   +Q
Sbjct  360   VTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTILKVKGSSSPKEQKQASQ  419

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRS  1592
             +SPTR LFGG+F+SRSF NFGL+RS
Sbjct  420   DSPTRFLFGGLFRSRSFVNFGLIRS  444



>ref|XP_008445429.1| PREDICTED: uncharacterized protein LOC103488452 [Cucumis melo]
Length=448

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/449 (74%), Positives = 383/449 (85%), Gaps = 5/449 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M   +++S ++DDEY KLIRRMNPPRVVIDN+ACK+ATVI+VDSANKHG LLE VQVLTD
Sbjct  1     MAIDMNFSHDIDDEYVKLIRRMNPPRVVIDNDACKDATVIRVDSANKHGILLEAVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLI+TKAYI  DG WFMDVFNVT+Q+G+K+ DE VLDYI +SL  DSCFASSMR SVGV
Sbjct  61    LNLIVTKAYISCDGCWFMDVFNVTDQDGNKVTDEGVLDYIKRSLESDSCFASSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D+T+IELIG+DR GLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+M VTD+ETG A
Sbjct  120   KPSVDYTAIELIGNDRQGLLSEVSAVLTHLKCNVVHAEVWTHNTRAAAVMHVTDDETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSN-KSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             +TD E LS IK LL NVL+GSN +S  AKT ++HG TH +RRLHQ+MFADRDYE   ++A
Sbjct  180   ITDLERLSRIKGLLSNVLRGSNSRSNGAKTVVSHGVTHIERRLHQMMFADRDYELLDEDA  239

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
             +    RPNV V NW D DYSVVTIR KDRPKLLFD +CTLTDM+YVVFH NV AEG EAY
Sbjct  240   MEDQQRPNVKVVNWCDIDYSVVTIRSKDRPKLLFDTVCTLTDMQYVVFHANVVAEGTEAY  299

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRE  1334
             QEY IRHIDGSPVKSDAERQRVI CLEAAI RRVSEGLKLELCTTDRVGLLS+VTRIFRE
Sbjct  300   QEYYIRHIDGSPVKSDAERQRVIQCLEAAIRRRVSEGLKLELCTTDRVGLLSDVTRIFRE  359

Query  1335  NSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG--NPEEQ-  1505
             NSLTVTRAEV T+ GKA+NTFYV D SGYPVD++ I+S+R+ IGQTIL+VKG  +P+EQ 
Sbjct  360   NSLTVTRAEVTTKAGKAINTFYVRDPSGYPVDSKTIDSIRELIGQTILKVKGSSSPKEQK  419

Query  1506  NPTQESPTRSLFGGIFKSRSFCNFGLVRS  1592
               +Q+SPTR LFGG+F+SRSF NFGL+RS
Sbjct  420   QASQDSPTRFLFGGLFRSRSFVNFGLIRS  448



>ref|XP_009411127.1| PREDICTED: uncharacterized protein LOC103992926 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/438 (73%), Positives = 372/438 (85%), Gaps = 4/438 (1%)
 Frame = +3

Query  297   EYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSD  476
             EYEK IRRMNPPRVV+DN++C NATVI+VDSANK+G LLEVVQVL DLNLIITKAYI SD
Sbjct  14    EYEKFIRRMNPPRVVVDNDSCANATVIRVDSANKYGILLEVVQVLMDLNLIITKAYISSD  73

Query  477   GGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             GGWFMDVFNV +++G+KI  E  LD    +I KSLG DS F  S R+SVG T  +DHTSI
Sbjct  74    GGWFMDVFNVRDRDGNKIEKEKDLDKIKNFIRKSLGEDSSFVPSRRKSVGFTPSSDHTSI  133

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             EL G+DRPGLLSEVSAVLT+L+CNVV+AEVWTHN+RAAA+MQVTDEETG A+TDPE LS 
Sbjct  134   ELTGTDRPGLLSEVSAVLTDLRCNVVSAEVWTHNSRAAAVMQVTDEETGSAITDPEKLSR  193

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             IK+LLCNVLKG+N+SR AKT ++ G T T+RRLHQLMF DRDYER+ +++ N   RP V+
Sbjct  194   IKELLCNVLKGNNRSREAKTTVSVGVTQTERRLHQLMFDDRDYERSDEDSRNEHHRPKVT  253

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHGNVDAEGPEAYQEYCIRH+DG
Sbjct  254   VVNWFDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEAYQEYCIRHVDG  313

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SPV S+AERQRVI CLEAAIERRVSEGLKLELCT+DR+GLL++VTRIFREN L+VTRAEV
Sbjct  314   SPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRMGLLTDVTRIFRENGLSVTRAEV  373

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLFG  1544
              TR GKA+NTFYV DA+G PVD + ++ +R  IGQT+LQVKG+ +     Q SPTR LFG
Sbjct  374   TTRSGKAINTFYVRDAAGNPVDPKTLDDIRAEIGQTVLQVKGHADHLKSPQGSPTRFLFG  433

Query  1545  GIFKSRSFCNFGLVRSYS  1598
             G+FKSRS  N GL+R Y+
Sbjct  434   GLFKSRSLYNLGLIRPYT  451



>ref|XP_010527984.1| PREDICTED: uncharacterized protein LOC104805208 [Tarenaya hassleriana]
 ref|XP_010527985.1| PREDICTED: uncharacterized protein LOC104805208 [Tarenaya hassleriana]
 ref|XP_010527986.1| PREDICTED: uncharacterized protein LOC104805208 [Tarenaya hassleriana]
Length=454

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/455 (73%), Positives = 377/455 (83%), Gaps = 9/455 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+   S+S NMDDEY K +RRMNPPRVVIDN+ CK ATV++VDS N+ G LLEVVQVLTD
Sbjct  1     MDVCSSFSHNMDDEYAKFVRRMNPPRVVIDNDVCKKATVVKVDSVNRPGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I KAYI SDGGWFMDVFNVTNQ+G+K+ DE VLDYI KSLGP+SCF SSMR SVGV
Sbjct  61    LNLSIRKAYISSDGGWFMDVFNVTNQDGNKVTDELVLDYIRKSLGPESCFMSSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                TD T IEL GSDRPGLLSE+SAVL +L+CNVVNAE+WTHNTRAAAI+Q+TDEETG A
Sbjct  120   KQSTDFTVIELTGSDRPGLLSELSAVLRDLRCNVVNAEIWTHNTRAAAIVQITDEETGFA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRH-AKTQITH-GATHTDRRLHQLMFADRDYERASDE  971
             +TD E LS IK+ L NVL G N   H AKT ++    THTDRRLHQ+MFADRDYE+ +DE
Sbjct  180   ITDQERLSKIKRHLGNVLMGGNSRTHEAKTMVSSLEVTHTDRRLHQMMFADRDYEQDNDE  239

Query  972   ALNHPD----RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAE  1139
                       RP+V V NWHDRDYS+VTIR KDRPKLLFD + TLTDM+YVVFH N+DAE
Sbjct  240   DGGVDKVGRLRPDVDVVNWHDRDYSIVTIRSKDRPKLLFDTVFTLTDMKYVVFHANIDAE  299

Query  1140  GPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVT  1319
             GPEA+QEY +RH DGSPVKS+AER+RVI CL AAI+RRVSEGLKLELCTTDRVGLLS+VT
Sbjct  300   GPEAHQEYYVRHTDGSPVKSEAERERVIKCLRAAIQRRVSEGLKLELCTTDRVGLLSSVT  359

Query  1320  RIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE  1499
             RIFRENSLTVTRAEV TRGGKA+NTFYV DASGY VD + I+S+RQ IGQTIL+VKG+ E
Sbjct  360   RIFRENSLTVTRAEVKTRGGKALNTFYVSDASGYTVDPKTIDSIRQVIGQTILKVKGDAE  419

Query  1500  E--QNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             E  +  +QESPTR LFG +FKSRSF NFGL+RSYS
Sbjct  420   ENLKLASQESPTRFLFGSLFKSRSFVNFGLIRSYS  454



>ref|XP_009627379.1| PREDICTED: uncharacterized protein LOC104117932 isoform X3 [Nicotiana 
tomentosiformis]
Length=371

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/371 (85%), Positives = 343/371 (92%), Gaps = 1/371 (0%)
 Frame = +3

Query  489   MDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRP  668
             MDVFNVTNQEG+KI DEA+LDYIM+SLGPDSCFASSMRRSVGVTSG DHTSIELIGSDRP
Sbjct  1     MDVFNVTNQEGNKITDEAMLDYIMRSLGPDSCFASSMRRSVGVTSGMDHTSIELIGSDRP  60

Query  669   GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNV  848
             GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEE GGA+ DPE LSM+K+LLCNV
Sbjct  61    GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEENGGAINDPERLSMMKQLLCNV  120

Query  849   LKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRD  1028
             L+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER +DE L+  +RPNV+V NW D+D
Sbjct  121   LRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTADEGLDDKERPNVNVVNWQDKD  180

Query  1029  YSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAE  1208
             YSVVTI CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGPEA+QEYCIRH+DGSPVKSDAE
Sbjct  181   YSVVTINCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPEAHQEYCIRHVDGSPVKSDAE  240

Query  1209  RQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAV  1388
             RQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTVTRAEV TR GKA+
Sbjct  241   RQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTVTRAEVTTRAGKAL  300

Query  1389  NTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFGGIFKSRS  1565
             N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN +E NP  QESPTR LFGG+FKSRS
Sbjct  301   NIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNVKELNPVRQESPTRFLFGGLFKSRS  360

Query  1566  FCNFGLVRSYS  1598
             FCNFGLVRSYS
Sbjct  361   FCNFGLVRSYS  371



>ref|XP_007156374.1| hypothetical protein PHAVU_003G280900g [Phaseolus vulgaris]
 gb|ESW28368.1| hypothetical protein PHAVU_003G280900g [Phaseolus vulgaris]
Length=452

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/446 (73%), Positives = 382/446 (86%), Gaps = 5/446 (1%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             +++S+ M+DEYEKL RRMNPPRVVIDNE+C+NATVI+VDSANKHG LLEVVQ+LTDLNL 
Sbjct  9     MNFSRYMNDEYEKLFRRMNPPRVVIDNESCENATVIRVDSANKHGILLEVVQILTDLNLT  68

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             ITKAYI SDGGWFMDVFNVT+ +G K+ DEA+L+YI KSLGP+SCF SSMR SVGVT   
Sbjct  69    ITKAYISSDGGWFMDVFNVTDHDGKKVTDEAILEYIRKSLGPESCFMSSMR-SVGVTQTM  127

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
              HT++EL+GSDRPGLLSEVSAVLTNLKCN++NAEVWTHNTRAAA++ VTDEETG A+TDP
Sbjct  128   QHTAVELLGSDRPGLLSEVSAVLTNLKCNILNAEVWTHNTRAAAVIHVTDEETGSAITDP  187

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNH--  983
             + LS+IK+LLCNVL G NK R + + +T    HT+RRLHQ+MFADRDYER  D+  +   
Sbjct  188   QRLSLIKELLCNVLGGGNKVRGSSSVVTKEVNHTERRLHQMMFADRDYERVDDDDEDIDE  247

Query  984   PDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEY  1163
               RP V+V NW D DYSVVTI+CKDR KLLFD++ TLTDM+YVVFH ++D++GP AYQEY
Sbjct  248   KSRPKVTVVNWSDNDYSVVTIQCKDRAKLLFDIVFTLTDMQYVVFHASIDSKGPNAYQEY  307

Query  1164  CIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  1343
              I+HIDGSPVKSDAERQRVI CLEAAI+RR+SEGLKLELC TDRVGLLS+VTRI RENSL
Sbjct  308   YIKHIDGSPVKSDAERQRVIQCLEAAIKRRISEGLKLELCATDRVGLLSDVTRIIRENSL  367

Query  1344  TVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QE  1520
             TVTRAEV T+GGKAVNTFYVG ASG PV+++ IES+RQ IG TIL+VKG PEE  P  Q+
Sbjct  368   TVTRAEVTTKGGKAVNTFYVGGASGCPVESKTIESIRQAIGNTILKVKGKPEELKPAPQD  427

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             SPTR LFGG+FKSRS  NFG+V SYS
Sbjct  428   SPTRFLFGGLFKSRSLANFGMV-SYS  452



>ref|XP_006856315.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
 gb|ERN17782.1| hypothetical protein AMTR_s00047p00143120 [Amborella trichopoda]
Length=438

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/438 (73%), Positives = 373/438 (85%), Gaps = 1/438 (0%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEYEKLIRRMNPPRVVIDNE+C++ATVIQVDSANKHG LLEVVQVLTDLNL+I KAYI
Sbjct  1     MDDEYEKLIRRMNPPRVVIDNESCEHATVIQVDSANKHGILLEVVQVLTDLNLVIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+++G K+ DE  +DYI KSLG DS F  S RRSVGV   T++TSIE
Sbjct  61    SSDGGWFMDVFNVTDRDGKKLRDEETMDYIRKSLGADSSFIPSQRRSVGVEPSTNYTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+M VTD+ T   ++DP+ L+ I
Sbjct  121   LTGTDRPGLLSEVSAVLTHLKCNVVSAEVWTHNTRAAAVMHVTDDPTSAPISDPQRLAKI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNVLKG+NK+R AKT ++ G THT+RRLHQ+MFADRDYER   ++++   RP V+V
Sbjct  181   KELLCNVLKGNNKTRGAKTVVSLGGTHTERRLHQMMFADRDYERDGQDSVDEGLRPQVTV  240

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              +   +DYSVVTIRCKDRPKLLFD +CTLTDM+YVVFH  VDAE PEAYQEY IRHIDG 
Sbjct  241   IDCFQKDYSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHATVDAERPEAYQEYYIRHIDGC  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PV S+AERQRV+ CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSL+V RAEV+
Sbjct  301   PVNSEAERQRVVQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLSVIRAEVS  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPTRSLFG  1544
             TR GKAVNTFYV DA+G PVD + +ESVR+ IGQT+LQVK +P   ++  QE+PTR LFG
Sbjct  361   TRNGKAVNTFYVRDATGNPVDPKTVESVRREIGQTVLQVKDDPSYPRSSPQEAPTRFLFG  420

Query  1545  GIFKSRSFCNFGLVRSYS  1598
              +F+S+S  NFG VRSY+
Sbjct  421   NLFRSKSLYNFGSVRSYT  438



>ref|XP_009793987.1| PREDICTED: uncharacterized protein LOC104240797 isoform X4 [Nicotiana 
sylvestris]
Length=371

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/371 (85%), Positives = 342/371 (92%), Gaps = 1/371 (0%)
 Frame = +3

Query  489   MDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRP  668
             MDVFNVTNQEG+KI DEA+LDYIMKSLGPDSCFASSMRRSVGVT+G DHTSIELIGSDRP
Sbjct  1     MDVFNVTNQEGNKITDEAMLDYIMKSLGPDSCFASSMRRSVGVTAGMDHTSIELIGSDRP  60

Query  669   GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNV  848
             GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQV DEE GGA+TDPE LS +K+LLCNV
Sbjct  61    GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVIDEEHGGAITDPERLSTMKQLLCNV  120

Query  849   LKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRD  1028
             L+GSNK R AKT ++ G +HT+RRLHQLMFADRDYER + E L+  DRPNV+V NW D+D
Sbjct  121   LRGSNKLRDAKTIVSDGVSHTERRLHQLMFADRDYERTTGEGLDDKDRPNVNVVNWQDKD  180

Query  1029  YSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAE  1208
             YSVVTI+CKDRPKLLFD ICTLTDM+YVVFHGNVDAEGP+A+QEYCIRH+DGSPVKSDAE
Sbjct  181   YSVVTIKCKDRPKLLFDTICTLTDMQYVVFHGNVDAEGPQAHQEYCIRHVDGSPVKSDAE  240

Query  1209  RQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAV  1388
             RQRVI CLEAAIERRVSEGLKLELCTTDRVGLLS+VTRIFRENSLTVTRAEV TR GKA+
Sbjct  241   RQRVIQCLEAAIERRVSEGLKLELCTTDRVGLLSDVTRIFRENSLTVTRAEVTTRAGKAL  300

Query  1389  NTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QESPTRSLFGGIFKSRS  1565
             N FYV D+SGYPVDA+IIESVRQTIGQTIL+VKGN EE NP  QESPTR LFGG+FKSRS
Sbjct  301   NIFYVRDSSGYPVDAKIIESVRQTIGQTILRVKGNIEELNPVPQESPTRFLFGGLFKSRS  360

Query  1566  FCNFGLVRSYS  1598
             FCNFGLVRSYS
Sbjct  361   FCNFGLVRSYS  371



>dbj|BAC43240.1| unknown protein [Arabidopsis thaliana]
Length=425

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/424 (74%), Positives = 364/424 (86%), Gaps = 10/424 (2%)
 Frame = +3

Query  354   ACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIM  533
             +CK ATVI+VDSAN++G LLEVVQ+LTDLNL ITKAYI SDGGWFMDVFNVT+Q+G+K+ 
Sbjct  3     SCKKATVIRVDSANEYGILLEVVQILTDLNLTITKAYISSDGGWFMDVFNVTDQDGNKVT  62

Query  534   DEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKC  713
             DE VLDYI KSLGP++CF++SMR SVGV   TD T IEL G DRPGLLSE+SAVLT+LKC
Sbjct  63    DEVVLDYIQKSLGPEACFSTSMR-SVGVIPSTDSTVIELTGCDRPGLLSELSAVLTHLKC  121

Query  714   NVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQIT  893
             +V+NAE+WTHNTRAAA+MQVTD+ TG  ++DPE LS IK LL NVLKGSN  R AKT ++
Sbjct  122   SVLNAEIWTHNTRAAAVMQVTDDLTGCGISDPERLSRIKNLLRNVLKGSNTPREAKTVVS  181

Query  894   HGATHTDRRLHQLMFADRDYE-RASDEALNHPD---RPNVSVTNWHDRDYSVVTIRCKDR  1061
             HG  HTDRRLHQ+MF DRDYE R  D+  +  D   RP+V V NW D+DYSVVT+RCKDR
Sbjct  182   HGEVHTDRRLHQMMFEDRDYEHRLVDDDSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDR  241

Query  1062  PKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAA  1241
             PKLLFD +CTLTDM+YVVFHG+VD EG EA+QEY +RHIDGSPVKS+AE+QRVI CLEAA
Sbjct  242   PKLLFDTVCTLTDMQYVVFHGSVDTEGTEAFQEYYVRHIDGSPVKSEAEKQRVIQCLEAA  301

Query  1242  IERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGY  1421
             I+RRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV T+GGKA+NTFYV DASGY
Sbjct  302   IKRRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVKTKGGKALNTFYVSDASGY  361

Query  1422  PVDARIIESVRQTIGQTILQVKGNPEEQ-----NPTQESPTRSLFGGIFKSRSFCNFGLV  1586
              +DA+ I+S+RQTIGQTIL+VK NP+EQ     +P+ ESPTR LFGG+FKS+SF NFGLV
Sbjct  362   SIDAKTIDSIRQTIGQTILKVKNNPQEQQQRQKSPSHESPTRFLFGGLFKSKSFVNFGLV  421

Query  1587  RSYS  1598
             RSYS
Sbjct  422   RSYS  425


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/197 (24%), Positives = 88/197 (45%), Gaps = 14/197 (7%)
 Frame = +3

Query  276  YSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIIT  455
            Y   + D+   +      P V +DN   K+ +V+ V   ++   L + V  LTD+  ++ 
Sbjct  201  YEHRLVDDDSSIQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVF  260

Query  456  KAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDH  635
               + ++G      + V + +GS +  EA    +++      C  ++++R V     ++ 
Sbjct  261  HGSVDTEGTEAFQEYYVRHIDGSPVKSEAEKQRVIQ------CLEAAIKRRV-----SEG  309

Query  636  TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPET  815
              +EL  +DR GLLS V+ +       V  AEV T   +A     V+D    G   D +T
Sbjct  310  LKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVKTKGGKALNTFYVSD--ASGYSIDAKT  367

Query  816  LSMIKKLLCN-VLKGSN  863
            +  I++ +   +LK  N
Sbjct  368  IDSIRQTIGQTILKVKN  384



>ref|XP_009394314.1| PREDICTED: uncharacterized protein LOC103979823 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/438 (71%), Positives = 364/438 (83%), Gaps = 4/438 (1%)
 Frame = +3

Query  297   EYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSD  476
             EYEK IRRMNPPRVV+DN++C +ATVI+VDSANKHG LLEVVQVL DLNLIITKAYI SD
Sbjct  14    EYEKFIRRMNPPRVVVDNDSCADATVIKVDSANKHGILLEVVQVLMDLNLIITKAYISSD  73

Query  477   GGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             GGWFMDVFNV +++G+KI +E  L+    +I KSLG +S +  S RRS+     +DHTSI
Sbjct  74    GGWFMDVFNVRDRDGNKIGEEMKLNEINGFIRKSLGEESSYIPSRRRSIDFMPSSDHTSI  133

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             EL G+DRPGLLSEV AVL++L+CNVVNAEVWTHNTRAAA+MQV+D+ TG A+ DPE LS 
Sbjct  134   ELTGTDRPGLLSEVCAVLSDLECNVVNAEVWTHNTRAAAVMQVSDKGTGTAIADPEKLSR  193

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             IKKLL NVLKGSNKSR AKT ++ GATHT+RRLHQ+MF DRDYER+ ++  N   RP V+
Sbjct  194   IKKLLYNVLKGSNKSREAKTAVSVGATHTERRLHQMMFDDRDYERSGEDDGNVCHRPKVT  253

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V NW D+DYS+VTIRCKDRPKLLFD +CTLTDM+YVVFHGNVDAEGPEAYQEY IRHIDG
Sbjct  254   VVNWFDKDYSMVTIRCKDRPKLLFDTVCTLTDMQYVVFHGNVDAEGPEAYQEYYIRHIDG  313

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SPV S+AERQRVI CLEAAIERRVSEGLKLELCT+DR+GLLS+VTRIFREN LTVTRAEV
Sbjct  314   SPVNSEAERQRVIQCLEAAIERRVSEGLKLELCTSDRMGLLSDVTRIFRENGLTVTRAEV  373

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLFG  1544
              T+GGK  N FYV DA+G  VD + ++ +R  IGQT+LQVKG+ +     QESPTR L G
Sbjct  374   TTKGGKVFNIFYVRDAAGNSVDPKTLDDIRAEIGQTVLQVKGHSDHLKSPQESPTRFLLG  433

Query  1545  GIFKSRSFCNFGLVRSYS  1598
              +FKS+S  N GL+RSY+
Sbjct  434   SLFKSKSLYNLGLIRSYT  451



>ref|XP_010554272.1| PREDICTED: uncharacterized protein LOC104824054 isoform X1 [Tarenaya 
hassleriana]
Length=453

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/454 (71%), Positives = 372/454 (82%), Gaps = 10/454 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+   S S N DDEY K IRRMNPPRVVIDNE CK+ATV++VDS N+ G LLEVVQVLTD
Sbjct  1     MDVCSSVSHNTDDEYAKFIRRMNPPRVVIDNEVCKDATVVKVDSVNRPGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I KAY+ SDGGWFMDVFNVT+Q+G+K+ DE VLDYI K+LGP+SCF SSM+ SVGV
Sbjct  61    LNLSIRKAYVSSDGGWFMDVFNVTDQDGNKVTDELVLDYIRKALGPESCFMSSMK-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                +D T IEL GSDRPGLLSE+SAVL +L+CNVVNAE+WTHNTRAAA++Q+TDEETG A
Sbjct  120   KQSSDFTVIELTGSDRPGLLSELSAVLRDLQCNVVNAEIWTHNTRAAAVVQITDEETGCA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRH-AKTQI-THGATHTDRRLHQLMFADRDYERAS--  965
             +TDPE LS IKKLL NVL GSN   H AKT + +   THTDRRLHQ+MFA RDYE+ +  
Sbjct  180   ITDPERLSKIKKLLGNVLMGSNGRIHEAKTMVPSSEVTHTDRRLHQMMFAGRDYEQRANG  239

Query  966   DEALNHPDR----PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVD  1133
             D+A++   R     +V V NWHDRDYS+VTIR KDRPKLLFD + TLTDM+Y+VFH  +D
Sbjct  240   DDAVDKVGRLRPDVDVDVVNWHDRDYSIVTIRSKDRPKLLFDTVFTLTDMKYMVFHAKID  299

Query  1134  AEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSN  1313
             AEGPEA+QEY +RH DGSPVKS+AERQRVI CL AAI+RRVSEGLKLELCTTDRVGLLSN
Sbjct  300   AEGPEAHQEYYLRHTDGSPVKSEAERQRVIRCLRAAIQRRVSEGLKLELCTTDRVGLLSN  359

Query  1314  VTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN  1493
             VTRIFRENSLTVTRAEV T+ GKA+NTFYV D SGY V+A+ I+++RQ IGQTIL+VKG 
Sbjct  360   VTRIFRENSLTVTRAEVKTKEGKALNTFYVSDVSGYQVNAKTIDAIRQVIGQTILKVKGK  419

Query  1494  PEEQNP-TQESPTRSLFGGIFKSRSFCNFGLVRS  1592
                  P + ESPTR LFGG+FKSRSF NFG +RS
Sbjct  420   TGGLKPASPESPTRFLFGGLFKSRSFVNFGSIRS  453



>gb|EAY90442.1| hypothetical protein OsI_12028 [Oryza sativa Indica Group]
Length=455

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/444 (70%), Positives = 362/444 (82%), Gaps = 6/444 (1%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I++MNPPRVVIDN +CKNATV+ VDSANK+G LLEVVQVLT+L LI+ K
Sbjct  12    SWDSDDEYQKFIQKMNPPRVVIDNTSCKNATVVHVDSANKYGILLEVVQVLTELQLIVKK  71

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVFNVT+Q G KIMDE+VLD    YI K LG DSCF  S RRSVGV   
Sbjct  72    AYISSDGGWFMDVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADSCFLPSRRRSVGVEPS  131

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +D+T IEL G+DRPGLLSEVSAVLTNL+CNVVNAEVWTHN RAAA+MQV D ETG A++D
Sbjct  132   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRETGLAISD  191

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
              + L+ IK+ L  V KGSN+S+  KT +T G THT+RRLHQLM  DRDYER   +  N  
Sbjct  192   TQRLARIKERLSYVFKGSNRSQDTKTTVTMGITHTERRLHQLMLEDRDYERYDKDRTNVN  251

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P VSV NW D+DYSVV IRCKDRPKLLFD +CTLTDM+YVVFHG+VD+EGPEAYQEY 
Sbjct  252   PTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAYQEYY  311

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LT
Sbjct  312   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLT  371

Query  1347  VTRAEVATRGGKAVNTFYVGDASG-YPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQE  1520
             VTRAEV+TRG KAVNTFYV DA+G   VD + +E++RQ IGQT+LQVKG+P+  ++P QE
Sbjct  372   VTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTVLQVKGHPDHRKSPPQE  431

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRS  1592
             SP+R LF  +F+ RS  + GL+RS
Sbjct  432   SPSRFLFSSLFRPRSLYSLGLIRS  455



>ref|NP_001050359.1| Os03g0413100 [Oryza sativa Japonica Group]
 gb|AAS07063.1| putative ACT domain containing protein, ACR4, with alternative 
splicing forms [Oryza sativa Japonica Group]
 gb|ABF96586.1| ACT domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12273.1| Os03g0413100 [Oryza sativa Japonica Group]
 dbj|BAF46923.1| ACT-domain repeat protein 7 [Oryza sativa Japonica Group]
 dbj|BAG88644.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/444 (70%), Positives = 362/444 (82%), Gaps = 6/444 (1%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I++MNPPRVVIDN +CKNATV+ VDSANK+G LLEVVQVLT+L LI+ K
Sbjct  9     SWDSDDEYQKFIQKMNPPRVVIDNTSCKNATVVHVDSANKYGILLEVVQVLTELQLIVKK  68

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVFNVT+Q G KIMDE+VLD    YI K LG DSCF  S RRSVGV   
Sbjct  69    AYISSDGGWFMDVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADSCFLPSRRRSVGVEPS  128

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +D+T IEL G+DRPGLLSEVSAVLTNL+CNVVNAEVWTHN RAAA+MQV D +TG A++D
Sbjct  129   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISD  188

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
              + L+ IK+ L  V KGSN+S+  KT +T G THT+RRLHQLM  DRDYER   +  N  
Sbjct  189   TQRLARIKERLSYVFKGSNRSQDTKTTVTMGITHTERRLHQLMLEDRDYERYDKDRTNVN  248

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P VSV NW D+DYSVV IRCKDRPKLLFD +CTLTDM+YVVFHG+VD+EGPEAYQEY 
Sbjct  249   PTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAYQEYY  308

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LT
Sbjct  309   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLT  368

Query  1347  VTRAEVATRGGKAVNTFYVGDASG-YPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQE  1520
             VTRAEV+TRG KAVNTFYV DA+G   VD + +E++RQ IGQT+LQVKG+P+  ++P QE
Sbjct  369   VTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTVLQVKGHPDHRKSPPQE  428

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRS  1592
             SP+R LF  +F+ RS  + GL+RS
Sbjct  429   SPSRFLFSSLFRPRSLYSLGLIRS  452



>gb|EAZ27314.1| hypothetical protein OsJ_11253 [Oryza sativa Japonica Group]
Length=455

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/444 (70%), Positives = 362/444 (82%), Gaps = 6/444 (1%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I++MNPPRVVIDN +CKNATV+ VDSANK+G LLEVVQVLT+L LI+ K
Sbjct  12    SWDSDDEYQKFIQKMNPPRVVIDNTSCKNATVVHVDSANKYGILLEVVQVLTELQLIVKK  71

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVFNVT+Q G KIMDE+VLD    YI K LG DSCF  S RRSVGV   
Sbjct  72    AYISSDGGWFMDVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADSCFLPSRRRSVGVEPS  131

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +D+T IEL G+DRPGLLSEVSAVLTNL+CNVVNAEVWTHN RAAA+MQV D +TG A++D
Sbjct  132   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISD  191

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
              + L+ IK+ L  V KGSN+S+  KT +T G THT+RRLHQLM  DRDYER   +  N  
Sbjct  192   TQRLARIKERLSYVFKGSNRSQDTKTTVTMGITHTERRLHQLMLEDRDYERYDKDRTNVN  251

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P VSV NW D+DYSVV IRCKDRPKLLFD +CTLTDM+YVVFHG+VD+EGPEAYQEY 
Sbjct  252   PTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAYQEYY  311

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LT
Sbjct  312   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLT  371

Query  1347  VTRAEVATRGGKAVNTFYVGDASG-YPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQE  1520
             VTRAEV+TRG KAVNTFYV DA+G   VD + +E++RQ IGQT+LQVKG+P+  ++P QE
Sbjct  372   VTRAEVSTRGDKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTVLQVKGHPDHRKSPPQE  431

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRS  1592
             SP+R LF  +F+ RS  + GL+RS
Sbjct  432   SPSRFLFSSLFRPRSLYSLGLIRS  455



>ref|XP_006395679.1| hypothetical protein EUTSA_v10004191mg [Eutrema salsugineum]
 gb|ESQ32965.1| hypothetical protein EUTSA_v10004191mg [Eutrema salsugineum]
Length=454

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/455 (70%), Positives = 367/455 (81%), Gaps = 11/455 (2%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS  MDDE  K I+R+NPPRV IDN+ CKN TVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MDVCLSYSYQMDDEIAKFIKRVNPPRVSIDNDVCKNVTVIKVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSV  611
             LNL I KAYI SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGPD  SCF+ SMR S+
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDQDGNKVTDEIVLEYIRKSLGPDESSCFSPSMRSSI  120

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV    D T IEL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET 
Sbjct  121   GVKQSVDFTVIELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETC  180

Query  792   GAVTDPETLSMIKKLLCNVLKGSNK-SRHAKTQITH--GATHTDRRLHQLMFADRDYER-  959
              AVTDPE LS I+KLL  VL G N+ SR  KT ++     T+TDR+LHQLMFADRDY+  
Sbjct  181   SAVTDPERLSKIRKLLGYVLTGGNRRSREPKTTVSSPLNETYTDRKLHQLMFADRDYDEW  240

Query  960   ---ASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNV  1130
                  DE  +    P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YVV H ++
Sbjct  241   ENNVDDEDKSGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYVVSHASI  300

Query  1131  DAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLS  1310
             DAEGPEAYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+DRVGLLS
Sbjct  301   DAEGPEAYQEYYIRHADGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSDRVGLLS  360

Query  1311  NVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG  1490
             +VTRIFRENSLTVTRAEV T+GGKA+NTFYV DASGY VDA+ IES+RQ IGQTILQVKG
Sbjct  361   DVTRIFRENSLTVTRAEVKTKGGKALNTFYVRDASGYQVDAKTIESIRQVIGQTILQVKG  420

Query  1491  NPEEQNP-TQESPTRSLFGGIFKSRSFCNFGLVRS  1592
                +  P +QESPT  LF G+FKSRSF NFGL+RS
Sbjct  421   GNTDPKPSSQESPTGFLF-GVFKSRSFVNFGLIRS  454



>ref|XP_002876893.1| hypothetical protein ARALYDRAFT_904656 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53152.1| hypothetical protein ARALYDRAFT_904656 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/461 (69%), Positives = 368/461 (80%), Gaps = 21/461 (5%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS NMDDE  K IRR+NPPRVVIDNE CK+ TVI+VDSANKHG LLEVVQVLT+
Sbjct  1     MDVCLSYSYNMDDEIAKFIRRVNPPRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTE  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSV  611
             LNL I KAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGPD  +CF+ SMR ++
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDQDGNKVTDEIVLDYIRKSLGPDESTCFSPSMRSTI  120

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV    D+T IEL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET 
Sbjct  121   GVKQSVDYTVIELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETC  180

Query  792   GAVTDPETLSMIKKLLCNVLKGSN---KSRHAKTQITHGA--THTDRRLHQLMFADRDYE  956
              A+TDPE LS I+KLL  VL G +   + R  KT ++     THTDR+LHQLMFADRDY 
Sbjct  181   SAITDPERLSKIRKLLGYVLTGGSSGRRFREPKTMVSSALDDTHTDRKLHQLMFADRDY-  239

Query  957   RASDEALNHPDR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYV  1112
                DE  N+ D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM YV
Sbjct  240   ---DEWENNVDDEDKCGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMNYV  296

Query  1113  VFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTD  1292
             V H ++DAEGPEAYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+D
Sbjct  297   VSHASIDAEGPEAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSD  356

Query  1293  RVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQT  1472
             RVGLLS+VTRIFRENSLTVTRAEV T+G KA+NTFYV DASGY VDA+ IES+RQ IGQT
Sbjct  357   RVGLLSDVTRIFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDAKTIESIRQVIGQT  416

Query  1473  ILQVK-GNPEEQNPTQESPTRSLFGGIFKSRSFCNFGLVRS  1592
             ILQVK GN + +   Q+SPT  LF G+FKSRSF NFGL+RS
Sbjct  417   ILQVKGGNTDAKTSPQDSPTGFLF-GVFKSRSFVNFGLIRS  456



>gb|ACG60673.1| hypothetical protein BoB028L01.070 [Brassica oleracea var. alboglabra]
Length=425

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/457 (67%), Positives = 363/457 (79%), Gaps = 45/457 (10%)
 Frame = +3

Query  261   EATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDL  440
             + ++S+SQ+MDDEYEKLIRRMNPPRVVIDN++CK ATVI+VDSAN++G LLEVVQ+LTDL
Sbjct  3     DVSMSFSQDMDDEYEKLIRRMNPPRVVIDNDSCKEATVIRVDSANEYGILLEVVQILTDL  62

Query  441   NLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT  620
             +L ITKAYI SDGGWFMDVFNVT+Q+G+K+ DE VLDYI KSLGP++CF++S+ RSVGV 
Sbjct  63    DLTITKAYISSDGGWFMDVFNVTHQDGNKVTDEVVLDYIQKSLGPEACFSTSL-RSVGVI  121

Query  621   SGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAV  800
               TD T IEL G DRPGLLSE++AVLT+LKC+V+NAEVWTHNTRAAA+M+VTD+ TG AV
Sbjct  122   PSTDSTVIELTGCDRPGLLSELTAVLTHLKCSVLNAEVWTHNTRAAAVMEVTDDLTGSAV  181

Query  801   TDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA---SDE  971
             +DPE LS+IK LL NVLKGSN  + AKT ++ G  HTDRRLHQ+MF DRDYE      D+
Sbjct  182   SDPERLSLIKSLLRNVLKGSNTPKEAKTVVSQGEVHTDRRLHQMMFEDRDYENGVMVDDD  241

Query  972   ALNHPD---RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEG  1142
             + N  D   RP+V V NW D+DYSVVT+RCKDRPKLLFD +CTLTDM+YVVFHG+VD EG
Sbjct  242   SSNVQDERQRPDVCVDNWLDKDYSVVTVRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEG  301

Query  1143  PEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTR  1322
              EA+QEY                                 GLKLELCTTDRVGLLSNVTR
Sbjct  302   TEAFQEY---------------------------------GLKLELCTTDRVGLLSNVTR  328

Query  1323  IFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE  1502
             IFRENSLTVTRAEV T+GGKAVNTFYV DASGY +DA+ I+S+RQTIG+T+L+VK  P++
Sbjct  329   IFRENSLTVTRAEVKTKGGKAVNTFYVSDASGYSIDAKTIDSIRQTIGKTLLKVKNKPKD  388

Query  1503  QN-----PTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             Q      P+QESPTR LFGG+FKS+SF NFGLVRSYS
Sbjct  389   QQQREKPPSQESPTRFLFGGLFKSKSFVNFGLVRSYS  425



>ref|XP_010554273.1| PREDICTED: uncharacterized protein LOC104824054 isoform X2 [Tarenaya 
hassleriana]
Length=432

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/433 (71%), Positives = 359/433 (83%), Gaps = 10/433 (2%)
 Frame = +3

Query  321   MNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVF  500
             MNPPRVVIDNE CK+ATV++VDS N+ G LLEVVQVLTDLNL I KAY+ SDGGWFMDVF
Sbjct  1     MNPPRVVIDNEVCKDATVVKVDSVNRPGILLEVVQVLTDLNLSIRKAYVSSDGGWFMDVF  60

Query  501   NVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLS  680
             NVT+Q+G+K+ DE VLDYI K+LGP+SCF SSM+ SVGV   +D T IEL GSDRPGLLS
Sbjct  61    NVTDQDGNKVTDELVLDYIRKALGPESCFMSSMK-SVGVKQSSDFTVIELTGSDRPGLLS  119

Query  681   EVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGS  860
             E+SAVL +L+CNVVNAE+WTHNTRAAA++Q+TDEETG A+TDPE LS IKKLL NVL GS
Sbjct  120   ELSAVLRDLQCNVVNAEIWTHNTRAAAVVQITDEETGCAITDPERLSKIKKLLGNVLMGS  179

Query  861   NKSRH-AKTQI-THGATHTDRRLHQLMFADRDYERAS--DEALNHPDR----PNVSVTNW  1016
             N   H AKT + +   THTDRRLHQ+MFA RDYE+ +  D+A++   R     +V V NW
Sbjct  180   NGRIHEAKTMVPSSEVTHTDRRLHQMMFAGRDYEQRANGDDAVDKVGRLRPDVDVDVVNW  239

Query  1017  HDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVK  1196
             HDRDYS+VTIR KDRPKLLFD + TLTDM+Y+VFH  +DAEGPEA+QEY +RH DGSPVK
Sbjct  240   HDRDYSIVTIRSKDRPKLLFDTVFTLTDMKYMVFHAKIDAEGPEAHQEYYLRHTDGSPVK  299

Query  1197  SDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRG  1376
             S+AERQRVI CL AAI+RRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV T+ 
Sbjct  300   SEAERQRVIRCLRAAIQRRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVKTKE  359

Query  1377  GKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESPTRSLFGGIF  1553
             GKA+NTFYV D SGY V+A+ I+++RQ IGQTIL+VKG      P + ESPTR LFGG+F
Sbjct  360   GKALNTFYVSDVSGYQVNAKTIDAIRQVIGQTILKVKGKTGGLKPASPESPTRFLFGGLF  419

Query  1554  KSRSFCNFGLVRS  1592
             KSRSF NFG +RS
Sbjct  420   KSRSFVNFGSIRS  432



>ref|NP_565304.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
 ref|NP_001030965.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
 sp|Q9ZPQ8.2|ACR5_ARATH RecName: Full=ACT domain-containing protein ACR5; AltName: Full=Protein 
ACT DOMAIN REPEATS 5 [Arabidopsis thaliana]
 gb|AAD20075.2| putative uridylyl transferase [Arabidopsis thaliana]
 gb|AAN41308.1| putative uridylyl transferase [Arabidopsis thaliana]
 dbj|BAH20165.1| AT2G03730 [Arabidopsis thaliana]
 gb|AEC05742.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
 gb|AEC05743.1| ACT domain-containing protein 5 [Arabidopsis thaliana]
Length=456

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/461 (68%), Positives = 367/461 (80%), Gaps = 21/461 (5%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS NMDDE  K IRR+NPPRVVIDNE CK+ TVI+VDSANKHG LLEVVQVLT+
Sbjct  1     MDVCLSYSYNMDDEIAKFIRRVNPPRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTE  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSV  611
             LNL I KAYI SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGPD  SCF+ SMR ++
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDQDGNKVTDEIVLEYIRKSLGPDESSCFSPSMRSTI  120

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV    D+T +EL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET 
Sbjct  121   GVKQSVDYTVVELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETC  180

Query  792   GAVTDPETLSMIKKLLCNVLKGSN---KSRHAKTQITHG--ATHTDRRLHQLMFADRDYE  956
              A+TDPE LS I+KLL  VL G +   + R  KT ++     THTDR+LHQLMFADRDY 
Sbjct  181   SAITDPERLSKIRKLLGYVLTGGSSGRRFREPKTTVSSALNETHTDRKLHQLMFADRDY-  239

Query  957   RASDEALNHPDR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYV  1112
                DE  N+ D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM YV
Sbjct  240   ---DEWENNVDDEDKCGRVIPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMNYV  296

Query  1113  VFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTD  1292
             V H ++DAEGP+AYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+D
Sbjct  297   VSHASIDAEGPQAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSD  356

Query  1293  RVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQT  1472
             RVGLLS+VTRIFRENSLTVTRAEV T+G KA+NTFYV DASGY VD + IES+RQ IGQT
Sbjct  357   RVGLLSDVTRIFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDTKTIESIRQVIGQT  416

Query  1473  ILQVKGNPEEQNPT-QESPTRSLFGGIFKSRSFCNFGLVRS  1592
             ILQVKG   +  P+ Q+SPT  LF G+FKSRSF NFGL+RS
Sbjct  417   ILQVKGGNTDAKPSPQDSPTGFLF-GVFKSRSFVNFGLIRS  456



>ref|XP_009129076.1| PREDICTED: uncharacterized protein LOC103853936 [Brassica rapa]
 ref|XP_009129077.1| PREDICTED: uncharacterized protein LOC103853936 [Brassica rapa]
Length=455

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/456 (68%), Positives = 362/456 (79%), Gaps = 12/456 (3%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS +MDDE  K IRR+NPPRVVIDNE CKN TVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MDVCLSYSYHMDDEIAKFIRRVNPPRVVIDNEVCKNVTVIKVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I KAYI SDGGWFMDVFNVT+Q+G+K+ DE VL YI KSLGPD     S R ++GV
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDQDGNKVTDEIVLGYIRKSLGPDDSSCYSPRSTIGV  120

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D T IEL G+DRPGLLSE+ AVLT+L+CNVVNAE+WTH  +AAA++QVTDEET  A
Sbjct  121   KQSVDFTVIELTGTDRPGLLSELCAVLTDLQCNVVNAEIWTHRAKAAAVLQVTDEETCSA  180

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHA---KTQITHG--ATHTDRRLHQLMFADRDYERA  962
             VTDPE LS I+KLL  VL G ++SR +   KT ++     T+ DR+LHQLMFADRDY+  
Sbjct  181   VTDPERLSQIRKLLGYVLTGGSRSRRSCEPKTTVSSSLDETYADRKLHQLMFADRDYDEW  240

Query  963   SDEALNHPDR-----PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGN  1127
              +   +  D+     P+V V+N HD DYSVV IRCKDRPKLLFD + TLTDM YVV H +
Sbjct  241   ENNVGDDEDKSGRVVPDVDVSNLHDLDYSVVMIRCKDRPKLLFDTVFTLTDMNYVVSHAS  300

Query  1128  VDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLL  1307
             +DAEGPEAYQEY IRH DGSPV S+AERQRVI CL+AAI+RRVSEGLKLELCT+DRVGLL
Sbjct  301   IDAEGPEAYQEYYIRHTDGSPVTSEAERQRVIKCLKAAIQRRVSEGLKLELCTSDRVGLL  360

Query  1308  SNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVK  1487
             S+VTRIFRENSLTVTRAEV T+GGKA+NTFYV DASGY VDA+ I+++RQ IGQTILQVK
Sbjct  361   SDVTRIFRENSLTVTRAEVKTKGGKALNTFYVKDASGYQVDAKTIDAIRQVIGQTILQVK  420

Query  1488  GNPEEQNP-TQESPTRSLFGGIFKSRSFCNFGLVRS  1592
             G   E  P +QES T  LF G+FKSRSF NFGL+RS
Sbjct  421   GGNTEVKPSSQESQTGFLF-GVFKSRSFVNFGLIRS  455



>ref|XP_010502395.1| PREDICTED: uncharacterized protein LOC104779692 [Camelina sativa]
Length=456

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/461 (68%), Positives = 366/461 (79%), Gaps = 21/461 (5%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS NMDDE  K I+R+NPPRVVIDNE CK+ TVI+VDSANKHG LLEVVQVLT+
Sbjct  1     MDVCLSYSYNMDDEIAKFIKRVNPPRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTE  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSV  611
             LNL I KAYI SDGGWFMDVFNVT+ EG+K+ D+ VL+YI  SLGPD  SCF+ SMR S+
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDHEGNKVTDDMVLEYIRTSLGPDESSCFSPSMRSSI  120

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV    D T IEL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET 
Sbjct  121   GVKQSVDFTVIELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETC  180

Query  792   GAVTDPETLSMIKKLLCNVLKGS---NKSRHAKTQITHG--ATHTDRRLHQLMFADRDYE  956
              A+TDPE LS I+KLL  VL G     + R  KT ++     THTDR+LHQLMFADRDY 
Sbjct  181   SAITDPERLSKIRKLLGYVLTGGCSGRRFREPKTTVSSSLNETHTDRKLHQLMFADRDY-  239

Query  957   RASDEALNHPDR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYV  1112
                DE  N+ D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YV
Sbjct  240   ---DEWENNVDDGDKCGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYV  296

Query  1113  VFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTD  1292
             V H ++DAEGPEAYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+D
Sbjct  297   VSHASIDAEGPEAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSD  356

Query  1293  RVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQT  1472
             RVGLLS+VTRIFRENSLTVTRAEV T+G KA+NTFYV DASGY VDA+ IES+RQ IGQT
Sbjct  357   RVGLLSDVTRIFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDAKTIESIRQVIGQT  416

Query  1473  ILQVK-GNPEEQNPTQESPTRSLFGGIFKSRSFCNFGLVRS  1592
             ILQVK GN + ++  Q+SPT  LF G+FKSRSF NFGL+RS
Sbjct  417   ILQVKGGNTDAKSSPQDSPTGFLF-GVFKSRSFVNFGLIRS  456



>ref|XP_010514143.1| PREDICTED: uncharacterized protein LOC104790131 [Camelina sativa]
Length=456

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/461 (68%), Positives = 364/461 (79%), Gaps = 21/461 (5%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS NMDDE  K IRR+NPPRVVIDNE CK+ TVI+VDSANKHG LLEVVQVLT+
Sbjct  1     MDVCLSYSYNMDDEIAKFIRRVNPPRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTE  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSV  611
             LNL I KAYI SDGGWFMDVFNVT+ EG+K+ D+ VL+YI  SLGPD  SCF+ SMR S+
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDHEGNKVTDDIVLEYIRTSLGPDESSCFSPSMRSSI  120

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV    D T IEL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET 
Sbjct  121   GVKQSVDFTVIELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETC  180

Query  792   GAVTDPETLSMIKKLLCNVLKGS---NKSRHAKTQITHG--ATHTDRRLHQLMFADRDYE  956
              A+TDPE LS I+KLL  VL G     + R  KT ++     THTDR+LHQLMFADRDY 
Sbjct  181   SAITDPERLSKIRKLLGYVLTGGCSGRRFREPKTTVSSSLNETHTDRKLHQLMFADRDY-  239

Query  957   RASDEALNHPDR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYV  1112
                DE  N+ D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YV
Sbjct  240   ---DEWENNVDEGDKCGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYV  296

Query  1113  VFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTD  1292
             V H ++DAEGPEAYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+D
Sbjct  297   VSHASIDAEGPEAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSD  356

Query  1293  RVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQT  1472
             RVGLLS+VTRIFRENSLTVTRAEV T+G KA+NTFYV DASGY VD + IES+RQ IGQT
Sbjct  357   RVGLLSDVTRIFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDDKTIESIRQVIGQT  416

Query  1473  ILQVKGNPEEQNPT-QESPTRSLFGGIFKSRSFCNFGLVRS  1592
             ILQVKG   +  P+ Q+SPT  LF G+FKSRSF NFGL+RS
Sbjct  417   ILQVKGGNTDAKPSPQDSPTGFLF-GVFKSRSFVNFGLIRS  456



>ref|XP_006650194.1| PREDICTED: uncharacterized protein LOC102721346 [Oryza brachyantha]
Length=452

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/444 (69%), Positives = 356/444 (80%), Gaps = 6/444 (1%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I++MNPPRVVIDN +C NATV+ VDSANK+G LLEVVQVLT+L LI+ K
Sbjct  9     SWDSDDEYQKFIQKMNPPRVVIDNTSCANATVVHVDSANKYGILLEVVQVLTELQLIVKK  68

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVFNVT+Q G KIMDE VLD    YI K L  DSCF  S RRSVGV   
Sbjct  69    AYISSDGGWFMDVFNVTDQNGLKIMDELVLDEIVQYIHKCLRADSCFLPSRRRSVGVEPS  128

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +D+T IEL G+DRPGLLSEVSAVLTNL+CNVVNAEVWTHN RAAA+MQVTD +TG A++D
Sbjct  129   SDYTLIELTGTDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVTDRKTGLAISD  188

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP  986
                L  IK+ L  V KGSN+S+  KT +T G THTDRRLHQ+M  DRDYER   +  +  
Sbjct  189   TVRLGRIKERLSFVFKGSNRSQDTKTTVTMGITHTDRRLHQMMLEDRDYERYDKDRTSVN  248

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P VSV NW D+DYSVV IRCKDRPKLLFD +CTLTDM+YVVFHG+VD+EGPEAYQEY 
Sbjct  249   PTPMVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMKYVVFHGSVDSEGPEAYQEYY  308

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRHIDGSPV S+AERQRVI CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LT
Sbjct  309   IRHIDGSPVNSEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLT  368

Query  1347  VTRAEVATRGGKAVNTFYVGDASG-YPVDARIIESVRQTIGQTILQVKGNPEEQNPT-QE  1520
             VTRAEV+T+  KAVNTFYV DA+G   VD + +E++R+ IGQT+LQVKG+P+ +  T QE
Sbjct  369   VTRAEVSTKDDKAVNTFYVRDAAGSSAVDLKTLEAIREEIGQTVLQVKGHPDHRKSTPQE  428

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRS  1592
             SP+R LF  +F+ RS  + GL+RS
Sbjct  429   SPSRFLFSSLFRPRSLYSLGLIRS  452



>ref|XP_006291103.1| hypothetical protein CARUB_v10017215mg [Capsella rubella]
 gb|EOA24001.1| hypothetical protein CARUB_v10017215mg [Capsella rubella]
Length=456

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/461 (68%), Positives = 365/461 (79%), Gaps = 21/461 (5%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+  +SYS NMDDE  K I+R+NPPRVVIDNE CK+ TVI+VDSANKHG LLEVVQVLT+
Sbjct  1     MDVCLSYSYNMDDEIAKFIKRVNPPRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTE  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSV  611
             LNL I KAYI SDGGWFMDVFNVT+QEG+K+ D+ VL+YI  SLGPD  SCF+ SMR S+
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTDQEGNKVTDDIVLEYIRTSLGPDESSCFSPSMRSSI  120

Query  612   GVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETG  791
             GV    D T IEL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET 
Sbjct  121   GVKQSVDFTVIELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETC  180

Query  792   GAVTDPETLSMIKKLLCNVLKGS---NKSRHAKTQITHG--ATHTDRRLHQLMFADRDYE  956
              A+TDPE LS I+KLL  VL G     + R  K  ++     T+TDR+LHQLMFADRDY 
Sbjct  181   SAITDPERLSKIRKLLGYVLTGGCSGRRFREPKITVSSALNETYTDRKLHQLMFADRDY-  239

Query  957   RASDEALNHPDR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYV  1112
                DE  N+ D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YV
Sbjct  240   ---DEWENNVDDEDKCGRVIPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYV  296

Query  1113  VFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTD  1292
             V H ++DAEGPEAYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+D
Sbjct  297   VSHASIDAEGPEAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSD  356

Query  1293  RVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQT  1472
             RVGLLS+VTRIFRENSLTVTRAEV T+G KA+NTFYV DASGY VDA+ IES+RQ IGQT
Sbjct  357   RVGLLSDVTRIFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDAKTIESIRQVIGQT  416

Query  1473  ILQVKGNPEEQNPT-QESPTRSLFGGIFKSRSFCNFGLVRS  1592
             ILQVKG   +  P+ Q+SPT  LF G+FKSRSF NFGL+RS
Sbjct  417   ILQVKGGNTDAKPSPQDSPTGFLF-GVFKSRSFVNFGLIRS  456



>emb|CDY49687.1| BnaA02g27260D [Brassica napus]
Length=445

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/446 (69%), Positives = 357/446 (80%), Gaps = 12/446 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE  K IRR+NPPRVVIDNE CKN TVI+VDSANKHG LLEVVQVLTDLNL I KAYI
Sbjct  1     MDDEIAKFIRRVNPPRVVIDNEVCKNVTVIKVDSANKHGILLEVVQVLTDLNLTIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+K+ DE VL YI KSLGPD     S R ++GV    D T +E
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEIVLGYIRKSLGPDDSSCYSPRSTIGVKQSVDFTVVE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L+CNVVNAE+WTH  +AAA++QVTDEET  AVTDPE LS I
Sbjct  121   LTGTDRPGLLSELCAVLTDLQCNVVNAEIWTHRAKAAAVLQVTDEETCSAVTDPERLSQI  180

Query  828   KKLLCNVLKGSNKSRHA---KTQITHG--ATHTDRRLHQLMFADRDYERASDEALNHPDR  992
             +KLL  VL G ++SR +   KT ++     T+ DR+LHQLMFADRDY+   +   +  D+
Sbjct  181   RKLLGYVLTGGSRSRRSCEPKTTVSSSLDETYADRKLHQLMFADRDYDEWENNVGDDEDK  240

Query  993   -----PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                  P+V V+N HD DYSVV IRCKDRPKLLFD + TLTDM+YVV H ++DAEGPEAYQ
Sbjct  241   SGRVVPDVDVSNLHDLDYSVVMIRCKDRPKLLFDTVFTLTDMKYVVSHASIDAEGPEAYQ  300

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+DRVGLLS+VTRIFREN
Sbjct  301   EYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFREN  360

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEV T+GGKA+NTFYV DASGY VDA+ I+++RQ IGQTILQVKG   E  P +
Sbjct  361   SLTVTRAEVKTKGGKALNTFYVKDASGYQVDAKTIDAIRQVIGQTILQVKGGNTEVKPSS  420

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRS  1592
             QES T  LF G+FKSRSF NFGL+RS
Sbjct  421   QESQTGFLF-GVFKSRSFVNFGLIRS  445



>ref|XP_004984033.1| PREDICTED: uncharacterized protein LOC101763377 isoform X1 [Setaria 
italica]
Length=445

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/429 (69%), Positives = 346/429 (81%), Gaps = 7/429 (2%)
 Frame = +3

Query  297   EYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSD  476
             EY+K I++MNPPRV IDN +C NAT+I VDSANK+G LLEVVQVLTDL LI+ KAYI SD
Sbjct  19    EYQKFIKKMNPPRVTIDNTSCANATIIHVDSANKYGILLEVVQVLTDLKLIVKKAYISSD  78

Query  477   GGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             GGWFMDVFNVTNQ G KIMDE+VL    DYI KS+ P SCF  S RR++GV   +D+T I
Sbjct  79    GGWFMDVFNVTNQSGQKIMDESVLQGIKDYIYKSIAPGSCFLPSRRRAIGVEPSSDYTLI  138

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             EL G+DRPGLLSEVSAVLTNL CNVVNAEVWTHN RAAA++QVTD ++G A++D + L  
Sbjct  139   ELTGTDRPGLLSEVSAVLTNLDCNVVNAEVWTHNERAAAVIQVTDRKSGLAISDADRLGR  198

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             IK+ L NV KG  +SR AKT +  G THT+RRLHQ+M  DRDYER   +  N    P VS
Sbjct  199   IKEWLRNVFKG--RSRDAKTTVAMGITHTERRLHQMMLEDRDYERYDKDRANANPMPMVS  256

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V NW  +DYSVVT+RCKDRPKLLFD +CTLTDM+YVV+HG+VD EGPEAYQEY IRHIDG
Sbjct  257   VVNWLQKDYSVVTMRCKDRPKLLFDTVCTLTDMQYVVYHGSVDTEGPEAYQEYYIRHIDG  316

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SPV S+AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LTVTRAEV
Sbjct  317   SPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLTVTRAEV  376

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESPTRSLF  1541
             ATRG KA+NTFYV D +G  V+ + +E++RQ IGQT+LQVKG+PE  ++P QESPTR LF
Sbjct  377   ATRGNKAINTFYVRDTAGSSVELKTLEAIRQEIGQTVLQVKGHPEHPKSPAQESPTRFLF  436

Query  1542  GGIFKSRSF  1568
               +F+ RS 
Sbjct  437   SSLFRPRSL  445



>ref|XP_004984034.1| PREDICTED: uncharacterized protein LOC101763377 isoform X2 [Setaria 
italica]
Length=441

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/429 (69%), Positives = 346/429 (81%), Gaps = 7/429 (2%)
 Frame = +3

Query  297   EYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSD  476
             EY+K I++MNPPRV IDN +C NAT+I VDSANK+G LLEVVQVLTDL LI+ KAYI SD
Sbjct  15    EYQKFIKKMNPPRVTIDNTSCANATIIHVDSANKYGILLEVVQVLTDLKLIVKKAYISSD  74

Query  477   GGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             GGWFMDVFNVTNQ G KIMDE+VL    DYI KS+ P SCF  S RR++GV   +D+T I
Sbjct  75    GGWFMDVFNVTNQSGQKIMDESVLQGIKDYIYKSIAPGSCFLPSRRRAIGVEPSSDYTLI  134

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             EL G+DRPGLLSEVSAVLTNL CNVVNAEVWTHN RAAA++QVTD ++G A++D + L  
Sbjct  135   ELTGTDRPGLLSEVSAVLTNLDCNVVNAEVWTHNERAAAVIQVTDRKSGLAISDADRLGR  194

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             IK+ L NV KG  +SR AKT +  G THT+RRLHQ+M  DRDYER   +  N    P VS
Sbjct  195   IKEWLRNVFKG--RSRDAKTTVAMGITHTERRLHQMMLEDRDYERYDKDRANANPMPMVS  252

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V NW  +DYSVVT+RCKDRPKLLFD +CTLTDM+YVV+HG+VD EGPEAYQEY IRHIDG
Sbjct  253   VVNWLQKDYSVVTMRCKDRPKLLFDTVCTLTDMQYVVYHGSVDTEGPEAYQEYYIRHIDG  312

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SPV S+AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LTVTRAEV
Sbjct  313   SPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLTVTRAEV  372

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESPTRSLF  1541
             ATRG KA+NTFYV D +G  V+ + +E++RQ IGQT+LQVKG+PE  ++P QESPTR LF
Sbjct  373   ATRGNKAINTFYVRDTAGSSVELKTLEAIRQEIGQTVLQVKGHPEHPKSPAQESPTRFLF  432

Query  1542  GGIFKSRSF  1568
               +F+ RS 
Sbjct  433   SSLFRPRSL  441



>gb|AAM93430.1| ACR5 [Arabidopsis thaliana]
Length=446

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/451 (68%), Positives = 360/451 (80%), Gaps = 21/451 (5%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE  K IRR+NPPRVVIDNE CK+ TVI+VDSANKHG LLEVVQVLT+LNL I KAYI
Sbjct  1     MDDEIAKFIRRVNPPRVVIDNEVCKDVTVIKVDSANKHGILLEVVQVLTELNLTIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPD--SCFASSMRRSVGVTSGTDHTS  641
              SDGGWFMDVFNVT+Q+G+K+ DE VL+YI KSLGPD  SCF+ SMR ++GV    D+T 
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEIVLEYIRKSLGPDESSCFSPSMRSTIGVKQSVDYTV  120

Query  642   IELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLS  821
             +EL G+DRPGLLSE+ AVL +L+CNVVNAE+WTH  +AAA++QVTDEET  A+TDPE LS
Sbjct  121   VELTGTDRPGLLSELCAVLMDLQCNVVNAEIWTHRAKAAAVLQVTDEETCSAITDPERLS  180

Query  822   MIKKLLCNVLKGSN---KSRHAKTQITHG--ATHTDRRLHQLMFADRDYERASDEALNHP  986
              I+KLL  VL G +   + R  KT ++     THTDR+LHQLMFADRDY    DE  N+ 
Sbjct  181   KIRKLLGYVLTGGSSGRRFREPKTTVSSALNETHTDRKLHQLMFADRDY----DEWENNV  236

Query  987   DR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEG  1142
             D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM YVV H ++DAEG
Sbjct  237   DDEDKCGRVIPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMNYVVSHASIDAEG  296

Query  1143  PEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTR  1322
             P+AYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+DRVGLLS+VTR
Sbjct  297   PQAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSDRVGLLSDVTR  356

Query  1323  IFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE  1502
             IFRENSLTVTRAEV T+G KA+NTFYV DASGY VD + IES+RQ IGQTILQVKG   +
Sbjct  357   IFRENSLTVTRAEVKTKGDKALNTFYVRDASGYQVDTKTIESIRQVIGQTILQVKGGNTD  416

Query  1503  QNPT-QESPTRSLFGGIFKSRSFCNFGLVRS  1592
               P+ Q+SPT  LF G+FKSRSF NFGL+RS
Sbjct  417   AKPSPQDSPTGFLF-GVFKSRSFVNFGLIRS  446



>ref|XP_009152150.1| PREDICTED: uncharacterized protein LOC103875388 [Brassica rapa]
Length=451

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/456 (68%), Positives = 359/456 (79%), Gaps = 16/456 (4%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M+A +SYS +MDDE  + IRR+NPP+VVIDN+  KN TVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MDACLSYSYHMDDEIARFIRRVNPPKVVIDNDVYKNVTVIKVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNL I KAYI SDGGWFMDVFNVTNQ+G+K+ DE VLDYI KSLGPD     S R ++GV
Sbjct  61    LNLTIKKAYISSDGGWFMDVFNVTNQDGNKVTDEIVLDYIRKSLGPDESSCYSPRSTIGV  120

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 D T IEL G+DRPGLLSE+ AVLT+L+CNVVNAE+WTH  +AAA++QVTDEET  A
Sbjct  121   KQSVDFTVIELTGTDRPGLLSELCAVLTDLQCNVVNAEIWTHRAKAAAVLQVTDEETSSA  180

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQIT--HGATHTDRRLHQLMFADRDYERASDE  971
             VTDPE LS I+KLL  VL G ++SR  +   T    + + DR+LHQLMFADRDY    DE
Sbjct  181   VTDPERLSKIRKLLGYVLTGGSRSRRCREPKTTVSSSLNADRKLHQLMFADRDY----DE  236

Query  972   ALNHPDR--------PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGN  1127
               N+ D         P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YVV H +
Sbjct  237   WENNVDDEDKIGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYVVSHAS  296

Query  1128  VDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLL  1307
             +DAEGPEAYQEY IRH DGSPVKS+AERQRVI CL+AAI+RRV EGLKLELCT+DRVGLL
Sbjct  297   IDAEGPEAYQEYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVFEGLKLELCTSDRVGLL  356

Query  1308  SNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVK  1487
             S+VTRIFRENSLTVTRAEV T+GGKA+NTFYV DASGY VDA+ I+S+RQ IGQ ILQVK
Sbjct  357   SDVTRIFRENSLTVTRAEVKTKGGKALNTFYVRDASGYEVDAKTIDSIRQVIGQKILQVK  416

Query  1488  GNPEEQNPTQ-ESPTRSLFGGIFKSRSFCNFGLVRS  1592
             G   E  P+  ES T  LF G+FKSRSF NFGL+RS
Sbjct  417   GGNTEVKPSSPESQTGFLF-GVFKSRSFVNFGLIRS  451



>ref|XP_002467694.1| hypothetical protein SORBIDRAFT_01g032575 [Sorghum bicolor]
 gb|EER94692.1| hypothetical protein SORBIDRAFT_01g032575 [Sorghum bicolor]
Length=427

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/429 (69%), Positives = 349/429 (81%), Gaps = 7/429 (2%)
 Frame = +3

Query  321   MNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVF  500
             MNPPRV IDN +C NATVI VDSANK+G LLEVVQVLTDL LI+ KAYI SDGGWFMDVF
Sbjct  1     MNPPRVTIDNTSCPNATVIHVDSANKYGVLLEVVQVLTDLKLIVKKAYISSDGGWFMDVF  60

Query  501   NVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRP  668
             NVTNQ G KIMDE+VL    D I KS+GPDSC   S RR++GV   +D+T IEL G+DRP
Sbjct  61    NVTNQGGHKIMDESVLEGIKDCIYKSIGPDSCLLPSRRRAIGVEPSSDYTLIELTGTDRP  120

Query  669   GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNV  848
             GLLSEVSAVLTNL+CNVVNAE+WTHN RAAA+MQVTD ++G A++D E L  IK+ LCNV
Sbjct  121   GLLSEVSAVLTNLECNVVNAELWTHNERAAAVMQVTDRKSGLAISDAERLGRIKERLCNV  180

Query  849   LKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRD  1028
              KG  +SR AKT +  G THT+RRLHQ+M  DRDY+R   +  +      VSV NW  +D
Sbjct  181   FKG--RSRDAKTTVAMGITHTERRLHQMMLEDRDYDRHDKDRASGSPTSMVSVVNWLQKD  238

Query  1029  YSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAE  1208
             YSVVTIRCKDRPKLLFD +CTLTDM+YVVFHG+VD EGP+AYQ+Y IRHIDGSPV S+AE
Sbjct  239   YSVVTIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPDAYQDYYIRHIDGSPVNSEAE  298

Query  1209  RQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAV  1388
             R+R+IHCLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LTVTRAEV+T+G KA+
Sbjct  299   RKRIIHCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLTVTRAEVSTKGDKAI  358

Query  1389  NTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESPTRSLFGGIFKSRS  1565
             NTFYV DA+G  V+ + +E++RQ IGQT+LQVKG+P++ ++ TQESPTR LF  +F+ RS
Sbjct  359   NTFYVRDAAGSSVELKTLEAIRQEIGQTVLQVKGHPDQPKSLTQESPTRFLFSSLFRPRS  418

Query  1566  FCNFGLVRS  1592
              CN GL+ S
Sbjct  419   LCNLGLIGS  427



>emb|CDY45710.1| BnaC02g35120D [Brassica napus]
Length=445

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/446 (69%), Positives = 356/446 (80%), Gaps = 12/446 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE  K IRR+NPPRVVIDNE CKN TVI+VDSANKHG LLEVVQVLTDLNL I KAYI
Sbjct  1     MDDEIAKFIRRVNPPRVVIDNEVCKNVTVIKVDSANKHGILLEVVQVLTDLNLTIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+K+ DE VL YI KSLGPD     S R ++GV    D T IE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVTDEIVLGYIRKSLGPDDSSCYSPRSTIGVKQSVDFTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L+CNVVNAE+WTH  +AAA++QVTDEET  AVTD E LS I
Sbjct  121   LTGTDRPGLLSELCAVLTDLQCNVVNAEIWTHRAKAAAVLQVTDEETCSAVTDLERLSQI  180

Query  828   KKLLCNVLKGSNKSRHA---KTQITHG--ATHTDRRLHQLMFADRDYERASDEALNHPDR  992
             +KLL  VL G ++SR +   KT ++     T+ DR+LHQLMFADRDY+   +   +  D+
Sbjct  181   RKLLGYVLTGGSRSRRSCEPKTTVSSSLDETYADRKLHQLMFADRDYDEWENNVGDDEDK  240

Query  993   -----PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                  P+V V+N HD DYSVV IRCKDRPKLLFD + TLTDM+Y V H ++DA+GPEAYQ
Sbjct  241   SGRVVPDVDVSNLHDLDYSVVMIRCKDRPKLLFDTVFTLTDMKYGVSHASIDAQGPEAYQ  300

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH DGSPVKS+AERQRVI CL+AAI+RRVSEGLKLELCT+DRVGLLS+VTRIFREN
Sbjct  301   EYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVSEGLKLELCTSDRVGLLSDVTRIFREN  360

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-T  1514
             SLTVTRAEV T+GGKA+NTFYV DASGY VDA+ I+++R+ IGQTILQVKG   E  P +
Sbjct  361   SLTVTRAEVKTKGGKALNTFYVKDASGYKVDAKTIDAIREVIGQTILQVKGGNTEVKPSS  420

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRS  1592
             QES TR LF G+FKSRSF NFGL+RS
Sbjct  421   QESQTRFLF-GVFKSRSFVNFGLIRS  445



>gb|KDO70280.1| hypothetical protein CISIN_1g013090mg [Citrus sinensis]
Length=372

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/373 (78%), Positives = 335/373 (90%), Gaps = 4/373 (1%)
 Frame = +3

Query  489   MDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRP  668
             MDVFNVT+++G+KI DE +LDYI K LGP++CFASSMR SVGV    DHT+IEL GSDRP
Sbjct  1     MDVFNVTDEDGNKITDEGILDYIRKCLGPEACFASSMR-SVGVKQSMDHTAIELTGSDRP  59

Query  669   GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNV  848
             GLLSEVSAVLT+LKCNVV+AEVWTHNTRAAA+MQVTDEETGGA++DPE LS+IK+LLCNV
Sbjct  60    GLLSEVSAVLTHLKCNVVSAEVWTHNTRAAALMQVTDEETGGAISDPERLSVIKELLCNV  119

Query  849   LKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS--DEALNHPDRPNVSVTNWHD  1022
             LKGSNKS  AKT+++   THT+RRLHQ+MFADRDYER    D++L+   RPNV+V N +D
Sbjct  120   LKGSNKSGLAKTEVSQDVTHTERRLHQMMFADRDYERTGTDDDSLDEKQRPNVNVVNCYD  179

Query  1023  RDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSD  1202
             +DYSVVTI  KDRPKL+FD +CTLTDM+YVVFH N+DAEGPEAYQEY IRHIDGSPVKSD
Sbjct  180   KDYSVVTITSKDRPKLVFDTVCTLTDMQYVVFHANIDAEGPEAYQEYFIRHIDGSPVKSD  239

Query  1203  AERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGK  1382
             AER+RVI CL+AAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT+ GK
Sbjct  240   AERERVIQCLKAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATKSGK  299

Query  1383  AVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESPTRSLFGGIFKS  1559
             AVNTFYVG ASGYPVDA+II+S+RQ+IGQTIL+VKGNPE+ ++ +Q+SPTR LFGG+FKS
Sbjct  300   AVNTFYVGGASGYPVDAKIIDSIRQSIGQTILKVKGNPEDLKSASQDSPTRFLFGGLFKS  359

Query  1560  RSFCNFGLVRSYS  1598
             RSF NFGLVRS S
Sbjct  360   RSFVNFGLVRSCS  372



>emb|CDY51199.1| BnaA06g39780D [Brassica napus]
Length=441

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/446 (68%), Positives = 351/446 (79%), Gaps = 16/446 (4%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE  + IRR+NPP+VVIDN+  KN TVI+VDSANKHG LLEVVQVLTDLNL I KAYI
Sbjct  1     MDDEIARFIRRVNPPKVVIDNDVYKNVTVIKVDSANKHGILLEVVQVLTDLNLTIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVTNQ+G+K+ DE VLDYI KSLGPD     S R ++GV    D T IE
Sbjct  61    SSDGGWFMDVFNVTNQDGNKVTDEIVLDYIRKSLGPDESSCYSPRSTIGVKQSVDFTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L+CNVVNAE+WTH  +AAA++QVTDEET  AVTDPE LS I
Sbjct  121   LTGTDRPGLLSELCAVLTDLQCNVVNAEIWTHRAKAAAVLQVTDEETSSAVTDPERLSKI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT--HGATHTDRRLHQLMFADRDYERASDEALNHPDR---  992
             +KLL  VL G ++SR  +   T    + + DR+LHQLMFADRDY    DE  N+ D    
Sbjct  181   RKLLGYVLTGGSRSRRCREPKTTVSSSLNADRKLHQLMFADRDY----DEWENNVDDEDK  236

Query  993   -----PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                  P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YVV H ++DAEGPEAYQ
Sbjct  237   IGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYVVSHASIDAEGPEAYQ  296

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH DGSPVKS+AERQRVI CL+AAI+RRV EGLKLELCT+DRVGLLS+VTRIFREN
Sbjct  297   EYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVFEGLKLELCTSDRVGLLSDVTRIFREN  356

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQ  1517
             SLTVTRAEV T+GGKA+NTFYV DASGY VDA+ I+S+RQ IGQ ILQVKG   E  P+ 
Sbjct  357   SLTVTRAEVKTKGGKALNTFYVRDASGYEVDAKTIDSIRQVIGQKILQVKGGNTEVKPSS  416

Query  1518  -ESPTRSLFGGIFKSRSFCNFGLVRS  1592
              ES T  LF G+FKSRSF NFGL+RS
Sbjct  417   PESQTGFLF-GVFKSRSFVNFGLIRS  441



>ref|XP_008668558.1| PREDICTED: ACR4 isoform X1 [Zea mays]
 tpg|DAA45791.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=459

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/448 (68%), Positives = 352/448 (79%), Gaps = 16/448 (4%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I+ MNPPRV IDN +C NATVI VDSANK+G LLEVVQVLTDL LI+ K
Sbjct  13    SWDSDDEYQKFIQNMNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKK  72

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVF VTNQ G KI DE+VL    DYI KS+GPDSCF  S RR+VGV   
Sbjct  73    AYISSDGGWFMDVFTVTNQSGHKITDESVLQGIKDYIYKSIGPDSCFLPSRRRAVGVEPS  132

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +DHT IEL G+DRPGLLSEVSAVLT+L+CNVV+AE+WTHN RAAA+MQVTD E+G AV+D
Sbjct  133   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  192

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDE----  971
              E +  IK  L NV +G  +SR AKT + T GATH +RRLHQ+MF DRDYER   +    
Sbjct  193   AERVGRIKGRLYNVFRG--RSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGRA  250

Query  972   -ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE  1148
              A      P VSV NW  + YSVVT+RC+DRPKLLFD +CTLTDM+YVVFHG+VD EGPE
Sbjct  251   AASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPE  310

Query  1149  AYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIF  1328
             AYQ+Y IRHIDG PV S+AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIF
Sbjct  311   AYQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIF  370

Query  1329  RENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN  1508
             REN LTVTRAEV+TRG +AVNTFYV DA+G  V+ R +E++RQ IGQT+LQVKG+PE+  
Sbjct  371   RENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVLQVKGHPEQPK  430

Query  1509  P---TQESPTRSLFGG-IFKSRSFCNFG  1580
             P    Q+SPTR LF   +F+ RS CN G
Sbjct  431   PPVAAQDSPTRFLFSSLLFRPRSLCNLG  458



>ref|NP_001142223.1| ACR4 [Zea mays]
 gb|ACF87927.1| unknown [Zea mays]
 gb|ACN27877.1| unknown [Zea mays]
 tpg|DAA45792.1| TPA: ACR4 [Zea mays]
Length=458

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/448 (68%), Positives = 352/448 (79%), Gaps = 16/448 (4%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I+ MNPPRV IDN +C NATVI VDSANK+G LLEVVQVLTDL LI+ K
Sbjct  12    SWDSDDEYQKFIQNMNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKK  71

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVF VTNQ G KI DE+VL    DYI KS+GPDSCF  S RR+VGV   
Sbjct  72    AYISSDGGWFMDVFTVTNQSGHKITDESVLQGIKDYIYKSIGPDSCFLPSRRRAVGVEPS  131

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +DHT IEL G+DRPGLLSEVSAVLT+L+CNVV+AE+WTHN RAAA+MQVTD E+G AV+D
Sbjct  132   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  191

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDE----  971
              E +  IK  L NV +G  +SR AKT + T GATH +RRLHQ+MF DRDYER   +    
Sbjct  192   AERVGRIKGRLYNVFRG--RSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGRA  249

Query  972   -ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE  1148
              A      P VSV NW  + YSVVT+RC+DRPKLLFD +CTLTDM+YVVFHG+VD EGPE
Sbjct  250   AASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPE  309

Query  1149  AYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIF  1328
             AYQ+Y IRHIDG PV S+AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIF
Sbjct  310   AYQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIF  369

Query  1329  RENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN  1508
             REN LTVTRAEV+TRG +AVNTFYV DA+G  V+ R +E++RQ IGQT+LQVKG+PE+  
Sbjct  370   RENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVLQVKGHPEQPK  429

Query  1509  P---TQESPTRSLFGG-IFKSRSFCNFG  1580
             P    Q+SPTR LF   +F+ RS CN G
Sbjct  430   PPVAAQDSPTRFLFSSLLFRPRSLCNLG  457



>emb|CDY02975.1| BnaC07g22520D [Brassica napus]
Length=441

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/446 (68%), Positives = 350/446 (78%), Gaps = 16/446 (4%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE  + IRR+NPP+VVIDN+  KN TVI+VDSANK G LLEVVQVLTDLNL I KAYI
Sbjct  1     MDDEIARFIRRVNPPKVVIDNDVYKNVTVIKVDSANKQGILLEVVQVLTDLNLTIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVTNQ+G+K+ DE VLDYI KSLGPD     S R ++GV    D T IE
Sbjct  61    SSDGGWFMDVFNVTNQDGNKVTDEIVLDYIRKSLGPDESSCYSPRSTIGVKQSVDFTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L+CNVVNAE+WTH  +AAA++QVTDEET  AVTDPE LS I
Sbjct  121   LTGTDRPGLLSELCAVLTDLQCNVVNAEIWTHRAKAAAVLQVTDEETSSAVTDPERLSKI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT--HGATHTDRRLHQLMFADRDYERASDEALNHPDR---  992
             +KLL  VL G ++SR  +   T    + + DR+LHQLMFADRDY    DE  N+ D    
Sbjct  181   RKLLGYVLTGGSRSRRCREPKTTVSSSLNADRKLHQLMFADRDY----DEWENNVDDEDK  236

Query  993   -----PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                  P+V V+N HD DYS+V I+CKDRPKLLFD + TLTDM+YVV H ++DAEGPEAYQ
Sbjct  237   IGRVVPDVDVSNLHDLDYSIVMIKCKDRPKLLFDTVFTLTDMKYVVSHASIDAEGPEAYQ  296

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH DGSPVKS+AERQRVI CL+AAI+RRV EGLKLELCT+DRVGLLS+VTRIFREN
Sbjct  297   EYYIRHTDGSPVKSEAERQRVIKCLKAAIQRRVFEGLKLELCTSDRVGLLSDVTRIFREN  356

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQ  1517
             SLTVTRAEV T+GGKA+NTFYV DASGY VDA+ I+S+RQ IGQ ILQVKG   E  P+ 
Sbjct  357   SLTVTRAEVKTKGGKALNTFYVRDASGYEVDAKTIDSIRQVIGQKILQVKGGNTEVKPSS  416

Query  1518  -ESPTRSLFGGIFKSRSFCNFGLVRS  1592
              ES T  LF G+FKSRSF NFGL+RS
Sbjct  417   PESQTGFLF-GVFKSRSFVNFGLIRS  441



>gb|ACG25547.1| ACR4 [Zea mays]
Length=458

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/448 (67%), Positives = 351/448 (78%), Gaps = 16/448 (4%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S + DDEY+K I+ MNPPRV IDN +C NATVI VDSANK+G LLEVVQVLTDL LI+ K
Sbjct  12    SWDSDDEYQKFIQNMNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKK  71

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSG  626
             AYI SDGGWFMDVF VTNQ G KI DE+VL    DYI KS+GPDSCF  S R +VGV   
Sbjct  72    AYISSDGGWFMDVFTVTNQSGHKITDESVLQGIKDYIYKSIGPDSCFLPSRRXAVGVEPS  131

Query  627   TDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTD  806
             +DHT IEL G+DRPGLLSEVSAVLT+L+CNVV+AE+WTHN RAAA+MQVTD E+G AV+D
Sbjct  132   SDHTLIELTGTDRPGLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSD  191

Query  807   PETLSMIKKLLCNVLKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDE----  971
              E +  IK  L NV +G  +SR AKT + T GATH +RRLHQ+MF DRDYER   +    
Sbjct  192   AERVGRIKGRLYNVFRG--RSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGRA  249

Query  972   -ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE  1148
              A      P VSV NW  + YSVVT+RC+DRPKLLFD +CTLTDM+YVVFHG+VD EGPE
Sbjct  250   AASGSNPGPVVSVVNWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPE  309

Query  1149  AYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIF  1328
             AYQ+Y IRHIDG PV S+AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIF
Sbjct  310   AYQDYYIRHIDGCPVNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIF  369

Query  1329  RENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN  1508
             REN LTVTRAEV+TRG +AVNTFYV DA+G  V+ R +E++RQ IGQT+LQVKG+PE+  
Sbjct  370   RENGLTVTRAEVSTRGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVLQVKGHPEQPK  429

Query  1509  P---TQESPTRSLFGG-IFKSRSFCNFG  1580
             P    Q+SPTR LF   +F+ RS CN G
Sbjct  430   PPVAAQDSPTRFLFSSLLFRPRSLCNLG  457



>tpg|DAA45793.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=433

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/434 (68%), Positives = 342/434 (79%), Gaps = 16/434 (4%)
 Frame = +3

Query  321   MNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVF  500
             MNPPRV IDN +C NATVI VDSANK+G LLEVVQVLTDL LI+ KAYI SDGGWFMDVF
Sbjct  1     MNPPRVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKKAYISSDGGWFMDVF  60

Query  501   NVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRP  668
              VTNQ G KI DE+VL    DYI KS+GPDSCF  S RR+VGV   +DHT IEL G+DRP
Sbjct  61    TVTNQSGHKITDESVLQGIKDYIYKSIGPDSCFLPSRRRAVGVEPSSDHTLIELTGTDRP  120

Query  669   GLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNV  848
             GLLSEVSAVLT+L+CNVV+AE+WTHN RAAA+MQVTD E+G AV+D E +  IK  L NV
Sbjct  121   GLLSEVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSDAERVGRIKGRLYNV  180

Query  849   LKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDE-----ALNHPDRPNVSVT  1010
              +G  +SR AKT + T GATH +RRLHQ+MF DRDYER   +     A      P VSV 
Sbjct  181   FRG--RSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGRAAASGSNPGPVVSVV  238

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             NW  + YSVVT+RC+DRPKLLFD +CTLTDM+YVVFHG+VD EGPEAYQ+Y IRHIDG P
Sbjct  239   NWLQKYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPEAYQDYYIRHIDGCP  298

Query  1191  VKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT  1370
             V S+AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LTVTRAEV+T
Sbjct  299   VNSEAERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLTVTRAEVST  358

Query  1371  RGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP---TQESPTRSLF  1541
             RG +AVNTFYV DA+G  V+ R +E++RQ IGQT+LQVKG+PE+  P    Q+SPTR LF
Sbjct  359   RGDEAVNTFYVRDAAGSAVELRTLEAIRQEIGQTVLQVKGHPEQPKPPVAAQDSPTRFLF  418

Query  1542  GG-IFKSRSFCNFG  1580
                +F+ RS CN G
Sbjct  419   SSLLFRPRSLCNLG  432



>gb|ACL53099.1| unknown [Zea mays]
 tpg|DAA45794.1| TPA: hypothetical protein ZEAMMB73_762765 [Zea mays]
Length=440

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/430 (68%), Positives = 338/430 (79%), Gaps = 16/430 (4%)
 Frame = +3

Query  333   RVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTN  512
             RV IDN +C NATVI VDSANK+G LLEVVQVLTDL LI+ KAYI SDGGWFMDVF VTN
Sbjct  12    RVTIDNTSCPNATVIHVDSANKYGILLEVVQVLTDLKLIVKKAYISSDGGWFMDVFTVTN  71

Query  513   QEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLS  680
             Q G KI DE+VL    DYI KS+GPDSCF  S RR+VGV   +DHT IEL G+DRPGLLS
Sbjct  72    QSGHKITDESVLQGIKDYIYKSIGPDSCFLPSRRRAVGVEPSSDHTLIELTGTDRPGLLS  131

Query  681   EVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGS  860
             EVSAVLT+L+CNVV+AE+WTHN RAAA+MQVTD E+G AV+D E +  IK  L NV +G 
Sbjct  132   EVSAVLTSLECNVVSAELWTHNGRAAAVMQVTDRESGLAVSDAERVGRIKGRLYNVFRG-  190

Query  861   NKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDE-----ALNHPDRPNVSVTNWHD  1022
              +SR AKT + T GATH +RRLHQ+MF DRDYER   +     A      P VSV NW  
Sbjct  191   -RSRDAKTAVATTGATHPERRLHQMMFEDRDYERRGKDDGRAAASGSNPGPVVSVVNWLQ  249

Query  1023  RDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSD  1202
             + YSVVT+RC+DRPKLLFD +CTLTDM+YVVFHG+VD EGPEAYQ+Y IRHIDG PV S+
Sbjct  250   KYYSVVTVRCRDRPKLLFDTVCTLTDMQYVVFHGSVDTEGPEAYQDYYIRHIDGCPVNSE  309

Query  1203  AERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGK  1382
             AER+R+I CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LTVTRAEV+TRG +
Sbjct  310   AERKRIIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLTVTRAEVSTRGDE  369

Query  1383  AVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP---TQESPTRSLFGG-I  1550
             AVNTFYV DA+G  V+ R +E++RQ IGQT+LQVKG+PE+  P    Q+SPTR LF   +
Sbjct  370   AVNTFYVRDAAGSAVELRTLEAIRQEIGQTVLQVKGHPEQPKPPVAAQDSPTRFLFSSLL  429

Query  1551  FKSRSFCNFG  1580
             F+ RS CN G
Sbjct  430   FRPRSLCNLG  439



>ref|XP_003622131.1| Amino acid binding protein, putative [Medicago truncatula]
 gb|AES78349.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=442

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/442 (63%), Positives = 344/442 (78%), Gaps = 5/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN AC+NATVIQVDS NKHG LL+VVQV++D+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNACENATVIQVDSVNKHGILLDVVQVISDMNLVIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNVT++ G+KI D+ V+DYI + L  +  F +SMR SVGV    +HT IE
Sbjct  61    SSDGVWFMDVFNVTDRNGNKIKDKEVIDYIQRRLEKNPSFETSMRESVGVVPTEEHTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVL +L+CNVV AE+WTHNTRAAA++ VTD+ +G A+ DP  LS I
Sbjct  121   LTGTDRPGLLSEICAVLADLRCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIEDPSRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHPDR---P  995
             + LLCNVL+GS+  + AKT ++H G T+ DRRLHQ+MFADRDYER     L   D+   P
Sbjct  181   RDLLCNVLRGSDDPKTAKTALSHPGVTYRDRRLHQIMFADRDYERVERAGLRERDKGPFP  240

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
             +V+V++  +RDY+VV +R KDRPKLLFD++CTLTDM+YVVFHG V  E   AYQE+ IRH
Sbjct  241   HVTVSDCTERDYTVVIMRAKDRPKLLFDIVCTLTDMQYVVFHGVVQTERTGAYQEFYIRH  300

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             +DG P+ S+AER+R+I CLEAAIERR SEG++LELCT DRVGLLS++TRIFRENSL + R
Sbjct  301   VDGFPISSEAERERLIQCLEAAIERRASEGMELELCTEDRVGLLSDITRIFRENSLCIKR  360

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPTR  1532
             AE++T  GKA +TFYV D +G PVD + I+S+R+ IG T+LQVK N      P Q +   
Sbjct  361   AEISTENGKAKDTFYVTDVTGNPVDPKSIDSIRRQIGDTVLQVKHNSSLSPKPPQGTTIG  420

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
              LFG  FK+RSF NF L+RSYS
Sbjct  421   FLFGSFFKARSFQNFKLIRSYS  442



>ref|XP_002512902.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF49405.1| amino acid binding protein, putative [Ricinus communis]
Length=443

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/444 (64%), Positives = 348/444 (78%), Gaps = 8/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN+ C++ATVIQVDS NKHG LL+VVQVLTD+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDVCEDATVIQVDSVNKHGILLQVVQVLTDMNLVIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV +Q+G+KI D+ V+ YI + L  ++ FA S+R SVGV    DHTSIE
Sbjct  61    SSDGGWFMDVFNVIDQDGNKIRDKEVIGYIQRRLESNASFAPSLRGSVGVMPSEDHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L+CNVVNAE+WTHN RAAA++ VTD+ TG AV DP+ LS I
Sbjct  121   LSGNDRPGLLSEVCAVLADLRCNVVNAEIWTHNARAAAVVHVTDDSTGCAVKDPKRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             K+LLCNVLKG+N  + AK  ++  G T  +RRLHQ+MFADRDYER     L    +   R
Sbjct  181   KELLCNVLKGNNDLKAAKMTLSPPGITSRERRLHQIMFADRDYERVDRVGLGRLEDKSSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDA-EGPEAYQEYCI  1169
             P+V+V N  ++DYSV+T+R KDRPKLLFD++CTLTDMEYVVFHG V+A    EAYQE+ I
Sbjct  241   PHVTVLNI-EKDYSVITMRSKDRPKLLFDIVCTLTDMEYVVFHGMVNAGRKEEAYQEFYI  299

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DG P+ SDAER+RVI CLEAAIERR SEGL+LELCT DRVGLLS++TR FRENSL +
Sbjct  300   RHVDGLPISSDAERERVIQCLEAAIERRASEGLELELCTEDRVGLLSDITRTFRENSLCI  359

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESP  1526
              RAE++T+GG A +TFYV D +G PVD +I++S+ + IGQT LQVK N      P QE+ 
Sbjct  360   KRAEISTKGGIAKDTFYVTDVTGSPVDPKIVDSICRQIGQTRLQVKQNLTLSPKPAQETT  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                L G +FK+R+F NF L+RSYS
Sbjct  420   MGYLLGTLFKARTFQNFKLIRSYS  443



>ref|XP_004514319.1| PREDICTED: uncharacterized protein LOC101500937 [Cicer arietinum]
Length=442

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/442 (63%), Positives = 343/442 (78%), Gaps = 5/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN  C+ ATVIQVDS NKHG LL+VVQVL+D+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNTCEYATVIQVDSVNKHGILLDVVQVLSDMNLVIIKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNVT++ G+KI D+ V+DYI + L  ++ FA+SMR SVGV    +HT IE
Sbjct  61    SSDGVWFMDVFNVTDRNGNKIKDKEVIDYIQRRLEKNAGFATSMRESVGVVPTEEHTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVL +L CNVV AE+WTHNTRAAA++ VTD+ +G A+ DP  LS I
Sbjct  121   LTGTDRPGLLSEICAVLADLHCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIEDPSRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHPDR---P  995
             + LLCNVL+GS+  + AKT ++H G T+ DRRLHQ+MFADRDYER     +N  ++   P
Sbjct  181   RDLLCNVLRGSDDPKTAKTVLSHPGVTYRDRRLHQIMFADRDYERVERAGMNERNKSPFP  240

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
             +V+V +  +RDY+VV +R KDRPKLLFD++CTLTDM+YVVFHG V  E  EAYQE+ IRH
Sbjct  241   HVTVLDCVERDYTVVIMRAKDRPKLLFDIVCTLTDMQYVVFHGVVQTERTEAYQEFYIRH  300

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             IDG P+ S+ ER+R+I CLEAAIERR SEG++LELCT DRVGLLS++TRIFRENSL + R
Sbjct  301   IDGFPISSEGERERLIQCLEAAIERRASEGMELELCTEDRVGLLSDITRIFRENSLCIKR  360

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPTR  1532
             AE++T  GKA +TFYV D +G PVD +II+S+R+ IG T+LQVK N      P Q +   
Sbjct  361   AEISTENGKAKDTFYVTDVTGSPVDPKIIDSIRRQIGDTVLQVKHNSSLSPKPPQGTKIG  420

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
              L G  FK+RSF NF L+RSYS
Sbjct  421   FLLGSFFKARSFQNFKLIRSYS  442



>ref|XP_002272024.1| PREDICTED: uncharacterized protein LOC100248040 [Vitis vinifera]
 emb|CBI21324.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/440 (64%), Positives = 341/440 (78%), Gaps = 3/440 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN+A + ATVIQVDS NKHG LLEVVQVLTD+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDASEEATVIQVDSVNKHGILLEVVQVLTDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV + +G+KI D+ V++YI K+L  D+ F   MR +VGV    DHTSIE
Sbjct  61    SSDGGWFMDVFNVVDGDGNKIRDKGVINYITKTLERDASFVPPMRGTVGVMPSEDHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  LS I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIEDPNRLSKI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEAL--NHPDRPN  998
             K+LLCNVLKG+N  + AK  ++  G TH +RRLHQ+MFADRDY+R     L  +   RP+
Sbjct  181   KELLCNVLKGNNDLKTAKMTLSPPGFTHRERRLHQIMFADRDYQRVERAELGKDKSSRPH  240

Query  999   VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHI  1178
             V+V +  ++DY+V+T+R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IRH+
Sbjct  241   VTVLDCIEKDYTVITMRSKDRPKLLFDTVCTLTDMQYVVFHGVVHTGRMEAYQEYYIRHV  300

Query  1179  DGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRA  1358
             DG P+ SDAER+RVI CLEAAIERR SEGL+LEL T DR GLLS++TR+FRENSL + RA
Sbjct  301   DGLPMSSDAERERVIECLEAAIERRASEGLELELRTEDRFGLLSDITRVFRENSLCIKRA  360

Query  1359  EVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSL  1538
             E++T GGKA +TFYV D +G PV+ +II+S+RQ IG +ILQVK +       QE+    L
Sbjct  361   EISTEGGKAKDTFYVTDVTGNPVNPQIIDSIRQQIGHSILQVKNSNLSPKAPQETTMSFL  420

Query  1539  FGGIFKSRSFCNFGLVRSYS  1598
             FG IFK R+  NF L+RSYS
Sbjct  421   FGNIFKCRTLQNFKLIRSYS  440



>ref|XP_002466847.1| hypothetical protein SORBIDRAFT_01g015160 [Sorghum bicolor]
 gb|EER93845.1| hypothetical protein SORBIDRAFT_01g015160 [Sorghum bicolor]
Length=453

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 341/440 (78%), Gaps = 8/440 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY+  IR+MNPPR+VIDNE+   AT+++VDSAN++G LLEV+QV+ DLNL+I+KAYI 
Sbjct  15    DDEYDNFIRKMNPPRIVIDNESSAEATIVRVDSANEYGILLEVIQVMIDLNLVISKAYIT  74

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             SDGGWFMDVFNVT++EG KI DEA L    DYI KSLG DS +  S RRSV V +  DH 
Sbjct  75    SDGGWFMDVFNVTDKEGKKIKDEATLTQIEDYIRKSLGADSRYIPSRRRSVDVAAAADHN  134

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
              IEL G+DRPGLLSEVSAVL +LKCNVV+AE+WTHN RAAA+M+VTDE+T  AVTD E L
Sbjct  135   VIELTGTDRPGLLSEVSAVLASLKCNVVSAEIWTHNARAAAVMRVTDEDTRLAVTDTERL  194

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGA--THTDRRLHQLMFADRDYERASDEALNHPDR  992
               I++ L  +L+G N SR A   ++ G   THT+RRLHQ+M  D DYE+    A     R
Sbjct  195   ERIREKLSYLLRGGNLSRGAAMAVSSGTATTHTERRLHQMMLDDCDYEQLQQLAPGQSQR  254

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             PNV+V NW+D+DYSVVTIRCKDRPKLLFD +CTLTD++YVVFH N+DA+  +AYQE+ +R
Sbjct  255   PNVTVRNWNDKDYSVVTIRCKDRPKLLFDTVCTLTDLQYVVFHANIDAKDNQAYQEFYVR  314

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H++GSP+ ++ ER RVI CLEAAIERRVSEG+KLELCT D+VGLLS VTRIFRENSLTVT
Sbjct  315   HVNGSPMNTETERLRVIQCLEAAIERRVSEGVKLELCTNDKVGLLSEVTRIFRENSLTVT  374

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESPT  1529
             RAEV TRG  AVNTFYV  ++G  VD + I+S+RQ IG + LQVKG PE Q    +ESPT
Sbjct  375   RAEVTTRGRMAVNTFYVRGSTGEDVDQKAIDSIRQAIGHS-LQVKGQPEPQEAQKKESPT  433

Query  1530  RSLFGGIFKSRSFCNFGLVR  1589
               LF  +F+ RS  +FG +R
Sbjct  434   WFLFANLFRPRSLYSFGFMR  453



>ref|NP_001130980.1| uncharacterized protein LOC100192085 [Zea mays]
 gb|ACF78873.1| unknown [Zea mays]
 gb|ACF79393.1| unknown [Zea mays]
 gb|ACF84636.1| unknown [Zea mays]
 gb|ACG28920.1| ACR4 [Zea mays]
 gb|ACN28949.1| unknown [Zea mays]
 tpg|DAA50240.1| TPA: ACR4 [Zea mays]
Length=451

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/438 (63%), Positives = 338/438 (77%), Gaps = 6/438 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY+  IR+MNPPR+VIDNE+   AT+++VDSAN++G LLEV+QV+ DLNL+I KAYI 
Sbjct  15    DDEYDNFIRKMNPPRIVIDNESSAEATIVRVDSANEYGILLEVIQVMIDLNLVIGKAYIT  74

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             SDGGWFMDVFNVT++EG KI DEA L    DYI KSLG DS +  S RRSV V +  DH 
Sbjct  75    SDGGWFMDVFNVTDKEGKKIKDEATLTQIEDYIRKSLGADSRYIPSRRRSVDVAAAADHN  134

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
              IEL G+DRPGLLSEVSAVLT+LKCNVV+AE+WTHNTRAAA+M+VTDE+TG AVTD E L
Sbjct  135   IIELTGTDRPGLLSEVSAVLTSLKCNVVSAEIWTHNTRAAAVMRVTDEDTGLAVTDAERL  194

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPN  998
               I++ L  + +G N SR A        THT+RRLHQ+M  D DYE+   +A     RPN
Sbjct  195   ERIREKLSYLFRGGNLSRGATVSSRTATTHTERRLHQMMLDDGDYEQLQRQAPGQSQRPN  254

Query  999   VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHI  1178
             V+V NW+D+DYSVVTIRCKDR KLLFD +CTLTD++YVVFH N+DA+  +AYQE+ +RH+
Sbjct  255   VTVRNWNDKDYSVVTIRCKDRSKLLFDTVCTLTDLQYVVFHANIDAKDNQAYQEFYVRHV  314

Query  1179  DGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRA  1358
             +GSP+ ++ ER RVI CLEAAIERRVSEG+KLELCT D+VGLLS VTRIFRENSLTVTRA
Sbjct  315   NGSPMNTETERLRVIQCLEAAIERRVSEGVKLELCTNDKVGLLSEVTRIFRENSLTVTRA  374

Query  1359  EVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESPTRS  1535
             EV TRG  AVNTFYV  ++G  VD + I+S+R+ IG + LQVKG  E   P  +ESPT  
Sbjct  375   EVTTRGRMAVNTFYVRGSAGEAVDQKAIDSIREAIGHS-LQVKGQAEPPEPQKKESPTWF  433

Query  1536  LFGGIFKSRSFCNFGLVR  1589
             LF  +F+ RS  +FG +R
Sbjct  434   LFANLFRPRSLYSFGFMR  451



>ref|NP_001050608.1| Os03g0598100 [Oryza sativa Japonica Group]
 gb|AAO59994.1| putative ACT domain repeat protein [Oryza sativa Japonica Group]
 gb|ABF97461.1| ACT domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12522.1| Os03g0598100 [Oryza sativa Japonica Group]
 dbj|BAF46924.1| ACT-domain repeat protein 5 [Oryza sativa Japonica Group]
 gb|EEE59457.1| hypothetical protein OsJ_11646 [Oryza sativa Japonica Group]
Length=453

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/451 (61%), Positives = 351/451 (78%), Gaps = 8/451 (2%)
 Frame = +3

Query  252   ISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVL  431
             +SM+     + + DDEY+  IR+MNPPR+ IDN++C +AT+++VDSAN++G LLEV+QVL
Sbjct  1     MSMDEGYGPTWDSDDEYDNFIRKMNPPRIEIDNDSCNDATIVRVDSANEYGILLEVIQVL  60

Query  432   TDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSM  599
              DLNL+I+KAYI SDGGW MDVFN+T++EG K+ D+A +    DYI KSLG DS +  S 
Sbjct  61    IDLNLVISKAYITSDGGWVMDVFNITDKEGQKLKDKATIARIEDYICKSLGADSRYIPSR  120

Query  600   RRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTD  779
             RRSV V + +DH  IEL G+DRPGLLSEVSAVL +LKCNVV+AE+WTHNTRAAA+M+VTD
Sbjct  121   RRSVDVAASSDHNVIELTGTDRPGLLSEVSAVLASLKCNVVSAEIWTHNTRAAAVMRVTD  180

Query  780   EETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHG--ATHTDRRLHQLMFADRDY  953
             E TG AVTD + L  I+  L  +L+G N SR A   ++ G  +THT+RRLHQ+M  D D+
Sbjct  181   EGTGSAVTDADRLERIRDRLSYLLRGGNLSRGAAMAVSTGTCSTHTERRLHQMMLDDGDH  240

Query  954   ERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVD  1133
             E+      N   RPNV+V+NW+D+DYSVVTIRCKDRPKLLFD +CTLTD+ YVVFH N+D
Sbjct  241   EQLHRHPPNQSQRPNVTVSNWNDKDYSVVTIRCKDRPKLLFDTVCTLTDLHYVVFHANID  300

Query  1134  AEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSN  1313
             A+  +AYQE+ +RH++GSP+ ++A+R RVI CLEAAIERRVSEG+KLELCT D+VGLLS 
Sbjct  301   AKDNQAYQEFYVRHVNGSPMHTEADRLRVIQCLEAAIERRVSEGVKLELCTNDKVGLLSE  360

Query  1314  VTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN  1493
             VTRIFRENSLTVTRAEV+TRG  AVNTFYV D++G  VD + I+S+RQ IGQ I QVKG 
Sbjct  361   VTRIFRENSLTVTRAEVSTRGRMAVNTFYVRDSTGGTVDQKTIDSIRQAIGQNI-QVKGQ  419

Query  1494  PEEQNP-TQESPTRSLFGGIFKSRSFCNFGL  1583
             PE   P  +ESPT  LF  +F+ RS  +FG+
Sbjct  420   PEPSEPQKKESPTWFLFANLFRPRSLYSFGM  450



>ref|XP_006369838.1| hypothetical protein POPTR_0001s33460g [Populus trichocarpa]
 gb|ERP66407.1| hypothetical protein POPTR_0001s33460g [Populus trichocarpa]
Length=439

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/443 (64%), Positives = 347/443 (78%), Gaps = 10/443 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MD+EY KLIRR+NPPRVVIDN+AC+ ATVIQVDS NKHG LL+VVQVLTD+NL+ITKAYI
Sbjct  1     MDEEYAKLIRRLNPPRVVIDNDACEEATVIQVDSVNKHGILLKVVQVLTDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +Q+G KI D+ V+DYI + L  ++ FA S+R SVGV    +HT+IE
Sbjct  61    SSDGDWFMDVFNVVDQDGKKIRDKEVMDYIQRRLESNASFAPSLRGSVGVMPSEEHTAIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVLT+L CNVVNAE+WTHNTRAAA++ VTD+ TG A+ DP+ LS I
Sbjct  121   LTGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIKDPKRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             ++LLCNVLKG++ S+ A T ++  G T  +RRLHQ+MFADRDYER     L    +   R
Sbjct  181   RELLCNVLKGNDDSKTATTTLSPPGVTSRERRLHQIMFADRDYERVERAGLARFEDKSSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+V N  +RDY+VV++R KDRPKLLFD++CTLTDMEYVVFHG V     EAYQE+ IR
Sbjct  241   PHVTVLNI-ERDYTVVSMRSKDRPKLLFDIVCTLTDMEYVVFHGMVSTGRMEAYQEFYIR  299

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG PV SDAER+RV+ CLEAAIERR SEGL+LELCT DRVGLLS++TRIFRENSL + 
Sbjct  300   HVDGLPVSSDAERERVVQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLCIK  359

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQESPT  1529
             RAE+ T+GGKA +TFYV D +G PVD +II+S+ + IGQT L VK N      P QE+  
Sbjct  360   RAEILTKGGKAKDTFYVTDVTGNPVDPKIIDSICRQIGQTKLLVKRNSILSPKPPQETTM  419

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               +FG +FK+R+   F L+RSYS
Sbjct  420   GYIFGNLFKART---FKLIRSYS  439



>ref|XP_011000958.1| PREDICTED: uncharacterized protein LOC105108367 isoform X1 [Populus 
euphratica]
Length=439

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/443 (64%), Positives = 347/443 (78%), Gaps = 10/443 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRR+NPPRVVIDN+A ++ATVIQVDS NKHG LL+VVQVLTD+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRLNPPRVVIDNDASEDATVIQVDSVNKHGILLKVVQVLTDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +Q+G KI D+ V+DYI + L  ++ FA S+R SVGV    +HT+IE
Sbjct  61    SSDGDWFMDVFNVVDQDGKKIRDKEVMDYIQRRLESNASFAPSLRGSVGVMPSEEHTAIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVLT+L CNVVNAE+WTHNTRAAA++ VTD+ TG A+ DP+ LS I
Sbjct  121   LTGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIKDPKRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             ++LLCNVLKG++ S+ A   ++  G T  +RRLHQ+MFADRDYER     L    +   R
Sbjct  181   RELLCNVLKGNDDSKTATMTLSPPGVTSRERRLHQIMFADRDYERVERAGLARFEDKSSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+V N  +RDY+VV++R KDRPKLLFD++CTLTDMEYVVFHG V     EAYQE+ IR
Sbjct  241   PHVTVLNI-ERDYTVVSMRSKDRPKLLFDIVCTLTDMEYVVFHGMVSTGRMEAYQEFYIR  299

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG PV SDAER+RV+ CLEAAIERR SEGL+LELCT DRVGLLS++TRIFRENSL + 
Sbjct  300   HVDGLPVSSDAERERVVQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLCIK  359

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQESPT  1529
             RAE+ T+GGKA +TFYV D +G PVD +II+S+ + IGQT LQVK N      P QE+  
Sbjct  360   RAEILTKGGKAKDTFYVTDVTGNPVDPKIIDSICRQIGQTKLQVKRNSILSPKPPQETTM  419

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               +FG +FK+R+   F L+RSYS
Sbjct  420   GYIFGNLFKART---FKLIRSYS  439



>ref|XP_008231090.1| PREDICTED: uncharacterized protein LOC103330312 isoform X2 [Prunus 
mume]
Length=443

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/444 (63%), Positives = 346/444 (78%), Gaps = 8/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             M+DEY K +RRMNPPRVVIDN+ C++ATVIQVDS NKHG LL+VVQVL ++NLIITKAYI
Sbjct  1     MEDEYSKFVRRMNPPRVVIDNDTCEDATVIQVDSVNKHGILLDVVQVLAEVNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +Q G KI D+ +++YI   L  ++ F  SMR SVGV    +HTSIE
Sbjct  61    SSDGVWFMDVFNVIDQNGKKIRDQDIINYIQMRLESNAGFVPSMRDSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDPNRLATI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K+LLCNVL+G+++ + AK T  T G T+ DRRLHQLMFADRDYE+     L   +    R
Sbjct  181   KELLCNVLRGNSELKAAKMTLATPGVTNRDRRLHQLMFADRDYEKVERAELQRIEDKGSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+  +   +DY+VVT+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PHVTALDCSQKDYTVVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRMEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL V 
Sbjct  301   HVDGLPISSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLCVK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN--PEEQNPTQESP  1526
             RAE++T+GGKA++TFYV D +G  VD +II+SVR+ IGQTILQVK N  P  + P Q + 
Sbjct  361   RAEISTKGGKAIDTFYVTDVTGNTVDPKIIDSVRRQIGQTILQVKLNSSPPPKAP-QGTT  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                LFG +FK+RSF NF L+RSYS
Sbjct  420   MGYLFGNLFKARSFQNFKLIRSYS  443



>ref|XP_006650292.1| PREDICTED: uncharacterized protein LOC102702453 [Oryza brachyantha]
Length=453

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/451 (61%), Positives = 350/451 (78%), Gaps = 8/451 (2%)
 Frame = +3

Query  252   ISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVL  431
             +SM+     + + DDEY+  IR+MNPPR+ IDN++C +AT+++VDSAN++G LLEV+QVL
Sbjct  1     MSMDEGYGPTWDSDDEYDNFIRKMNPPRIEIDNDSCSDATIVRVDSANEYGILLEVIQVL  60

Query  432   TDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSM  599
              DLNL+I+KAYI SDGGWFMDVFN+T++EG K+ D+A +    DYI KSLG DS +  S 
Sbjct  61    IDLNLVISKAYITSDGGWFMDVFNITDKEGQKLKDKATIARIEDYICKSLGADSRYIPSR  120

Query  600   RRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTD  779
             RRSV V + +DH  IEL G+DRPGLLSEVSAVL +LKCNVV+AE+WTHNTRAAA+M+VTD
Sbjct  121   RRSVDVAASSDHNVIELTGTDRPGLLSEVSAVLASLKCNVVSAEIWTHNTRAAAVMRVTD  180

Query  780   EETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGA--THTDRRLHQLMFADRDY  953
             E+TG AVTD   L  I+  L  +L+G N SR A   ++ GA  THTDRRLHQ+M  D D+
Sbjct  181   EDTGLAVTDTGRLERIRDKLSYLLRGGNVSRGAAMAVSTGASTTHTDRRLHQMMLDDGDH  240

Query  954   ERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVD  1133
             E+      N   RPNV+V+NW+D+DYSVVTIRCKDRPKLLFD +CTLTD+ YVVFH N+D
Sbjct  241   EQLHRHPPNQSQRPNVTVSNWNDKDYSVVTIRCKDRPKLLFDTVCTLTDLHYVVFHANID  300

Query  1134  AEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSN  1313
             A+  +AYQE+ +RH++GSP+ ++A+R RVI CLEAAIERR SEG+KLELCT D+VGLLS 
Sbjct  301   AKDNQAYQEFYVRHVNGSPMNTEADRLRVIQCLEAAIERRASEGVKLELCTNDKVGLLSE  360

Query  1314  VTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN  1493
             VTRIFRENSLTVTRAEV+TRG  AVNTFYV D++G  VD + I+S+RQ IGQ I QVK  
Sbjct  361   VTRIFRENSLTVTRAEVSTRGRMAVNTFYVRDSAGGTVDQKTIDSIRQAIGQNI-QVKNQ  419

Query  1494  PEEQN-PTQESPTRSLFGGIFKSRSFCNFGL  1583
             PE  +   +ESPT  LF  +F+ RS  +FG+
Sbjct  420   PEPSDQQKKESPTWFLFANLFRPRSLYSFGM  450



>ref|XP_004982474.1| PREDICTED: uncharacterized protein LOC101774584 isoform X1 [Setaria 
italica]
Length=454

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/450 (62%), Positives = 345/450 (77%), Gaps = 8/450 (2%)
 Frame = +3

Query  255   SMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             SM+     + + DDEY+  IR+MNPPR+VIDNE+   AT+++VDSAN++G LLEV+QV+ 
Sbjct  3     SMDEGYGPTWDSDDEYDNFIRKMNPPRIVIDNESSAEATIVRVDSANEYGILLEVIQVMI  62

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMR  602
             DLNL+I KAYI SDGGWFMDVFNVT++EG KI D+  L    DYI KSLG DS +  S R
Sbjct  63    DLNLVIGKAYITSDGGWFMDVFNVTDKEGKKIKDDVTLAQIEDYIRKSLGADSRYIPSRR  122

Query  603   RSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDE  782
             RSVGV +  DH  IEL+G+DRPGLLSEVSAVL +LKCNVV+AE+WTHNTRAAA+M+VTDE
Sbjct  123   RSVGVAAAADHNVIELMGTDRPGLLSEVSAVLASLKCNVVSAEIWTHNTRAAAVMRVTDE  182

Query  783   ETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITH--GATHTDRRLHQLMFADRDYE  956
             +TG AVTDP+ L  I++ L  +L+G + SR A   ++      HT+RRLHQ+M  D DYE
Sbjct  183   DTGLAVTDPDRLERIRERLSYLLRGGDLSRGAAMAVSSETATMHTERRLHQMMLDDGDYE  242

Query  957   RASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDA  1136
             +   +A     RPNV+V NW+D+DYSVVTIRCKDR KLLFD +CTLTD++YVVFH N+DA
Sbjct  243   QLQRQAPEQSQRPNVTVRNWNDKDYSVVTIRCKDRSKLLFDTVCTLTDLQYVVFHANIDA  302

Query  1137  EGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNV  1316
             +  +AYQE+ +RH++GSP+ ++ ER RVI CLEAAIERRVSEG+KLELCT D+VGLLS V
Sbjct  303   KDNQAYQEFYVRHVNGSPMNTETERLRVIQCLEAAIERRVSEGVKLELCTNDKVGLLSEV  362

Query  1317  TRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP  1496
             TRIFRENSLTVTRAEV TRG  AVNTFYV  ++G  VD + I+S+RQ IGQ  LQVKG P
Sbjct  363   TRIFRENSLTVTRAEVTTRGRMAVNTFYVRGSAGEAVDQKTIDSIRQAIGQN-LQVKGQP  421

Query  1497  EEQ-NPTQESPTRSLFGGIFKSRSFCNFGL  1583
             E      +ESPT  LF  +F+ RS  +FGL
Sbjct  422   EPPVAQKKESPTWFLFANLFRPRSLYSFGL  451



>gb|EEC75693.1| hypothetical protein OsI_12504 [Oryza sativa Indica Group]
Length=453

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/451 (61%), Positives = 350/451 (78%), Gaps = 8/451 (2%)
 Frame = +3

Query  252   ISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVL  431
             +SM+     + + DDEY+  IR+MNPPR+ IDN++C +AT+++VDSAN++G LLEV+QVL
Sbjct  1     MSMDEGYGPTWDSDDEYDNFIRKMNPPRIEIDNDSCNDATIVRVDSANEYGILLEVIQVL  60

Query  432   TDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSM  599
              DLNL+I+KAYI SDGGW MDVFN+T++EG K+ D+A +    DYI KSLG DS +  S 
Sbjct  61    IDLNLVISKAYITSDGGWVMDVFNITDKEGQKLKDKATIARIEDYICKSLGADSRYIPSR  120

Query  600   RRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTD  779
             RRSV V + +DH  IEL G+DRPGLLSEVSAVL +LKCNVV+AE+WTHNTRAAA+M+VTD
Sbjct  121   RRSVDVAASSDHNVIELTGTDRPGLLSEVSAVLASLKCNVVSAEIWTHNTRAAAVMRVTD  180

Query  780   EETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHG--ATHTDRRLHQLMFADRDY  953
             E TG AVTD + L  I+  L  +L+G N SR     ++ G  +THT+RRLHQ+M  D D+
Sbjct  181   EGTGSAVTDADRLERIRDRLSYLLRGGNLSRGTAMAVSTGTCSTHTERRLHQMMLDDGDH  240

Query  954   ERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVD  1133
             E+      N   RPNV+V+NW+D+DYSVVTIRCKDRPKLLFD +CTLTD+ YVVFH N+D
Sbjct  241   EQLHRHPPNQSQRPNVTVSNWNDKDYSVVTIRCKDRPKLLFDTVCTLTDLHYVVFHANID  300

Query  1134  AEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSN  1313
             A+  +AYQE+ +RH++GSP+ ++A+R RVI CLEAAIERRVSEG+KLELCT D+VGLLS 
Sbjct  301   AKDNQAYQEFYVRHVNGSPMHTEADRLRVIQCLEAAIERRVSEGVKLELCTNDKVGLLSE  360

Query  1314  VTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN  1493
             VTRIFRENSLTVTRAEV+TRG  AVNTFYV D++G  VD + I+S+RQ IGQ I QVKG 
Sbjct  361   VTRIFRENSLTVTRAEVSTRGRMAVNTFYVRDSTGGTVDQKTIDSIRQAIGQNI-QVKGQ  419

Query  1494  PEEQNP-TQESPTRSLFGGIFKSRSFCNFGL  1583
             PE   P  +ESPT  LF  +F+ RS  +FG+
Sbjct  420   PEPSEPQKKESPTWFLFANLFRPRSLYSFGM  450



>ref|XP_006844620.1| hypothetical protein AMTR_s00016p00225040 [Amborella trichopoda]
 gb|ERN06295.1| hypothetical protein AMTR_s00016p00225040 [Amborella trichopoda]
Length=452

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/447 (61%), Positives = 345/447 (77%), Gaps = 6/447 (1%)
 Frame = +3

Query  276   YSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIIT  455
             YS+N+DDEYEKL+ RMNPPRV +DN +C NAT+++VDSAN HG LLEVVQVLTDLN+   
Sbjct  6     YSRNVDDEYEKLVIRMNPPRVTVDNTSCPNATLVKVDSANMHGVLLEVVQVLTDLNIRFN  65

Query  456   KAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDH  635
             +AYI SDGGWFMDVF+VT++ G+K+ DE V++ I +SLG  +   SS RRSVGV    +H
Sbjct  66    RAYISSDGGWFMDVFHVTDRYGNKLCDEEVINKIQQSLGAKTSSFSSQRRSVGVQPSPEH  125

Query  636   TSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPET  815
             TSIEL G DRPGLLSE+ AVL +LKCNVV AEVWTHN+R A+++ +TDE +G  + DP+ 
Sbjct  126   TSIELTGRDRPGLLSEIFAVLADLKCNVVAAEVWTHNSRMASVVYITDECSGSPIDDPQR  185

Query  816   LSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD--  989
             LS IK+LL N+L+G    R AKT ++ G THT+RRLHQ+MFADRDYER   + L   +  
Sbjct  186   LSRIKELLSNILRGDRDKRGAKTVVSMGLTHTERRLHQMMFADRDYERVERDGLEREEDK  245

Query  990   --RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEY  1163
               RP+V++ +  +RDYSVVT+R KDRPKLLFD +CTLTDM+YVV+HG V     EAYQEY
Sbjct  246   SLRPDVTLLDCFERDYSVVTMRSKDRPKLLFDTVCTLTDMQYVVYHGTVQTGRREAYQEY  305

Query  1164  CIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  1343
              IRH+DG PV S+AE+QRVI CLEAAIERR SEGL+LELCT DRVGLLS+VTRIFRENSL
Sbjct  306   YIRHVDGLPVSSEAEKQRVIQCLEAAIERRASEGLELELCTEDRVGLLSDVTRIFRENSL  365

Query  1344  TVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQ  1517
             T+TRAE+ T+ GKA++TFY+ D SG PVD + I+++RQ IGQ  L VK +     ++P  
Sbjct  366   TITRAEITTKSGKAIDTFYLTDVSGNPVDPKTIDAIRQEIGQANLHVKRDSLLPPKSPPH  425

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             E+    LF  IFK+++F NF L+RSYS
Sbjct  426   ETIASYLFSNIFKAKNFHNFRLIRSYS  452



>ref|XP_003562315.1| PREDICTED: uncharacterized protein LOC100840593 [Brachypodium 
distachyon]
Length=453

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/438 (63%), Positives = 340/438 (78%), Gaps = 8/438 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY+  IR+MNPP +V+DN++C +AT+++VDSAN++G LLEV+QVL DLNL+I+KAYI 
Sbjct  14    DDEYDNFIRKMNPPSIVVDNDSCNDATIVRVDSANEYGILLEVIQVLIDLNLVISKAYIT  73

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             SDGGWFMDVFN+T++EG K+ D+A L    DYI KSLG DS +  + RRSV V +  +H 
Sbjct  74    SDGGWFMDVFNITDKEGKKLKDKATLAQIEDYIRKSLGADSRYLPARRRSVDVAASANHN  133

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
              IEL G+DRPGLLSEVSAVL NLKCNVV+AE+WTHNTRAAA+MQVTD++TG AVTD E L
Sbjct  134   VIELTGTDRPGLLSEVSAVLANLKCNVVSAEIWTHNTRAAAVMQVTDQDTGLAVTDTERL  193

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGA--THTDRRLHQLMFADRDYERASDEALNHPDR  992
               IK+ L  +L+G N SR A   ++ G   THT+RRLHQ+M  D D E+    A N   R
Sbjct  194   ERIKERLSYLLRGGNLSRGAAMAVSSGTSTTHTERRLHQMMLDDGDCEQLQRHASNQSQR  253

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             PNV+V NW+D+DYSVVTIRCKDRPKLLFD +CTLTD+ YVVFH N+DA   +AYQE+ +R
Sbjct  254   PNVTVRNWNDKDYSVVTIRCKDRPKLLFDTVCTLTDLHYVVFHANIDANDNQAYQEFYVR  313

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H++GSP+ ++AER RV+ CLEAAIERRV EG+KLELCT D+VGLLS VTRIFRENSLTVT
Sbjct  314   HVNGSPMNTEAERLRVVQCLEAAIERRVWEGMKLELCTNDKVGLLSEVTRIFRENSLTVT  373

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESPT  1529
             RAEV+TRG  AVNTFYV  ++G  VD + I+S+RQ IG  I QVKG PE   P  +ESPT
Sbjct  374   RAEVSTRGRTAVNTFYVCGSAGEAVDQKTIDSIRQEIGHNI-QVKGQPEPSEPQKKESPT  432

Query  1530  RSLFGGIFKSRSFCNFGL  1583
               LF  +F+ RS  + G+
Sbjct  433   WFLFANLFRPRSLYSLGM  450



>gb|KDP41794.1| hypothetical protein JCGZ_26812 [Jatropha curcas]
Length=442

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/444 (64%), Positives = 345/444 (78%), Gaps = 9/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN+A ++ TVIQVDS NKHG LLEVVQVLTD+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDASEDITVIQVDSVNKHGILLEVVQVLTDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+KI+DE V+ YI + +  ++ +  SM  SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKIIDEEVISYIQRRIESNASYVPSMSGSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV AVLT+L CNVVNAE+WTHN RAAA++ VTD+ T  A+ DP+ LS+I
Sbjct  121   LTGPDRPGLLSEVCAVLTDLHCNVVNAEIWTHNARAAAVVNVTDDSTRCAIKDPKRLSII  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEALN-HPD---R  992
             ++LLCNVLKG+N  +  K  ++  G T  +RRLHQ+MFADRDYER     L  H D   R
Sbjct  181   RELLCNVLKGNNDLKAGKMTLSPPGITSRERRLHQIMFADRDYERVERGGLGRHEDKSSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+V N  ++DYSV+T+R KDRPKLLFD++CTLTDMEYVVFHG V     EAYQE+ IR
Sbjct  241   PHVTVLNI-EKDYSVITMRSKDRPKLLFDIVCTLTDMEYVVFHGMVSTGRMEAYQEFYIR  299

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ SDAER+RVI CLEAAIERR SEGL+LELC+ DRVGLLS++TRIFRENSL + 
Sbjct  300   HVDGLPISSDAERERVIQCLEAAIERRGSEGLELELCSEDRVGLLSDITRIFRENSLCIK  359

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQESP  1526
             RAE++T+GGK  +TFYV D +G PVD + I S+ Q IG+T LQVK N     + P QE+ 
Sbjct  360   RAEISTKGGKVKDTFYVTDVTGSPVDPKSINSICQQIGETKLQVKHNSTLSPKRP-QETT  418

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                LF  +FK+R+F NF L+RSYS
Sbjct  419   MGYLFSNLFKARTFSNFKLIRSYS  442



>ref|XP_008341281.1| PREDICTED: uncharacterized protein LOC103404170 [Malus domestica]
Length=450

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/445 (62%), Positives = 344/445 (77%), Gaps = 6/445 (1%)
 Frame = +3

Query  282   QNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKA  461
             + MDDEY K +RRMNPPRVVIDN++C++ATVIQVDS NKHG LL+VVQVLTD+NL ITKA
Sbjct  6     EKMDDEYAKFVRRMNPPRVVIDNDSCEDATVIQVDSVNKHGILLDVVQVLTDVNLTITKA  65

Query  462   YICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTS  641
             YI SDG WFMDVFNV +++G KI D+ +++ I   L  ++ F  SMR SVGV    +HTS
Sbjct  66    YISSDGVWFMDVFNVIDRDGKKIRDKDIINCIQMRLESNAGFVPSMRDSVGVMPSEEHTS  125

Query  642   IELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLS  821
             IEL G+DRPGLLSEV AVL +L CNVVNAE+WTHNTRAAA++ VTD+ TG A+ DP  L 
Sbjct  126   IELSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIEDPIRLX  185

Query  822   MIKKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEAL----NHP  986
              IK LLCNVLKG+N+ + AK T  T G T+ DRRLHQ+MFADRDYER     L    +  
Sbjct  186   AIKDLLCNVLKGNNELKPAKMTLATPGVTNRDRRLHQIMFADRDYERVERAELXRVEDKG  245

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +P+V+  +   +DY+V+T+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ 
Sbjct  246   SKPHVTALDCSQKDYTVITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRMEAYQEFY  305

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL 
Sbjct  306   IRHVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLC  365

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ-NPTQES  1523
             + RAE++T+ GKA +TFYV D +G PVD +II+S+R+ IGQTILQVK NP     P Q +
Sbjct  366   IKRAEISTKNGKAXDTFYVTDVTGSPVDPKIIDSIRRQIGQTILQVKCNPSPAPKPXQGT  425

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 LFG +FK+ SF +F LVRSYS
Sbjct  426   KMGYLFGNLFKAPSFQSFKLVRSYS  450



>ref|XP_010250632.1| PREDICTED: uncharacterized protein LOC104592825 [Nelumbo nucifera]
 ref|XP_010250633.1| PREDICTED: uncharacterized protein LOC104592825 [Nelumbo nucifera]
Length=439

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/444 (64%), Positives = 343/444 (77%), Gaps = 12/444 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN+AC++ATVIQ+DSAN+HG LLEVVQVLTDLNL ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDACEHATVIQIDSANEHGILLEVVQVLTDLNLTITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+  G+KI DE +++YI K+L  D+CF  S+R SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFNVTDHAGNKISDEGIINYIQKTLETDACFLPSLRGSVGVMPSNEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL NL+CNVVNAE+WTHN RAAA++ VTDE TG A+ D E LS +
Sbjct  121   LTGADRPGLLSEVCAVLKNLRCNVVNAEIWTHNARAAAVVHVTDEMTGCAIEDSERLSTV  180

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHPD-----  989
             K+LLCNVLKG+     AK  ++  G  HT+RRLHQ+MFA RDYER     +   D     
Sbjct  181   KELLCNVLKGNYDLNTAKMTLSSPGVMHTERRLHQMMFAVRDYERVGVTGMGRTDEDRSS  240

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             RP+V++++  ++DY+VVT+R KDRPKLLFD I TLTDM+YVVFHG V+    EAYQEY I
Sbjct  241   RPHVTISDCVEKDYTVVTMRSKDRPKLLFDTIFTLTDMQYVVFHGTVNTGRLEAYQEYYI  300

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DG P+ S+AERQRV  CLEAAIERR SEGL+LELCT DRVGLLS++TRIFRENSL +
Sbjct  301   RHVDGLPISSEAERQRVTQCLEAAIERRTSEGLELELCTEDRVGLLSDITRIFRENSLCI  360

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESP  1526
              RA+++T+ GKA +TFYV D SG PVD + IES+++ IGQ+IL+VK N      P QE+ 
Sbjct  361   KRAKISTKCGKAKDTFYVTDVSGNPVDLKTIESIQREIGQSILRVKQNLSFSPKPPQETA  420

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                L G  F++    NF L+RSYS
Sbjct  421   G-FLLGNFFRT----NFRLIRSYS  439



>ref|XP_010926807.1| PREDICTED: uncharacterized protein LOC105048981 [Elaeis guineensis]
Length=448

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/438 (63%), Positives = 340/438 (78%), Gaps = 2/438 (0%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIR+MNPPRV IDN+A  +ATVIQVDS NKHG LLEVVQVLTDLNLIITKAY+ 
Sbjct  11    DDEYAKLIRKMNPPRVFIDNDASDDATVIQVDSVNKHGILLEVVQVLTDLNLIITKAYVS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT++ G+K+ D+ +L+YI KSL  D+CF  S+R SVGVT   ++TSIEL
Sbjct  71    SDGNWFMDVFNVTDRNGNKLRDKEILNYIQKSLESDACFFPSLRSSVGVTPSNEYTSIEL  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSEV AVLT+LKCNVV A VWTHNTRAAA++ VTDE T  A+ DP+ LS IK
Sbjct  131   TGTDRPGLLSEVCAVLTDLKCNVVKAVVWTHNTRAAAVVHVTDESTRSAIEDPKRLSTIK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS-DEALNHPDRPNVSV  1007
             +LLCNVLK  N SR AK  ++ G THT+RRLHQ+MF DRDYERA   E  +   +P V+V
Sbjct  191   ELLCNVLKWDNDSRRAKMTVSMGGTHTERRLHQMMFDDRDYERAGLVEEDDKKSKPQVAV  250

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              +  ++DYS++ +R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IRHIDG 
Sbjct  251   MDCTEKDYSIIILRSKDRPKLLFDTLCTLTDMQYVVFHGTVKTGNSEAYQEYYIRHIDGH  310

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PV S+AER R+I CLEAAIERR S GL+LEL T DR+GLLS++TRIFREN L + RA+++
Sbjct  311   PVNSEAERHRLIQCLEAAIERRASGGLELELITEDRIGLLSDITRIFRENGLCIRRAQIS  370

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLFGG  1547
             T+GGKAV+TFYV + SG PVDA+ I+ +R+  GQ IL+VK +P    P++E+ T   F G
Sbjct  371   TKGGKAVDTFYVSEMSGSPVDAKTIDLIRRQTGQMILRVKQSPSPSKPSEETSTTGFFFG  430

Query  1548  IFKSR-SFCNFGLVRSYS  1598
              F    +F +F L+RSYS
Sbjct  431   NFFRGCTFHSFRLIRSYS  448



>ref|XP_002298641.1| hypothetical protein POPTR_0001s33460g [Populus trichocarpa]
 gb|EEE83446.1| hypothetical protein POPTR_0001s33460g [Populus trichocarpa]
Length=441

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 348/445 (78%), Gaps = 12/445 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MD+EY KLIRR+NPPRVVIDN+AC+ ATVIQVDS NKHG LL+VVQVLTD+NL+ITKAYI
Sbjct  1     MDEEYAKLIRRLNPPRVVIDNDACEEATVIQVDSVNKHGILLKVVQVLTDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYI--MKSLGPDSCFASSMRRSVGVTSGTDHTS  641
              SDG WFMDVFNV +Q+G KI D+ V+DYI  ++ L  ++ FA S+R SVGV    +HT+
Sbjct  61    SSDGDWFMDVFNVVDQDGKKIRDKEVMDYIQRVRRLESNASFAPSLRGSVGVMPSEEHTA  120

Query  642   IELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLS  821
             IEL G+DRPGLLSEV AVLT+L CNVVNAE+WTHNTRAAA++ VTD+ TG A+ DP+ LS
Sbjct  121   IELTGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIKDPKRLS  180

Query  822   MIKKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEAL----NHP  986
              I++LLCNVLKG++ S+ A T ++  G T  +RRLHQ+MFADRDYER     L    +  
Sbjct  181   TIRELLCNVLKGNDDSKTATTTLSPPGVTSRERRLHQIMFADRDYERVERAGLARFEDKS  240

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              RP+V+V N  +RDY+VV++R KDRPKLLFD++CTLTDMEYVVFHG V     EAYQE+ 
Sbjct  241   SRPHVTVLNI-ERDYTVVSMRSKDRPKLLFDIVCTLTDMEYVVFHGMVSTGRMEAYQEFY  299

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG PV SDAER+RV+ CLEAAIERR SEGL+LELCT DRVGLLS++TRIFRENSL 
Sbjct  300   IRHVDGLPVSSDAERERVVQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLC  359

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQES  1523
             + RAE+ T+GGKA +TFYV D +G PVD +II+S+ + IGQT L VK N      P QE+
Sbjct  360   IKRAEILTKGGKAKDTFYVTDVTGNPVDPKIIDSICRQIGQTKLLVKRNSILSPKPPQET  419

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 +FG +FK+R+   F L+RSYS
Sbjct  420   TMGYIFGNLFKART---FKLIRSYS  441



>ref|XP_008804075.1| PREDICTED: uncharacterized protein LOC103717456 [Phoenix dactylifera]
Length=448

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/438 (63%), Positives = 336/438 (77%), Gaps = 2/438 (0%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIR+MNPPRVVIDN+A  +ATVIQVDS NKHG LLEVVQVLTDLNLI+TKAY+ 
Sbjct  11    DDEYAKLIRKMNPPRVVIDNDASDDATVIQVDSVNKHGILLEVVQVLTDLNLIVTKAYVS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT++ G+K+ D+ +L+YI KSL  D+C   S+R SVGV    ++TSIEL
Sbjct  71    SDGNWFMDVFNVTDRNGNKLRDKEILNYIQKSLESDACILPSLRSSVGVKPSNEYTSIEL  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSEV AVLT+LKCNVV AE WTHNTRAAA++ VTDE T  A+ DP+ LS +K
Sbjct  131   TGTDRPGLLSEVCAVLTDLKCNVVKAEAWTHNTRAAAVVHVTDESTRSAIEDPKRLSTVK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS-DEALNHPDRPNVSV  1007
             +LL NVL     SR AK +++ G THT+RRLHQ+MF DRDYE     E  +   RP V+V
Sbjct  191   ELLFNVLTWDKDSRRAKMRVSMGGTHTERRLHQMMFDDRDYESVGLVEEGDKKSRPQVAV  250

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              +  ++DYS++ +R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IRHIDG 
Sbjct  251   MDCTEKDYSIIILRSKDRPKLLFDTLCTLTDMQYVVFHGTVKTGNSEAYQEYYIRHIDGH  310

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PV S+AER R+I CLEAAIERR SEGL+LEL T DR GLLS++TRIFREN L + RAE++
Sbjct  311   PVNSEAERHRLIQCLEAAIERRASEGLELELVTEDRSGLLSDITRIFRENGLCIRRAEIS  370

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRS-LFG  1544
             T+GGKAV+TF V + SG PVDA+II+S+R+  GQ IL+VK +P    P++E+ T   L  
Sbjct  371   TKGGKAVDTFSVSEMSGSPVDAKIIDSIRRQTGQMILRVKQSPLPSKPSEETSTTGFLLA  430

Query  1545  GIFKSRSFCNFGLVRSYS  1598
               FK  SF +F L+RSYS
Sbjct  431   NFFKGCSFHSFRLIRSYS  448



>ref|XP_009344226.1| PREDICTED: uncharacterized protein LOC103936115 [Pyrus x bretschneideri]
Length=443

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 344/443 (78%), Gaps = 6/443 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K +RRMNPPRVVIDN++C++ATVIQV S NKHG LL+VVQVLTD+NL ITKAYI
Sbjct  1     MDDEYAKFVRRMNPPRVVIDNDSCEDATVIQVGSVNKHGILLDVVQVLTDVNLTITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV + +G KI D+ +++ I   L  ++ F  SMR SVGV    +HTSIE
Sbjct  61    SSDGVWFMDVFNVIDHDGKKIRDKDIINCIQMRLESNAGFVPSMRHSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHNTRAAA++ VTD+ TG A+ DP  L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIEDPIRLATI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K LLCNVLKG+N+ + AK T  T G T+ DRRLHQ+MFADRDYER     L   +    +
Sbjct  181   KDLLCNVLKGNNELKPAKMTLATPGVTNRDRRLHQIMFADRDYERVERAELRRVEDKGSK  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+V +   +DY+V+T+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PHVTVLDCSQKDYTVITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRMEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL + 
Sbjct  301   HVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLCIK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ-NPTQESPT  1529
             RAE++T+ GKA++TFYV D +G PVD +II+S+R+ IGQTILQVK NP     P Q +  
Sbjct  361   RAEISTKNGKAIDTFYVTDVTGSPVDPKIIDSIRRQIGQTILQVKCNPSPAPKPPQGTKM  420

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               LFG +FK+ +F +F LVRSYS
Sbjct  421   GYLFGNLFKAPNFQSFKLVRSYS  443



>ref|XP_011009634.1| PREDICTED: uncharacterized protein LOC105114683 isoform X3 [Populus 
euphratica]
Length=372

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/335 (79%), Positives = 298/335 (89%), Gaps = 1/335 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDE EKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSNDMDDECEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+ +G+K+ DEA+LDYI KSLGP+SCF SSMR SVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFISSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLT+LKCNVVNAEVWTHN RAAA+MQVTDEETG A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             + DPE LS IK+LLCNVLKGSNKSR AKT ++HG THT+RRLHQ+MFADRDYERA+++ L
Sbjct  180   IIDPEKLSRIKELLCNVLKGSNKSRGAKTVVSHGVTHTERRLHQMMFADRDYERANNDEL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNVSV NW ++DYSVVTI  KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+Q
Sbjct  240   DEKQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSE  1262
             EY I+HIDGSPVKS+AERQR+I CLEAAIERRVSE
Sbjct  300   EYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSE  334



>ref|XP_011009626.1| PREDICTED: uncharacterized protein LOC105114683 isoform X2 [Populus 
euphratica]
Length=380

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/335 (79%), Positives = 298/335 (89%), Gaps = 1/335 (0%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             ME  +S+S +MDDE EKL RR+NPPRVVIDNEACKNATVI+VDSANKHG LLEVVQVLTD
Sbjct  1     MEVNMSFSNDMDDECEKLFRRLNPPRVVIDNEACKNATVIRVDSANKHGILLEVVQVLTD  60

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDGGWFMDVFNVT+ +G+K+ DEA+LDYI KSLGP+SCF SSMR SVGV
Sbjct  61    LNLIITKAYISSDGGWFMDVFNVTDPDGNKVTDEAILDYITKSLGPESCFISSMR-SVGV  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
                 DHT+IEL GSDRPGLLSEVSAVLT+LKCNVVNAEVWTHN RAAA+MQVTDEETG A
Sbjct  120   KQSMDHTAIELTGSDRPGLLSEVSAVLTHLKCNVVNAEVWTHNMRAAAVMQVTDEETGSA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL  977
             + DPE LS IK+LLCNVLKGSNKSR AKT ++HG THT+RRLHQ+MFADRDYERA+++ L
Sbjct  180   IIDPEKLSRIKELLCNVLKGSNKSRGAKTVVSHGVTHTERRLHQMMFADRDYERANNDEL  239

Query  978   NHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
             +   RPNVSV NW ++DYSVVTI  KDRPKLLFD +CTLTDMEYVVFH N+DAEGPEA+Q
Sbjct  240   DEKQRPNVSVVNWCEKDYSVVTITSKDRPKLLFDTVCTLTDMEYVVFHANIDAEGPEAHQ  299

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSE  1262
             EY I+HIDGSPVKS+AERQR+I CLEAAIERRVSE
Sbjct  300   EYYIKHIDGSPVKSEAERQRIIQCLEAAIERRVSE  334



>ref|XP_007215389.1| hypothetical protein PRUPE_ppa005796mg [Prunus persica]
 gb|EMJ16588.1| hypothetical protein PRUPE_ppa005796mg [Prunus persica]
Length=443

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/444 (62%), Positives = 344/444 (77%), Gaps = 8/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K +RRMNPPRVVIDN+ C++ATVIQVDS NKHG LL+VVQVL ++NLIITKAYI
Sbjct  1     MDDEYSKFVRRMNPPRVVIDNDTCEDATVIQVDSVNKHGILLDVVQVLAEVNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +Q G KI D  +++YI   L  ++ F  SMR SVGV    +HTSIE
Sbjct  61    SSDGVWFMDVFNVIDQNGKKIRDRDIINYIQMRLESNASFVPSMRDSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ D   L+ I
Sbjct  121   LSGTDRPGLLSEMCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDLNRLTTI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K+LLCNVL+G+++ + AK T  T G T+ DRRLHQLMFADRDYE+     L   +    R
Sbjct  181   KELLCNVLRGNSELKAAKMTLATPGVTNRDRRLHQLMFADRDYEKVERAELQRIEDKGSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+  +   +DY+VVT+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PHVTALDCSQKDYTVVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRMEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL + 
Sbjct  301   HVDGLPISSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLCIK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN--PEEQNPTQESP  1526
             RAE++T+GGKA++TFYV D +G  VD +II+SVR+ IGQTILQV+ N  P  + P Q + 
Sbjct  361   RAEISTKGGKAIDTFYVTDVTGNTVDPKIIDSVRRQIGQTILQVRRNSSPPPKAP-QGTT  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                LFG +FK+RSF NF L+RSYS
Sbjct  420   MGYLFGNLFKARSFQNFKLIRSYS  443



>ref|XP_009377996.1| PREDICTED: uncharacterized protein LOC103966550 [Pyrus x bretschneideri]
Length=443

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 344/443 (78%), Gaps = 6/443 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K +RRMNPPRVVIDN++C++ATVIQV S NKHG LL+VVQVLTD+NL ITKAYI
Sbjct  1     MDDEYAKFVRRMNPPRVVIDNDSCEDATVIQVGSVNKHGILLDVVQVLTDVNLTITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +++G KI D+ +++ I   L  ++ F  SMR SVGV    +HTSIE
Sbjct  61    SSDGVWFMDVFNVIDRDGKKIRDKDIINCIQMRLESNAGFVPSMRHSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHNTRAAA++ VTD+ TG A+ DP  L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNTRAAAVVHVTDDSTGCAIEDPIRLASI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K LLCNVLKG+N+ + AK T  T G T+ DRRLHQ+MFADRDYER     L   +    +
Sbjct  181   KDLLCNVLKGNNELKPAKMTLATPGVTNRDRRLHQIMFADRDYERVERAELRRVEDKGSK  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+  +   +DY+V+T+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PHVTALDCSQKDYTVITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRMEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL + 
Sbjct  301   HVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLCIK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ-NPTQESPT  1529
             RAE++T+ GKA++TFYV D +G PVD +II+S+R+ IGQTILQVK NP     P Q +  
Sbjct  361   RAEISTKNGKAIDTFYVTDVTGSPVDPKIIDSIRRQIGQTILQVKCNPSPAPKPPQGTKM  420

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               LFG +FK+ +F +F LVRSYS
Sbjct  421   GYLFGNLFKAPTFQSFKLVRSYS  443



>ref|XP_008379088.1| PREDICTED: uncharacterized protein LOC103442112 [Malus domestica]
Length=443

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 342/443 (77%), Gaps = 6/443 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K +RRMNPPRVVIDN+ C++ATVIQVDS NKHG LL+VVQVL D+NL+ITKAYI
Sbjct  1     MDDEYAKFVRRMNPPRVVIDNDYCEDATVIQVDSVNKHGILLDVVQVLADVNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV ++EG KI D+ +++YI   L  +  F  SMR SVG+    ++TSIE
Sbjct  61    SSDGVWFMDVFNVIDREGKKIRDKDIINYIQMRLESNGGFVPSMRDSVGMMPSEEYTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIEDPIRLATI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K+LLCNVLK +++ + AK T  T G T+ DRRLHQ+MFADRDYER     L   +    +
Sbjct  181   KELLCNVLKVNSELKAAKMTLATPGVTNRDRRLHQIMFADRDYERVERAELRRVEDKGSK  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+  +   +DY+V+T+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PHVTALDCSQKDYTVITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRTEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL VT
Sbjct  301   HVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLRVT  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ-NPTQESPT  1529
             RAE++T+ GKA++TFYV D +G PVD +II+SVR+ IGQTILQVK N      P Q +  
Sbjct  361   RAEISTKSGKAIDTFYVTDVTGSPVDPKIIDSVRRQIGQTILQVKCNSSPAPKPPQGTTM  420

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               LFG +FK+RSF    LVRSYS
Sbjct  421   GYLFGNLFKARSFQPLKLVRSYS  443



>ref|XP_007031924.1| ACT domain repeat 6 [Theobroma cacao]
 gb|EOY02850.1| ACT domain repeat 6 [Theobroma cacao]
Length=443

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/444 (62%), Positives = 343/444 (77%), Gaps = 8/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRR+N PRVVIDN + ++ATVIQVDS N+HG LLEVVQVLTD+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRVNQPRVVIDNNSSEDATVIQVDSVNRHGILLEVVQVLTDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV + +G+KI D+ V+DYI + +   + F  S R SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFNVVDNDGNKIGDKEVIDYIQRRIETSAGFVPSRRGSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP+ LS I
Sbjct  121   LAGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAINDPKRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             K+LL NVLKGS++ + AKT ++  G  H +RRLHQ+MFADRDYER     +    +   R
Sbjct  181   KELLYNVLKGSDELKTAKTMLSAPGVMHRERRLHQIMFADRDYERVERAGVRAVEDGSSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P VS+ N  ++DY+V+T+R KDRPKLLFD++CTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PQVSLLNI-EKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRMEAYQEFYIR  299

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER RVI CLEAAIERR SEGL LELCT DR+GLLS++TRIFRENSL + 
Sbjct  300   HVDGLPISSEAERVRVIQCLEAAIERRASEGLMLELCTEDRLGLLSDITRIFRENSLCIK  359

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE--EQNPTQESP  1526
             RA ++T+GGKA +TFYV D +G PVD +II+S+R+ IGQ+ LQVK N     + P QE+ 
Sbjct  360   RALISTKGGKAKDTFYVTDVTGNPVDPKIIDSIRRQIGQSALQVKHNSNLTPKPPHQETT  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                 FG +FK+R+F NF LVRSYS
Sbjct  420   MGYFFGNLFKARTFQNFKLVRSYS  443



>ref|XP_009346780.1| PREDICTED: uncharacterized protein LOC103938500 [Pyrus x bretschneideri]
Length=443

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/443 (62%), Positives = 344/443 (78%), Gaps = 6/443 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K +RRMNPPRVVIDN++C++ATVIQVDS NKHG LL+VVQVL D+NL+ITKAYI
Sbjct  1     MDDEYAKFVRRMNPPRVVIDNDSCEDATVIQVDSVNKHGILLDVVQVLADVNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +++G KI D+ +++YI   L  +  F  SMR SVG+    ++TSIE
Sbjct  61    SSDGVWFMDVFNVIDRDGKKIRDKDIINYIQMRLESNGGFVPSMRDSVGMMPSEEYTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIEDPIRLATI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             K+LLCNVLK +++ + AK T  T G T+ DRRLHQ+MFADRDYER     L    +   +
Sbjct  181   KELLCNVLKVNSELKAAKMTLATPGVTNRDRRLHQIMFADRDYERVERAELWRVEDKGSK  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+  +   +DY+++T+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PHVTALDCSQKDYTIITMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRTEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL VT
Sbjct  301   HVDGLPINSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLRVT  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPT  1529
             RAE++T+ GKA++TFYV D +G PVD +II+SVR+ IGQTILQVK N      P Q +  
Sbjct  361   RAEISTKNGKAIDTFYVTDVTGSPVDPKIIDSVRRQIGQTILQVKCNSSPPPKPPQGTTM  420

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               LFG +FK+RSF +  LVRSYS
Sbjct  421   GYLFGNLFKARSFQSLKLVRSYS  443



>ref|XP_008441313.1| PREDICTED: uncharacterized protein LOC103485467 [Cucumis melo]
Length=442

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/442 (62%), Positives = 337/442 (76%), Gaps = 5/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MD+EY+KLIRR+NPPRVVIDN ACK+ATVIQVDS NKHG LL+VVQVL D+NLIITKAYI
Sbjct  1     MDNEYDKLIRRLNPPRVVIDNNACKDATVIQVDSMNKHGILLKVVQVLMDMNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV   EG+KI D+ V++ I   L  D+ F  S+R SVGV    DHTSIE
Sbjct  61    SSDGGWFMDVFNVITYEGNKIRDQEVINAIQMRLEVDASFVPSLRESVGVMPSEDHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNA+VWTHN RAAA++ VTD+ TG A+ DP+ L  I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNADVWTHNNRAAAVVHVTDDATGRAINDPQRLLTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEALNHPD---RP  995
             K+LLCNVL+G+ + + AK  ++  G T TDRRLHQ+M ADRDYERA    L   D   RP
Sbjct  181   KELLCNVLRGNGELKEAKMTLSPPGVTSTDRRLHQIMLADRDYERAVKTKLEVEDKNLRP  240

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
             +V+V +  ++DY+V+T R +DRPKLLFDV+CTLTDMEYVVFHG V+    EAY E+ IRH
Sbjct  241   HVTVLDCSEKDYTVITTRSRDRPKLLFDVLCTLTDMEYVVFHGMVNTGRVEAYLEFYIRH  300

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
              DG P+ S+AER RV+HCLEAAIERR SEGLKLELC  DRVGLLS++TRIFRENSL + R
Sbjct  301   KDGLPISSEAERDRVLHCLEAAIERRESEGLKLELCAEDRVGLLSDITRIFRENSLCIRR  360

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQESPTR  1532
             AE+AT+ GKA + FYV D +G  +D ++IES+R+ IG  +LQVK N    + P +E+   
Sbjct  361   AEIATKRGKAKDIFYVTDMTGTTIDTKVIESIRKQIGDAMLQVKHNSCLSETPPKETTAG  420

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
                G  FK+R+F NF L+RSYS
Sbjct  421   FFLGYFFKARTFQNFKLIRSYS  442



>ref|XP_008796580.1| PREDICTED: uncharacterized protein LOC103711996 [Phoenix dactylifera]
Length=449

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/451 (62%), Positives = 344/451 (76%), Gaps = 6/451 (1%)
 Frame = +3

Query  258   MEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTD  437
             M ++V+   + DDEY KLIRRMNPPRVVIDN+AC NATVI+V S NKHG LLEVVQVLTD
Sbjct  1     MRSSVALEMD-DDEYAKLIRRMNPPRVVIDNDACDNATVIRVHSVNKHGFLLEVVQVLTD  59

Query  438   LNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGV  617
             LNLIITKAYI SDG WFM+VFNVT+++G+KI D+ ++  I  S+  D+CF  ++R SVG+
Sbjct  60    LNLIITKAYISSDGSWFMEVFNVTDRDGNKIRDKEIISCIQTSVESDACFFPALRNSVGI  119

Query  618   TSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGA  797
              S  ++TSIEL G+DRPGLLSE+ AVL +L CNVV AEVWTHNTRAAA++ V DE T GA
Sbjct  120   MSSAENTSIELTGTDRPGLLSEIFAVLADLNCNVVKAEVWTHNTRAAAVVHVADESTRGA  179

Query  798   VTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGA-THTDRRLHQLMFADRDYER--ASD  968
             + DP+ LS IKK L NVLKG N SR AK  ++  A THT+RRLHQ+MF DRDYER   + 
Sbjct  180   IEDPQRLSTIKKFLFNVLKGDNTSRTAKMIVSTAALTHTERRLHQMMFDDRDYERLDMTG  239

Query  969   EALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE  1148
             E  +   RP V++ +  ++DY+ V +R KDRPKLLFD +CTLTDM+YVVFHG V     E
Sbjct  240   EG-DDKSRPRVAIMDCSEKDYTTVILRSKDRPKLLFDTVCTLTDMQYVVFHGTVHTGSSE  298

Query  1149  AYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIF  1328
             AYQEY IRH+DG P+ S+AERQRVI CLEAAIERR SEGL+LEL T DRVGLLS++TRIF
Sbjct  299   AYQEYYIRHVDGLPISSEAERQRVIQCLEAAIERRASEGLELELRTEDRVGLLSDITRIF  358

Query  1329  RENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN  1508
             REN L + RA ++T GGKAV+TFY+ + SG PV+A+ I+S+R  IGQTIL+VK NP    
Sbjct  359   RENGLCIRRAGISTIGGKAVDTFYLSEMSGNPVEAKTIDSLRNQIGQTILKVKQNPLPPT  418

Query  1509  PTQESPTRS-LFGGIFKSRSFCNFGLVRSYS  1598
             P + + T   LFG  FK+ SF +F L+RS S
Sbjct  419   PPEAASTTGFLFGNFFKACSFQSFRLIRSSS  449



>ref|XP_003622132.1| Amino acid binding protein, putative [Medicago truncatula]
Length=475

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/475 (58%), Positives = 344/475 (72%), Gaps = 38/475 (8%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN AC+NATVIQVDS NKHG LL+VVQV++D+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNACENATVIQVDSVNKHGILLDVVQVISDMNLVIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMK----------------------------  563
              SDG WFMDVFNVT++ G+KI D+ V+DYI +                            
Sbjct  61    SSDGVWFMDVFNVTDRNGNKIKDKEVIDYIQRVGSCLFAISRMLQLTLIYVARSLWKGDF  120

Query  564   -----SLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNA  728
                   L  +  F +SMR SVGV    +HT IEL G+DRPGLLSE+ AVL +L+CNVV A
Sbjct  121   TVLYHRLEKNPSFETSMRESVGVVPTEEHTVIELTGTDRPGLLSEICAVLADLRCNVVTA  180

Query  729   EVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITH-GAT  905
             E+WTHNTRAAA++ VTD+ +G A+ DP  LS I+ LLCNVL+GS+  + AKT ++H G T
Sbjct  181   EIWTHNTRAAAVVHVTDDSSGCAIEDPSRLSTIRDLLCNVLRGSDDPKTAKTALSHPGVT  240

Query  906   HTDRRLHQLMFADRDYERASDEALNHPDR---PNVSVTNWHDRDYSVVTIRCKDRPKLLF  1076
             + DRRLHQ+MFADRDYER     L   D+   P+V+V++  +RDY+VV +R KDRPKLLF
Sbjct  241   YRDRRLHQIMFADRDYERVERAGLRERDKGPFPHVTVSDCTERDYTVVIMRAKDRPKLLF  300

Query  1077  DVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRV  1256
             D++CTLTDM+YVVFHG V  E   AYQE+ IRH+DG P+ S+AER+R+I CLEAAIERR 
Sbjct  301   DIVCTLTDMQYVVFHGVVQTERTGAYQEFYIRHVDGFPISSEAERERLIQCLEAAIERRA  360

Query  1257  SEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDAR  1436
             SEG++LELCT DRVGLLS++TRIFRENSL + RAE++T  GKA +TFYV D +G PVD +
Sbjct  361   SEGMELELCTEDRVGLLSDITRIFRENSLCIKRAEISTENGKAKDTFYVTDVTGNPVDPK  420

Query  1437  IIESVRQTIGQTILQVKGNPE-EQNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              I+S+R+ IG T+LQVK N      P Q +    LFG  FK+RSF NF L+RSYS
Sbjct  421   SIDSIRRQIGDTVLQVKHNSSLSPKPPQGTTIGFLFGSFFKARSFQNFKLIRSYS  475



>ref|XP_008231089.1| PREDICTED: uncharacterized protein LOC103330312 isoform X1 [Prunus 
mume]
Length=465

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/466 (60%), Positives = 346/466 (74%), Gaps = 30/466 (6%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             M+DEY K +RRMNPPRVVIDN+ C++ATVIQVDS NKHG LL+VVQVL ++NLIITKAYI
Sbjct  1     MEDEYSKFVRRMNPPRVVIDNDTCEDATVIQVDSVNKHGILLDVVQVLAEVNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +Q G KI D+ +++YI   L  ++ F  SMR SVGV    +HTSIE
Sbjct  61    SSDGVWFMDVFNVIDQNGKKIRDQDIINYIQMRLESNAGFVPSMRDSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDPNRLATI  180

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K+LLCNVL+G+++ + AK T  T G T+ DRRLHQLMFADRDYE+     L   +    R
Sbjct  181   KELLCNVLRGNSELKAAKMTLATPGVTNRDRRLHQLMFADRDYEKVERAELQRIEDKGSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ-----  1157
             P+V+  +   +DY+VVT+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQ     
Sbjct  241   PHVTALDCSQKDYTVVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRMEAYQQSAAG  300

Query  1158  -----------------EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCT  1286
                              E+ IRH+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT
Sbjct  301   FDELMTTLNLMLTSLYREFYIRHVDGLPISSEAERERVVQCLEAAIERRASEGLELQLCT  360

Query  1287  TDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIG  1466
              DRVGLLS++TRIFRENSL V RAE++T+GGKA++TFYV D +G  VD +II+SVR+ IG
Sbjct  361   DDRVGLLSDITRIFRENSLCVKRAEISTKGGKAIDTFYVTDVTGNTVDPKIIDSVRRQIG  420

Query  1467  QTILQVKGN--PEEQNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QTILQVK N  P  + P Q +    LFG +FK+RSF NF L+RSYS
Sbjct  421   QTILQVKLNSSPPPKAP-QGTTMGYLFGNLFKARSFQNFKLIRSYS  465



>ref|XP_010929569.1| PREDICTED: uncharacterized protein LOC105051016 isoform X1 [Elaeis 
guineensis]
Length=449

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 337/440 (77%), Gaps = 5/440 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY +LIRRMNPPRVVIDN +C NATVI+V S NKHG LLEVVQVLTDLNLIITKAYI 
Sbjct  11    DDEYAQLIRRMNPPRVVIDNGSCDNATVIRVHSFNKHGILLEVVQVLTDLNLIITKAYIS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT+++G+K+ D+ ++ YI  SL  D+CF  ++R SVGV    DHTSIEL
Sbjct  71    SDGSWFMDVFNVTDRDGNKVWDKEIISYIQTSLESDACFFPTLRNSVGVMPSKDHTSIEL  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSE+ AVLT+L CNVV AEVWTHNTRAAA++ VTD+ T  A+ DP  LS IK
Sbjct  131   TGTDRPGLLSEICAVLTDLNCNVVKAEVWTHNTRAAAVVHVTDKSTRDAIEDPLRLSTIK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYER--ASDEALNHPDRPNVS  1004
             +LLCNVLKG+N SR AK  ++ G THT+RRLHQ+MF DRDYER   S E  +   RP V+
Sbjct  191   ELLCNVLKGNNTSRTAKMTVSAGLTHTERRLHQMMFDDRDYERIDMSWEG-DEKSRPQVA  249

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
               +  ++DY++V +R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IRH+DG
Sbjct  250   TMDCSEKDYTIVILRSKDRPKLLFDTVCTLTDMQYVVFHGTVHTGSAEAYQEYYIRHVDG  309

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
              P+ S+AERQRVI CLEAAIERR SEGL+LEL T DRVGLLS++TRIFREN L + RA++
Sbjct  310   LPISSEAERQRVIQCLEAAIERRASEGLELELRTEDRVGLLSDITRIFRENGLRIRRADI  369

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQE--SPTRSL  1538
             +T  GKAV+TF + + SG PV+A+ I+S+R+ IG T L+VK NP       E  S T SL
Sbjct  370   STIRGKAVDTFCLSEMSGNPVEAKTIDSLRRQIGPTSLKVKQNPLPPPKPPEAASTTGSL  429

Query  1539  FGGIFKSRSFCNFGLVRSYS  1598
              G  FK  SF +F L+RSYS
Sbjct  430   LGNFFKVCSFQSFRLIRSYS  449



>ref|XP_010249097.1| PREDICTED: uncharacterized protein LOC104591778 [Nelumbo nucifera]
Length=443

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/447 (62%), Positives = 348/447 (78%), Gaps = 14/447 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K IRRMNPPRVVIDN+AC++ATVI+VDS NKHG LL+VVQ LTDLNLIITKAY+
Sbjct  1     MDDEYAKFIRRMNPPRVVIDNDACEHATVIKVDSVNKHGVLLDVVQALTDLNLIITKAYM  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVT-SGTDHTSI  644
              SDGGWFMDVFNVT+  G+KI DE +L+YI K+L  D+CF  S+R SVGV  S  +HTSI
Sbjct  61    SSDGGWFMDVFNVTDYGGNKIRDERILNYIQKTLETDACFLPSLRDSVGVMPSSKEHTSI  120

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVT-DPETLS  821
             EL+G++RPGLLSE+ AVLT+L+CNVVNAE+WTHN RAAA++ VTDE TG  +  D E LS
Sbjct  121   ELMGTERPGLLSELCAVLTDLRCNVVNAEIWTHNERAAAVVHVTDESTGSPIEEDSERLS  180

Query  822   MIKKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHP----  986
              IK+LLC +LKG+N  R AK  ++  G  HT+RRLHQ+MFADRDYER   + +       
Sbjct  181   KIKQLLCYLLKGNNGLRTAKMALSPPGLIHTERRLHQMMFADRDYERVEGKGMTRAKDWS  240

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              RP+V+V +  ++DY+V+T+R KDRPKLLFD ICTLTDM+YVVFHG V+    EAYQEY 
Sbjct  241   SRPDVTVLDCIEKDYTVITMRSKDRPKLLFDTICTLTDMQYVVFHGTVNTARMEAYQEYY  300

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P++S+AE+QR+  CLEAAIERR SEG++LELCT DRVGLLS++TRIFRENSL 
Sbjct  301   IRHVDGFPIRSEAEQQRLRQCLEAAIERRSSEGVELELCTEDRVGLLSDITRIFRENSLY  360

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             + RA+++T+GGKA +TFYV DASG PVD + I+S+ + IGQTILQVK +    +P     
Sbjct  361   IKRAKISTKGGKAKDTFYVTDASGDPVDPKAIDSICRQIGQTILQVKQSWRSFSPKPPKE  420

Query  1527  TRS---LFGGIFKSRSFCNFGLVRSYS  1598
             TR+   L G +FK+    NF L+RS S
Sbjct  421   TRTAGFLLGNLFKT----NFRLIRSCS  443



>ref|XP_010250636.1| PREDICTED: uncharacterized protein LOC104592829 [Nelumbo nucifera]
Length=450

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/447 (61%), Positives = 345/447 (77%), Gaps = 10/447 (2%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S ++DDE+EKL+ RMNPPRV +DN   + AT+I+VDSANKHG+LLEVVQVLTD+NL I +
Sbjct  7     SVDVDDEFEKLLIRMNPPRVTVDNTTSRKATLIKVDSANKHGSLLEVVQVLTDMNLTIIR  66

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             AYI SDG WFMDVF+V +Q+G+K+ DE V+D I +SLG  +    S+RRSVGV +  +HT
Sbjct  67    AYISSDGEWFMDVFHVVDQDGNKLFDEKVIDRIQQSLGSRAQSLRSLRRSVGVQAAAEHT  126

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
             +IEL G DRPGLLSE+ AVLT+LKCNVV AEVWTHN+R A+++ +TDE TG  + DP+ L
Sbjct  127   TIELTGRDRPGLLSEIFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGSPIDDPDRL  186

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP----  986
             + IK+LL  VLKG    R A T ++ G THT+RRLHQ+M+ADRDY+R  ++  N P    
Sbjct  187   ARIKQLLLYVLKGDRDMRTANTAVSVGTTHTERRLHQMMYADRDYDR--EDMGNSPAIDR  244

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +P V+V N  D+ Y+VV +RC+DRPKLLFD++CTLTDM+YVVFHG V  EG EAYQEY 
Sbjct  245   SKPCVTVENCADKGYTVVNLRCRDRPKLLFDIVCTLTDMQYVVFHGTVGTEGLEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P++S+AERQR++HCLEAA++RR +EG++LELC  DR+GLLS+VTRIFREN L+
Sbjct  305   IRHKDGYPIRSEAERQRLVHCLEAAVQRRSTEGIRLELCIEDRIGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN+FYV D+SG PV +  IESVR  IGQT+L+VK N    +P QES 
Sbjct  365   VTRAEVTTRGSQAVNSFYVTDSSGNPVKSETIESVRSEIGQTVLRVKDNIYTNSPPQESG  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +F+SRS     N GL+RS S
Sbjct  425   RFSL-GNLFRSRSEKFLYNLGLIRSCS  450



>ref|XP_003553951.1| PREDICTED: uncharacterized protein LOC100801859 [Glycine max]
Length=445

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/445 (61%), Positives = 341/445 (77%), Gaps = 8/445 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN AC+NATVIQVDS NKHG LL+VVQV++D+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNACENATVIQVDSVNKHGILLDVVQVISDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV + +G+KI D+ V+DYI + L  +  F  S+R SVGV    +HT IE
Sbjct  61    SSDGVWFMDVFNVIDHKGNKIRDKEVIDYIQRRLENNPSFVPSLRESVGVVPTEEHTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L CNVV AE+WTHNTRAAA++ VTD+ +G A+ DP  LS I
Sbjct  121   LTGTDRPGLLSEICAVLTDLHCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIKDPSRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY---ERASDEALNHPDR-  992
             + LL NVL+GSN  + A+T ++ HG T+ DRRLHQ+MFADRDY   ERA  E L   D+ 
Sbjct  181   RDLLSNVLRGSNDPKTARTTLSPHGVTNRDRRLHQIMFADRDYERIERAGQEELRDRDKR  240

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P+V+V +  ++DY+VVT+R +DRPKLLFD++CTLTDM+YVVFHG V     EA+QE+ 
Sbjct  241   PLPHVTVGDCVEKDYTVVTMRAQDRPKLLFDIVCTLTDMQYVVFHGVVKTLRMEAFQEFY  300

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+R++ CLEAAIERR SEG+ LELCT DRVGLLS++TR FRENSL 
Sbjct  301   IRHVDGFPISSEAERERLMQCLEAAIERRASEGMGLELCTEDRVGLLSDITRTFRENSLC  360

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQES  1523
             + RAE++T  GKA +TFYV D +G PVD +II+S+R+ IG  +L+VK N      P Q +
Sbjct  361   IKRAEISTEEGKARDTFYVTDVTGNPVDPKIIDSIRRQIGDKVLKVKHNSNLSPKPPQPT  420

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 L G  FK+RSF NF L++SYS
Sbjct  421   TIGFLLGNFFKARSFQNFKLIKSYS  445



>ref|XP_004304532.1| PREDICTED: uncharacterized protein LOC101293911 [Fragaria vesca 
subsp. vesca]
Length=443

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/445 (61%), Positives = 347/445 (78%), Gaps = 10/445 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY K +RRMNPPRVVIDN++C++AT+IQVDS NKHG+LL+VVQVL D+NL+ITKAYI
Sbjct  1     MDDEYTKFVRRMNPPRVVIDNDSCEDATIIQVDSVNKHGSLLDVVQVLADVNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV +++G KI D+ +++YI   L  ++ F  S   SVGVT   +HT IE
Sbjct  61    SSDGVWFMDVFNVIDRDGKKIRDKDIINYIQIRLESNASFVPSTD-SVGVTPSEEHTLIE  119

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DR GLLSEV AVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  L+ I
Sbjct  120   LSGTDRTGLLSEVCAVLADLHCNVVNAEIWTHNARAAAVVHVTDDTTGCAIKDPNRLASI  179

Query  828   KKLLCNVLKGSNKSRHAK-TQITHGATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             K+LLCNVL+G+N+S+ AK T  T G T+ DRRLHQ+MFADRDYER     L    +   R
Sbjct  180   KELLCNVLRGNNESKAAKMTLATSGVTNRDRRLHQIMFADRDYERVGRAELRRVEDKGSR  239

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P V+  +   + Y+V+T++ KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  240   PQVTAFDCSQKYYTVITMKAKDRPKLLFDIICTLTDMQYVVFHGMVNTGMTEAYQEFYIR  299

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV+ CLEAAIERR SEGL+L+LCT DRVGLLS++TRIFRENSL++ 
Sbjct  300   HVDGVPISSEAERERVVQCLEAAIERRASEGLELQLCTDDRVGLLSDITRIFRENSLSIK  359

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN---PEEQNPTQES  1523
             RAE++T+GGKA++TFYV D +G PVD ++I+S+R+ IGQTILQVK N   P  ++P + +
Sbjct  360   RAEISTKGGKALDTFYVTDVTGNPVDPKMIDSIRREIGQTILQVKCNSTPPPSKSP-EGT  418

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 LFG +FK+R+F N  L+RSYS
Sbjct  419   KMGYLFGNLFKARNFQNLKLIRSYS  443



>ref|XP_003549097.1| PREDICTED: uncharacterized protein LOC100818506 isoform X1 [Glycine 
max]
 gb|KHN28280.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=445

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/445 (61%), Positives = 341/445 (77%), Gaps = 8/445 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN AC+NATVIQVDS NKHG LL+VVQV++D+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNACENATVIQVDSVNKHGILLDVVQVISDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SD  WFMDVFNV +  G+KI D+ V+DYI + L  +  FA S+R SVGV    +HT IE
Sbjct  61    SSDAVWFMDVFNVIDHNGNKIRDKEVIDYIQRRLENNPSFAPSLRESVGVVPTEEHTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L CNVV AE+WTHNTRAAA++ VTD+ +G A+ DP  LS I
Sbjct  121   LTGTDRPGLLSEICAVLTDLHCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIKDPSRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY---ERASDEALNHPDR-  992
             + LL NVL+GSN  + A+T ++  G T+ DRRLHQ+MFADRDY   ERA    L   D+ 
Sbjct  181   RDLLSNVLRGSNDPKTARTTLSPPGVTNRDRRLHQIMFADRDYERIERAGRGGLRDRDKR  240

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P+V+V +  ++DY+VVT+R +DRPKLLFD++CTLTDM+YVVFHG V     EA+QE+ 
Sbjct  241   PLPHVTVVDCVEKDYTVVTMRAQDRPKLLFDIVCTLTDMQYVVFHGVVKTLRTEAFQEFY  300

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+R++ CLEAAIERR SEG++LELCT DRVGLLS++TRIFRENSL 
Sbjct  301   IRHVDGFPISSEAERERLVQCLEAAIERRASEGMELELCTEDRVGLLSDITRIFRENSLC  360

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQES  1523
             + RAE++T  GKA +TFYV D +G PVD +II+S+R+ IG  +L+VK N      P+Q +
Sbjct  361   IKRAEISTEEGKARDTFYVTDVTGNPVDPKIIDSIRRQIGDKVLKVKHNSNLSPKPSQPT  420

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 L G  FK+RSF NF L+RSYS
Sbjct  421   TIGFLLGNFFKARSFQNFKLIRSYS  445



>ref|XP_006447023.1| hypothetical protein CICLE_v10015110mg [Citrus clementina]
 ref|XP_006470099.1| PREDICTED: uncharacterized protein LOC102618393 isoform X2 [Citrus 
sinensis]
 gb|ESR60263.1| hypothetical protein CICLE_v10015110mg [Citrus clementina]
Length=441

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/442 (62%), Positives = 335/442 (76%), Gaps = 6/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN  C +ATVI+VDS NKHG LL+V+QVL D+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNTCADATVIKVDSVNKHGILLQVIQVLNDVNLVIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV + +G KI D+ V+DYI + L  D+ FA S+R SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFNVIDCDGKKIRDKEVIDYIQQRLETDASFAPSLRSSVGVMPTEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
               G+DRPGL SEV AVL +L CNVVNAE+WTHN RAAA++ VTD  TG A+ DP+ LS I
Sbjct  121   FTGTDRPGLFSEVCAVLADLHCNVVNAEIWTHNDRAAAVVHVTDHSTGCAIKDPKRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYER---ASDEALNHPDRP  995
             K+LL NVL+G +  R AKT ++  G  + +RRLHQ+MF DRDYER   A     +   RP
Sbjct  181   KELLFNVLRGYDDFRKAKTSLSPPGIMNRERRLHQIMFDDRDYERVEKAVGRVEDKSSRP  240

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
              V+V N  ++DY+V+T+R KDRPKLLFD++CTLTDM+YVVFHG V+    EAYQE+ IRH
Sbjct  241   QVTVLNI-EKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRTEAYQEFYIRH  299

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             +DG P+ S+AER+RVI CLEAAIERR SEGL+LELCT DRVGLLS++TRIFRENSL++ R
Sbjct  300   VDGLPISSEAERERVIQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLSIKR  359

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQESPTR  1532
             AE++T GGK  +TFYV D +G PVD +II+S+R+ IG T LQVK N      P +E+ T 
Sbjct  360   AEISTIGGKVKDTFYVTDVTGNPVDPKIIDSIRRQIGHTKLQVKHNTILAPKPPKETTTG  419

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
                G  FK+R+F  F L+RSYS
Sbjct  420   FFLGNFFKARTFQTFKLIRSYS  441



>gb|KHN02059.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=445

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/445 (61%), Positives = 340/445 (76%), Gaps = 8/445 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN AC+NATVIQVDS NKHG LL+VVQV++D+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNACENATVIQVDSVNKHGILLDVVQVISDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV + +G+KI D+ V+DYI + L  +  F  S+R SVGV    +HT IE
Sbjct  61    SSDGVWFMDVFNVIDHKGNKIRDKEVIDYIQRRLENNPSFVPSLRESVGVVPTEEHTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L CNVV AE+WTHNTRAAA++ VTD+ +G A+ DP  LS I
Sbjct  121   LTGTDRPGLLSEICAVLTDLHCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIKDPSRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY---ERASDEALNHPDR-  992
             + LL NVL+GSN  + A+T ++  G T+ DRRLHQ+MFADRDY   ERA  E L   D+ 
Sbjct  181   RDLLSNVLRGSNDPKTARTTLSPPGVTNRDRRLHQIMFADRDYERIERAGQEELRDRDKR  240

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P+V+V +  ++DY+VVT+R +DRPKLLFD++CTLTDM+YVVFHG V     EA+QE+ 
Sbjct  241   PLPHVTVGDCVEKDYTVVTMRAQDRPKLLFDIVCTLTDMQYVVFHGVVKTLRMEAFQEFY  300

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+R++ CLEAAIERR SEG+ LELCT DRVGLLS++TR FRENSL 
Sbjct  301   IRHVDGFPISSEAERERLMQCLEAAIERRASEGMGLELCTEDRVGLLSDITRTFRENSLC  360

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQES  1523
             + RAE++T  GKA +TFYV D +G PVD +II+S+R+ IG  +L+VK N      P Q +
Sbjct  361   IKRAEISTEEGKARDTFYVTDVTGNPVDPKIIDSIRRQIGDKVLKVKHNSNLSPKPPQPT  420

Query  1524  PTRSLFGGIFKSRSFCNFGLVRSYS  1598
                 L G  FK+RSF NF L+RSYS
Sbjct  421   TIGFLLGNFFKARSFQNFKLIRSYS  445



>gb|KDO63881.1| hypothetical protein CISIN_1g013535mg [Citrus sinensis]
Length=441

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 334/442 (76%), Gaps = 6/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN  C +ATVI+VDS NKHG LL+V+QVL D+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNTCADATVIKVDSVNKHGILLQVIQVLNDVNLVIKKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV + +G KI D+ V+DYI + L  D+ FA S+R SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFNVIDCDGKKIRDKEVIDYIQQRLETDASFAPSLRSSVGVMPTEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
               G+DRPGL SEV AVL +L CNVVNAE+WTHN RAAA++ VTD  TG A+ DP+ LS I
Sbjct  121   FTGTDRPGLFSEVCAVLADLHCNVVNAEIWTHNDRAAAVVHVTDHSTGYAIKDPKRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYER---ASDEALNHPDRP  995
             K+LL NVL+G +  R AKT ++  G  + +RRLHQ+MF DRDYER   A     +   RP
Sbjct  181   KELLFNVLRGYDDFRKAKTSLSPPGIMNRERRLHQIMFDDRDYERVEKAVGRVEDKSSRP  240

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
              V+V N  ++DY+V+T+R KDRPKLLFD++CTLTDM+YVVFHG V+    EAYQE+ IRH
Sbjct  241   QVTVLNI-EKDYTVITMRSKDRPKLLFDIVCTLTDMQYVVFHGMVNTGRTEAYQEFYIRH  299

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             +DG P+ S+AER+RVI CLEAAIERR SEGL+LELCT DRVGLLS++TRIFRENSL++ R
Sbjct  300   VDGLPISSEAERERVIQCLEAAIERRASEGLELELCTEDRVGLLSDITRIFRENSLSIKR  359

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVK-GNPEEQNPTQESPTR  1532
             AE++T GGK  +TFYV D +G PVD +II+S+R+ IG T LQVK        P +E+ T 
Sbjct  360   AEISTIGGKVKDTFYVTDVTGNPVDPKIIDSIRRQIGHTKLQVKRSTILAPKPPKETTTG  419

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
                G  FK+R+F  F L+RSYS
Sbjct  420   FFLGNFFKARTFQTFKLIRSYS  441



>ref|XP_003614265.1| ACR4 [Medicago truncatula]
 gb|AES97223.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=362

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/357 (73%), Positives = 300/357 (84%), Gaps = 4/357 (1%)
 Frame = +3

Query  261   EATVSYSQN--MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLT  434
             E  +SYSQ+  MDDEYEKL RRMNPPRVVIDN A +NATVI+VDSANK G LLEVVQ+LT
Sbjct  6     EVNMSYSQSHYMDDEYEKLFRRMNPPRVVIDNGASQNATVIRVDSANKQGILLEVVQILT  65

Query  435   DLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVG  614
             DLNLIITKAYI SDGGWFMDVFNVT+Q+G+K+ DE +LDYI KSLGP+SCFA++MR SVG
Sbjct  66    DLNLIITKAYISSDGGWFMDVFNVTDQDGNKVTDEVILDYIRKSLGPESCFATTMR-SVG  124

Query  615   VTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGG  794
             V    DHT+IEL+GSDRPGLLSEVSAVLTNLKCN+VNAEVWTHN RAAA+M VTDEETG 
Sbjct  125   VKQTPDHTAIELMGSDRPGLLSEVSAVLTNLKCNIVNAEVWTHNMRAAAVMHVTDEETGS  184

Query  795   AVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA  974
             A+TD + LS+IK+LLCNVL G N+ R AKT +T  +THTDRRLHQ+MF DRDYER  D+ 
Sbjct  185   AITDSQRLSLIKELLCNVLGGGNRKRGAKTVVTDDSTHTDRRLHQMMFDDRDYERVDDDD  244

Query  975   LNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAY  1154
              +   RPNV V NW D+DYSVVTI C+DRPKL+FD +CTLTDM+YVVFH N+DAEGP+AY
Sbjct  245   FDEKQRPNVDVVNWSDKDYSVVTIECRDRPKLVFDTVCTLTDMQYVVFHANIDAEGPQAY  304

Query  1155  QEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRI  1325
             QEY I+HIDGSPVKSDAERQRVIHCLEAAIERRVSE   L L  +D + + S   RI
Sbjct  305   QEYYIKHIDGSPVKSDAERQRVIHCLEAAIERRVSEVRDLMLVLSD-ISIASKFGRI  360



>ref|XP_004158495.1| PREDICTED: uncharacterized protein LOC101225681 [Cucumis sativus]
 gb|KGN63154.1| hypothetical protein Csa_2G405050 [Cucumis sativus]
Length=440

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/442 (62%), Positives = 336/442 (76%), Gaps = 7/442 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MD+EY+KLIRR+NPPRVVIDN ACK+ATVIQVDS NKHG LL+VVQVL D+NLIITKAYI
Sbjct  1     MDNEYDKLIRRLNPPRVVIDNNACKDATVIQVDSMNKHGILLKVVQVLMDMNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV   EG+KI D+ V++ I   L  ++ F  S+R SVGV    DHTSIE
Sbjct  61    SSDGGWFMDVFNVITYEGNKIRDQEVINAIQMRL--EASFVPSLRESVGVMPSEDHTSIE  118

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNA+VWTHN RAAA++ VTD+ TG A+ DP+ L  I
Sbjct  119   LSGTDRPGLLSEVCAVLADLHCNVVNADVWTHNNRAAAVVHVTDDATGRAINDPQRLLTI  178

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHPD---RP  995
             K+LLCNVL+G+ + + AK  ++  G T TDRRLHQ+M ADRDYERA    L   D   RP
Sbjct  179   KELLCNVLRGNGELKEAKMTLSPPGVTSTDRRLHQIMLADRDYERAVKTKLEVEDKNLRP  238

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
             +V+V +  ++DY+++T R +DRPKLLFDV+CTLTDMEYVVFHG V+    EA+ E+ IRH
Sbjct  239   HVTVFDCTEKDYTLITTRTRDRPKLLFDVLCTLTDMEYVVFHGMVETGRMEAFLEFYIRH  298

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
              DG P+ S AER RV+HCLEAAIERR SEGLKLELC  DRVGLLS++TRIFRENSL + R
Sbjct  299   KDGLPISSKAERDRVLHCLEAAIERRESEGLKLELCAEDRVGLLSDITRIFRENSLCIRR  358

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQESPTR  1532
             AE+AT+ GKA + FYV D +G  +DA+++ES+R+ IG  +LQVK N    + P +E    
Sbjct  359   AEIATKRGKAKDIFYVTDMTGTTIDAKVVESIRKQIGDAMLQVKHNSCLSETPPKEMTAG  418

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
                G  FK+R+F NF L+RSYS
Sbjct  419   FFLGYFFKARTFQNFKLIRSYS  440



>ref|XP_002280377.1| PREDICTED: uncharacterized protein LOC100256112 [Vitis vinifera]
 emb|CBI15703.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 338/441 (77%), Gaps = 5/441 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C +ATVI+VDSAN+HG LL+VVQVLTDLNLIITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDSCGHATVIEVDSANRHGILLQVVQVLTDLNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+ +G+K+ DE +L+Y+ K+L  ++ F +S+R SVGV    + TSIE
Sbjct  61    SSDGGWFMDVFNVTDHDGNKLRDEEILNYLQKTLETEAGFLNSLRGSVGVMPSKEDTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L GSDRPGLLSEVSAVLT+L+CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP+ LSMI
Sbjct  121   LTGSDRPGLLSEVSAVLTDLRCNVVNAEIWTHNARAAAVIHVTDQATGCAIEDPKRLSMI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHG---ATHTDRRLHQLMFADRDYERASDEALNHPDRPN  998
             KK L NV KG++  R  K  I+     A + DRRLHQ+MFA RD+ER  +   +   RP+
Sbjct  181   KKRLGNVFKGNSSFRTPKMTISSPGPVAMNRDRRLHQMMFAARDFERL-EYVQDKNSRPH  239

Query  999   VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHI  1178
             V+V +  DRDY+VVTIR +DRPKLLFD +C LTDM+YVVFHG V     EAYQE+ IRH+
Sbjct  240   VTVLDCSDRDYTVVTIRSRDRPKLLFDTVCALTDMQYVVFHGTVITGRMEAYQEHYIRHV  299

Query  1179  DGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRA  1358
             DG P++S+AERQRV  CLEAAIERR  EGL LEL T DR GLLS+VTR+FREN L + RA
Sbjct  300   DGLPLRSEAERQRVTECLEAAIERRAWEGLVLELSTEDRFGLLSDVTRVFRENGLCIKRA  359

Query  1359  EVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSL  1538
              + T+ GKA +TF+V D SG  VD++ +E +RQ IGQTIL+VKGN        +  TRS 
Sbjct  360   VITTKCGKAKDTFFVTDVSGNTVDSKTVEMIRQQIGQTILRVKGNLNFSPKLPQEGTRSF  419

Query  1539  -FGGIFKSRSFCNFGLVRSYS  1598
              FG +FK RSF  F L++SYS
Sbjct  420   PFGNLFKGRSFQTFKLIKSYS  440



>ref|XP_010912996.1| PREDICTED: uncharacterized protein LOC105038791 [Elaeis guineensis]
Length=449

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/443 (61%), Positives = 335/443 (76%), Gaps = 11/443 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPP++VIDN+AC N TVI+V S NKHG LLEVVQVLTDLNLIITKAYI 
Sbjct  11    DDEYAKLIRRMNPPKIVIDNDACDNVTVIRVHSVNKHGILLEVVQVLTDLNLIITKAYIS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT+++G+K+ D+ ++  I  SL  D+C+  ++R SVG+ S  ++TSIEL
Sbjct  71    SDGSWFMDVFNVTDRDGNKVRDKKIISCIQTSLESDACYFPTLRNSVGIMSSEENTSIEL  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSE+ AVL +L CNVV  EVWTHNTRAAA++ VTDE T GA+ DP+ LS IK
Sbjct  131   TGTDRPGLLSEIFAVLADLNCNVVKGEVWTHNTRAAAVVHVTDESTMGAIEDPQRLSTIK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA-----SDEALNHPDRP  995
             KLL NVLKG N SR AK  ++ G THT+RRLHQ+MF DRDYER       DE      RP
Sbjct  191   KLLFNVLKGDNTSRTAKMMVSRGLTHTERRLHQMMFDDRDYERVRVIGEGDEK----SRP  246

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
              V++ +  ++DY+++ +R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IRH
Sbjct  247   RVAIMDCSEKDYTIIILRSKDRPKLLFDTVCTLTDMQYVVFHGTVHTGSSEAYQEYYIRH  306

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             +DG P+ S+AERQRVI CLEAAIERR SEGL+LEL T DRVGLLS++TRIFREN L + R
Sbjct  307   VDGLPISSEAERQRVIQCLEAAIERRASEGLELELRTEDRVGLLSDITRIFRENGLRIRR  366

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN--PEEQNPTQESPT  1529
             A+++T  GKAV+TF + + SG PV+ + I+S+R+ IGQTIL+VK N  P  ++P   S T
Sbjct  367   ADISTIEGKAVDTFCLSEMSGNPVEGKTIDSLREQIGQTILKVKQNPLPPPKHPESVSTT  426

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               L G  FK  S  +F L+RS S
Sbjct  427   GFLLGNFFKVCSLQSFRLIRSSS  449



>emb|CAN80840.1| hypothetical protein VITISV_043834 [Vitis vinifera]
Length=440

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/441 (63%), Positives = 338/441 (77%), Gaps = 5/441 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C +ATVI+VDSAN+HG LL+VVQVLTDLNLIITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDSCGHATVIEVDSANRHGILLQVVQVLTDLNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+ +G+K+ DE +L+Y+ K+L  ++ F +S+R SVGV    + TSIE
Sbjct  61    SSDGGWFMDVFNVTDHDGNKLRDEEILNYLQKTLETEAGFLNSLRGSVGVMPSKEDTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L GSDRPGLLSEVSAVLT+L+CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP+ LSMI
Sbjct  121   LTGSDRPGLLSEVSAVLTDLRCNVVNAEIWTHNXRAAAVIHVTDQATGCAIEDPKRLSMI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHG---ATHTDRRLHQLMFADRDYERASDEALNHPDRPN  998
             KK L NV KG++  R  K  I+     A + DRRLHQ+MFA RD+ER  + A +   RP+
Sbjct  181   KKRLGNVFKGNSSFRTPKMTISSPGPVAMNRDRRLHQMMFAARDFERL-EYAQDTNSRPH  239

Query  999   VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHI  1178
             V+V +  DRDY+VVTIR +DRPKLLFD +C LTDM+YVVFHG V     EAYQE+ IRH+
Sbjct  240   VTVLDCSDRDYTVVTIRSRDRPKLLFDTVCALTDMQYVVFHGTVITGRMEAYQEHYIRHV  299

Query  1179  DGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRA  1358
             DG P++S+AERQRV  CLEAAIERR  EGL LEL T DR GLLS+VTR+FREN L + RA
Sbjct  300   DGLPLRSEAERQRVTECLEAAIERRAWEGLVLELSTEDRFGLLSDVTRVFRENGLCIKRA  359

Query  1359  EVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSL  1538
              + T+ GKA +TF+V D SG  VD++ +E +RQ IGQTIL+VKGN           TRS 
Sbjct  360   VITTKCGKAKDTFFVTDVSGNXVDSKTVEMIRQQIGQTILRVKGNLNFSPKLPXEGTRSF  419

Query  1539  -FGGIFKSRSFCNFGLVRSYS  1598
              FG +FK RSF  F L++SYS
Sbjct  420   XFGNLFKGRSFQTFKLIKSYS  440



>ref|XP_007161677.1| hypothetical protein PHAVU_001G089200g [Phaseolus vulgaris]
 gb|ESW33671.1| hypothetical protein PHAVU_001G089200g [Phaseolus vulgaris]
Length=445

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/446 (61%), Positives = 339/446 (76%), Gaps = 10/446 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN AC+NATVIQVDS NKHG LL+VVQV++D+NL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNACENATVIQVDSVNKHGILLDVVQVISDMNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVFNV ++ G+KI D+ V+DYI + +  +  FA S+R SVGV    +HT IE
Sbjct  61    SSDGVWFMDVFNVIDRNGNKIRDKEVIDYIQRRIENNPSFAPSLRESVGVVPTEEHTVIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSE+ AVLT+L CNVV AE+WTHNTRAAA++ VTD+ +G A+ DP  LS I
Sbjct  121   LTGTDRPGLLSEICAVLTDLHCNVVTAEIWTHNTRAAAVVHVTDDSSGCAIKDPSRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDE---ALNHPDR-  992
             + LL NVL+GSN  + AKT ++  G T+ DRRLHQ+MFADRDYER   E   AL    + 
Sbjct  181   RDLLSNVLRGSNDPKTAKTTLSPPGVTNRDRRLHQIMFADRDYERIEREGRGALRDRGKR  240

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P+V+V +  D+DY+VVT+R  DRPKLLFD++CTLTDM+YVVFHG V     EA+QE+ 
Sbjct  241   PLPHVTVVDCVDKDYTVVTMRATDRPKLLFDIVCTLTDMQYVVFHGVVKTVRTEAFQEFY  300

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+  +AER+R++ CLEAAIERR SEG++LELCT DRVGLLS++TRIFRENSL 
Sbjct  301   IRHVDGFPISLEAERERLVQCLEAAIERRASEGMELELCTKDRVGLLSDITRIFRENSLC  360

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             + RAE++T  G A +TFYV D +G PVD +II+S+R+ IG  +L VK N    +P    P
Sbjct  361   IKRAEISTEEGMARDTFYVTDVTGNPVDPKIIDSIRRQIGDKVLNVKHN-SSLSPKASQP  419

Query  1527  TR--SLFGGIFKSRSFCNFGLVRSYS  1598
             T    L G  FK+RSF NF L+RSYS
Sbjct  420   TTIGFLLGNFFKARSFQNFKLIRSYS  445



>ref|XP_009405884.1| PREDICTED: uncharacterized protein LOC103988920 [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/439 (62%), Positives = 336/439 (77%), Gaps = 7/439 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KL+RRMNPPRVVIDN+AC +ATVI+VDS NKHG LLEVVQVLTDLNL+ITKAYI 
Sbjct  12    DDEYAKLVRRMNPPRVVIDNDACDHATVIRVDSVNKHGILLEVVQVLTDLNLVITKAYIS  71

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT+++G+KI DE ++ YI KSLG D+CF   +R S GV    +HT +EL
Sbjct  72    SDGSWFMDVFNVTDRDGNKIWDEEIVSYIQKSLGSDACFFPKLRSSAGVMPSNEHTFVEL  131

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSE+ AVL N KCNVV AE+WTHN R AA+++VTDE T  AV DPE LSMIK
Sbjct  132   TGTDRPGLLSEICAVLANSKCNVVRAELWTHNARVAAVVRVTDESTRRAVEDPEKLSMIK  191

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVT  1010
             +LLCNVLKG   SR A   ++ G THT+RRLHQ+MF++RDYER      +    P V+V 
Sbjct  192   ELLCNVLKG---SRTASMTVSMGHTHTERRLHQMMFSNRDYERIGATQGDDKSWPQVAVM  248

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             +  ++DYSVV +R KDRPKLLFD +CTLTDM+YVV HG VD+   EAYQEY IRH+DG P
Sbjct  249   DCSEKDYSVVIMRSKDRPKLLFDTLCTLTDMQYVVHHGTVDSGEEEAYQEYYIRHVDGHP  308

Query  1191  VKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT  1370
             + S+AERQRVI CLEAAIERR +EGL+L L T DR+GLLS++TRIFREN LT+TRAE++T
Sbjct  309   ISSEAERQRVIDCLEAAIERRATEGLELVLRTEDRIGLLSDITRIFRENGLTITRAEIST  368

Query  1371  RGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQESPTRSLFG  1544
               GKA +TF++ + SG PV+A+ I+S+ + +G  I+++K NP    ++P        LFG
Sbjct  369   EDGKAFDTFFLSEMSGNPVEAKTIDSISRQLGHMIVRLKQNPLLASKSPEVAGAAGFLFG  428

Query  1545  GIFKSRSFCNFGLV-RSYS  1598
              +FK+ SF +F LV  SYS
Sbjct  429   NLFKA-SFQSFWLVGSSYS  446



>ref|XP_010028975.1| PREDICTED: uncharacterized protein LOC104419122 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55807.1| hypothetical protein EUGRSUZ_I01627 [Eucalyptus grandis]
Length=443

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/443 (60%), Positives = 337/443 (76%), Gaps = 6/443 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVV+D+ A  +ATVIQVDS NKHG LLEVVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVVDHNASGDATVIQVDSVNKHGILLEVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVF+V +++G KI D  V + I + +   + FA S+R SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFHVVDRDGKKIRDTEVTENIKRRIEKSASFAPSLRGSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVLTNL CN+VN E+WTHN RAAA++ VTD+ TG A+ DPE L+ I
Sbjct  121   LTGTDRPGLLSEVCAVLTNLHCNIVNGEIWTHNARAAAVLHVTDDSTGSAIKDPERLAKI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERASDEALNHPD----R  992
             K++L N+LKG +  + AKT ++  G T  +RRLHQ+MFADRDY+R  + ++   D    R
Sbjct  181   KEMLFNILKGDDDMKTAKTTLSPPGVTSRERRLHQIMFADRDYQRFENSSIGQADDQSLR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V++ +  +RDY++VT+R KDRPKLLFD++CTLTDM+YVVFHG V     EAYQE+ IR
Sbjct  241   PHVTIMDCDERDYTIVTMRSKDRPKLLFDIVCTLTDMQYVVFHGMVKTGRKEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+R+I CLEAAI+RR SEGL+LEL   DRVGLLS+VTRIFRENSL + 
Sbjct  301   HVDGLPIGSEAERERIIQCLEAAIQRRASEGLELELSIVDRVGLLSDVTRIFRENSLCIK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPT  1529
             RAE+ TRGGKA +TFYV D +G PVD ++I+S+ + IGQ  L+VK N      P +++  
Sbjct  361   RAELTTRGGKAKDTFYVTDVTGDPVDPKMIDSICKQIGQPALRVKQNWNFSPKPPEKTKA  420

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               LFG  F SR+  +F L+RSYS
Sbjct  421   GFLFGYFFSSRTLQSFKLIRSYS  443



>gb|KDP26845.1| hypothetical protein JCGZ_18003 [Jatropha curcas]
Length=449

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 343/447 (77%), Gaps = 7/447 (2%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  MDDE+EKL+ RMNPPRV +DN + + AT+I+VDSANK G+LLEVVQVLTDL+LII
Sbjct  5     SPSVAMDDEFEKLVIRMNPPRVTVDNVSSRKATLIKVDSANKRGSLLEVVQVLTDLDLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ ++ V + I +SLGP +C   S+RRS+GV + T+
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLSEDDVAERIQQSLGPRACSFRSLRRSIGVQAATE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             +T+IEL G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE TG  + +PE
Sbjct  125   NTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGLPIDNPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDE--ALNHP  986
              L+ IK+LL  VL G    R A T ++ G+TH +RRLHQ+M+ADRDY+    E    N  
Sbjct  185   RLTKIKQLLLYVLMGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDMEDTECGTSNER  244

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AEGPEAYQEY 
Sbjct  245   RKPLVTVENCTDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DGSPV S+AERQRVI+CLEAAI RR  EG++LELC+ DRVGLLS VTRIFREN L+
Sbjct  305   IRHMDGSPVSSEAERQRVINCLEAAIRRRTPEGIRLELCSEDRVGLLSEVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN FYV DASGY V +  IE+VR+ IG TIL VK + E+ +P QE  
Sbjct  365   VTRAEVTTRGSQAVNVFYVTDASGYSVKSETIEAVRKEIGLTILCVKDD-EQSSPPQERG  423

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +F+SRS     N GL++SYS
Sbjct  424   KFSL-GNLFRSRSEKFLYNLGLIKSYS  449



>ref|XP_004138626.1| PREDICTED: uncharacterized protein LOC101213097 [Cucumis sativus]
Length=445

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 337/447 (75%), Gaps = 12/447 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MD+EY+KLIRR+NPPRVVIDN ACK+ATVIQVDS NKHG LL+VVQVL D+NLIITKAYI
Sbjct  1     MDNEYDKLIRRLNPPRVVIDNNACKDATVIQVDSMNKHGILLKVVQVLMDMNLIITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV   EG+KI D+ V++ I   L  ++ F  S+R SVGV    DHTSIE
Sbjct  61    SSDGGWFMDVFNVITYEGNKIRDQEVINAIQMRL--EASFVPSLRESVGVMPSEDHTSIE  118

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNA+VWTHN RAAA++ VTD+ TG A+ DP+ L  I
Sbjct  119   LSGTDRPGLLSEVCAVLADLHCNVVNADVWTHNNRAAAVVHVTDDATGRAINDPQRLLTI  178

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHPD---RP  995
             K+LLCNVL+G+ + + AK  ++  G T TDRRLHQ+M ADRDYERA    L   D   RP
Sbjct  179   KELLCNVLRGNGELKEAKMTLSPPGVTSTDRRLHQIMLADRDYERAVKTKLEVEDKNLRP  238

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPE-----AYQE  1160
             +V+V +  ++DY+++T R +DRPKLLFDV+CTLTDMEYVVFHG V+    E     ++QE
Sbjct  239   HVTVFDCTEKDYTLITTRTRDRPKLLFDVLCTLTDMEYVVFHGMVETGRMEENWSFSFQE  298

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             + IRH DG P+ S AER RV+HCLEAAIERR SEGLKLELC  DRVGLLS++TRIFRENS
Sbjct  299   FYIRHKDGLPISSKAERDRVLHCLEAAIERRESEGLKLELCAEDRVGLLSDITRIFRENS  358

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQ  1517
             L + RAE+AT+ GKA + FYV D +G  +DA+++ES+R+ IG  +LQVK N    + P +
Sbjct  359   LCIRRAEIATKRGKAKDIFYVTDMTGTTIDAKVVESIRKQIGDAMLQVKHNSCLSETPPK  418

Query  1518  ESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             E       G  FK+R+F NF L+RSYS
Sbjct  419   EMTAGFFLGYFFKARTFQNFKLIRSYS  445



>ref|XP_009383404.1| PREDICTED: uncharacterized protein LOC103971170 [Musa acuminata 
subsp. malaccensis]
Length=444

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/432 (61%), Positives = 328/432 (76%), Gaps = 4/432 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDE+ KLIRRMNPPRVVIDN++  +ATVI+VDS NKHG LLEVVQVLTDL+L+I+KAYI 
Sbjct  11    DDEFAKLIRRMNPPRVVIDNDSHHDATVIRVDSVNKHGILLEVVQVLTDLDLVISKAYIS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT+++G+K+ ++ ++ YI KSL  D+CF   +R SVG+T   + T IE+
Sbjct  71    SDGSWFMDVFNVTDRDGNKVWNKEIISYITKSLESDACFFPKLRSSVGITPSKEQTLIEV  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              GSDRPGLLSE+ AVL    C+V  AE+WTHNTR AA++ VTDE TGGA+ DPE LS IK
Sbjct  131   TGSDRPGLLSEICAVLATQLCHVDKAELWTHNTRVAAVLHVTDESTGGAIEDPERLSAIK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEA-LNHPDRPNVSV  1007
             KLLCNVLKG N SR  K  ++ G TH DRRLHQLMF DRDYER   +A +N    P V+V
Sbjct  191   KLLCNVLKGDNDSRTGKMTVSMGLTHVDRRLHQLMFDDRDYERVGMKAEVNDKSAPQVTV  250

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
             T+  ++DY+VV +R KDRPKLLFD ICTLTDM+YVVFHG V +    AYQEY IRH+DG 
Sbjct  251   TDCLEKDYTVVILRSKDRPKLLFDTICTLTDMQYVVFHGTVSSGKEGAYQEYYIRHVDGL  310

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PV S+ ERQR+I CLEAAIERR SEGL+LEL T DR G LS +TRIFREN LT+ RAE++
Sbjct  311   PVSSEGERQRLIQCLEAAIERRASEGLELELRTEDRFGFLSEITRIFRENGLTIRRAEIS  370

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQESPTRSLF  1541
             T  GK V+TFY+ + SG P+DA+ I+S+R+ IGQT+L+VK NP    + P   S    +F
Sbjct  371   TEEGKVVDTFYLSEMSGNPIDAKTIDSIRRQIGQTVLRVKQNPLLPSKPPEVGSTVSLIF  430

Query  1542  GGIFKSRSFCNF  1577
             G +F++ SF N 
Sbjct  431   GNLFRA-SFQNL  441



>ref|XP_007038043.1| ACT domain repeat 6 isoform 1 [Theobroma cacao]
 gb|EOY22544.1| ACT domain repeat 6 isoform 1 [Theobroma cacao]
Length=538

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/445 (61%), Positives = 336/445 (76%), Gaps = 3/445 (1%)
 Frame = +3

Query  270   VSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLI  449
             + + + MDDE+ KLIRR+NPPRVV+DN+AC++ATVIQVDS N+HG LLEVVQVL DLNL+
Sbjct  95    LEHKEKMDDEFAKLIRRINPPRVVVDNDACEHATVIQVDSVNRHGILLEVVQVLADLNLV  154

Query  450   ITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGT  629
             +TKAYI SD GWFMDVF VT+ EG+KI +E  L YI K+L     F +S+R SVGV    
Sbjct  155   VTKAYISSDAGWFMDVFYVTDYEGNKIRNERTLSYIQKTLETKVHFLNSLRSSVGVIPSK  214

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             +HTSIEL GSDRPGL+SEVSAVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP
Sbjct  215   EHTSIELTGSDRPGLVSEVSAVLADLGCNVVNAEIWTHNARAAAVIYVTDQSTGHAIEDP  274

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDEALNHP  986
             + LS+IK+LL NV+KG++  R  +  I + G  H  RRLHQ++FADRD+ER  +      
Sbjct  275   KKLSIIKELLFNVMKGNSDFRTPRMSISSSGVMHRARRLHQMLFADRDFERPENVKFESA  334

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +P+V+V +  DRDY+VVTIR  DRPKLLFD ICTLTDMEYVVFHG V     EAYQEY 
Sbjct  335   -KPHVTVQDCSDRDYTVVTIRSLDRPKLLFDTICTLTDMEYVVFHGTVITGRMEAYQEYY  393

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AE+QRV+ CLEAAIERR  EGL+LEL T DR GLLS++TRIFREN L 
Sbjct  394   IRHVDGFPISSEAEQQRVVECLEAAIERRAQEGLELELFTDDRFGLLSDITRIFRENGLC  453

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             + RAE++T+GGKA +TF+V D SG PVDA+ ++ ++  IGQ  LQVKGN        +  
Sbjct  454   IRRAEISTKGGKAKDTFFVTDVSGNPVDAKTVDLIQHQIGQANLQVKGNSFLSPKLPKET  513

Query  1527  TRS-LFGGIFKSRSFCNFGLVRSYS  1598
              RS LFG +FK RSF NF L++S S
Sbjct  514   ARSFLFGNLFKGRSFQNFKLIKSCS  538



>tpg|DAA50241.1| TPA: hypothetical protein ZEAMMB73_737306 [Zea mays]
Length=442

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/436 (62%), Positives = 332/436 (76%), Gaps = 10/436 (2%)
 Frame = +3

Query  297   EYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSD  476
             ++ +LI R    R+VIDNE+   AT+++VDSAN++G LLEV+QV+ DLNL+I KAYI SD
Sbjct  12    QFWRLIGR----RIVIDNESSAEATIVRVDSANEYGILLEVIQVMIDLNLVIGKAYITSD  67

Query  477   GGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             GGWFMDVFNVT++EG KI DEA L    DYI KSLG DS +  S RRSV V +  DH  I
Sbjct  68    GGWFMDVFNVTDKEGKKIKDEATLTQIEDYIRKSLGADSRYIPSRRRSVDVAAAADHNII  127

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             EL G+DRPGLLSEVSAVLT+LKCNVV+AE+WTHNTRAAA+M+VTDE+TG AVTD E L  
Sbjct  128   ELTGTDRPGLLSEVSAVLTSLKCNVVSAEIWTHNTRAAAVMRVTDEDTGLAVTDAERLER  187

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             I++ L  + +G N SR A        THT+RRLHQ+M  D DYE+   +A     RPNV+
Sbjct  188   IREKLSYLFRGGNLSRGATVSSRTATTHTERRLHQMMLDDGDYEQLQRQAPGQSQRPNVT  247

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V NW+D+DYSVVTIRCKDR KLLFD +CTLTD++YVVFH N+DA+  +AYQE+ +RH++G
Sbjct  248   VRNWNDKDYSVVTIRCKDRSKLLFDTVCTLTDLQYVVFHANIDAKDNQAYQEFYVRHVNG  307

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SP+ ++ ER RVI CLEAAIERRVSEG+KLELCT D+VGLLS VTRIFRENSLTVTRAEV
Sbjct  308   SPMNTETERLRVIQCLEAAIERRVSEGVKLELCTNDKVGLLSEVTRIFRENSLTVTRAEV  367

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQESPTRSLF  1541
              TRG  AVNTFYV  ++G  VD + I+S+R+ IG + LQVKG  E   P  +ESPT  LF
Sbjct  368   TTRGRMAVNTFYVRGSAGEAVDQKAIDSIREAIGHS-LQVKGQAEPPEPQKKESPTWFLF  426

Query  1542  GGIFKSRSFCNFGLVR  1589
               +F+ RS  +FG +R
Sbjct  427   ANLFRPRSLYSFGFMR  442



>ref|XP_002266641.1| PREDICTED: uncharacterized protein LOC100250497 [Vitis vinifera]
 emb|CBI38152.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/445 (60%), Positives = 343/445 (77%), Gaps = 5/445 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+ RMNPPRV +DN + + AT+I+VDSAN+ G+LLEVVQVL D++LII
Sbjct  5     SPSLTVDDEFEKLVIRMNPPRVTVDNASSRTATLIKVDSANRRGSLLEVVQVLNDMDLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ ++ V + I +SLGP +    S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQKGNKLSEDDVAERIQQSLGPRARSFRSLRRSVGVQAANE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TD+ETG  + DP+
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDDETGLPIDDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L  IK+LL  VLKG    R A T ++ G+T+T RRLHQ+M+ADRDY+  S  + N   +
Sbjct  185   RLVKIKQLLLYVLKGDRDKRSANTAVSVGSTNTQRRLHQMMYADRDYDMDSG-STNDRSK  243

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P V+V N+ D+ Y+VV +RC DRPKLLFD +CTLTDM+YVVFH  V AEGPEAYQEY IR
Sbjct  244   PLVTVENFADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVFHATVIAEGPEAYQEYYIR  303

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AE+QRVI CLEAAI RR SEG++LELC+ DRVGLLS+VTRIFREN L+VT
Sbjct  304   HVDGCPISSEAEQQRVILCLEAAIRRRTSEGIRLELCSEDRVGLLSDVTRIFRENGLSVT  363

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR  1532
             RAEV TRG +AVN FYV D+SG PV +  IE+VR+ IG TIL+VK +   ++P QES   
Sbjct  364   RAEVTTRGSQAVNAFYVTDSSGNPVKSETIEAVRKEIGLTILRVKDDAYSKSPPQESGRF  423

Query  1533  SLFGGIFKSRS---FCNFGLVRSYS  1598
             SL G +F+SRS     N GL+RSYS
Sbjct  424   SL-GNLFRSRSEKVLYNLGLMRSYS  447



>ref|XP_002514875.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF47429.1| amino acid binding protein, putative [Ricinus communis]
Length=450

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/447 (60%), Positives = 339/447 (76%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  MDDE+EKL+ RMNPPRV +DN   + AT+I+VDSANK G+LLEVVQVLTDL+L+I
Sbjct  5     SPSVTMDDEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDLLI  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ ++ V + I +SLGP +C   S+RRSVGV + ++
Sbjct  65    RRAYISSDGEWFMDVFHVTDQHGNKLSEDDVAERIQQSLGPRACSFRSLRRSVGVQTASE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             +T+IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG  + +P+
Sbjct  125   NTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEVTGSPINEPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L+ IK+LL  VLKG    R A T ++ G+TH +RRLHQ+M+ADRDY+    E  +  +R
Sbjct  185   RLTKIKQLLLYVLKGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDIDDGEGGSTSER  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AEGPEAYQEY 
Sbjct  245   RKPLVTVENCADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DGSP+ S+AERQRVI+CLEAAI RR  EG++LELC+ DR+GLLS VTRIFREN L+
Sbjct  305   IRHMDGSPISSEAERQRVINCLEAAIRRRNPEGIRLELCSEDRIGLLSEVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TR  +AVN FYV DASGYPV +  IE+VR+ IG TIL+VK +     P QE  
Sbjct  365   VTRAEVTTRDSQAVNAFYVTDASGYPVKSETIEAVRKEIGLTILRVKDD-SNSPPPQEER  423

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
              R   G IF+SRS     N GL++SYS
Sbjct  424   GRFSLGNIFRSRSEKFLYNLGLIKSYS  450



>ref|XP_010025287.1| PREDICTED: uncharacterized protein LOC104415658 [Eucalyptus grandis]
 gb|KCW61914.1| hypothetical protein EUGRSUZ_H04608 [Eucalyptus grandis]
Length=454

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/442 (61%), Positives = 340/442 (77%), Gaps = 6/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             +DDE+EKL+ RMNPPRV +DN + K AT+++VDSANK G+LLEVVQVLTD+NLII +AYI
Sbjct  10    LDDEFEKLVLRMNPPRVAVDNASSKKATLLKVDSANKRGSLLEVVQVLTDMNLIIRRAYI  69

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVF+VT+Q+G+K+ ++ V + I +SLGP      S+R SVGV +  ++T+IE
Sbjct  70    SSDGEWFMDVFHVTDQKGNKLFEDDVAERIQQSLGPRIRSFRSLRSSVGVQAAAENTTIE  129

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV AVL NLKCNVV AEVWTHN+R A+++ +TDEE+   + DP+ L+ I
Sbjct  130   LTGRDRPGLLSEVFAVLANLKCNVVAAEVWTHNSRMASVVYITDEESSLPIDDPDRLAKI  189

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LL  VLKG      A T +T G+THT+RRLHQLM+ADRDY+    +  +  ++  +SV
Sbjct  190   KQLLLFVLKGDRDKNSANTAVTVGSTHTERRLHQLMYADRDYDMDGVDGGSAGEQSKLSV  249

Query  1008  T--NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHID  1181
             T  N  D+ Y+VV +RC+DRPKL+FD +CTLTDM+YVV+HG V AEGPEAYQEY IRH+D
Sbjct  250   TVDNCMDKGYTVVNLRCQDRPKLIFDTVCTLTDMDYVVYHGTVIAEGPEAYQEYYIRHMD  309

Query  1182  GSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
             GSP+ S+AERQRVIHCL AAI+RR SEG+KLELC  DRVGLLS+ TRIFREN L+VTRAE
Sbjct  310   GSPISSEAERQRVIHCLGAAIKRRTSEGIKLELCCPDRVGLLSDATRIFRENGLSVTRAE  369

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF  1541
             V TRG +AVNTFYV D+SG PV + IIESVR+ IG  ILQVK     Q+P Q++   SL 
Sbjct  370   VTTRGSQAVNTFYVTDSSGNPVKSEIIESVRKQIGVAILQVKDESYSQSPPQDTGKFSL-  428

Query  1542  GGIFKSRS---FCNFGLVRSYS  1598
             G +F+SRS     N GL++S S
Sbjct  429   GNLFRSRSEKFLYNLGLIKSCS  450



>ref|XP_010024175.1| PREDICTED: uncharacterized protein LOC104414711 [Eucalyptus grandis]
 gb|KCW60625.1| hypothetical protein EUGRSUZ_H03350 [Eucalyptus grandis]
Length=443

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/444 (60%), Positives = 337/444 (76%), Gaps = 8/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C++ATVIQVDS NKHG LLEVVQVL D+NL ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNKSCEDATVIQVDSINKHGILLEVVQVLIDMNLTITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNV + +G KI ++ V++YI + L  ++  + S R SVG     +HTSIE
Sbjct  61    SSDGGWFMDVFNVIDCDGKKIKEKEVIEYIKRRLESNASISPSFRESVGFMPSNEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVLT+L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP+ L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNARAAAVVHVTDDTTGHAIKDPKRLATI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEAL----NHPDR  992
             + LLCNVLK       AK  ++  G T+  RRLHQ+MFADRDYER   E +    ++  R
Sbjct  181   RDLLCNVLKADGDVNTAKMTLSSPGVTNRGRRLHQIMFADRDYERVDKEEIRRMHDNSTR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P V+V + +++DY++VT+R KDRPKLLFD+ICTLTDM+YVVFHG V+    EAYQE+ IR
Sbjct  241   PFVTVMDCYEKDYTIVTMRSKDRPKLLFDIICTLTDMQYVVFHGMVNTGRKEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+R+  CLEAAIERR SEGL+LELC  DRVGLL++VTR+FREN L V 
Sbjct  301   HVDGLPIGSEAERERITQCLEAAIERRASEGLELELCAEDRVGLLADVTRLFRENGLCVK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQESP  1526
             RAE++T+ GKA +TFYV D +G PVD +II+S+R+ I  ++LQVK N     + P QE+ 
Sbjct  361   RAEISTKDGKAKDTFYVSDVTGSPVDLKIIDSIRRQIVPSVLQVKHNSLLLPKKP-QETT  419

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                LFG  F++R+F NF LVR  S
Sbjct  420   GGFLFGNFFRTRNFQNFKLVRLAS  443



>ref|XP_010929570.1| PREDICTED: uncharacterized protein LOC105051016 isoform X2 [Elaeis 
guineensis]
Length=447

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/426 (64%), Positives = 327/426 (77%), Gaps = 5/426 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY +LIRRMNPPRVVIDN +C NATVI+V S NKHG LLEVVQVLTDLNLIITKAYI 
Sbjct  11    DDEYAQLIRRMNPPRVVIDNGSCDNATVIRVHSFNKHGILLEVVQVLTDLNLIITKAYIS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT+++G+K+ D+ ++ YI  SL  D+CF  ++R SVGV    DHTSIEL
Sbjct  71    SDGSWFMDVFNVTDRDGNKVWDKEIISYIQTSLESDACFFPTLRNSVGVMPSKDHTSIEL  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSE+ AVLT+L CNVV AEVWTHNTRAAA++ VTD+ T  A+ DP  LS IK
Sbjct  131   TGTDRPGLLSEICAVLTDLNCNVVKAEVWTHNTRAAAVVHVTDKSTRDAIEDPLRLSTIK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYER--ASDEALNHPDRPNVS  1004
             +LLCNVLKG+N SR AK  ++ G THT+RRLHQ+MF DRDYER   S E  +   RP V+
Sbjct  191   ELLCNVLKGNNTSRTAKMTVSAGLTHTERRLHQMMFDDRDYERIDMSWEG-DEKSRPQVA  249

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
               +  ++DY++V +R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IRH+DG
Sbjct  250   TMDCSEKDYTIVILRSKDRPKLLFDTVCTLTDMQYVVFHGTVHTGSAEAYQEYYIRHVDG  309

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
              P+ S+AERQRVI CLEAAIERR SEGL+LEL T DRVGLLS++TRIFREN L + RA++
Sbjct  310   LPISSEAERQRVIQCLEAAIERRASEGLELELRTEDRVGLLSDITRIFRENGLRIRRADI  369

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQE--SPTRSL  1538
             +T  GKAV+TF + + SG PV+A+ I+S+R+ IG T L+VK NP       E  S T SL
Sbjct  370   STIRGKAVDTFCLSEMSGNPVEAKTIDSLRRQIGPTSLKVKQNPLPPPKPPEAASTTGSL  429

Query  1539  FGGIFK  1556
              G  FK
Sbjct  430   LGNFFK  435



>ref|XP_010112397.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXC33392.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=443

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/443 (60%), Positives = 330/443 (74%), Gaps = 6/443 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN+ C++ATVI+VDS NKHGTLLEVVQVL D+NL I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDVCEDATVIKVDSVNKHGTLLEVVQVLADVNLTIVKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
               DGGWFMDVFNV + +G KI D+ VL+YI   L  +  F  ++R SVGV    +HT IE
Sbjct  61    SCDGGWFMDVFNVVDHDGKKIRDKEVLNYIQVRLESNDGFVPTVRESVGVMPAEEHTWIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L+CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP  LS I
Sbjct  121   LSGTDRPGLLSEVCAVLADLRCNVVNAEIWTHNARAAAVVHVTDDSTGCAIKDPRRLSTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDYERAS----DEALNHPDR  992
             K+LLCNVLKG+N  + AK  ++  G T+ DRRLHQ+MFADRDYER          +   R
Sbjct  181   KELLCNVLKGNNDRKEAKMTLSPPGVTNRDRRLHQIMFADRDYERVERVDPGRIEDKGSR  240

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P V+V N   +DY+++T+R KDRPKLLFD+ICTLTDMEYVVFHG V     EAYQE+ IR
Sbjct  241   PRVAVFNCIQKDYTMITMRAKDRPKLLFDIICTLTDMEYVVFHGMVTTGRTEAYQEFYIR  300

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AER+RV  CLEAAIERR +EG++L+LCT DR GLLS++TRIFRENSL + 
Sbjct  301   HVDGLPISSEAERERVTQCLEAAIERRANEGIELQLCTDDRAGLLSDITRIFRENSLCIK  360

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPT  1529
             RAE++T+  K  + F+V D +G PVD +II+S+R+ +G   LQVK +      P QE+  
Sbjct  361   RAEISTKDRKVKDIFHVTDVAGNPVDPKIIDSIRRQVGPGSLQVKYDTSLSPKPRQETTI  420

Query  1530  RSLFGGIFKSRSFCNFGLVRSYS  1598
               LFG  F++R+  NF L+RSYS
Sbjct  421   GFLFGNFFRARTLQNFKLIRSYS  443



>ref|XP_002884250.1| hypothetical protein ARALYDRAFT_477311 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60509.1| hypothetical protein ARALYDRAFT_477311 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/442 (61%), Positives = 334/442 (76%), Gaps = 8/442 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPPRVVIDN A  +ATVIQVDS NKHGTLLEVVQVLTD+NL+I KAYI 
Sbjct  3     DDEYAKLIRRMNPPRVVIDNNASDDATVIQVDSVNKHGTLLEVVQVLTDMNLVIKKAYIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V +Q+G+KI D  VLDYI + +  ++  F   +R SVGV    ++T+IE
Sbjct  63    SDGGWFMDVFKVIDQDGNKIRDTQVLDYIQRRIESNAGWFIPPLRSSVGVMPTDEYTAIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++ VTD  T  A+TDP  LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDNLTNSAITDPIRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNV++ ++ SR AKT  +   TH +RRLHQ+MF DRDYE     A     RP+V++
Sbjct  183   KELLCNVVRTNSGSRAAKTVFSCSDTHRERRLHQIMFDDRDYE-GVKRAKTSASRPSVTL  241

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              N  ++DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IRH+DG 
Sbjct  242   MNI-EKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPVEAYQEFYIRHVDGL  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ RAE++
Sbjct  301   PINSEAEQERVIQCLEAAIERRASEGLELELSAEDRVGLLSDITRTFRENSLTIVRAEIS  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-----EQNPTQESPTR  1532
             TR GKA +TFYV D +G PV+++I+ES+RQ IG + L+VK   +        P+ E+   
Sbjct  361   TREGKAKDTFYVTDVTGNPVESKIVESIRQQIGVSKLKVKKKEDCSVLGTSRPSHETTMG  420

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
              L   IFK +S  +F L  S+S
Sbjct  421   YLLSNIFKPKSLQSFKLHLSHS  442



>ref|XP_006447024.1| hypothetical protein CICLE_v10015110mg [Citrus clementina]
 ref|XP_006470098.1| PREDICTED: uncharacterized protein LOC102618393 isoform X1 [Citrus 
sinensis]
 gb|ESR60264.1| hypothetical protein CICLE_v10015110mg [Citrus clementina]
Length=473

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/474 (57%), Positives = 335/474 (71%), Gaps = 38/474 (8%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN  C +ATVI+VDS NKHG LL+V+QVL D+NL+I KAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNNTCADATVIKVDSVNKHGILLQVIQVLNDVNLVIKKAYI  60

Query  468   CSDGGWFMD--------------------------------VFNVTNQEGSKIMDEAVLD  551
              SDGGWFMD                                VFNV + +G KI D+ V+D
Sbjct  61    SSDGGWFMDGKVYSSSAASVVSSCASFSVPHLILFLHYLISVFNVIDCDGKKIRDKEVID  120

Query  552   YIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAE  731
             YI + L  D+ FA S+R SVGV    +HTSIE  G+DRPGL SEV AVL +L CNVVNAE
Sbjct  121   YIQQRLETDASFAPSLRSSVGVMPTEEHTSIEFTGTDRPGLFSEVCAVLADLHCNVVNAE  180

Query  732   VWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITH-GATH  908
             +WTHN RAAA++ VTD  TG A+ DP+ LS IK+LL NVL+G +  R AKT ++  G  +
Sbjct  181   IWTHNDRAAAVVHVTDHSTGCAIKDPKRLSTIKELLFNVLRGYDDFRKAKTSLSPPGIMN  240

Query  909   TDRRLHQLMFADRDYER---ASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFD  1079
              +RRLHQ+MF DRDYER   A     +   RP V+V N  ++DY+V+T+R KDRPKLLFD
Sbjct  241   RERRLHQIMFDDRDYERVEKAVGRVEDKSSRPQVTVLNI-EKDYTVITMRSKDRPKLLFD  299

Query  1080  VICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVS  1259
             ++CTLTDM+YVVFHG V+    EAYQE+ IRH+DG P+ S+AER+RVI CLEAAIERR S
Sbjct  300   IVCTLTDMQYVVFHGMVNTGRTEAYQEFYIRHVDGLPISSEAERERVIQCLEAAIERRAS  359

Query  1260  EGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARI  1439
             EGL+LELCT DRVGLLS++TRIFRENSL++ RAE++T GGK  +TFYV D +G PVD +I
Sbjct  360   EGLELELCTEDRVGLLSDITRIFRENSLSIKRAEISTIGGKVKDTFYVTDVTGNPVDPKI  419

Query  1440  IESVRQTIGQTILQVKGNP-EEQNPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             I+S+R+ IG T LQVK N      P +E+ T    G  FK+R+F  F L+RSYS
Sbjct  420   IDSIRRQIGHTKLQVKHNTILAPKPPKETTTGFFLGNFFKARTFQTFKLIRSYS  473



>emb|CAN83845.1| hypothetical protein VITISV_001862 [Vitis vinifera]
Length=465

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/431 (61%), Positives = 335/431 (78%), Gaps = 2/431 (0%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+ RMNPPRV +DN + + AT+I+VDSAN+ G+LLEVVQVL D++LII
Sbjct  5     SPSLTVDDEFEKLVIRMNPPRVTVDNASSRTATLIKVDSANRRGSLLEVVQVLNDMDLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ ++ V + I +SLGP +    S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQKGNKLSEDDVAERIQQSLGPRARSFRSLRRSVGVQAANE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TD+ETG  + DP+
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDDETGLPIDDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L  IK+LL  VLKG    R A T ++ G+T+T RRLHQ+M+ADRDY+  S  + N   +
Sbjct  185   RLVKIKQLLLYVLKGDRDKRSANTAVSVGSTNTQRRLHQMMYADRDYDMDSG-STNDRSK  243

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P V+V N+ D+ Y+VV +RC DRPKLLFD +CTLTDM+YVVFH  V AEGPEAYQEY IR
Sbjct  244   PLVTVENFADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVFHATVIAEGPEAYQEYYIR  303

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AE+QRVI CLEAAI RR SEG++LELC+ DRVGLLS+VTRIFREN L+VT
Sbjct  304   HVDGCPISSEAEQQRVILCLEAAIRRRTSEGIRLELCSEDRVGLLSDVTRIFRENGLSVT  363

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR  1532
             RAEV TRG +AVN FYV D+SG PV +  IE+VR+ IG TIL+VK +   ++P QES   
Sbjct  364   RAEVTTRGSQAVNAFYVTDSSGNPVKSETIEAVRKEIGLTILRVKDDAYSKSPPQESGRF  423

Query  1533  SLFGGIFKSRS  1565
             SL G +F+SRS
Sbjct  424   SL-GNLFRSRS  433



>ref|XP_007222095.1| hypothetical protein PRUPE_ppa005632mg [Prunus persica]
 gb|EMJ23294.1| hypothetical protein PRUPE_ppa005632mg [Prunus persica]
Length=450

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/447 (60%), Positives = 336/447 (75%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL  R+NPPRV +DN + + AT+I+VDSANK G+LLE+VQVL DLNLII
Sbjct  5     SSSLTVDDEFEKLAMRINPPRVTVDNTSSRKATLIKVDSANKRGSLLELVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP +    S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLRRSVGVQAAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL++LKCNVV AEVWTHN+R A+++ +TDE TG  + DP+
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLSDLKCNVVTAEVWTHNSRMASVVFITDEATGRPIDDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              LS IKKLL  VLKG    R A T ++  +TH +RRLHQ+M+ADRDY+    +  +  DR
Sbjct  185   HLSKIKKLLLYVLKGDRDKRSANTAVSVDSTHKERRLHQMMYADRDYDMDGADCGSASDR  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AEGPEAYQEY 
Sbjct  245   SKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P+ S+ ER RVIHCLEAAI RR SEG++LELC  DRVGLLS+VTRIFREN L+
Sbjct  305   IRHTDGCPISSEGERLRVIHCLEAAIRRRTSEGIRLELCGEDRVGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN FYV DASG  V +  IE+VRQ IG TIL+VK +   ++P QES 
Sbjct  365   VTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGSTILRVKEDFYSKSPPQESV  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +F++RS     N GL++S S
Sbjct  425   RFSL-GNLFRTRSEKFLYNLGLIKSCS  450



>ref|XP_010679989.1| PREDICTED: uncharacterized protein LOC104895235 [Beta vulgaris 
subsp. vulgaris]
Length=440

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/438 (60%), Positives = 330/438 (75%), Gaps = 9/438 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             M+DEY KLIRR+NPPRVVIDN +C++ATVIQVDS NKHGTLL+VVQVL D+NLII KAY 
Sbjct  1     MEDEYAKLIRRLNPPRVVIDNISCEDATVIQVDSVNKHGTLLQVVQVLADMNLIIKKAYF  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+  G+KI D+ V++YI  ++  ++     +R SVGV    +HTSIE
Sbjct  61    SSDGGWFMDVFNVTDYHGNKIRDQEVINYIETTIESNASLWPPLRDSVGVMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL++L CNVVNAE+WTHN+RAAA++ VTD  TG A+ DP+ +  I
Sbjct  121   LTGTDRPGLLSEVCAVLSDLNCNVVNAEIWTHNSRAAAVVHVTDYSTGHAINDPKKILTI  180

Query  828   KKLLCNVLKGSNKSRHAKTQI---THGATHTDRRLHQLMFADRDYER----ASDEALNHP  986
             KKLL  V+KG N   H   Q+     G TH  RRLHQ+MF DRDYER        + N+ 
Sbjct  181   KKLLSYVVKG-NSDCHQTAQMRVSPTGTTHRGRRLHQIMFDDRDYERMERIGHSRSENNY  239

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              RP+V+V++  ++DY+V+ +R KDRPKLLFD++CTLTDM+YVVFHG V     EAYQE+ 
Sbjct  240   RRPHVTVSDCTEKDYTVIVMRSKDRPKLLFDIVCTLTDMQYVVFHGMVTTGRMEAYQEFY  299

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P++S+AER+RV+ CLEAAIERR S+GL+LELCT DRVGLLS++TRIFREN LT
Sbjct  300   IRHVDGRPIRSEAERERVMQCLEAAIERRASDGLELELCTEDRVGLLSDITRIFRENGLT  359

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQES  1523
             + RAE++T+ GKAV+TFYV D +G PVD   ++S++Q IGQTILQ+K N  +   P QE+
Sbjct  360   IRRAEISTKSGKAVDTFYVTDVTGNPVDPGTVDSIQQQIGQTILQIKHNSYQSPKPAQET  419

Query  1524  PTRSLFGGIFKSRSFCNF  1577
                 LFG  FK  S  N 
Sbjct  420   TMSFLFGNFFKYPSLQNL  437



>ref|XP_011086839.1| PREDICTED: uncharacterized protein LOC105168447 isoform X2 [Sesamum 
indicum]
Length=449

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/446 (60%), Positives = 339/446 (76%), Gaps = 5/446 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE++KL+ RMNPPRV +DN + K AT+I+VDSANK G+LLEVVQVLTDLNLII
Sbjct  5     SSSLRVDDEFKKLVIRMNPPRVTVDNASDKKATLIKVDSANKRGSLLEVVQVLTDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF VT++ G+K+ ++ V + I +SLGP       + RSVGV S ++
Sbjct  65    RRAYISSDGEWFMDVFYVTDEFGNKVYEDNVSERIQQSLGPRGHSFRLLARSVGVQSASE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE  G  + DPE
Sbjct  125   HTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEANGSPINDPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHPD  989
              L+ IK+LL  VLKG  + R A + ++ G+THT RRLHQ+M+ADRDY+ +  D A     
Sbjct  185   RLANIKQLLLYVLKGDREWRSANSAVSVGSTHTQRRLHQMMYADRDYDVQNVDNATTERT  244

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             +P V+V N  ++ Y+VV + C DRPKLLFD +CTLTDM+YVVFHG + AEGPEA QEY I
Sbjct  245   KPLVTVENCVEKGYTVVNLSCPDRPKLLFDTVCTLTDMQYVVFHGTIIAEGPEAQQEYYI  304

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DG P+ S+AERQRVIHCLEAAI+RR SEG++LELC+ DRVGLLS+VTRIFREN L+V
Sbjct  305   RHMDGCPISSEAERQRVIHCLEAAIKRRESEGIRLELCSDDRVGLLSDVTRIFRENGLSV  364

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPT  1529
             TRAEV TRG +AVN FYV DASG PV +  IE+VR+ IG TIL+VK +    +P QE+  
Sbjct  365   TRAEVTTRGTQAVNVFYVTDASGSPVKSETIEAVRKEIGLTILRVKDDTYSSSPPQETGR  424

Query  1530  RSLFGGIFKSRS---FCNFGLVRSYS  1598
              SL G +F+SRS     + GL++S S
Sbjct  425   FSL-GSLFRSRSEKFLYSLGLIKSCS  449



>ref|XP_008222209.1| PREDICTED: uncharacterized protein LOC103322107 [Prunus mume]
Length=524

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 336/447 (75%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL  R+NPPRV +DN + + AT+I+VDSANK G+LLE+VQVL DLNLII
Sbjct  79    SSSLAVDDEFEKLAMRINPPRVTVDNTSSRKATLIKVDSANKRGSLLELVQVLNDLNLII  138

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP +    S+RRSVGV +  +
Sbjct  139   RRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLRRSVGVQAAAE  198

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSE+ AVL++LKCNVV AEVWTHN+R A+++ +TDE TG  + DP+
Sbjct  199   HTTIELTGRDRPGLLSEIFAVLSDLKCNVVTAEVWTHNSRMASVVFITDEATGRPIDDPD  258

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              LS IKKLL  VLKG    R A T ++  +TH +RRLHQ+M+ADRDY+    +  +  DR
Sbjct  259   HLSKIKKLLLYVLKGDRDKRSANTAVSVDSTHKERRLHQMMYADRDYDMDGADCGSASDR  318

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AEGPEAYQEY 
Sbjct  319   SKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEAYQEYY  378

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P+ S+ ER RVIHCLEAAI RR SEG++LELC  DRVGLLS+VTRIFREN L+
Sbjct  379   IRHTDGCPISSEGERLRVIHCLEAAIRRRTSEGIRLELCGEDRVGLLSDVTRIFRENGLS  438

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN FYV DASG  V +  IE+VRQ IG TIL+VK +   ++P QES 
Sbjct  439   VTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGSTILRVKEDFNSKSPPQESV  498

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +F++RS     N GL++S S
Sbjct  499   RFSL-GNLFRTRSEKFLYNLGLIKSCS  524



>ref|XP_009343127.1| PREDICTED: uncharacterized protein LOC103935102 [Pyrus x bretschneideri]
Length=449

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/446 (59%), Positives = 334/446 (75%), Gaps = 5/446 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL  R+NPP V +DN +   AT+I+VDSANK G+LLEVVQ+L DLNLII
Sbjct  5     SPSLAVDDEFEKLAMRINPPMVTVDNASSSKATLIKVDSANKRGSLLEVVQILNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP +    S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLRRSVGVQAAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL+NLKCNVV  EVWTHN+R A+++ +TDEETG  + DPE
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLSNLKCNVVTGEVWTHNSRMASVVYITDEETGRPIDDPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYER-ASDEALNHPD  989
              L+ IK+LL  VLKG    R A T ++ G+TH +RRLHQ+M+ADRDY+  A+D   +   
Sbjct  185   HLTKIKQLLLYVLKGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDMDAADCGASDRS  244

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             +P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDMEYVV+H  V AEGPEAYQEY I
Sbjct  245   KPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGPEAYQEYYI  304

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH DG P+ S+ ERQRVIHCLEAAI RR SEG++LELC  DR GLLS+VTRIFREN L+V
Sbjct  305   RHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFRENGLSV  364

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPT  1529
             TRAEV TRG +AVN FYV DASG  V +  IE+VRQ IG  +L ++ +   ++P QES  
Sbjct  365   TRAEVTTRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLALLSLQDDFCSKSPPQESGR  424

Query  1530  RSLFGGIFKSRS---FCNFGLVRSYS  1598
              SL G +F++RS     N GL++S S
Sbjct  425   FSL-GNLFRTRSEKFLYNLGLIKSCS  449



>gb|KHF98294.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=447

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/448 (60%), Positives = 337/448 (75%), Gaps = 12/448 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRR+N PRVVIDN AC++ATVIQVDS NKHG LLE+VQVLTD+NL I KAYI
Sbjct  1     MDDEYAKLIRRVNQPRVVIDNNACEDATVIQVDSVNKHGILLELVQVLTDMNLTIRKAYI  60

Query  468   CSDGGWFMD---VFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
              SDGG  +     FNV + +G+KI D+ ++DYI + +   + F SS R SVGV    +HT
Sbjct  61    ASDGGCIVSHVSFFNVVDNDGNKIRDKEIIDYIQRRIETSAGFVSSRRGSVGVMPSEEHT  120

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
             SIEL G+DRPGLLSEV AVL +L+CNVVNAE+WTHNTRAAA++ VTD+ TG A+TD + L
Sbjct  121   SIELAGTDRPGLLSEVCAVLADLRCNVVNAEIWTHNTRAAAVVHVTDDSTGCAITDLKRL  180

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEAL----NH  983
              MIK LLCNVLKG++  + AKT ++  G  H +RRLHQ+MFADRDYER     +      
Sbjct  181   LMIKDLLCNVLKGNDDLKTAKTMLSAPGVMHRERRLHQIMFADRDYERVERTGVRAVEER  240

Query  984   PDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEY  1163
               RP V++ N  ++DY+V+T+R KDRPKLLFD+ICTLTDM+YVVFHG V+    +A QE+
Sbjct  241   SSRPQVNLLNI-EKDYTVITMRAKDRPKLLFDIICTLTDMQYVVFHGMVNTTRMDANQEF  299

Query  1164  CIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  1343
              IRH+DG P+ S+AER RVI CLEAAIERR SEGL+LELCT DR+GLLS++TRIFRENSL
Sbjct  300   YIRHVDGLPISSEAERVRVIQCLEAAIERRASEGLELELCTEDRLGLLSDITRIFRENSL  359

Query  1344  TVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEE---QNPT  1514
              + RA ++T+GGKA +TFYV D +   VD +II+S+ + IG++ LQVK N      + P 
Sbjct  360   CIKRALISTKGGKAKDTFYVTDMTENSVDPKIIDSICRQIGRSALQVKHNRSSLAPKPPH  419

Query  1515  QESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
             QE+    LFG +FK+R+F NF L+RSYS
Sbjct  420   QETTMSYLFGNLFKARTFQNFKLIRSYS  447



>ref|XP_009599622.1| PREDICTED: uncharacterized protein LOC104095244 [Nicotiana tomentosiformis]
Length=449

 Score =   532 bits (1370),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 263/446 (59%), Positives = 336/446 (75%), Gaps = 5/446 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE++KL+ RMNPPRV +DN + K  T+I+VDSANK G+LLEVVQVLTDLNLII
Sbjct  5     SSSFTVDDEFKKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ ++ V + I +SLGP      SM RSVGV S  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQYGNKLSEDNVAERIQQSLGPRGRSFRSMERSVGVQSAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSE+ AVL + K NVV AEVWTHN+R A+++ +TDEE+G A+TDP+
Sbjct  125   HTTIELTGRDRPGLLSEIFAVLADHKNNVVAAEVWTHNSRMASVVYITDEESGLAITDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L+ I+KLL  VLKG    R A T ++ G+THT+RRLHQ+M+ADRDY++     ++   R
Sbjct  185   RLAKIRKLLLYVLKGDRDRRGANTAVSVGSTHTERRLHQMMYADRDYDKDDTSCVSVDQR  244

Query  993   -PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
              P V+V +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AEGPEA QEY I
Sbjct  245   KPMVTVESCADKGYTVVNLRCADRPKLLFDAVCTLTDMQYVVYHATIIAEGPEASQEYYI  304

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DG PV S+AERQRVIHCLEAA++RR S G++LELC  DR+GLLS+VTRIFREN L+V
Sbjct  305   RHMDGCPVSSEAERQRVIHCLEAAVKRRTSTGIRLELCGDDRIGLLSDVTRIFRENGLSV  364

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPT  1529
             +RAEV T+G +A+N FYV DASG PV    IE+VR  IG TIL+V+ +    +P Q++  
Sbjct  365   SRAEVMTKGSQAINVFYVTDASGSPVKTETIEAVRNEIGMTILRVRDDLYSNSPPQQTAR  424

Query  1530  RSLFGGIFKSRS---FCNFGLVRSYS  1598
              SL G IF+SRS     N GL +SYS
Sbjct  425   FSL-GNIFRSRSEKFLYNLGLTKSYS  449



>ref|XP_006408561.1| hypothetical protein EUTSA_v10020734mg [Eutrema salsugineum]
 gb|ESQ50014.1| hypothetical protein EUTSA_v10020734mg [Eutrema salsugineum]
Length=443

 Score =   531 bits (1369),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 264/442 (60%), Positives = 330/442 (75%), Gaps = 7/442 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPPRVVIDN A ++ATVIQ+DS NKHGTLLEVVQVLTD+NL+I KAYI 
Sbjct  3     DDEYAKLIRRMNPPRVVIDNNASEDATVIQIDSVNKHGTLLEVVQVLTDMNLVIKKAYIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V + +G+KI D  VLDYI + +  ++  F    R SVGV    ++T+IE
Sbjct  63    SDGGWFMDVFKVIDHDGNKIRDTQVLDYIQRRIESNAGWFIPPSRGSVGVMPSDEYTTIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++ VTD  T  A+TDP  LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDNSTNSAITDPVRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNV++ ++ SR AKT  +   TH +RRLHQ+MF DRDYE     A     RP+V++
Sbjct  183   KELLCNVVRTNSGSRTAKTVFSCSDTHRERRLHQIMFDDRDYE-GVQRARTSASRPSVTL  241

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              N  D+DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IRH+DG 
Sbjct  242   MNIDDKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPLEAYQEFYIRHVDGL  301

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ RAE++
Sbjct  302   PINSEAEQERVIQCLEAAIERRASEGLELELSAEDRVGLLSDITRTFRENSLTIVRAEIS  361

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-----EQNPTQESPTR  1532
             TR G A + FYV D +G  V+++ +ES+RQ IG + L+VK   E         +QE+   
Sbjct  362   TREGIAKDVFYVTDVTGNAVESKTVESIRQEIGVSKLKVKNKEECSVLGTSRASQETTMW  421

Query  1533  SLFGGIFKSRSFCNFGLVRSYS  1598
              L   IF++++  NF L  S+S
Sbjct  422   YLLNNIFRAKTLRNFKLHLSHS  443



>gb|KCW61913.1| hypothetical protein EUGRSUZ_H04608 [Eucalyptus grandis]
Length=433

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/417 (62%), Positives = 325/417 (78%), Gaps = 2/417 (0%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             +DDE+EKL+ RMNPPRV +DN + K AT+++VDSANK G+LLEVVQVLTD+NLII +AYI
Sbjct  10    LDDEFEKLVLRMNPPRVAVDNASSKKATLLKVDSANKRGSLLEVVQVLTDMNLIIRRAYI  69

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVF+VT+Q+G+K+ ++ V + I +SLGP      S+R SVGV +  ++T+IE
Sbjct  70    SSDGEWFMDVFHVTDQKGNKLFEDDVAERIQQSLGPRIRSFRSLRSSVGVQAAAENTTIE  129

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV AVL NLKCNVV AEVWTHN+R A+++ +TDEE+   + DP+ L+ I
Sbjct  130   LTGRDRPGLLSEVFAVLANLKCNVVAAEVWTHNSRMASVVYITDEESSLPIDDPDRLAKI  189

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LL  VLKG      A T +T G+THT+RRLHQLM+ADRDY+    +  +  ++  +SV
Sbjct  190   KQLLLFVLKGDRDKNSANTAVTVGSTHTERRLHQLMYADRDYDMDGVDGGSAGEQSKLSV  249

Query  1008  T--NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHID  1181
             T  N  D+ Y+VV +RC+DRPKL+FD +CTLTDM+YVV+HG V AEGPEAYQEY IRH+D
Sbjct  250   TVDNCMDKGYTVVNLRCQDRPKLIFDTVCTLTDMDYVVYHGTVIAEGPEAYQEYYIRHMD  309

Query  1182  GSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
             GSP+ S+AERQRVIHCL AAI+RR SEG+KLELC  DRVGLLS+ TRIFREN L+VTRAE
Sbjct  310   GSPISSEAERQRVIHCLGAAIKRRTSEGIKLELCCPDRVGLLSDATRIFRENGLSVTRAE  369

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR  1532
             V TRG +AVNTFYV D+SG PV + IIESVR+ IG  ILQVK     Q+P Q++  R
Sbjct  370   VTTRGSQAVNTFYVTDSSGNPVKSEIIESVRKQIGVAILQVKDESYSQSPPQDTGRR  426



>ref|XP_010929567.1| PREDICTED: uncharacterized protein LOC105051015 isoform X2 [Elaeis 
guineensis]
Length=450

 Score =   531 bits (1367),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 266/441 (60%), Positives = 336/441 (76%), Gaps = 7/441 (2%)
 Frame = +3

Query  285   NMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAY  464
             ++DDEY KL+ RMNPPRV +DN + K AT+++VDS+N+HG+LLEVVQ +TDLNL I +AY
Sbjct  8     DVDDEYGKLVIRMNPPRVTVDNTSSKKATLVKVDSSNRHGSLLEVVQAITDLNLTIRRAY  67

Query  465   ICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             + SDG WFMDVF+V +Q+G+K+ D  V+D I +SLG  +    S+RRSVGV +   HT+I
Sbjct  68    VSSDGEWFMDVFHVVDQDGNKLHDSEVIDRIQQSLGAKAFDLWSLRRSVGVQASGVHTTI  127

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             ELIG +RPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE TGG + D + LS 
Sbjct  128   ELIGRNRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGGPIDDADRLSK  187

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA-SDEALNHPDRPNV  1001
             IK+LL  VLKG+   R A T I+ G THT+RRLHQ+M+ADRDY+R  +DE  +  DR  +
Sbjct  188   IKQLLRYVLKGNRDKRSANTAISLGVTHTERRLHQMMYADRDYDRGDADEEESPSDRRKL  247

Query  1002  SVT--NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
              VT  N  D+ YSVV +RCKDRPKLLFD +CTLTDM+YVVFH  + AEGPEAYQEY IRH
Sbjct  248   QVTVENCTDKGYSVVNVRCKDRPKLLFDTVCTLTDMQYVVFHATLIAEGPEAYQEYYIRH  307

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
              DG P+ S+AERQR+I CLEAAI+RR +EG++LELC  DRVGLLS+VTRIFREN LTVT 
Sbjct  308   SDGLPISSEAERQRLILCLEAAIKRRNTEGVRLELCCDDRVGLLSDVTRIFRENGLTVTC  367

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRS  1535
             AEV+TRG +AVN FYV DASG PV +R IE++R  IG+ IL VK +   ++  Q+    S
Sbjct  368   AEVSTRGSQAVNVFYVMDASGNPVQSRTIEAIRNEIGEAILHVKDDMYSKSSPQDGGKFS  427

Query  1536  LFGGIFKSRS---FCNFGLVR  1589
              FG IF+SRS     + GL+R
Sbjct  428   -FGNIFRSRSEKFLYSLGLIR  447



>gb|KHG17797.1| [Protein-PII] uridylyltransferase [Gossypium arboreum]
Length=450

 Score =   530 bits (1366),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 336/447 (75%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +D+E+EKL+ RMNPPRV +DN   + AT+I+VDSANK G+LLEVVQVLTDL+L+I
Sbjct  5     SSSLMVDEEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDLLI  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ +  V + I + LGP S    S+ RSVGV + + 
Sbjct  65    RRAYISSDGEWFMDVFHVTDQHGNKLSEVDVAEKIQQQLGPRSYSFRSLTRSVGVQAASK  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
              T IEL G DRPGLLSE+ AVLT+LKCNVV AEVWTHN+R A+++ + DE TG ++ +PE
Sbjct  125   QTIIELTGRDRPGLLSEIFAVLTDLKCNVVAAEVWTHNSRMASVVYIADETTGLSIDNPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L+ IK+LL  VLKG     +A T ++ G+ H +RRLHQ+M+ADRDY+ +   + +  DR
Sbjct  185   RLTKIKQLLLYVLKGDRDKMNANTAVSLGSMHKERRLHQMMYADRDYDMSDANSGSTSDR  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N   + Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AEGPEAYQEY 
Sbjct  245   SKPQVTVENCEHKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AE+QRVIHCLEAAI+RR SEG++LELC+ DRVGLLS+VTRIFREN L+
Sbjct  305   IRHMDGCPISSEAEQQRVIHCLEAAIKRRASEGIRLELCSDDRVGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN FYV DASG PV +  IE+VR+ IG TIL VK +   ++P QES 
Sbjct  365   VTRAEVKTRGSQAVNIFYVTDASGDPVKSETIEAVRKEIGLTILHVKDDAYSKSPPQESR  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +FKSRS     N GL++S S
Sbjct  425   IFSL-GTLFKSRSEKILYNLGLIKSCS  450



>ref|XP_009404247.1| PREDICTED: uncharacterized protein LOC103987622 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   530 bits (1366),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 327/439 (74%), Gaps = 3/439 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDE+ KLIRRMNPPRVVIDN++C +ATVI+VDS NKHG LLEVVQVLTDL+L+I KAYI 
Sbjct  13    DDEFAKLIRRMNPPRVVIDNDSCGDATVIRVDSVNKHGILLEVVQVLTDLDLVIRKAYIS  72

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT+ +G+K+ DE ++ YI KSL  ++C    ++ SVG+   T+ T IE+
Sbjct  73    SDGSWFMDVFNVTDCDGNKLWDEEIISYIKKSLESEACLFPKLQNSVGIMPSTEDTLIEI  132

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              GSDRPGLLSE+ AVL     +VV AE+WTHN R AA++ VT E T GA+ DP+ LS +K
Sbjct  133   TGSDRPGLLSEICAVLATQMSHVVKAELWTHNNRVAAVLHVTHESTEGAIEDPQQLSTLK  192

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS-DEALNHPDRPNVSV  1007
             +LLCNVL+G +  R     ++ G THT+RRLHQ+MF DRDYER    EA+ +  RP V+V
Sbjct  193   ELLCNVLRGDHDPRMGTMTVSMGLTHTERRLHQMMFHDRDYERVEVKEAVGNKSRPQVTV  252

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              +  ++DY+VV +R KDRPKLLFD ICTLTDM+YVVFHG   A   EAYQEY IRH+DG 
Sbjct  253   MDCSEKDYTVVILRSKDRPKLLFDTICTLTDMQYVVFHGTASAGKEEAYQEYYIRHVDGL  312

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+ E+Q +I CLEAA+ERR S+GL+LEL T D VG LS +TR+FREN LT+ RAE++
Sbjct  313   PISSEVEQQHLIQCLEAAVERRASDGLELELKTEDEVGSLSEITRVFRENGLTIRRAEIS  372

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQESPTRSLF  1541
             T GGK V+TF++ + SG PVDA+ I+S+R+ +GQTI++VK NP  E + P +   T S F
Sbjct  373   TEGGKEVDTFHLSETSGNPVDAKTIDSIRRQLGQTIVRVKQNPLLEAKPPPEVVSTVSFF  432

Query  1542  GGIFKSRSFCNFGLVRSYS  1598
              G     SF +F L+RSYS
Sbjct  433   FGNLFRASFQSFRLIRSYS  451



>ref|XP_008776535.1| PREDICTED: uncharacterized protein LOC103696629 [Phoenix dactylifera]
Length=451

 Score =   530 bits (1366),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 266/444 (60%), Positives = 337/444 (76%), Gaps = 7/444 (2%)
 Frame = +3

Query  285   NMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAY  464
             ++DDEY KL+ RMNPPRV +DN + K AT+++VDS N+HG+LLEVVQ LTDLNL I +AY
Sbjct  9     DVDDEYGKLVIRMNPPRVTVDNTSSKKATLVKVDSVNRHGSLLEVVQALTDLNLTIRRAY  68

Query  465   ICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSI  644
             I SDG WFMDVF+V +Q+G+K+    V+D I +SLG  +     +RR+VGV +   HT+I
Sbjct  69    ISSDGEWFMDVFHVVDQDGNKLHGSEVIDRIQQSLGAKAFDLWLLRRTVGVQASAAHTTI  128

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             ELIG +RPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE TGGA+ D + LS 
Sbjct  129   ELIGRNRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGGAIDDADHLSK  188

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS-DEALNHPDRPN-  998
             IK LLC VLKG+   R AKT I+ G THT+RRLHQ+M+ADRDY+R   DE  +  D+   
Sbjct  189   IKLLLCYVLKGNPDKRSAKTAISLGVTHTERRLHQMMYADRDYDRGDVDEEESPSDQSKL  248

Query  999   -VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
              V+V N  D+ YSVV +RCKDRPKLLFD +CTLTDM+YVVFH  + AEGPEAYQEY IRH
Sbjct  249   LVTVENCSDKGYSVVNVRCKDRPKLLFDTVCTLTDMQYVVFHATLIAEGPEAYQEYYIRH  308

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             +DG P+ S+AER+R+I CLEAAI+RR +EG++LELC  DR+GLLS+VTRIFREN LTVT 
Sbjct  309   LDGFPISSEAERRRLILCLEAAIKRRNTEGVRLELCCDDRIGLLSDVTRIFRENGLTVTC  368

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRS  1535
             AEV+TRG +AVN FYV DASG PV ++ IE+VR  IG+TIL VK +   ++  Q+    S
Sbjct  369   AEVSTRGSQAVNVFYVMDASGNPVQSQTIEAVRNEIGETILHVKDDMYSKSSPQDGGKFS  428

Query  1536  LFGGIFKSRS---FCNFGLVRSYS  1598
             L G +F+SRS     + G +RS S
Sbjct  429   L-GNLFRSRSEKFLYSLGFIRSGS  451



>ref|XP_007043904.1| ACT domain repeat 4 isoform 2 [Theobroma cacao]
 gb|EOX99735.1| ACT domain repeat 4 isoform 2 [Theobroma cacao]
Length=450

 Score =   530 bits (1365),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 338/447 (76%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +D+E+EKL+ RMNPPRV +DN   + AT+I+VDSANK G+LLEVVQVLTDL+LII
Sbjct  5     SPSLTLDEEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ +  V + I + LGP +    S+ RSVGV + + 
Sbjct  65    RRAYISSDGEWFMDVFHVTDQYGNKLSEVDVAERIQQQLGPRAYSFRSLTRSVGVQAASK  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE TG ++ +PE
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGSSIDNPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYER--ASDEALNHP  986
              L+ IK+LL  VLKG      A T ++ G+THT+RRLHQ+M+ADRDY+   A   + +  
Sbjct  185   RLTKIKQLLLYVLKGDRDQMRANTAVSVGSTHTERRLHQMMYADRDYDMNDADSGSTSEW  244

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V A+GPEAYQEY 
Sbjct  245   SKPLVTVENCADKGYTVVNLRCLDRPKLLFDTVCTLTDMQYVVYHATVIADGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG PV S+ ERQRVI+CLEAAI+RR SEG++LELC+ DRVGLLS+VTRIFREN L+
Sbjct  305   IRHMDGCPVSSEPERQRVINCLEAAIKRRASEGIRLELCSEDRVGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN F V DASG PV +  IE+VR+ +G TIL VK +   ++P QES 
Sbjct  365   VTRAEVTTRGSQAVNAFCVTDASGDPVKSETIEAVRKELGLTILHVKDDAYSKSPPQESG  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +FKSRS     N GL++S S
Sbjct  425   GFSL-GTLFKSRSEKFLYNLGLIKSCS  450


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 86/201 (43%), Gaps = 13/201 (6%)
 Frame = +3

Query  237  HNPSRISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLE  416
            H   R+          +M+D         + P V ++N A K  TV+ +   ++   L +
Sbjct  216  HTERRLHQMMYADRDYDMNDADSGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLFD  275

Query  417  VVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASS  596
             V  LTD+  ++  A + +DG      + + + +G  +  E     ++      +C  ++
Sbjct  276  TVCTLTDMQYVVYHATVIADGPEAYQEYYIRHMDGCPVSSEPERQRVI------NCLEAA  329

Query  597  MRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVT  776
            ++R       ++   +EL   DR GLLS+V+ +      +V  AEV T  ++A     VT
Sbjct  330  IKR-----RASEGIRLELCSEDRVGLLSDVTRIFRENGLSVTRAEVTTRGSQAVNAFCVT  384

Query  777  DEETGGAVTDPETLSMIKKLL  839
            D    G     ET+  ++K L
Sbjct  385  D--ASGDPVKSETIEAVRKEL  403



>ref|XP_008389912.1| PREDICTED: uncharacterized protein LOC103452175 [Malus domestica]
Length=449

 Score =   530 bits (1365),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 264/446 (59%), Positives = 333/446 (75%), Gaps = 5/446 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL  R+NPP V +DN + + AT+I+VDSANK G+LLEVVQVL DLNLII
Sbjct  5     SPSLAVDDEFEKLAMRINPPMVTVDNASGRKATLIKVDSANKRGSLLEVVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP +    S+RR VGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAERIQQSLGPRARSFRSLRRXVGVQAAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL+NLKCNVV  EVWTHN+R A+++ +TDEETG  + DPE
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLSNLKCNVVAGEVWTHNSRMASVVYITDEETGRPIDDPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYER-ASDEALNHPD  989
              L+ IK+LL  VLKG    R A T ++ G+TH +RRLHQ+M+ADRDY+   +D   +   
Sbjct  185   HLTKIKQLLLYVLKGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDMDNADSVASDRS  244

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             +P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDMEYVV+H  V AEGPEAYQEY I
Sbjct  245   KPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGPEAYQEYYI  304

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH DG P+ S+ ERQRVIHCLEAAI RR SEG++LELC  DR GLLS+VTRIFREN L+V
Sbjct  305   RHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFRENGLSV  364

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPT  1529
             TRAEV TRG +AVN FYV DASG  V +  IE+VRQ IG  +L ++ +   ++P QES  
Sbjct  365   TRAEVTTRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLALLSLQDDFCSKSPPQESGR  424

Query  1530  RSLFGGIFKSRS---FCNFGLVRSYS  1598
              SL G +F++RS     N GL++S S
Sbjct  425   FSL-GNLFRTRSEKFLYNLGLIKSCS  449



>ref|XP_009785185.1| PREDICTED: uncharacterized protein LOC104233484 [Nicotiana sylvestris]
Length=442

 Score =   530 bits (1364),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 263/444 (59%), Positives = 336/444 (76%), Gaps = 9/444 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C++AT+IQVDS NKHG LL+VVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDSCEDATIIQVDSVNKHGILLQVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+K+ DE +++YI K+L  D     S+R +VG+    +HTSIE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVRDEEIINYIQKTLENDEVLLPSLRGTVGLMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNA +WTHN RAAA++ V D  TG A+ DP+ L++I
Sbjct  121   LSGTDRPGLLSEVCAVLADLSCNVVNAAIWTHNARAAAVVHVVDNSTGCAIEDPKRLAII  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY------ERASDEALNHP  986
             KKLL NVLK +N  + AK  ++  G TH +RRLHQ+MFADRDY      E+   E L   
Sbjct  181   KKLLHNVLKCNNDLKTAKMTLSPPGFTHRERRLHQIMFADRDYVKVRRTEQGKVEDLK--  238

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              RP ++V +  ++DY+V+T+R +DRPKLLFD++CTLTDM+YVVFHG V     EAYQE+ 
Sbjct  239   SRPCINVYDCSEKDYTVITMRSRDRPKLLFDIVCTLTDMQYVVFHGVVHTGKKEAYQEFY  298

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+RV  CLEAAIERR SEGL+LELCT DR+GLLS++TRIFRENSL 
Sbjct  299   IRHVDGIPISSEAERERVKQCLEAAIERRASEGLELELCTEDRLGLLSDITRIFRENSLC  358

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             V RAE++T GGKA + FYV D +G PVD + ++S+ + +GQ +L VK NP      +E  
Sbjct  359   VKRAEISTEGGKAKDIFYVTDVTGNPVDQKTVDSICEQVGQNMLHVKWNPCHSKLPEEGT  418

Query  1527  TRSLFGGIFKSRSFCNFGLVRSYS  1598
                LFG +FK R+  N  L++ Y+
Sbjct  419   ISYLFGNLFKVRTLQNLNLMKYYT  442



>ref|XP_009421053.1| PREDICTED: uncharacterized protein LOC104000676 [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   529 bits (1363),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 258/438 (59%), Positives = 327/438 (75%), Gaps = 3/438 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPPRVVIDN+AC NATVI+VDS  KHG LLEV+QVLTDL+LIITKAYI 
Sbjct  11    DDEYAKLIRRMNPPRVVIDNDACDNATVIRVDSIKKHGILLEVIQVLTDLDLIITKAYIS  70

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT++ G+K+ D+ ++  I  SLG D+ F   +  SV +    +HT IE+
Sbjct  71    SDGSWFMDVFNVTDRNGNKVRDKEIISCIQNSLGSDAFFFPRIGNSVDIVPSKEHTFIEM  130

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G+DRPGLLSE+ AVL N  C+V  AE+WTHNTR AA++ VT+E TG AV DPE LS IK
Sbjct  131   TGTDRPGLLSEICAVLANRNCSVAKAELWTHNTRVAAVVHVTEESTGAAVEDPERLSTIK  190

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVT  1010
             +LLCNVL+G N SR  +  ++   THT+RRLHQ+MF DRDYE     A +   RP V+V 
Sbjct  191   ELLCNVLRGDNDSRMGRMTVSKDRTHTERRLHQMMFGDRDYESTVVGAGDDKPRPQVAVM  250

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             +  ++DYSVV +R +DRPKLLFD +CTLTDM+YVVFHG VD    EAYQEY IRH+DG P
Sbjct  251   DCAEKDYSVVILRSRDRPKLLFDTVCTLTDMQYVVFHGTVDTRDDEAYQEYYIRHVDGCP  310

Query  1191  VKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT  1370
             + S+AERQRVI CLEAAIERR +EGL+L L T DR GLLS+VTR+FREN LT+ RAE++T
Sbjct  311   INSEAERQRVIKCLEAAIERRTTEGLELVLRTEDRPGLLSDVTRVFRENGLTIRRAEIST  370

Query  1371  RGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQESPTRSLFG  1544
             +GGKA +TFY+ + SG PV+A+ I+S+ + +G+ +++VK +P    + P     T  LFG
Sbjct  371   QGGKASDTFYLSEMSGKPVEAKTIDSICRQLGEMVVRVKQSPLLAPKPPEVAGATSFLFG  430

Query  1545  GIFKSRSFCNFGLVRSYS  1598
              + K+ S  +F LV S+S
Sbjct  431   NLLKA-SLQSFRLVGSHS  447



>ref|XP_004310107.1| PREDICTED: uncharacterized protein LOC101292961 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   528 bits (1360),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 334/447 (75%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE++KL  R+NPPRV +DN   + AT+I+VDSANK G+LLEVVQVL DLNLI+
Sbjct  5     SPSLAVDDEFQKLALRVNPPRVTVDNGTSRKATLIKVDSANKRGSLLEVVQVLNDLNLIV  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP +    ++R SVGV + ++
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLYDDGIAECIQQSLGPRARSFRALRSSVGVQAASE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DR GLLSEV AVL  LKCNVV  EVWTHN+R A+++ +TDEETG  + DP 
Sbjct  125   HTTIELTGRDRAGLLSEVFAVLAELKCNVVAGEVWTHNSRMASVVYITDEETGKPIDDPL  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              LS IK+ L NVLK     R A T ++ G+TH +RRLHQ+M+ADRDY+  S ++ +  DR
Sbjct  185   RLSEIKEFLLNVLKADKDMRTANTAVSVGSTHKERRLHQMMYADRDYDLHSADSGSASDR  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AEGPEAYQEY 
Sbjct  245   TKPFVTVENCADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P+ S+ ERQRVIHCLEAAI RR SEG++LELC  DR GLLS+VTRIFRENSL+
Sbjct  305   IRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFRENSLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN FYV  ASG PV +  IE+VRQ IG TIL+V+ +   ++P QES 
Sbjct  365   VTRAEVMTRGSQAVNVFYVTGASGNPVTSETIEAVRQEIGLTILRVEEDMYSKSPPQESG  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +F++RS     N GL++S S
Sbjct  425   RFSL-GNLFRTRSEKFLYNLGLIKSCS  450



>ref|XP_006437973.1| hypothetical protein CICLE_v10031521mg [Citrus clementina]
 ref|XP_006484166.1| PREDICTED: uncharacterized protein LOC102625080 isoform X1 [Citrus 
sinensis]
 ref|XP_006484167.1| PREDICTED: uncharacterized protein LOC102625080 isoform X2 [Citrus 
sinensis]
 gb|ESR51213.1| hypothetical protein CICLE_v10031521mg [Citrus clementina]
Length=450

 Score =   528 bits (1359),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 262/440 (60%), Positives = 335/440 (76%), Gaps = 6/440 (1%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DE+EKL+ RMNPPRV +DN + + AT+I+VDSANK G+LLE+VQVL DL+LII +AYI S
Sbjct  12    DEFEKLVLRMNPPRVTVDNTSSRKATLIKVDSANKRGSLLELVQVLNDLDLIIRRAYISS  71

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDVF+VT+Q G+K+ ++ V + I +SLGP +    S+RRSVGV +  +HT+IEL 
Sbjct  72    DGEWFMDVFHVTDQNGNKLSEDDVSERIQQSLGPRARSFRSLRRSVGVQAALEHTTIELT  131

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G DRPGLLSEV AVL++LKCNV+ AEVWTHN+R A+++ +T E TG  + DP+TL+ IK+
Sbjct  132   GRDRPGLLSEVFAVLSDLKCNVMGAEVWTHNSRMASVVYITSEATGLPIDDPDTLAKIKQ  191

Query  834   LLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR--PNVSV  1007
             LL  VLKG    R A T ++  +TH +RRLHQ+M+ADRDY+    E+ +   R  P V+V
Sbjct  192   LLLYVLKGDRDKRSANTAVSVDSTHKERRLHQMMYADRDYDMNYAESGSASGRSKPLVTV  251

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AE PEAYQEY IRH+DG+
Sbjct  252   ESCTDKGYTVVNLRCPDRPKLLFDAVCTLTDMQYVVYHATVIAESPEAYQEYYIRHVDGN  311

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AERQRVI+CLEAAI+RR SEG+ LELC  DR GLLS+VTRIFREN L+VTRAEV 
Sbjct  312   PISSEAERQRVINCLEAAIKRRTSEGISLELCCEDRAGLLSDVTRIFRENGLSVTRAEVT  371

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLFGG  1547
             TRG +AVN FYV DASG PV +  IESVR+ IG TIL+VK +   ++P QES   SL G 
Sbjct  372   TRGSQAVNVFYVVDASGNPVKSETIESVRKEIGLTILRVKDDAYSKSPPQESGRFSL-GN  430

Query  1548  IFKSRS---FCNFGLVRSYS  1598
             +F+SRS     N GL++S S
Sbjct  431   LFRSRSEKFLYNLGLIKSCS  450



>ref|XP_002511139.1| amino acid binding protein, putative [Ricinus communis]
 gb|EEF51741.1| amino acid binding protein, putative [Ricinus communis]
Length=452

 Score =   528 bits (1359),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 267/449 (59%), Positives = 333/449 (74%), Gaps = 16/449 (4%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DEY KLIRRMN PRVVIDN+AC++AT++QVD+ N++GTLL+VVQVLTDLNLIITKAYI S
Sbjct  6     DEYAKLIRRMNSPRVVIDNDACEHATIVQVDTLNRYGTLLQVVQVLTDLNLIITKAYISS  65

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDVF VT  +G+K+ DE++L+YI K+L  D    +S+R S+ +    +HTSIEL 
Sbjct  66    DGVWFMDVFYVTGNDGNKVEDESILNYIKKALERDGHVVNSIRSSIAMLPSKEHTSIELS  125

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G+DRPGLLSEVSAVLT+L C+VVNAE+WTHN R AAIM +T++ TG AV +P+ LS+IK+
Sbjct  126   GTDRPGLLSEVSAVLTDLGCSVVNAEIWTHNFRVAAIMHITEQSTGCAVEEPKRLSLIKE  185

Query  834   LLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVT  1010
             LL NVLKG++  R  K  I+    TH  RRLHQ+MFA RD+ER  + A      P V V+
Sbjct  186   LLRNVLKGNSTFRSPKVSISSPEETHIGRRLHQMMFAARDFERL-ESAKEKGVEPCVIVS  244

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             +  D+DY+VVT+RC DRPKLLFD +  LTDM+YVVFHG V   G EAYQEY IRH+DG P
Sbjct  245   DCADKDYTVVTVRCIDRPKLLFDTVFALTDMQYVVFHGTVITGGKEAYQEYYIRHVDGLP  304

Query  1191  VKSDAERQRVIHCLEAAIERRVSE-----------GLKLELCTTDRVGLLSNVTRIFREN  1337
             + S+AERQRV  CLEAAIERR SE           GL+LELCT DR GLLS++TRIFREN
Sbjct  305   ISSEAERQRVTECLEAAIERRASERYTHRNVTLSQGLELELCTDDRFGLLSDITRIFREN  364

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG--NPEEQNP  1511
              L++ RAE++T+ GKA +TF+V D +G  VD   +  +R+ IGQTIL  KG  N   + P
Sbjct  365   GLSIQRAEISTKNGKAKDTFFVTDVAGNSVDPTTVRMIREQIGQTILHAKGKLNVLSKFP  424

Query  1512  TQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              QE+P   LFG  FK RSF +FGLV+SYS
Sbjct  425   -QETPRSFLFGSFFKGRSFHHFGLVKSYS  452



>ref|XP_008454022.1| PREDICTED: uncharacterized protein LOC103494569 [Cucumis melo]
Length=449

 Score =   527 bits (1358),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 261/440 (59%), Positives = 338/440 (77%), Gaps = 6/440 (1%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DEY+KL+ RMNPPRV IDN + + AT+I+VDS+N+HG+LLEVVQVLTDLNLII +AYI S
Sbjct  11    DEYQKLVIRMNPPRVSIDNTSSRKATLIKVDSSNRHGSLLEVVQVLTDLNLIIRRAYISS  70

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDVF+VT+Q G K+ D+ V + I +SLGP +    S+RRSVGV +  +HT+IEL 
Sbjct  71    DGEWFMDVFHVTDQNGKKLCDDGVGERIQQSLGPRARSFRSLRRSVGVQAAAEHTTIELS  130

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TD+ +G  + DP+ L+ IK+
Sbjct  131   GRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDDTSGMPIDDPDWLAKIKQ  190

Query  834   LLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHPDRPNVSVT  1010
             LL  VLKG      A T ++  +TH +RRLHQ+M+ADRD++   +  + ++  RP V+V 
Sbjct  191   LLLYVLKGDRDKHSANTAVSMNSTHKERRLHQMMYADRDFDLNYTSCSESYQSRPLVTVE  250

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             N  ++ Y+VV +RC DRPKLLFD +CTLTDM+YVV+HG + AE PEAYQEY IRH+DGSP
Sbjct  251   NCVEKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEEPEAYQEYFIRHVDGSP  310

Query  1191  VKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT  1370
             + S+AERQRVIHCLEAAI+RR +EG+KLELC+ DRVGLL++VTRIFREN L+VTRAEV+T
Sbjct  311   ISSEAERQRVIHCLEAAIKRRTTEGIKLELCSEDRVGLLTDVTRIFRENGLSVTRAEVST  370

Query  1371  RGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-PTQESPTRSLFGG  1547
             RG +AVN FYV DASG  V +  I++VR+ IG TIL VK + ++   P QE    SL G 
Sbjct  371   RGTQAVNVFYVTDASGNSVRSETIKAVREAIGLTILHVKDDEQQSKCPPQEGSGFSL-GN  429

Query  1548  IFKSRS---FCNFGLVRSYS  1598
             +F+SRS     N GL++S S
Sbjct  430   LFRSRSEKVLYNLGLIKSCS  449



>gb|KDO81815.1| hypothetical protein CISIN_1g044728mg [Citrus sinensis]
Length=450

 Score =   527 bits (1358),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 262/440 (60%), Positives = 335/440 (76%), Gaps = 6/440 (1%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DE+EKL+ RMNPPRV +DN + + AT+I+VDSANK G+LLE+VQVL DL+LII +AYI S
Sbjct  12    DEFEKLVLRMNPPRVTVDNTSNRKATLIKVDSANKRGSLLELVQVLNDLDLIIRRAYISS  71

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDVF+VT+Q G+K+ ++ V + I +SLGP +    S+RRSVGV +  +HT+IEL 
Sbjct  72    DGEWFMDVFHVTDQNGNKLSEDDVSERIQQSLGPRARSFRSLRRSVGVQAALEHTTIELT  131

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G DRPGLLSEV AVL++LKCNV+ AEVWTHN+R A+++ +T E TG  + DP+TL+ IK+
Sbjct  132   GRDRPGLLSEVFAVLSDLKCNVMGAEVWTHNSRMASVVYITSEATGLPIDDPDTLAKIKR  191

Query  834   LLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR--PNVSV  1007
             LL  VLKG    R A T ++  +TH +RRLHQ+M+ADRDY+    E+ +   R  P V+V
Sbjct  192   LLLYVLKGDRDKRSANTAVSVDSTHKERRLHQMMYADRDYDMNYAESGSASGRSKPLVTV  251

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AE PEAYQEY IRH+DG+
Sbjct  252   ESCTDKGYTVVNLRCPDRPKLLFDAVCTLTDMQYVVYHATVIAESPEAYQEYYIRHVDGN  311

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AERQRVI+CLEAAI+RR SEG+ LELC  DR GLLS+VTRIFREN L+VTRAEV 
Sbjct  312   PISSEAERQRVINCLEAAIKRRTSEGISLELCCEDRAGLLSDVTRIFRENGLSVTRAEVT  371

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLFGG  1547
             TRG +AVN FYV DASG PV +  IESVR+ IG TIL+VK +   ++P QES   SL G 
Sbjct  372   TRGSQAVNVFYVVDASGNPVKSETIESVRKEIGLTILRVKDDAYSKSPPQESGRFSL-GN  430

Query  1548  IFKSRS---FCNFGLVRSYS  1598
             +F+SRS     N GL++S S
Sbjct  431   LFRSRSEKFLYNLGLIKSCS  450



>emb|CDP13377.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   527 bits (1357),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 267/445 (60%), Positives = 336/445 (76%), Gaps = 6/445 (1%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S ++DDE+EKL  R+NPP V +DNE+ K AT+I+VDSAN+ G+LLEVVQVLTDLNLII +
Sbjct  7     SVSVDDEFEKLALRINPPMVTVDNESDKKATLIKVDSANRRGSLLEVVQVLTDLNLIIKR  66

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             AYI SDG WFMDVF+VT+Q+G+K+ ++ V + I +SLGP      S RRSVGV    +H 
Sbjct  67    AYISSDGEWFMDVFHVTDQDGNKLSEDKVAERIQQSLGPRGRSFRSFRRSVGVQPALEHA  126

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
             +IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE  G A+ DPE L
Sbjct  127   TIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEVNGVAIDDPERL  186

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR--  992
             S IK+LL +VLKG+   R A T ++ G+TH +RRLHQ+M+ADRDY+    +     DR  
Sbjct  187   SKIKQLLLHVLKGNKDRRSANTAVSVGSTHKERRLHQMMYADRDYDNDVMDCAPTSDRTK  246

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P V+V    D+ Y+VV + C DRPKLLFD +CTLTDM+YVV+HG + AEGPEA+QEY IR
Sbjct  247   PLVTVEKCADKGYTVVNLSCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEGPEAHQEYYIR  306

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             HIDG P+ S+AERQR+IHCLEAAI+RR SEG++LELC+ DRVGLLS+VTRIFREN L+VT
Sbjct  307   HIDGWPISSEAERQRLIHCLEAAIKRRTSEGIRLELCSEDRVGLLSDVTRIFRENGLSVT  366

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR  1532
             RAEV TRG +AVN FYV DASGYPV    IE+VR+ IG TIL+VK      +P Q+    
Sbjct  367   RAEVTTRGSQAVNVFYVTDASGYPVKNETIEAVRKEIGLTILRVKDETYSTSPPQQGGKF  426

Query  1533  SLFGGIFKSRS---FCNFGLVRSYS  1598
             SL G +F+SRS     + GL++S S
Sbjct  427   SL-GNLFRSRSERFLFSLGLIKSCS  450



>emb|CDP20649.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   525 bits (1353),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 265/445 (60%), Positives = 338/445 (76%), Gaps = 10/445 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KL+RRMNPPRVVIDN++C++AT+IQV S  KHG LL VVQVLTDL+L+ITKAYI
Sbjct  1     MDDEYAKLLRRMNPPRVVIDNDSCEDATIIQVYSVKKHGILLHVVQVLTDLDLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
               DGGWFMDVFNV ++ G+K+ +E V+D+I K+L  D   A S+RR+VG+ S  +HTSIE
Sbjct  61    SLDGGWFMDVFNVIDRSGNKVQEEEVIDHIKKTLESDDISAPSLRRTVGLMSSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVLT+L CNVVNAE+WTHN RAAA++ V D+ TG A+ DP+ L+ I
Sbjct  121   LAGTDRPGLLSEVCAVLTDLHCNVVNAEIWTHNARAAAVVHVADDSTGYAIEDPKRLATI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY---ERASDEALNHPDRP  995
             K LLC+VLKG++  R  K  ++  G TH  RRLHQ+MFADRDY   ER    A      P
Sbjct  181   KALLCSVLKGNSDMRSPKMTLSPPGVTHRGRRLHQIMFADRDYVKVERVQGRAEEKGSSP  240

Query  996   NVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRH  1175
              V+V N  ++DY+V+T+R KDRPKLLFD+ICTLTDM+YVVFHG V     EAYQEY IRH
Sbjct  241   QVTVFNCSEKDYTVITMRSKDRPKLLFDIICTLTDMQYVVFHGVVHTRRMEAYQEYYIRH  300

Query  1176  IDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTR  1355
             +DG P+  +AER+RV+ CLEAAIERR SEGL+LELC  DRVGLLS++TRIFRENSL++ R
Sbjct  301   VDGLPISLEAERERVVQCLEAAIERRASEGLELELCAEDRVGLLSDITRIFRENSLSIKR  360

Query  1356  AEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQ-ESPTR  1532
             AE++T GGK  +TFYV D +G PVD + I+SVR  IGQ++L+V   P   +P + E  T+
Sbjct  361   AEISTEGGKVRDTFYVTDVTGNPVDDKTIDSVRGEIGQSLLRVI--PNSGSPVEAEGATK  418

Query  1533  S---LFGGIFKSRSFCNFGLVRSYS  1598
             +   +FG  F+++SF +  L++S S
Sbjct  419   TIGCIFGSFFRAKSFQDSKLIKSCS  443



>ref|XP_010090668.1| [Protein-PII] uridylyltransferase [Morus notabilis]
 gb|EXB40332.1| [Protein-PII] uridylyltransferase [Morus notabilis]
Length=451

 Score =   526 bits (1354),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 264/441 (60%), Positives = 335/441 (76%), Gaps = 7/441 (2%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DE+EKL+ R+NPPRV +DN + + AT+I+VDSAN+ G+LLEVVQVLTDLNLII +AYI S
Sbjct  12    DEFEKLMMRINPPRVTVDNASSRKATLIKVDSANRRGSLLEVVQVLTDLNLIIRRAYISS  71

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDVF+VT+Q G K+ ++ V + I +SLGP +    S+RRSVGV + T++T+IEL 
Sbjct  72    DGEWFMDVFHVTDQHGKKLSEDDVAERIQQSLGPRAHSFRSLRRSVGVQAATENTTIELT  131

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G+DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE TG  + D + L+ IK+
Sbjct  132   GTDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEATGLPIDDADHLTKIKQ  191

Query  834   LLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDY--ERASDEALNHPDRPNVSV  1007
             LL  VLKG    R A T ++  +TH DRRLHQ+M+ADRDY  E +     + P +P  +V
Sbjct  192   LLLYVLKGDRDKRSANTAVSVDSTHKDRRLHQMMYADRDYDVEDSDGGTTSEPRKPLATV  251

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              N  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  V AEGPEA QEY IRH DG 
Sbjct  252   ENCADKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEACQEYYIRHTDGC  311

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AERQRVI+CLEAAI RR SEG++LELC+ DRVGLLS+VTRIFREN L+V+RAEV 
Sbjct  312   PISSEAERQRVINCLEAAIRRRNSEGIRLELCSDDRVGLLSDVTRIFRENGLSVSRAEVT  371

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVK-GNPEEQNPTQESPTRSLFG  1544
             TRG +AVN FYV DASG PV +  IE+VR+ IG TIL+VK  +   ++P QE    SL G
Sbjct  372   TRGSQAVNVFYVTDASGNPVRSETIEAVRKEIGLTILRVKEEDLSSKSPPQEGGRFSL-G  430

Query  1545  GIFKSRS---FCNFGLVRSYS  1598
              +F+SRS     N GL++SYS
Sbjct  431   NLFRSRSEKFLYNLGLIKSYS  451



>ref|XP_011086838.1| PREDICTED: uncharacterized protein LOC105168447 isoform X1 [Sesamum 
indicum]
Length=462

 Score =   526 bits (1354),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 269/459 (59%), Positives = 339/459 (74%), Gaps = 18/459 (4%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVI-------------QVDSANKHGTLL  413
             S S  +DDE++KL+ RMNPPRV +DN + K AT+I             QVDSANK G+LL
Sbjct  5     SSSLRVDDEFKKLVIRMNPPRVTVDNASDKKATLIKVLQTFVSFPDFLQVDSANKRGSLL  64

Query  414   EVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFAS  593
             EVVQVLTDLNLII +AYI SDG WFMDVF VT++ G+K+ ++ V + I +SLGP      
Sbjct  65    EVVQVLTDLNLIIRRAYISSDGEWFMDVFYVTDEFGNKVYEDNVSERIQQSLGPRGHSFR  124

Query  594   SMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQV  773
              + RSVGV S ++HT+IEL G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +
Sbjct  125   LLARSVGVQSASEHTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYI  184

Query  774   TDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDY  953
             TDE  G  + DPE L+ IK+LL  VLKG  + R A + ++ G+THT RRLHQ+M+ADRDY
Sbjct  185   TDEANGSPINDPERLANIKQLLLYVLKGDREWRSANSAVSVGSTHTQRRLHQMMYADRDY  244

Query  954   E-RASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNV  1130
             + +  D A     +P V+V N  ++ Y+VV + C DRPKLLFD +CTLTDM+YVVFHG +
Sbjct  245   DVQNVDNATTERTKPLVTVENCVEKGYTVVNLSCPDRPKLLFDTVCTLTDMQYVVFHGTI  304

Query  1131  DAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLS  1310
              AEGPEA QEY IRH+DG P+ S+AERQRVIHCLEAAI+RR SEG++LELC+ DRVGLLS
Sbjct  305   IAEGPEAQQEYYIRHMDGCPISSEAERQRVIHCLEAAIKRRESEGIRLELCSDDRVGLLS  364

Query  1311  NVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKG  1490
             +VTRIFREN L+VTRAEV TRG +AVN FYV DASG PV +  IE+VR+ IG TIL+VK 
Sbjct  365   DVTRIFRENGLSVTRAEVTTRGTQAVNVFYVTDASGSPVKSETIEAVRKEIGLTILRVKD  424

Query  1491  NPEEQNPTQESPTRSLFGGIFKSRS---FCNFGLVRSYS  1598
             +    +P QE+   SL G +F+SRS     + GL++S S
Sbjct  425   DTYSSSPPQETGRFSL-GSLFRSRSEKFLYSLGLIKSCS  462



>ref|XP_010927766.1| PREDICTED: uncharacterized protein LOC105049725 [Elaeis guineensis]
Length=430

 Score =   524 bits (1350),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 254/427 (59%), Positives = 322/427 (75%), Gaps = 4/427 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIR+MNPP V+IDN+AC +ATVIQV+S N +G LLEVV+VL DLNLIITKAYI 
Sbjct  4     DDEYAKLIRKMNPPSVIIDNDACDDATVIQVNSVNANGILLEVVRVLIDLNLIITKAYIS  63

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVFNVT++ G+K+ D+ ++ YI  SL  ++C +S  + SVGV     +TSIEL
Sbjct  64    SDGKWFMDVFNVTDRNGNKLRDKKIISYIQTSLESEACLSSLRKSSVGVKPSNGYTSIEL  123

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
             +G+DRPGLLSE+   LT+ KCNVV AE+WTHNTR A+++ VTDE T  A+ DPE LS IK
Sbjct  124   MGTDRPGLLSEICTALTDFKCNVVKAELWTHNTRVASVVHVTDESTRSAIEDPERLSTIK  183

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERAS--DEALNHPDRPNVS  1004
             +LL +VLKG + SR AK  ++ G THT+RRLHQ+M+ DRDYE     +E +    RP VS
Sbjct  184   ELLHDVLKGGDDSRRAKMTVSTGGTHTERRLHQMMYDDRDYEGVGLVEEGVKKS-RPQVS  242

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V +  +++Y++  +RCKDR KLLFD ICTLTDM+YVVFHG VD    EAY EYCIRHIDG
Sbjct  243   VMDCKEKNYTIFVLRCKDRSKLLFDTICTLTDMQYVVFHGTVDTGNGEAYHEYCIRHIDG  302

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
               VK++AER R++ CLEAAI+RR SEGL+LEL T DRVGLLS++TRIFREN L VTRAE+
Sbjct  303   HRVKTEAERDRLVQCLEAAIQRRASEGLELELRTGDRVGLLSDITRIFRENGLCVTRAEI  362

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQE-SPTRSLF  1541
             +T+G KAV+TFYV + SG PVDA+ I+S+R+ IG+ +L+VK  P    P++  S   SL 
Sbjct  363   STQGSKAVDTFYVSEMSGSPVDAKTIDSIRRQIGRMVLRVKQGPFPSKPSEATSAIASLL  422

Query  1542  GGIFKSR  1562
                 K R
Sbjct  423   RNFLKGR  429



>gb|AAS07062.1| putative ACT domain containing protein, ACR4, with alternative 
splicing forms [Oryza sativa Japonica Group]
 gb|ABF96587.1| ACT domain containing protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=374

 Score =   522 bits (1344),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 259/374 (69%), Positives = 300/374 (80%), Gaps = 6/374 (2%)
 Frame = +3

Query  489   MDVFNVTNQEGSKIMDEAVLD----YIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIG  656
             M VFNVT+Q G KIMDE+VLD    YI K LG DSCF  S RRSVGV   +D+T IEL G
Sbjct  1     MSVFNVTDQNGQKIMDESVLDEIVKYIHKCLGADSCFLPSRRRSVGVEPSSDYTLIELTG  60

Query  657   SDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKL  836
             +DRPGLLSEVSAVLTNL+CNVVNAEVWTHN RAAA+MQV D +TG A++D + L+ IK+ 
Sbjct  61    TDRPGLLSEVSAVLTNLECNVVNAEVWTHNKRAAAVMQVMDRKTGLAISDTQRLARIKER  120

Query  837   LCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSVTNW  1016
             L  V KGSN+S+  KT +T G THT+RRLHQLM  DRDYER   +  N    P VSV NW
Sbjct  121   LSYVFKGSNRSQDTKTTVTMGITHTERRLHQLMLEDRDYERYDKDRTNVNPTPVVSVVNW  180

Query  1017  HDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVK  1196
              D+DYSVV IRCKDRPKLLFD +CTLTDM+YVVFHG+VD+EGPEAYQEY IRHIDGSPV 
Sbjct  181   LDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVDSEGPEAYQEYYIRHIDGSPVN  240

Query  1197  SDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRG  1376
             S+AERQRVI CLEAAIERRVSEGLKLEL T DRVGLLS+VTRIFREN LTVTRAEV+TRG
Sbjct  241   SEAERQRVIQCLEAAIERRVSEGLKLELSTGDRVGLLSDVTRIFRENGLTVTRAEVSTRG  300

Query  1377  GKAVNTFYVGDASG-YPVDARIIESVRQTIGQTILQVKGNPEE-QNPTQESPTRSLFGGI  1550
              KAVNTFYV DA+G   VD + +E++RQ IGQT+LQVKG+P+  ++P QESP+R LF  +
Sbjct  301   DKAVNTFYVRDAAGSSAVDLKTLEAIRQEIGQTVLQVKGHPDHRKSPPQESPSRFLFSSL  360

Query  1551  FKSRSFCNFGLVRS  1592
             F+ RS  + GL+RS
Sbjct  361   FRPRSLYSLGLIRS  374


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 83/181 (46%), Gaps = 13/181 (7%)
 Frame = +3

Query  294  DEYEKLIRRMNP-PRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
            + Y+K    +NP P V + N   K+ +V+ +   ++   L + V  LTD+  ++    + 
Sbjct  160  ERYDKDRTNVNPTPVVSVVNWLDKDYSVVNIRCKDRPKLLFDTVCTLTDMQYVVFHGSVD  219

Query  471  SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
            S+G      + + + +GS +  EA    +++      C  +++ R V     ++   +EL
Sbjct  220  SEGPEAYQEYYIRHIDGSPVNSEAERQRVIQ------CLEAAIERRV-----SEGLKLEL  268

Query  651  IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
               DR GLLS+V+ +       V  AEV T   +A     V D   G +  D +TL  I+
Sbjct  269  STGDRVGLLSDVTRIFRENGLTVTRAEVSTRGDKAVNTFYVRD-AAGSSAVDLKTLEAIR  327

Query  831  K  833
            +
Sbjct  328  Q  328



>ref|XP_004152119.1| PREDICTED: uncharacterized protein LOC101215960 [Cucumis sativus]
 gb|KGN53037.1| hypothetical protein Csa_4G011840 [Cucumis sativus]
Length=449

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 260/440 (59%), Positives = 335/440 (76%), Gaps = 6/440 (1%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DEY+KL+ RMNPPRV IDN + + AT+I+VDS+N+HG+LLEVVQVLTDLNLII +AYI S
Sbjct  11    DEYQKLVIRMNPPRVSIDNTSSRKATLIKVDSSNRHGSLLEVVQVLTDLNLIIRRAYISS  70

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDVF+VT+Q G K+ D+ V + I +SLGP +    S+RRSVGV +  +HT+IEL 
Sbjct  71    DGEWFMDVFHVTDQNGKKLCDDGVGERIQQSLGPRARSFRSLRRSVGVQAAAEHTTIELS  130

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TD+ +G  + DP+ L+ IK+
Sbjct  131   GRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDDTSGMPIDDPDWLAKIKQ  190

Query  834   LLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHPDRPNVSVT  1010
             LL  VLKG      A T ++  +TH +RRLHQ+M+ADRD++   +  + ++  RP V+V 
Sbjct  191   LLLYVLKGDRDKHSANTAVSMNSTHKERRLHQMMYADRDFDLNYTSCSESYQSRPLVTVE  250

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             N  ++ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AE PEAYQEY IRH+DGSP
Sbjct  251   NCVEKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEEPEAYQEYFIRHVDGSP  310

Query  1191  VKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT  1370
             + S+AERQRVIHCLEAAI RR +EG+KLELC+ DRVGLL++VTRIFREN L+VTRAEV T
Sbjct  311   ISSEAERQRVIHCLEAAIRRRTTEGIKLELCSEDRVGLLTDVTRIFRENGLSVTRAEVTT  370

Query  1371  RGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-PTQESPTRSLFGG  1547
             RG +AVN FYV DASG  V +  I++VR+ IG TIL VK + ++   P QE    SL G 
Sbjct  371   RGTQAVNVFYVTDASGNSVRSETIKAVREAIGLTILHVKDDEQQSKCPPQEGSGFSL-GN  429

Query  1548  IFKSRS---FCNFGLVRSYS  1598
             +F+SRS     N GL++S S
Sbjct  430   LFRSRSEKVLYNLGLIKSCS  449



>ref|XP_010249096.1| PREDICTED: uncharacterized protein LOC104591777 [Nelumbo nucifera]
Length=453

 Score =   524 bits (1350),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 267/450 (59%), Positives = 335/450 (74%), Gaps = 9/450 (2%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S ++DDE+EKL+ RMNPPRV +DN +   AT+I+VDSANKHG+LLEVVQVLTDLNL I
Sbjct  5     SSSVDVDDEFEKLVIRMNPPRVTVDNISSSKATLIKVDSANKHGSLLEVVQVLTDLNLTI  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCF-ASSMRRSVGVTSGT  629
             ++AYI SDG WFMDVF+V +Q G+K+ DE V+D I +SLGP       S+RRSVGV +  
Sbjct  65    SRAYISSDGEWFMDVFHVIDQNGNKLSDEKVIDRIQQSLGPSRVQNLRSLRRSVGVQAAA  124

Query  630   DHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDP  809
             +HT++EL G DRPGLLSE+ AVL +LKCNVV AE+WTHN+R A+++ + DE TG ++ D 
Sbjct  125   EHTTVELTGRDRPGLLSEIFAVLMDLKCNVVAAEIWTHNSRMASVVYINDEATGSSIDDG  184

Query  810   ETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYER-ASDEALNHP  986
             + L+ IK+LL  VLKG    R A T ++ GATHT RRLHQ+M+ADRDY++    + +   
Sbjct  185   DRLARIKQLLLYVLKGDRDMRTANTAVSVGATHTQRRLHQMMYADRDYDKDYYVDGVPTT  244

Query  987   DR--PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQE  1160
             DR  P V V N  D+ Y+VV +RC+DRPKLLFD +CTLTDM+YVVFH  V+ EGPEA QE
Sbjct  245   DRSKPCVMVENCVDKGYTVVNLRCQDRPKLLFDTVCTLTDMQYVVFHATVNTEGPEACQE  304

Query  1161  YCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENS  1340
             Y IRH DG P+ S+AERQR+IHCL AAI+RR +EG++LELC+ DRVGLLS+VTRIFREN 
Sbjct  305   YYIRHKDGCPISSEAERQRLIHCLVAAIQRRSTEGIRLELCSEDRVGLLSDVTRIFRENG  364

Query  1341  LTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP-EEQNPTQ  1517
             L VTRAEV T G +AVN FYV D+SG PV +  IE+VR  IGQTIL VK      + P Q
Sbjct  365   LVVTRAEVTTCGSQAVNVFYVMDSSGNPVKSETIEAVRSEIGQTILHVKEEMYTNKTPAQ  424

Query  1518  ESPTRSLFGGIFKSRS---FCNFGLVRSYS  1598
             E+   SL G +F+SRS     N GL+RS S
Sbjct  425   ENGRFSL-GNLFRSRSEKILYNLGLIRSCS  453



>ref|XP_010682711.1| PREDICTED: uncharacterized protein LOC104897524 [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 262/447 (59%), Positives = 338/447 (76%), Gaps = 9/447 (2%)
 Frame = +3

Query  279   SQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITK  458
             S  +D+E++KL+ RMNPPRV +DN + +N T+I+VDSANK G+LLEVVQVL D+NLII +
Sbjct  7     SLKVDEEFQKLVLRMNPPRVTVDNSSSRNTTLIKVDSANKRGSLLEVVQVLNDMNLIIRR  66

Query  459   AYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             AYI SDG WFMDVF+VT+Q G+K+ ++ V + I +SLGP +  +   RRSVGV +  +HT
Sbjct  67    AYISSDGEWFMDVFHVTDQHGNKLCEDDVAERIQQSLGPRA-RSFRSRRSVGVQAAVEHT  125

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
             +IEL G DRPGLLSE+ AVLT+ KCNVV AEVWTH++R A+++ +TDE TG A+ DP+ L
Sbjct  126   TIELTGRDRPGLLSEIFAVLTDHKCNVVAAEVWTHSSRMASVVYITDEATGSAIYDPDRL  185

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEAL----NHP  986
             + I+ LL  VL      R A T ++ G THT+RRLHQ+M+ADRDY+  +   +    + P
Sbjct  186   TRIENLLLAVLMEDRDKRSANTAVSVGGTHTERRLHQMMYADRDYDMMNMNGVIPGCSQP  245

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              +P V+V N  +R Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AEGPEAYQEY 
Sbjct  246   RKPLVTVDNCSERGYTVVNLRCADRPKLLFDTVCTLTDMQYVVYHATLIAEGPEAYQEYY  305

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P+ S+AERQR+IHCLEAAI RR SEG+ LELC+ DRVGLLS+VTRIFREN L+
Sbjct  306   IRHTDGCPISSEAERQRLIHCLEAAISRRTSEGIMLELCSDDRVGLLSDVTRIFRENGLS  365

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +A N FYV D+SG PV ++ IE+VR+ IGQTIL+VK +   ++P QES 
Sbjct  366   VTRAEVTTRGSQATNVFYVIDSSGNPVKSQTIEAVRKEIGQTILRVKEDEYSKSPPQESG  425

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G +FKSRS     N GL++SYS
Sbjct  426   RFSL-GNLFKSRSEKFLYNLGLIKSYS  451



>ref|NP_186848.1| ACT domain-containing protein 6 [Arabidopsis thaliana]
 sp|Q9SGA0.1|ACR6_ARATH RecName: Full=ACT domain-containing protein ACR6; AltName: Full=Protein 
ACT DOMAIN REPEATS 6 [Arabidopsis thaliana]
 gb|AAF14836.1|AC011664_18 unknown protein [Arabidopsis thaliana]
 gb|AAM93431.1| ACR6 [Arabidopsis thaliana]
 dbj|BAC42843.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63976.1| unknown protein [Arabidopsis thaliana]
 gb|AEE73747.1| ACT domain-containing protein 6 [Arabidopsis thaliana]
Length=433

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 257/393 (65%), Positives = 312/393 (79%), Gaps = 3/393 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPPRVVIDN A  +ATVIQVDS NKHGTLLEVVQVLTD+NL+I KAYI 
Sbjct  3     DDEYAKLIRRMNPPRVVIDNNASDDATVIQVDSVNKHGTLLEVVQVLTDMNLVIKKAYIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V +Q+G+KI D  VLDYI K +  ++  F   +R SVGV    ++TSIE
Sbjct  63    SDGGWFMDVFKVIDQDGNKIRDTQVLDYIQKRIESNAGWFIPPLRSSVGVMPTDEYTSIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++ VTD  T  A+TDP  LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDNSTHSAITDPIRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNV++ ++ SR AKT  +   TH +RRLHQ+MF DRDYE     A     RP+V++
Sbjct  183   KELLCNVVRTNSGSRAAKTVFSCSDTHRERRLHQIMFDDRDYE-GVKRARTSASRPSVTL  241

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              N  ++DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IRH+DG 
Sbjct  242   MNI-EKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPVEAYQEFYIRHVDGL  300

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ RAE++
Sbjct  301   PINSEAEQERVIQCLEAAIERRASEGLELELSAEDRVGLLSDITRTFRENSLTIVRAEIS  360

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIG  1466
             TR GKA +TFYV D +G PV+++I+ES+RQ IG
Sbjct  361   TREGKAKDTFYVTDVTGNPVESKIVESIRQQIG  393



>ref|XP_011036119.1| PREDICTED: uncharacterized protein LOC105133725 [Populus euphratica]
Length=448

 Score =   523 bits (1347),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 267/443 (60%), Positives = 338/443 (76%), Gaps = 9/443 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             M+DE+EKL+ RMNPPRV +DN + + AT+I+VDSANK G+LLEVVQVLTDLNL+IT+AYI
Sbjct  9     MNDEFEKLVIRMNPPRVTVDNASSRKATLIKVDSANKRGSLLEVVQVLTDLNLLITRAYI  68

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVF VT+Q G+K+ ++ V + I +SLGP      S+RRSVGV +  ++T+IE
Sbjct  69    SSDGEWFMDVFYVTDQHGNKLSEDDVAERIQQSLGPRGRSFRSLRRSVGVQAAAENTTIE  128

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSE+ A+LT+LKCNVV +EVWTHN+R A+++ +TDE TG  + DP+ L+ I
Sbjct  129   LTGRDRPGLLSEIFAILTDLKCNVVASEVWTHNSRMASVVYITDEATGLPIDDPDRLTKI  188

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR-PNVS  1004
             K+LL  VLKG    R A T ++  +TH +RRLHQ+M+ADRDY+    +  +   R P V+
Sbjct  189   KQLLLYVLKGDRDKRSANTAVSVDSTHKERRLHQMMYADRDYDMDDADFGSASGRKPFVT  248

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V N  D+ Y++V +RC DRPKLLFD +CTLTDM+YVV+HG + AEGPEA QEY IRH+DG
Sbjct  249   VENCVDKGYTIVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEGPEACQEYFIRHVDG  308

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
             SPV S+AERQRVI+CLEAAI RR SEG++LELC+ DRVGLLS+VTRIFREN L+VTRAEV
Sbjct  309   SPVSSEAERQRVINCLEAAIRRRTSEGVRLELCSEDRVGLLSDVTRIFRENGLSVTRAEV  368

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF-  1541
              TRG +AVN FYV D+SGYPV    IE+VR+ IG TIL V  +   ++P QE   R LF 
Sbjct  369   TTRGFQAVNVFYVTDSSGYPVKNETIEAVRKEIGSTILHVNDDAHSKSPPQE---RGLFS  425

Query  1542  -GGIFKSRS---FCNFGLVRSYS  1598
              G IF+SRS     N GL+RSYS
Sbjct  426   LGNIFRSRSEKFLYNLGLIRSYS  448



>gb|ADE77534.1| unknown [Picea sitchensis]
Length=439

 Score =   522 bits (1345),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 264/439 (60%), Positives = 328/439 (75%), Gaps = 13/439 (3%)
 Frame = +3

Query  321   MNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVF  500
             MN PRVVIDN  C NAT+++VDSANKHG LLE VQVLTDL L I KA + SDG WFMDVF
Sbjct  1     MNSPRVVIDNAVCGNATLVKVDSANKHGILLEAVQVLTDLKLNINKANVSSDGRWFMDVF  60

Query  501   NVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD-HTSIELIGSDRPGLL  677
              VT++ G K+ DE V+ YI K+L  + C   S  +SVGV    D HT+IEL G+DRPGLL
Sbjct  61    YVTDENGKKLTDEGVIGYIEKTLETNPCILPSFGKSVGVEVAADQHTAIELTGTDRPGLL  120

Query  678   SEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKG  857
             SE+ AVL++LKCNVV AEVWTHN R A ++ VTDEETG  + D + +  I++LL NV++G
Sbjct  121   SEIFAVLSDLKCNVVEAEVWTHNRRVACLVYVTDEETGAPIDDGQKICKIEELLRNVMRG  180

Query  858   SNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA------SDEALNHPD--RPNVSVTN  1013
             ++  R AKT  + G THT+RRLHQLMFADRDYE+       +   LN  D  +P+V+V N
Sbjct  181   NSNIRGAKTVASMGLTHTERRLHQLMFADRDYEKLDGTVGRAPPPLNDNDNAKPHVTVEN  240

Query  1014  WHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPV  1193
               +R YSVV ++CKDRPKLLFDV+CTLTDMEYVVFH  +D++GP+ +QEY IRH DG PV
Sbjct  241   CLERGYSVVNVQCKDRPKLLFDVVCTLTDMEYVVFHATIDSQGPQTHQEYYIRHTDGCPV  300

Query  1194  KSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATR  1373
              S+AERQRVI CLEAAI RR SEG++LELCT DRVGLLS+VTRIFREN ++VTRAEV+TR
Sbjct  301   NSEAERQRVIQCLEAAIRRRASEGVRLELCTNDRVGLLSDVTRIFRENGMSVTRAEVSTR  360

Query  1374  GGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGN-PEEQNPTQESPTRSLFGGI  1550
             G KAVN FYV DA+G PVD + +E+VR+ IG TILQVK N  + ++P +E      FG +
Sbjct  361   GDKAVNVFYVTDAAGNPVDPKTVEAVRREIGLTILQVKDNCMDTKSPRREPAIPFSFGNL  420

Query  1551  FKSRS---FCNFGLVRSYS  1598
             FKS+S     + GL++SYS
Sbjct  421   FKSKSERFLYSLGLIKSYS  439



>ref|XP_010496419.1| PREDICTED: uncharacterized protein LOC104773493 [Camelina sativa]
 ref|XP_010496421.1| PREDICTED: uncharacterized protein LOC104773493 [Camelina sativa]
 ref|XP_010496422.1| PREDICTED: uncharacterized protein LOC104773493 [Camelina sativa]
 ref|XP_010496423.1| PREDICTED: uncharacterized protein LOC104773493 [Camelina sativa]
Length=435

 Score =   522 bits (1344),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 271/436 (62%), Positives = 330/436 (76%), Gaps = 16/436 (4%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPPRVVIDN AC +ATVIQVDS NKHGTLLEVVQVLTD NL+I KAYI 
Sbjct  3     DDEYAKLIRRMNPPRVVIDNNACDDATVIQVDSVNKHGTLLEVVQVLTDTNLVIKKAYIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V +Q G KI D  VLDYI + +  ++  F   +R SVGV    ++T+IE
Sbjct  63    SDGGWFMDVFKVIDQFGQKIRDTQVLDYIQRRIESNAGWFVPPLRSSVGVMPSDEYTAIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++ VTD  T  A+TD   LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDHSTNSAITDLIRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-----RASDEALNHPDR  992
             K+LLCNV++ ++ SR AKT  +   TH +RRLHQ+MF DRDYE     RAS  A     R
Sbjct  183   KELLCNVVRTNSGSRAAKTVFSSSDTHRERRLHQIMFDDRDYEYEGVKRASPSA----SR  238

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             PNV++ N  D+DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IR
Sbjct  239   PNVTLMNI-DKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPVEAYQEFYIR  297

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ 
Sbjct  298   HVDGLPINSEAEQERVIQCLEAAIERRASEGLELELLAEDRVGLLSDITRTFRENSLTIV  357

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-----EQNPTQ  1517
             RAE++TR GKA +TFYV D +G PV+++I+ES+R+ IG + L+VK N +        P+Q
Sbjct  358   RAEISTREGKAKDTFYVTDVTGNPVESKIVESIRKEIGVSKLKVKNNEDCSVLGTSRPSQ  417

Query  1518  ESPTRSLFGGIFKSRS  1565
             E+    L   IFK +S
Sbjct  418   ETTMGYLLSNIFKPKS  433



>gb|KHN13850.1| [Protein-PII] uridylyltransferase [Glycine soja]
Length=450

 Score =   522 bits (1344),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 267/442 (60%), Positives = 332/442 (75%), Gaps = 6/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             + DE+EKL+ RMNPPRV +DN +    TVI+VDSANK G+LLEVVQVLTD+NL + +AYI
Sbjct  10    LHDEFEKLVIRMNPPRVAVDNISSGTDTVIKVDSANKRGSLLEVVQVLTDMNLSVRRAYI  69

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVF+VT+Q G K M + V D I +SLGP +    S+RRSVGV +  +HT+IE
Sbjct  70    SSDGEWFMDVFHVTDQNGKKFMQDDVADRIQQSLGPRASSFRSLRRSVGVQAEAEHTTIE  129

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG ++ DP+ L+ I
Sbjct  130   LTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGLSIDDPDRLAKI  189

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPN--V  1001
             K+LL  VLKG    + A T ++ G+TH DRRLHQLM+ADRDY+    ++ +  DR    V
Sbjct  190   KQLLLYVLKGDIDKKRANTAVSVGSTHKDRRLHQLMYADRDYDVDDGDSGSTSDRNKLLV  249

Query  1002  SVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHID  1181
             +V +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+HG V AEGPEAYQEY IRH+D
Sbjct  250   TVDDCIDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEGPEAYQEYYIRHVD  309

Query  1182  GSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
             GSP+ S+AERQRVIHCLEAA+ RR SEG+KLELC  DRVGLLS+VTRIFREN L+V RAE
Sbjct  310   GSPISSEAERQRVIHCLEAAVRRRTSEGIKLELCGEDRVGLLSDVTRIFRENGLSVNRAE  369

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF  1541
             V TRG +A+N FYV D SG PV +  IE+VR+ IG TILQVK +   + P QES   SL 
Sbjct  370   VTTRGSQAMNVFYVTDVSGNPVKSETIETVRKEIGLTILQVKDDVCSKPPPQESGKFSL-  428

Query  1542  GGIFKSRS---FCNFGLVRSYS  1598
               +F+S S     N GL++SYS
Sbjct  429   SNLFRSSSEKFLYNLGLMKSYS  450



>ref|XP_004156949.1| PREDICTED: uncharacterized LOC101215960 [Cucumis sativus]
Length=449

 Score =   521 bits (1343),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 259/440 (59%), Positives = 334/440 (76%), Gaps = 6/440 (1%)
 Frame = +3

Query  294   DEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICS  473
             DEY+KL+ RMNPPRV IDN + + AT+I+VDS+N+HG+LLEVVQVLTDLNLII +AYI S
Sbjct  11    DEYQKLVIRMNPPRVSIDNTSSRKATLIKVDSSNRHGSLLEVVQVLTDLNLIIRRAYISS  70

Query  474   DGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELI  653
             DG WFMDV +VT+Q G K+ D+ V + I +SLGP +    S+RRSVGV +  +HT+IEL 
Sbjct  71    DGEWFMDVLHVTDQNGKKLCDDGVGERIQQSLGPRARSFRSLRRSVGVQAAAEHTTIELS  130

Query  654   GSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKK  833
             G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TD+ +G  + DP+ L+ IK+
Sbjct  131   GRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDDTSGMPIDDPDWLAKIKQ  190

Query  834   LLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYE-RASDEALNHPDRPNVSVT  1010
             LL  VLKG      A T ++  +TH +RRLHQ+M+ADRD++   +  + ++  RP V+V 
Sbjct  191   LLLYVLKGDRDKHSANTAVSMNSTHKERRLHQMMYADRDFDLNYTSCSESYQSRPLVTVE  250

Query  1011  NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSP  1190
             N  ++ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AE PEAYQEY IRH+DGSP
Sbjct  251   NCVEKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHATIIAEEPEAYQEYFIRHVDGSP  310

Query  1191  VKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVAT  1370
             + S+AERQRVIHCLEAAI RR +EG+KLELC+ DRVGLL++VTRIFREN L+VTRAEV T
Sbjct  311   ISSEAERQRVIHCLEAAIRRRTTEGIKLELCSEDRVGLLTDVTRIFRENGLSVTRAEVTT  370

Query  1371  RGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQN-PTQESPTRSLFGG  1547
             RG +AVN FYV DASG  V +  I++VR+ IG TIL VK + ++   P QE    SL G 
Sbjct  371   RGTQAVNVFYVTDASGNSVRSETIKAVREAIGLTILHVKDDEQQSKCPPQEGSGFSL-GN  429

Query  1548  IFKSRS---FCNFGLVRSYS  1598
             +F+SRS     N GL++S S
Sbjct  430   LFRSRSEKVLYNLGLIKSCS  449



>ref|XP_010929566.1| PREDICTED: uncharacterized protein LOC105051015 isoform X1 [Elaeis 
guineensis]
Length=463

 Score =   521 bits (1343),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 266/454 (59%), Positives = 336/454 (74%), Gaps = 20/454 (4%)
 Frame = +3

Query  285   NMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAY  464
             ++DDEY KL+ RMNPPRV +DN + K AT+++VDS+N+HG+LLEVVQ +TDLNL I +AY
Sbjct  8     DVDDEYGKLVIRMNPPRVTVDNTSSKKATLVKVDSSNRHGSLLEVVQAITDLNLTIRRAY  67

Query  465   ICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMK-------------SLGPDSCFASSMRR  605
             + SDG WFMDVF+V +Q+G+K+ D  V+D I +             SLG  +    S+RR
Sbjct  68    VSSDGEWFMDVFHVVDQDGNKLHDSEVIDRIQQISAGNINKDFRTMSLGAKAFDLWSLRR  127

Query  606   SVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEE  785
             SVGV +   HT+IELIG +RPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TDE 
Sbjct  128   SVGVQASGVHTTIELIGRNRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDEA  187

Query  786   TGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERA-  962
             TGG + D + LS IK+LL  VLKG+   R A T I+ G THT+RRLHQ+M+ADRDY+R  
Sbjct  188   TGGPIDDADRLSKIKQLLRYVLKGNRDKRSANTAISLGVTHTERRLHQMMYADRDYDRGD  247

Query  963   SDEALNHPDRPNVSVT--NWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDA  1136
             +DE  +  DR  + VT  N  D+ YSVV +RCKDRPKLLFD +CTLTDM+YVVFH  + A
Sbjct  248   ADEEESPSDRRKLQVTVENCTDKGYSVVNVRCKDRPKLLFDTVCTLTDMQYVVFHATLIA  307

Query  1137  EGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNV  1316
             EGPEAYQEY IRH DG P+ S+AERQR+I CLEAAI+RR +EG++LELC  DRVGLLS+V
Sbjct  308   EGPEAYQEYYIRHSDGLPISSEAERQRLILCLEAAIKRRNTEGVRLELCCDDRVGLLSDV  367

Query  1317  TRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP  1496
             TRIFREN LTVT AEV+TRG +AVN FYV DASG PV +R IE++R  IG+ IL VK + 
Sbjct  368   TRIFRENGLTVTCAEVSTRGSQAVNVFYVMDASGNPVQSRTIEAIRNEIGEAILHVKDDM  427

Query  1497  EEQNPTQESPTRSLFGGIFKSRS---FCNFGLVR  1589
               ++  Q+    S FG IF+SRS     + GL+R
Sbjct  428   YSKSSPQDGGKFS-FGNIFRSRSEKFLYSLGLIR  460



>ref|XP_002297856.1| hypothetical protein POPTR_0001s13490g [Populus trichocarpa]
 gb|ABK95686.1| unknown [Populus trichocarpa]
 gb|EEE82661.1| hypothetical protein POPTR_0001s13490g [Populus trichocarpa]
Length=448

 Score =   521 bits (1341),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 266/442 (60%), Positives = 337/442 (76%), Gaps = 9/442 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDE+EKL+ RMNPPRV +DN + + AT+I+VDSANK G+LLEVVQVLTDLNLII +AYI 
Sbjct  10    DDEFEKLVIRMNPPRVTVDNASSRKATLIKVDSANKRGSLLEVVQVLTDLNLIIRRAYIS  69

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIEL  650
             SDG WFMDVF VT+Q G+K+ ++ V + I +SLGP      S+RRSVGV +  ++T+IEL
Sbjct  70    SDGEWFMDVFYVTDQHGNKLSEDDVAERIQQSLGPRGRSFRSLRRSVGVQAAAENTTIEL  129

Query  651   IGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIK  830
              G DRPGLLSE+ A+LT+LKCNVV +EVWTHN+R A+++ +TDE TG  + DP+ L+ IK
Sbjct  130   TGRDRPGLLSEIFAILTDLKCNVVASEVWTHNSRMASVVYITDEATGLPIDDPDRLTKIK  189

Query  831   KLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR-PNVSV  1007
             +LL  VLKG    R A T ++  +TH +RRLHQ+M+ADRDY+    +  +  +R P V++
Sbjct  190   QLLLYVLKGDRDKRSANTAVSVDSTHKERRLHQMMYADRDYDMDDADFGSASERKPFVTL  249

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              N  D+ Y++V +RC DRPKLLFD +CTLTDM+YVV+HG + AEGPEA QEY IRH+DGS
Sbjct  250   ENCVDKGYTIVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTIIAEGPEACQEYFIRHMDGS  309

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             PV S+AERQRVI+CLEAAI RR SEG++LELC+ DRVGLLS+VTRIFREN L+VTRAEV 
Sbjct  310   PVSSEAERQRVINCLEAAIRRRTSEGVRLELCSEDRVGLLSDVTRIFRENGLSVTRAEVT  369

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF--  1541
             TRG +AVN FYV D+SGYPV    IE+VR+ IG TIL V  +   ++P QE   R LF  
Sbjct  370   TRGSQAVNVFYVTDSSGYPVKNETIEAVRKEIGLTILHVNDDAHSKSPPQE---RGLFSL  426

Query  1542  GGIFKSRS---FCNFGLVRSYS  1598
             G IF+SRS     N GL+RSYS
Sbjct  427   GNIFRSRSEKFLYNLGLIRSYS  448



>gb|EMT11618.1| (Protein-PII) uridylyltransferase [Aegilops tauschii]
Length=537

 Score =   523 bits (1348),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 260/435 (60%), Positives = 325/435 (75%), Gaps = 13/435 (3%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY+  IR+MNPP ++IDN++  +AT+++V SAN++G LLEV+QVL DLNL+I+KAYI 
Sbjct  32    DDEYDNFIRKMNPPSIIIDNDSLVDATIVKVGSANEYGILLEVIQVLMDLNLVISKAYIT  91

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVL----DYIMKSLGPDSCFASSMRRSVGVTSGTDHT  638
             SDGGWFMDVFNVT++EG K+ D+A +     YI KSLG DS +  + RRSVGV + TDH 
Sbjct  92    SDGGWFMDVFNVTDKEGMKLKDKAAIAEIEGYIRKSLGADSRYMPAKRRSVGVAASTDHN  151

Query  639   SIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETL  818
              IEL GSDRPGLLSEVSAVL +LKCNVV+AE+WTHNTR AA+M+VTDE+T  AVTD   L
Sbjct  152   VIELTGSDRPGLLSEVSAVLASLKCNVVSAEIWTHNTRVAAVMRVTDEDTMLAVTDTVRL  211

Query  819   SMIKKLLCNVLKGSNKSRHAKTQITHG--ATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              MIK+ L  +L+G+N SR A      G  AT+T+RRLHQ+M +D D E         P R
Sbjct  212   EMIKERLSYLLRGNNLSRGAAMAEASGTSATNTERRLHQMMLSDGDTEEFHGHVPAQPQR  271

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             PNV+V NW D+DYSVVTIRCKDRPKLLFD +CTLTD+ YVV+H N+DA   +AYQE+ +R
Sbjct  272   PNVTVRNWKDKDYSVVTIRCKDRPKLLFDTVCTLTDLRYVVYHANIDASNNQAYQEFYVR  331

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H++GSP+ ++AER RVI CLE+AIERRVSEG+KLELC+ D+VGLLS VTRIFRENSLTVT
Sbjct  332   HVNGSPMNTEAERLRVIQCLESAIERRVSEGVKLELCSNDKVGLLSEVTRIFRENSLTVT  391

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTR  1532
             RAEV+TRG  AVNTFYV  ++G  VD + I+S+R+ IG  I  V       N T  S T 
Sbjct  392   RAEVSTRGRTAVNTFYVRSSAGEIVDQKTIDSIREAIGHNIQSV-------NTTVGSTTN  444

Query  1533  SLFGGIFKSRSFCNF  1577
                G +  S +  +F
Sbjct  445   KESGTVTASENMSSF  459



>ref|XP_008459880.1| PREDICTED: uncharacterized protein LOC103498865 isoform X2 [Cucumis 
melo]
Length=451

 Score =   520 bits (1339),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 268/448 (60%), Positives = 341/448 (76%), Gaps = 7/448 (2%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+ RMNPPRV IDN++ + AT+I+VDSANK G+LLEVVQVL DLNLII
Sbjct  5     SLSLPLDDEFEKLVNRMNPPRVTIDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ +  V + I +SLGP +    S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQHGNKLSENDVAERIQQSLGPRARSFRSLRRSVGVQAAEE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG +++DP+
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGFSISDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L  IK+LL  VLKG    R A T ++ G+TH +RRLHQ+M+ADRDY++   +  +  +R
Sbjct  185   RLGKIKQLLLFVLKGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDQDDLDCGSTSER  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +R  DRPKLLFD +CTLTDM+YVV+H  V AEGPEA QEY 
Sbjct  245   RKPLVTVENCADKGYTVVNLRSPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEASQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DGSP+ S+AERQRVIHCLEAAI RR SEG++LELC+ DR GLLS+VTRIFREN L+
Sbjct  305   IRHMDGSPISSEAERQRVIHCLEAAIRRRTSEGIRLELCSEDRAGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQES  1523
             VTRAEV TRG +AVN FYV DASG PV + +IE+VR+ IG T+L VK +    ++P+ ES
Sbjct  365   VTRAEVTTRGTQAVNVFYVTDASGNPVKSEMIEAVRKEIGLTVLCVKDDEFCMKSPSPES  424

Query  1524  PTRSLFGGIFKSRS---FCNFGLVRSYS  1598
                SL G +F+SRS     N GL++S S
Sbjct  425   SRFSL-GNLFRSRSEKFLYNLGLIKSCS  451



>ref|XP_003552661.1| PREDICTED: uncharacterized protein LOC100816426 [Glycine max]
Length=450

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 266/442 (60%), Positives = 331/442 (75%), Gaps = 6/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             + DE+EKL+ RMNPPRV +DN +    TVI+VDSANK G+LLEVVQVLTD+NL + +AYI
Sbjct  10    LHDEFEKLVIRMNPPRVAVDNISSGTDTVIKVDSANKRGSLLEVVQVLTDMNLSVRRAYI  69

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVF+VT+Q G K M + V D I +SLGP +    S+RRSVGV +  +HT+IE
Sbjct  70    SSDGEWFMDVFHVTDQNGKKFMQDDVADRIQQSLGPRASSFRSLRRSVGVQAEAEHTTIE  129

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG ++ DP+ L+ I
Sbjct  130   LTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGLSIDDPDRLAKI  189

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPN--V  1001
             K+LL  VLKG    + A T ++ G+TH DRRLHQLM+ADRDY+    ++ +  DR    V
Sbjct  190   KQLLLYVLKGDIDKKSANTAVSVGSTHKDRRLHQLMYADRDYDVDDGDSGSTSDRNKLLV  249

Query  1002  SVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHID  1181
             +V +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+HG V AEGPEAYQEY IRH+D
Sbjct  250   TVDDCIDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEGPEAYQEYYIRHVD  309

Query  1182  GSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
             GSP+ S+AERQRVIHCLEAA+ RR SEG+KLELC  DRVGLLS+VTRIFREN L+V RAE
Sbjct  310   GSPISSEAERQRVIHCLEAAVRRRTSEGIKLELCGEDRVGLLSDVTRIFRENGLSVNRAE  369

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF  1541
             V TRG +A+N FYV D SG PV +  IE+VR+ IG TIL VK +   + P QES   SL 
Sbjct  370   VTTRGSQAMNVFYVTDVSGNPVKSETIETVRKEIGLTILHVKDDVCSKPPPQESGKFSL-  428

Query  1542  GGIFKSRS---FCNFGLVRSYS  1598
               +F+S S     N GL++SYS
Sbjct  429   SNLFRSSSEKFLYNLGLMKSYS  450



>gb|EYU42079.1| hypothetical protein MIMGU_mgv1a006197mg [Erythranthe guttata]
Length=453

 Score =   519 bits (1337),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 259/451 (57%), Positives = 334/451 (74%), Gaps = 11/451 (2%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+RR+NPPRV +DN++   AT+I+VDSANK G+LLEVVQVLTDLNLII
Sbjct  5     STSLGVDDEFEKLVRRVNPPRVTVDNDSDNKATLIKVDSANKRGSLLEVVQVLTDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDGGWFMDVF+VT++ G+K+ +  + + I +SLG       S+ RSVGV S  +
Sbjct  65    RRAYISSDGGWFMDVFHVTDKYGNKVHEGNISESIQQSLGQRGRSCRSLARSVGVESAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVLT+LKCNVV AEVWTHN+R A+++ +TD+     + DP+
Sbjct  125   HTTIELSGRDRPGLLSEVFAVLTDLKCNVVAAEVWTHNSRMASVVYITDQTNSSPIQDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPD-  989
              LS IK+LL  VLKG    R A T ++ G+THT+RRLHQ+M+ADRDY+  +   L H   
Sbjct  185   RLSNIKQLLLYVLKGDRDKRSANTAVSVGSTHTERRLHQMMYADRDYDHLN--TLVHSSD  242

Query  990   ----RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQ  1157
                 +P V+V N  D+ Y+VV + C DRPKLLFD +CTLTDM+YVVFH  +  EGP+A Q
Sbjct  243   QLRTKPLVTVENCVDKGYTVVNLSCADRPKLLFDTVCTLTDMQYVVFHATIITEGPQAQQ  302

Query  1158  EYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFREN  1337
             EY IRH+DG P+ S+AERQRVIHCLEAAI+RR SEG++LELC+ DRVGLL++VTRIFREN
Sbjct  303   EYFIRHMDGCPISSEAERQRVIHCLEAAIKRRTSEGIRLELCSEDRVGLLTDVTRIFREN  362

Query  1338  SLTVTRAEVATRGGKAVNTFYVGDASGY-PVDARIIESVRQTIGQTILQVKGNPEEQNPT  1514
              L+V+RAEV TRG +AVN FYV DAS   PV ++ +E+VR+ IG TIL+VK +    +P 
Sbjct  363   GLSVSRAEVTTRGTQAVNVFYVTDASSSNPVQSQTVEAVRKEIGLTILRVKDDTYSTSPP  422

Query  1515  QESPTRSLFGGIFKSRS---FCNFGLVRSYS  1598
              +   R   G +F+SRS     N GL++S S
Sbjct  423   DQQTARFSLGTLFRSRSEKFLYNLGLIKSCS  453



>ref|XP_003621757.1| hypothetical protein MTR_7g022470 [Medicago truncatula]
 gb|AES77975.1| four ACT domain ACT domain protein which protein [Medicago truncatula]
Length=451

 Score =   519 bits (1336),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 261/443 (59%), Positives = 336/443 (76%), Gaps = 7/443 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             +DDE+EKL+ RMNPPRV +DN + +  T+I+VDSANK G+LLEVVQVLTD+NLI+ +AYI
Sbjct  10    LDDEFEKLVIRMNPPRVTVDNTSSRTTTLIKVDSANKRGSLLEVVQVLTDMNLIVRRAYI  69

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVF+VT+Q G KI+ E V D I +SLGP      S+RRSVGV +  +HT+IE
Sbjct  70    SSDGGWFMDVFHVTDQNGKKILQEDVADRIQQSLGPRVRSFRSVRRSVGVQAAAEHTTIE  129

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV A+L +LKCNVV AEVWTHN+R A+++ +TD+ TG  + +P+ L+ I
Sbjct  130   LTGRDRPGLLSEVFAILADLKCNVVAAEVWTHNSRMASVVYITDDTTGLPIDNPDRLAKI  189

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDE---ALNHPDRPN  998
             K LL  VL+G    ++A T ++  +TH DRRLHQLM+ADRDY+    +   + N  ++ N
Sbjct  190   KHLLLYVLRGDIDKKNANTAVSFCSTHKDRRLHQLMYADRDYDIYDGDYSCSTNDRNKLN  249

Query  999   VSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHI  1178
             V+V +  D+ Y+VV +RC DRPKLLFD +CT+TDM+YVV+HG V+AEGPEAYQEY IRH+
Sbjct  250   VTVDDCIDKGYTVVNLRCPDRPKLLFDTVCTITDMQYVVYHGTVNAEGPEAYQEYYIRHV  309

Query  1179  DGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRA  1358
             DG P+ S+AERQRVIHCLEAA+ RR SEG+KLEL   DRVGLLS+VTRIFREN L+V RA
Sbjct  310   DGYPISSEAERQRVIHCLEAAVRRRTSEGVKLELSGEDRVGLLSDVTRIFRENGLSVCRA  369

Query  1359  EVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSL  1538
             EV TRG +A+N FYV D SG PV +  IE+VR+ IG TIL+VK +P  ++PT+ES   SL
Sbjct  370   EVTTRGSQAMNVFYVTDVSGNPVKSETIEAVRKEIGLTILRVKDDPCLKSPTRESGKFSL  429

Query  1539  FGGIFKSRS---FCNFGLVRSYS  1598
                + +SRS     N GL++S S
Sbjct  430   -RDLVRSRSERFLYNLGLMKSSS  451



>ref|XP_009792706.1| PREDICTED: uncharacterized protein LOC104239695 [Nicotiana sylvestris]
Length=449

 Score =   518 bits (1334),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 263/446 (59%), Positives = 338/446 (76%), Gaps = 5/446 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE++KL+ RMNPPRV +DN + K  T+I+VDSANK G+LLEVVQVLTDLNLII
Sbjct  5     SSSFTVDDEFKKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ ++ V + I +SLGP      SM RSVGV S  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQHGNKLSEDNVAERIQQSLGPRGRSFRSMERSVGVQSAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSE+ AVL + K NVV AEVWTHN+R A+++ +TDEE+G A+TDP+
Sbjct  125   HTTIELTGRDRPGLLSEIFAVLADHKNNVVAAEVWTHNSRMASVVYITDEESGLAITDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L+ I+KLL  VLKG    R A T ++ G+THT+RRLHQ+M+ADRDY++   + ++   R
Sbjct  185   RLAKIRKLLLYVLKGDRDRRGANTAVSVGSTHTERRLHQMMYADRDYDKDDTDCVSVDQR  244

Query  993   -PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
              P V+V +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+H  + AEGPEA QEY I
Sbjct  245   KPLVTVESCADKGYTVVNLRCADRPKLLFDAVCTLTDMQYVVYHATIIAEGPEASQEYYI  304

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DG PV S+AERQRVIHCLEAA++RR S G++LELC  DR+GLLS+VTRIFREN L+V
Sbjct  305   RHMDGCPVSSEAERQRVIHCLEAAVKRRTSTGIRLELCGDDRIGLLSDVTRIFRENGLSV  364

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPT  1529
             +RAEV T+G +A+N FYV DASG PV +  IE+VR  IG TIL+V+ +    +P Q++  
Sbjct  365   SRAEVMTKGSQAINVFYVTDASGGPVKSETIEAVRNEIGMTILRVRDDLYSNSPPQQTAR  424

Query  1530  RSLFGGIFKSRS---FCNFGLVRSYS  1598
              SL G IF+SRS     N GL +SYS
Sbjct  425   FSL-GNIFRSRSEKFLYNLGLTKSYS  449



>ref|XP_007043903.1| ACT domain repeat 4 isoform 1 [Theobroma cacao]
 gb|EOX99734.1| ACT domain repeat 4 isoform 1 [Theobroma cacao]
Length=473

 Score =   518 bits (1334),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 266/470 (57%), Positives = 338/470 (72%), Gaps = 29/470 (6%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +D+E+EKL+ RMNPPRV +DN   + AT+I+VDSANK G+LLEVVQVLTDL+LII
Sbjct  5     SPSLTLDEEFEKLVIRMNPPRVTVDNATSRKATLIKVDSANKRGSLLEVVQVLTDLDLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKS----------------------  566
              +AYI SDG WFMDVF+VT+Q G+K+ +  V + I +                       
Sbjct  65    RRAYISSDGEWFMDVFHVTDQYGNKLSEVDVAERIQQKPKSSLHQFLLEWESSVLLVARA  124

Query  567   -LGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTH  743
              LGP +    S+ RSVGV + + HT+IEL G DRPGLLSEV AVLT+LKCNVV AEVWTH
Sbjct  125   QLGPRAYSFRSLTRSVGVQAASKHTTIELTGRDRPGLLSEVFAVLTDLKCNVVAAEVWTH  184

Query  744   NTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRL  923
             N+R A+++ +TDE TG ++ +PE L+ IK+LL  VLKG      A T ++ G+THT+RRL
Sbjct  185   NSRMASVVYITDEATGSSIDNPERLTKIKQLLLYVLKGDRDQMRANTAVSVGSTHTERRL  244

Query  924   HQLMFADRDYER--ASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLT  1097
             HQ+M+ADRDY+   A   + +   +P V+V N  D+ Y+VV +RC DRPKLLFD +CTLT
Sbjct  245   HQMMYADRDYDMNDADSGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLFDTVCTLT  304

Query  1098  DMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLE  1277
             DM+YVV+H  V A+GPEAYQEY IRH+DG PV S+ ERQRVI+CLEAAI+RR SEG++LE
Sbjct  305   DMQYVVYHATVIADGPEAYQEYYIRHMDGCPVSSEPERQRVINCLEAAIKRRASEGIRLE  364

Query  1278  LCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQ  1457
             LC+ DRVGLLS+VTRIFREN L+VTRAEV TRG +AVN F V DASG PV +  IE+VR+
Sbjct  365   LCSEDRVGLLSDVTRIFRENGLSVTRAEVTTRGSQAVNAFCVTDASGDPVKSETIEAVRK  424

Query  1458  TIGQTILQVKGNPEEQNPTQESPTRSLFGGIFKSRS---FCNFGLVRSYS  1598
              +G TIL VK +   ++P QES   SL G +FKSRS     N GL++S S
Sbjct  425   ELGLTILHVKDDAYSKSPPQESGGFSL-GTLFKSRSEKFLYNLGLIKSCS  473


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/201 (23%), Positives = 86/201 (43%), Gaps = 13/201 (6%)
 Frame = +3

Query  237  HNPSRISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLE  416
            H   R+          +M+D         + P V ++N A K  TV+ +   ++   L +
Sbjct  239  HTERRLHQMMYADRDYDMNDADSGSTSEWSKPLVTVENCADKGYTVVNLRCLDRPKLLFD  298

Query  417  VVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASS  596
             V  LTD+  ++  A + +DG      + + + +G  +  E     ++      +C  ++
Sbjct  299  TVCTLTDMQYVVYHATVIADGPEAYQEYYIRHMDGCPVSSEPERQRVI------NCLEAA  352

Query  597  MRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVT  776
            ++R       ++   +EL   DR GLLS+V+ +      +V  AEV T  ++A     VT
Sbjct  353  IKR-----RASEGIRLELCSEDRVGLLSDVTRIFRENGLSVTRAEVTTRGSQAVNAFCVT  407

Query  777  DEETGGAVTDPETLSMIKKLL  839
            D    G     ET+  ++K L
Sbjct  408  D--ASGDPVKSETIEAVRKEL  426



>ref|XP_011098918.1| PREDICTED: uncharacterized protein LOC105177449 [Sesamum indicum]
Length=442

 Score =   516 bits (1330),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 253/435 (58%), Positives = 323/435 (74%), Gaps = 6/435 (1%)
 Frame = +3

Query  282   QNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKA  461
             +  DDE+ KL+RR+NPPRVVIDN++C +ATVIQVDS NKHG LL VVQVLTDLNL+I KA
Sbjct  6     EETDDEFAKLLRRINPPRVVIDNDSCGDATVIQVDSVNKHGILLHVVQVLTDLNLVIKKA  65

Query  462   YICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTS  641
             YI SDGGWFMDVFNV +++G KI D  ++ YI K L  D     S +  VG+    +HT 
Sbjct  66    YISSDGGWFMDVFNVIDRDGEKIRDPELISYIQKRLESDEDLVPSFKGMVGLMPTEEHTC  125

Query  642   IELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLS  821
             IEL G+DRPGLLSEV AVL +L CN++NAE+WTHN RAAA++ VTD+ TG A+ DP  L+
Sbjct  126   IELTGTDRPGLLSEVCAVLADLHCNLLNAEIWTHNARAAAVVLVTDDTTGYAIEDPNRLA  185

Query  822   MIKKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY---ERASDEAL-NHP  986
              IK++LCNVLKG++    A+  ++  G TH +RRLHQ+MFADRDY   ER+    + +  
Sbjct  186   TIKEMLCNVLKGNSDINTARMTLSPPGVTHRERRLHQIMFADRDYENIERSEGGGVHDKS  245

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
              RP+V V +  ++DY+V+T+R KDRPKLLFD++CTLTDM+YV+FHG V     EAYQEY 
Sbjct  246   SRPHVIVADCTEKDYTVITMRSKDRPKLLFDIVCTLTDMQYVIFHGVVHTGRMEAYQEYY  305

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+RV+ CLEAA+ERR SEGL+LELC  DRVGLLS++TRIFRENSL 
Sbjct  306   IRHVDGVPISSEAERERVMQCLEAAVERRGSEGLQLELCAKDRVGLLSDITRIFRENSLC  365

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQ-NPTQES  1523
             + RAE++T+GG A +TFYV D SG PVD + ++S+ + IGQ IL VK N      P QE 
Sbjct  366   IKRAEISTKGGIARDTFYVTDVSGCPVDPKTVDSICRQIGQGILHVKWNSNSSPKPQQEK  425

Query  1524  PTRSLFGGIFKSRSF  1568
                 L G  FK+R+F
Sbjct  426   TISFLLGSFFKARTF  440



>ref|XP_006338714.1| PREDICTED: uncharacterized protein LOC102582229 isoform X2 [Solanum 
tuberosum]
Length=443

 Score =   516 bits (1330),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 262/446 (59%), Positives = 337/446 (76%), Gaps = 12/446 (3%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C+NAT+IQVDS NKHG LL+VVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDSCENATIIQVDSVNKHGILLQVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+Q+G+K+ DE ++ YI K+L  D     S+R +VG+    +HTSIE
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVRDEEIISYIQKTLENDEVLLPSLRGTVGLMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNA +WTHN RAAA++ V D+ T  A+ DP+ L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLHCNVVNAAIWTHNARAAAVVHVVDDITDCAIEDPKRLATI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY------ERASDEALNHP  986
             KKLL NVLKG+N  + AK  ++  G TH +RRLHQ+MF DRDY      E+ + E L   
Sbjct  181   KKLLRNVLKGNNDLKTAKMTLSPPGFTHRERRLHQIMFDDRDYVKVRKTEQGNIEDLKSG  240

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P ++V    ++DY+V+T+R +DRPKLLFD++CTLTDM+YVVFHG V     EAYQE+ 
Sbjct  241   --PCITVYYCSEKDYTVITMRSRDRPKLLFDIVCTLTDMQYVVFHGVVHTGKNEAYQEFY  298

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+RVI CLEAAIERR SEGL+LELCT DR+GLLS++TRIFRENSL 
Sbjct  299   IRHVDGLPISSEAERERVILCLEAAIERRTSEGLELELCTEDRLGLLSDITRIFRENSLC  358

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQNPTQE  1520
             + RAE++T+GGKA + FYV D +G PV+ + ++S+ + +G  +L VK NP   E+ P +E
Sbjct  359   IKRAEISTQGGKAKDIFYVTDVTGNPVEQKTVDSICEQVGPNMLHVKWNPCHSEKLP-EE  417

Query  1521  SPTRSLFGGIFKSRSFCNFGLVRSYS  1598
                  LFG +FK R+  +  L+ SY+
Sbjct  418   GTISYLFGSLFKVRTLQSLKLIGSYT  443



>ref|XP_007038044.1| ACT domain repeat 6 isoform 2 [Theobroma cacao]
 gb|EOY22545.1| ACT domain repeat 6 isoform 2 [Theobroma cacao]
Length=409

 Score =   515 bits (1326),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 253/405 (62%), Positives = 314/405 (78%), Gaps = 4/405 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE+ KLIRR+NPPRVV+DN+AC++ATVIQVDS N+HG LLEVVQVL DLNL++TKAYI
Sbjct  1     MDDEFAKLIRRINPPRVVVDNDACEHATVIQVDSVNRHGILLEVVQVLADLNLVVTKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SD GWFMDVF VT+ EG+KI +E  L YI K+L     F +S+R SVGV    +HTSIE
Sbjct  61    SSDAGWFMDVFYVTDYEGNKIRNERTLSYIQKTLETKVHFLNSLRSSVGVIPSKEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L GSDRPGL+SEVSAVL +L CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP+ LS+I
Sbjct  121   LTGSDRPGLVSEVSAVLADLGCNVVNAEIWTHNARAAAVIYVTDQSTGHAIEDPKKLSII  180

Query  828   KKLLCNVLKGSNKSRHAKTQI-THGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             K+LL NV+KG++  R  +  I + G  H  RRLHQ++FADRD+ER  +       +P+V+
Sbjct  181   KELLFNVMKGNSDFRTPRMSISSSGVMHRARRLHQMLFADRDFERPENVKFESA-KPHVT  239

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             V +  DRDY+VVTIR  DRPKLLFD ICTLTDMEYVVFHG V     EAYQEY IRH+DG
Sbjct  240   VQDCSDRDYTVVTIRSLDRPKLLFDTICTLTDMEYVVFHGTVITGRMEAYQEYYIRHVDG  299

Query  1185  SPVKSDAERQRVIHCLEAAIERRVS-EGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
              P+ S+AE+QRV+ CLEAAIERR   EGL+LEL T DR GLLS++TRIFREN L + RAE
Sbjct  300   FPISSEAEQQRVVECLEAAIERRAQEEGLELELFTDDRFGLLSDITRIFRENGLCIRRAE  359

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQ-VKGN  1493
             ++T+GGKA +TF+V D SG PVDA+ ++ ++  IGQ  LQ ++GN
Sbjct  360   ISTKGGKAKDTFFVTDVSGNPVDAKTVDLIQHQIGQANLQFLQGN  404



>ref|XP_010028976.1| PREDICTED: uncharacterized protein LOC104419122 isoform X2 [Eucalyptus 
grandis]
 gb|KCW55808.1| hypothetical protein EUGRSUZ_I01627 [Eucalyptus grandis]
Length=435

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/428 (59%), Positives = 323/428 (75%), Gaps = 6/428 (1%)
 Frame = +3

Query  333   RVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTN  512
             RVV+D+ A  +ATVIQVDS NKHG LLEVVQVLTDLNL+ITKAYI SDGGWFMDVF+V +
Sbjct  8     RVVVDHNASGDATVIQVDSVNKHGILLEVVQVLTDLNLVITKAYISSDGGWFMDVFHVVD  67

Query  513   QEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIELIGSDRPGLLSEVSA  692
             ++G KI D  V + I + +   + FA S+R SVGV    +HTSIEL G+DRPGLLSEV A
Sbjct  68    RDGKKIRDTEVTENIKRRIEKSASFAPSLRGSVGVMPSEEHTSIELTGTDRPGLLSEVCA  127

Query  693   VLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSR  872
             VLTNL CN+VN E+WTHN RAAA++ VTD+ TG A+ DPE L+ IK++L N+LKG +  +
Sbjct  128   VLTNLHCNIVNGEIWTHNARAAAVLHVTDDSTGSAIKDPERLAKIKEMLFNILKGDDDMK  187

Query  873   HAKTQIT-HGATHTDRRLHQLMFADRDYERASDEALNHPD----RPNVSVTNWHDRDYSV  1037
              AKT ++  G T  +RRLHQ+MFADRDY+R  + ++   D    RP+V++ +  +RDY++
Sbjct  188   TAKTTLSPPGVTSRERRLHQIMFADRDYQRFENSSIGQADDQSLRPHVTIMDCDERDYTI  247

Query  1038  VTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQR  1217
             VT+R KDRPKLLFD++CTLTDM+YVVFHG V     EAYQE+ IRH+DG P+ S+AER+R
Sbjct  248   VTMRSKDRPKLLFDIVCTLTDMQYVVFHGMVKTGRKEAYQEFYIRHVDGLPIGSEAERER  307

Query  1218  VIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTF  1397
             +I CLEAAI+RR SEGL+LEL   DRVGLLS+VTRIFRENSL + RAE+ TRGGKA +TF
Sbjct  308   IIQCLEAAIQRRASEGLELELSIVDRVGLLSDVTRIFRENSLCIKRAELTTRGGKAKDTF  367

Query  1398  YVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQESPTRSLFGGIFKSRSFCN  1574
             YV D +G PVD ++I+S+ + IGQ  L+VK N      P +++    LFG  F SR+  +
Sbjct  368   YVTDVTGDPVDPKMIDSICKQIGQPALRVKQNWNFSPKPPEKTKAGFLFGYFFSSRTLQS  427

Query  1575  FGLVRSYS  1598
             F L+RSYS
Sbjct  428   FKLIRSYS  435



>ref|XP_008459879.1| PREDICTED: uncharacterized protein LOC103498865 isoform X1 [Cucumis 
melo]
Length=452

 Score =   515 bits (1327),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 268/449 (60%), Positives = 341/449 (76%), Gaps = 8/449 (2%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+ RMNPPRV IDN++ + AT+I+VDSANK G+LLEVVQVL DLNLII
Sbjct  5     SLSLPLDDEFEKLVNRMNPPRVTIDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ +  V + I +SLGP +    S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQHGNKLSENDVAERIQQSLGPRARSFRSLRRSVGVQAAEE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG +++DP+
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGFSISDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L  IK+LL  VLKG    R A T ++ G+TH +RRLHQ+M+ADRDY++   +  +  +R
Sbjct  185   RLGKIKQLLLFVLKGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDQDDLDCGSTSER  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA-YQEY  1163
               P V+V N  D+ Y+VV +R  DRPKLLFD +CTLTDM+YVV+H  V AEGPEA  QEY
Sbjct  245   RKPLVTVENCADKGYTVVNLRSPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEASQQEY  304

Query  1164  CIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSL  1343
              IRH+DGSP+ S+AERQRVIHCLEAAI RR SEG++LELC+ DR GLLS+VTRIFREN L
Sbjct  305   YIRHMDGSPISSEAERQRVIHCLEAAIRRRTSEGIRLELCSEDRAGLLSDVTRIFRENGL  364

Query  1344  TVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQE  1520
             +VTRAEV TRG +AVN FYV DASG PV + +IE+VR+ IG T+L VK +    ++P+ E
Sbjct  365   SVTRAEVTTRGTQAVNVFYVTDASGNPVKSEMIEAVRKEIGLTVLCVKDDEFCMKSPSPE  424

Query  1521  SPTRSLFGGIFKSRS---FCNFGLVRSYS  1598
             S   SL G +F+SRS     N GL++S S
Sbjct  425   SSRFSL-GNLFRSRSEKFLYNLGLIKSCS  452



>ref|XP_006297724.1| hypothetical protein CARUB_v10013759mg [Capsella rubella]
 gb|EOA30622.1| hypothetical protein CARUB_v10013759mg [Capsella rubella]
Length=430

 Score =   514 bits (1324),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 267/431 (62%), Positives = 326/431 (76%), Gaps = 11/431 (3%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIRRMNPPRVVIDN+A  +ATVIQVDS NKHGTLLEVVQVLTD+NL I KA+I 
Sbjct  3     DDEYAKLIRRMNPPRVVIDNDASDDATVIQVDSVNKHGTLLEVVQVLTDMNLAIKKAHIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V +Q G KI D  VLDYI + +  ++  F   +R SVGV    ++T+IE
Sbjct  63    SDGGWFMDVFKVIDQFGRKIRDTQVLDYIQRRIESNAGWFIPPLRSSVGVMPSDEYTAIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++ VTD  T  A+TDP  LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDNSTNSAITDPVRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPNVSV  1007
             K+LLCNV+  ++ SR AKT  +   TH +RRLHQ+MF DRDYE     A     RPNV++
Sbjct  183   KELLCNVVGTNSGSRAAKTVFSCSDTHRERRLHQIMFDDRDYEGVKRSA----SRPNVTL  238

Query  1008  TNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDGS  1187
              N  D+DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IRH+DG 
Sbjct  239   MNI-DKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPVEAYQEFYIRHVDGL  297

Query  1188  PVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEVA  1367
             P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ RAE++
Sbjct  298   PINSEAEQERVIQCLEAAIERRASEGLELELLAEDRVGLLSDITRTFRENSLTIVRAEIS  357

Query  1368  TRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-----EQNPTQESPTR  1532
             TR GKA +TFYV D +G PV+++I+ES+RQ IG + L+VK + +        P QE+   
Sbjct  358   TREGKAKDTFYVTDVTGNPVESKIVESIRQQIGVSKLKVKKDEDCSVLGTGRPWQETAMG  417

Query  1533  SLFGGIFKSRS  1565
              L   IFK +S
Sbjct  418   YLLSNIFKPKS  428



>ref|XP_010543092.1| PREDICTED: uncharacterized protein LOC104816118 [Tarenaya hassleriana]
 ref|XP_010543093.1| PREDICTED: uncharacterized protein LOC104816119 [Tarenaya hassleriana]
 ref|XP_010543094.1| PREDICTED: uncharacterized protein LOC104816120 [Tarenaya hassleriana]
Length=452

 Score =   515 bits (1326),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 251/448 (56%), Positives = 336/448 (75%), Gaps = 6/448 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S + D+E EK + RMNPP+V IDN + + AT+++VDSANK G+LLEVVQVLTDL+L+I
Sbjct  5     SPSVSSDNELEKFVIRMNPPKVTIDNTSSRKATLVKVDSANKRGSLLEVVQVLTDLDLLI  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AY+ SDG WFMDVF+VT++ G+++M+E + + I +SLGP +C   +  RSVGV + ++
Sbjct  65    RRAYVSSDGEWFMDVFHVTDKNGNRVMEEDIAETIQQSLGPRTCSFRARNRSVGVQAISE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             +TSIEL G DRPGLLS+V AVLT+  CNVV AEVWTHN+R A+++ +TDE TG  + DP+
Sbjct  125   NTSIELTGRDRPGLLSDVFAVLTDNNCNVVAAEVWTHNSRMASVVYITDETTGSVIDDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              ++ IK+LL  VL+G+   R A T +  G+TH +RRLHQ+M+ +RDY+  + +  +  +R
Sbjct  185   RIAKIKQLLLYVLEGNRDKRIANTAVLMGSTHKERRLHQMMYDNRDYDMTNLDVGSTSER  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P ++V N  D+ Y+VV +RC DRPKL FD +CTLTDM+YVV+H  V AEGPEAYQEY 
Sbjct  245   RKPVITVENCTDKAYTVVNLRCIDRPKLFFDAVCTLTDMQYVVYHATVIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG PV S+AERQR+IHCLEAAI+RR SEG++LELC  DRVGLLS+VTRIFREN L+
Sbjct  305   IRHVDGGPVSSEAERQRLIHCLEAAIKRRTSEGIRLELCGEDRVGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNP-TQES  1523
             VTRAEV TRG +AVN FYV D+SG PV ++ IE+VR  IG+T+L+VK      +P TQ+ 
Sbjct  365   VTRAEVTTRGSQAVNAFYVTDSSGKPVKSQTIETVRNQIGRTVLRVKDEGFSGSPGTQQE  424

Query  1524  PTRSLFGGIFKSRS---FCNFGLVRSYS  1598
               +     +FKSRS     N GL +S+S
Sbjct  425   TGKFSLSNLFKSRSEKFLYNLGLSKSFS  452



>ref|XP_004140541.1| PREDICTED: uncharacterized protein LOC101218687 [Cucumis sativus]
 ref|XP_004170246.1| PREDICTED: uncharacterized LOC101218687 [Cucumis sativus]
 gb|KGN46439.1| hypothetical protein Csa_6G093100 [Cucumis sativus]
Length=451

 Score =   514 bits (1325),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 266/448 (59%), Positives = 338/448 (75%), Gaps = 7/448 (2%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+ RMNPPRV +DN++ + AT+I+VDSANK G+LLEVVQVL DLNLII
Sbjct  5     SLSLPLDDEFEKLVNRMNPPRVTVDNDSSRKATLIKVDSANKRGSLLEVVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q G+K+ +  V + I +SLGP      S+RRSVGV +  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDQRGNKLSENDVAERIQQSLGPRGRSFRSLRRSVGVQAAEE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG  + DP+
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGFPIDDPD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L  IK+LL  VLKG    R A T ++ G+TH +RRLHQ+M+ADRDY++   +  +  +R
Sbjct  185   RLGKIKQLLLFVLKGDRDKRSANTAVSVGSTHKERRLHQMMYADRDYDQDDLDCGSTSER  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V +  D+ Y+VV +R  DRPKLLFD +CTLTDM+YVV+H  V AEGPEA QEY 
Sbjct  245   RKPLVTVESCADKGYTVVNLRSPDRPKLLFDTVCTLTDMQYVVYHATVIAEGPEATQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DGSP+ S+AERQRVIHCLEAAI RR SEG++LELC+ DR GLLS+VTRIFREN L+
Sbjct  305   IRHMDGSPISSEAERQRVIHCLEAAIRRRTSEGIRLELCSDDRAGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPE-EQNPTQES  1523
             VTRAEV TRG +AVN FYV DASG PV + +IE+VR+ IG T+L VK +    ++P+ ES
Sbjct  365   VTRAEVTTRGTQAVNVFYVTDASGNPVKSEMIEAVRKEIGLTVLCVKDDEFCMKSPSPES  424

Query  1524  PTRSLFGGIFKSRS---FCNFGLVRSYS  1598
                SL G +F+SRS     N GL++S S
Sbjct  425   SRFSL-GNLFRSRSEKFLYNLGLIKSCS  451



>ref|XP_009134574.1| PREDICTED: uncharacterized protein LOC103858881 isoform X4 [Brassica 
rapa]
Length=431

 Score =   513 bits (1322),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 260/431 (60%), Positives = 323/431 (75%), Gaps = 8/431 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KL RRMNPPRVVIDN+A  +ATVIQVDS NK GTLLEVVQVLTD+NL+I KAYI 
Sbjct  3     DDEYAKLFRRMNPPRVVIDNKASDDATVIQVDSVNKQGTLLEVVQVLTDMNLVIKKAYIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V +Q+G+KI D  +LD+I   +  ++  F   +R SVGV    ++T+IE
Sbjct  63    SDGGWFMDVFKVIHQDGNKITDTQLLDFIQMRIERNAGWFIPPLRSSVGVMPSDEYTTIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++ VTD  T  A+TDP  LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHVTDNTTNSAITDPLRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGA-THTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             K LLCNV+  ++ SR AKT  +  + TH +RRLHQ+MF DRDYE           RP+V+
Sbjct  183   KHLLCNVVGTNSGSRAAKTVFSSCSDTHRERRLHQIMFDDRDYEGVKKRP--RTSRPSVT  240

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             +TN  D+DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IRH+DG
Sbjct  241   LTNI-DKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPLEAYQEFYIRHVDG  299

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
              P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ RAE+
Sbjct  300   LPINSEAEQERVIQCLEAAIERRTSEGLELELSAEDRVGLLSDITRTFRENSLTIVRAEI  359

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP---EEQNPTQESPTRS  1535
             +TR GKA +TFYV D +G  V+++I+ES+R+ IG + L+VK           +QE+    
Sbjct  360   STREGKAKDTFYVTDVTGNAVESKIVESIRKEIGVSKLKVKECAVLGTSSRGSQETTIGY  419

Query  1536  LFGGIFKSRSF  1568
             L   IFKS+  
Sbjct  420   LLSNIFKSKPL  430



>gb|EYU31837.1| hypothetical protein MIMGU_mgv1a007510mg [Erythranthe guttata]
Length=405

 Score =   512 bits (1319),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 246/399 (62%), Positives = 312/399 (78%), Gaps = 3/399 (1%)
 Frame = +3

Query  282   QNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKA  461
             +  DDE+ KLIRR+NPPRVVIDN++C++AT++QVDS NKHG LL+VVQVLTDLNL+I KA
Sbjct  6     EERDDEFAKLIRRINPPRVVIDNDSCEDATIVQVDSVNKHGILLQVVQVLTDLNLVIKKA  65

Query  462   YICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTS  641
             YI SDGGWFMDVFNV +Q+G+KI D+ ++ YI + L  D  F  S +  VG+    +HT 
Sbjct  66    YISSDGGWFMDVFNVIDQDGNKIRDQELISYIQRRLEEDDDFVPSSKGVVGLVPSEEHTC  125

Query  642   IELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLS  821
             IEL G DRPGLLSEV AVLT+L+CNVVNAE+WTHN RAAA++ VTD+ TG A+ DP+ L+
Sbjct  126   IELTGIDRPGLLSEVCAVLTDLRCNVVNAEIWTHNARAAAVVHVTDDITGCAIEDPKRLA  185

Query  822   MIKKLLCNVLKGSNKSRHAKTQIT--HGATHTDRRLHQLMFADRDYERAS-DEALNHPDR  992
              IK+LLCNVLKG++    AK  ++   G TH +RRLHQ+MFADRDY R    E      R
Sbjct  186   TIKELLCNVLKGNSDLNTAKMTLSPPGGVTHRERRLHQIMFADRDYVRVERPEGGAKKSR  245

Query  993   PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIR  1172
             P+V+V +  ++DY+V+T+R KDRPKLLFD +CTLTDM+YVVFHG V     EAYQEY IR
Sbjct  246   PHVTVADCTEKDYTVITMRSKDRPKLLFDTVCTLTDMQYVVFHGVVHTGRMEAYQEYYIR  305

Query  1173  HIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVT  1352
             H+DG PV S+AER+RV+ CLEAAIERR SEGL+LELC  DRVGLLS++TR+FRENSL + 
Sbjct  306   HVDGVPVSSEAERERVVQCLEAAIERRGSEGLELELCAEDRVGLLSDITRVFRENSLCIK  365

Query  1353  RAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQ  1469
             RAE++T+GGKA +TFYV D +G PVD + ++S+ + IGQ
Sbjct  366   RAEISTKGGKARDTFYVTDVTGSPVDPKTVDSICRQIGQ  404



>ref|XP_009613029.1| PREDICTED: uncharacterized protein LOC104106236 [Nicotiana tomentosiformis]
Length=443

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 260/445 (58%), Positives = 332/445 (75%), Gaps = 10/445 (2%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C++AT+IQVDS NKHG LL+VVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDSCEDATIIQVDSVNKHGILLQVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGGWFMDVFNVT+++G+K+ DE +++YI K+L  D     S+R +VG+    +HTSIE
Sbjct  61    SSDGGWFMDVFNVTDRDGNKVRDEEIINYIQKTLENDEVLLPSLRGTVGLMPSEEHTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEV AVL +L CNVVNA +WTHN RAAA++ V D  TG A+ DP+ L+ I
Sbjct  121   LSGTDRPGLLSEVCAVLADLSCNVVNAAIWTHNARAAAVVHVVDNITGCAIEDPKRLATI  180

Query  828   KKLLCNVLKGSNKSRHAKTQIT-HGATHTDRRLHQLMFADRDY------ERASDEALNHP  986
             KKLL NVLK +N  + AK  ++  G TH +RRLHQ+MFADRDY      E+   E L   
Sbjct  181   KKLLHNVLKCNNDLKTAKMTLSPPGFTHRERRLHQIMFADRDYVKVRRTEQGKVEDLKSG  240

Query  987   DRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P ++V +  ++DY+V+T+R +DRPKLLFD++CTLTDM+YVVFHG V     EAYQE+ 
Sbjct  241   --PCINVYDCSEKDYTVITMRSRDRPKLLFDIVCTLTDMQYVVFHGVVHTGKKEAYQEFY  298

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH+DG P+ S+AER+RVI CLEAAIERR S GL+LELC  DR+GLLS++TRIFRENSL 
Sbjct  299   IRHVDGLPISSEAERERVIQCLEAAIERRASVGLELELCAEDRLGLLSDITRIFRENSLC  358

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             V RAE++T GGKA + FYV D +G PVD + ++S+ + +GQ +L VK NP       E  
Sbjct  359   VKRAEISTEGGKAKDIFYVTDVTGNPVDQKTVDSICEQVGQNMLHVKWNPCHSTKLPEEG  418

Query  1527  TRS-LFGGIFKSRSFCNFGLVRSYS  1598
             T S L G +FK  +  N  L++ Y+
Sbjct  419   TISYLLGNLFKVSTLQNLKLMKYYT  443



>ref|XP_009372243.1| PREDICTED: uncharacterized protein LOC103961427 [Pyrus x bretschneideri]
Length=450

 Score =   513 bits (1322),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 333/447 (74%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL  R+NPPRV +DN +   AT+I+VDSANK G+LLE+VQVL DLNLII
Sbjct  5     SPSLAVDDEFEKLALRINPPRVTVDNASSGKATLIKVDSANKRGSLLELVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP      S+RRSVGV + T+
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAECIQQSLGPRGRSFPSLRRSVGVQAATE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL++LKCNVV  EVWTHN+R A+++ +TDE TG  + DPE
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLSDLKCNVVAGEVWTHNSRMASVVYITDEATGRPIDDPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L+ IK+LL  VLKG+   R A T ++ G+TH +RRLHQ+M+ADRDY+    +  +  DR
Sbjct  185   HLAKIKQLLLYVLKGNRDKRSANTAVSVGSTHKERRLHQMMYADRDYDMDDADCGSASDR  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDMEYVV+H  V AEGPEAYQEY 
Sbjct  245   SKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P+ S+ ERQRVIHCLEAAI RR SEG++LELC  DR GLLS+VTRIFREN L+
Sbjct  305   IRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEVATRG +AVN FYV DASG  V +  IE+VRQ IG T L V+ +   ++P QES 
Sbjct  365   VTRAEVATRGSQAVNVFYVTDASGNQVKSETIEAVRQEIGLTFLHVQDDFFSKSPPQESG  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G + + RS     N GL++S S
Sbjct  425   RFSL-GNLLRIRSEKFLYNLGLIKSCS  450



>ref|XP_008340245.1| PREDICTED: uncharacterized protein LOC103403190 [Malus domestica]
Length=450

 Score =   512 bits (1319),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 333/447 (74%), Gaps = 6/447 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S   DDE+EKL  R+NPPRV +DN + + AT+I+VDSANK G+LLE+VQVL DLNLII
Sbjct  5     SPSLAADDEFEKLAMRINPPRVTVDNASSRKATLIKVDSANKRGSLLELVQVLNDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT+Q+G+K+ D+ + + I +SLGP      S+RRSVGV + T+
Sbjct  65    RRAYISSDGEWFMDVFHVTDQQGNKLSDDGIAECIQQSLGPRGRSFPSLRRSVGVQAATE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HT+IEL G DRPGLLSEV AVL++LKCNVV  EVWTHN+R A+++ +TDE TG  + DPE
Sbjct  125   HTTIELTGRDRPGLLSEVFAVLSDLKCNVVAGEVWTHNSRMASVVYITDEATGRPIDDPE  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDR  992
              L+ IK+LL  VLKGS   R A T ++ G+TH +RRLHQ+M+ADRDY+    +  +  DR
Sbjct  185   HLTKIKQLLLYVLKGSRDKRSANTAVSVGSTHKERRLHQMMYADRDYDMDDADCGSASDR  244

Query  993   --PNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYC  1166
               P V+V N  D+ Y+VV +RC DRPKLLFD +CTLTDMEYVV+H  V AEGPEAYQEY 
Sbjct  245   SKPLVTVENCVDKGYTVVNLRCPDRPKLLFDTVCTLTDMEYVVYHATVIAEGPEAYQEYY  304

Query  1167  IRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLT  1346
             IRH DG P+ S+ ERQRVIHCLEAAI RR SEG++LELC  DR GLLS+VTRIFREN L+
Sbjct  305   IRHTDGCPISSEGERQRVIHCLEAAIRRRTSEGIRLELCGDDRAGLLSDVTRIFRENGLS  364

Query  1347  VTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESP  1526
             VTRAEV TRG +AVN FYV DASG  V +  IE+VRQ IG T L+V+ +   ++P QE+ 
Sbjct  365   VTRAEVTTRGSQAVNVFYVIDASGNQVKSETIEAVRQEIGLTFLRVQDDFFSKSPPQENG  424

Query  1527  TRSLFGGIFKSRS---FCNFGLVRSYS  1598
               SL G + + RS     N GL++S S
Sbjct  425   RFSL-GNLLRIRSEKFLYNLGLIKSCS  450



>gb|ADE76039.1| unknown [Picea sitchensis]
Length=454

 Score =   513 bits (1320),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 255/470 (54%), Positives = 335/470 (71%), Gaps = 28/470 (6%)
 Frame = +3

Query  216   ENLCDPYHNPSRISMEATVSYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSAN  395
             E++C PY +P                 ++E L +R++PP V IDN+ C++ ++++V+SAN
Sbjct  2     ESVCWPYFDP-----------------DFESLNQRIHPPMVCIDNDTCEDCSLVKVESAN  44

Query  396   KHGTLLEVVQVLTDLNLIITKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGP  575
             +HG LLEVVQVLTDL+LII+KAYI SDG WFMDVF+VT+Q G+K+ D+ ++DYI ++LG 
Sbjct  45    RHGILLEVVQVLTDLDLIISKAYISSDGRWFMDVFHVTDQLGNKLTDQRIIDYIQQALGA  104

Query  576   DSCFASS-----MRRSVGVTSGTDHTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWT  740
                 +++     + R+VGV S  +HT+IEL G+DRPGLLSE+SAVLTNLKCNVV AEVWT
Sbjct  105   KQGGSTTEVKTCLGRTVGVQSIGEHTAIELTGTDRPGLLSEISAVLTNLKCNVVAAEVWT  164

Query  741   HNTRAAAIMQVTDEETGGAVTDPETLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRR  920
             HN R A ++ VTDE T   + +PE L+ IK+ L NVLKG++  R  KT  + G THT+RR
Sbjct  165   HNMRVACVVYVTDESTSRPIEEPEQLAAIKEQLSNVLKGNDDRRGVKTDFSMGLTHTERR  224

Query  921   LHQLMFADRDYERASDEALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTD  1100
             LHQ+MFADRDYE     +L    RP + + N +++ YSVVT+ CKDRPKLLFD +CTLTD
Sbjct  225   LHQMMFADRDYEGPDTRSLGENGRPIIKIENCNEKGYSVVTVHCKDRPKLLFDTVCTLTD  284

Query  1101  MEYVVFHGNVDAEGPEAYQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLEL  1280
             M+YVV H  + + G  A QEY IRH+DG  + ++ E+QRVI CLEAAIERRVSEG++LEL
Sbjct  285   MQYVVLHATITSSGTYALQEYYIRHMDGCTLDTEGEKQRVIKCLEAAIERRVSEGVRLEL  344

Query  1281  CTTDRVGLLSNVTRIFRENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQT  1460
             CT+DRVGLLS++TRIFREN L+VTRA+V TR  KAVN FYV D SG PVD +I+E++R+ 
Sbjct  345   CTSDRVGLLSDITRIFRENGLSVTRADVTTRADKAVNVFYVTDTSGNPVDMKIVEAMRRE  404

Query  1461  IGQTILQVKGNPEEQNPTQE---SPTRSLFGGIFKS---RSFCNFGLVRS  1592
             IG TILQVK  P    P         +  FG + KS   R   NFGL++S
Sbjct  405   IGHTILQVKSIPSSPRPCPTDTGDKAKFSFGSLLKSQLERLSYNFGLIKS  454



>ref|XP_008790789.1| PREDICTED: uncharacterized protein LOC103707875 [Phoenix dactylifera]
Length=440

 Score =   511 bits (1316),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 251/427 (59%), Positives = 315/427 (74%), Gaps = 3/427 (1%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KLIR+MN PRV+IDN A  +ATVIQV+S N +G LL+VVQVL DLNLIITKAYI 
Sbjct  12    DDEYAKLIRKMNLPRVIIDNNASDDATVIQVNSVNDNGILLQVVQVLIDLNLIITKAYIS  71

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRS-VGVT-SGTDHTSI  644
             SDG WFMDVFNVT++ G+K+ DE ++ YI  SL  D+CF SS+R S  GV  S   +TSI
Sbjct  72    SDGKWFMDVFNVTDRNGNKLRDEKIISYIQTSLESDACFLSSLRESSAGVKPSNIGYTSI  131

Query  645   ELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSM  824
             EL G+DRPGLLSE+ +VLT+ KCNVV AE+WTHNTR A+++ VTDE T  A+ D E LS 
Sbjct  132   ELTGTDRPGLLSEICSVLTDFKCNVVKAELWTHNTRVASVVHVTDESTRSAIKDAERLST  191

Query  825   IKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASD-EALNHPDRPNV  1001
             IK+LL NVL+G + SR AK  ++ G+THT RRLHQ+MF DRDYER    E  +   RP V
Sbjct  192   IKELLRNVLEGDDDSRRAKMTVSTGSTHTARRLHQMMFDDRDYERVGVVEEGDKKSRPQV  251

Query  1002  SVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHID  1181
             +V +  ++DY+++ +R KDRPKLLFD +CTLT+M+YVVFHG V     E YQEYCIRHID
Sbjct  252   AVVDCKEKDYTIIILRSKDRPKLLFDTVCTLTEMQYVVFHGTVAPGNGETYQEYCIRHID  311

Query  1182  GSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
             G  V SDAER R++ CL+AAI+RR SEGL+LEL T DRVGLLS++TR FREN L +TRAE
Sbjct  312   GHRVNSDAERDRLVQCLQAAIQRRASEGLELELRTGDRVGLLSDITRAFRENGLCITRAE  371

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF  1541
             ++T   KAV+TFYV + SG PVDA+ I+ +R+ +GQ  L+VK  P    P++ +      
Sbjct  372   ISTEDAKAVDTFYVSEVSGSPVDAKTIDLIRRQVGQMFLRVKQEPFPSKPSEATSAIGFL  431

Query  1542  GGIFKSR  1562
              G F  R
Sbjct  432   LGNFLKR  438



>ref|XP_006338713.1| PREDICTED: uncharacterized protein LOC102582229 isoform X1 [Solanum 
tuberosum]
Length=448

 Score =   510 bits (1314),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 262/451 (58%), Positives = 337/451 (75%), Gaps = 17/451 (4%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDEY KLIRRMNPPRVVIDN++C+NAT+IQVDS NKHG LL+VVQVLTDLNL+ITKAYI
Sbjct  1     MDDEYAKLIRRMNPPRVVIDNDSCENATIIQVDSVNKHGILLQVVQVLTDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMK-----SLGPDSCFASSMRRSVGVTSGTD  632
              SDGGWFMDVFNVT+Q+G+K+ DE ++ YI K     +L  D     S+R +VG+    +
Sbjct  61    SSDGGWFMDVFNVTDQDGNKVRDEEIISYIQKFLVTQTLENDEVLLPSLRGTVGLMPSEE  120

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
             HTSIEL G+DRPGLLSEV AVL +L CNVVNA +WTHN RAAA++ V D+ T  A+ DP+
Sbjct  121   HTSIELSGTDRPGLLSEVCAVLADLHCNVVNAAIWTHNARAAAVVHVVDDITDCAIEDPK  180

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITH-GATHTDRRLHQLMFADRDY------ERASDE  971
              L+ IKKLL NVLKG+N  + AK  ++  G TH +RRLHQ+MF DRDY      E+ + E
Sbjct  181   RLATIKKLLRNVLKGNNDLKTAKMTLSPPGFTHRERRLHQIMFDDRDYVKVRKTEQGNIE  240

Query  972   ALNHPDRPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEA  1151
              L     P ++V    ++DY+V+T+R +DRPKLLFD++CTLTDM+YVVFHG V     EA
Sbjct  241   DLKSG--PCITVYYCSEKDYTVITMRSRDRPKLLFDIVCTLTDMQYVVFHGVVHTGKNEA  298

Query  1152  YQEYCIRHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFR  1331
             YQE+ IRH+DG P+ S+AER+RVI CLEAAIERR SEGL+LELCT DR+GLLS++TRIFR
Sbjct  299   YQEFYIRHVDGLPISSEAERERVILCLEAAIERRTSEGLELELCTEDRLGLLSDITRIFR  358

Query  1332  ENSLTVTRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP--EEQ  1505
             ENSL + RAE++T+GGKA + FYV D +G PV+ + ++S+ + +G  +L VK NP   E+
Sbjct  359   ENSLCIKRAEISTQGGKAKDIFYVTDVTGNPVEQKTVDSICEQVGPNMLHVKWNPCHSEK  418

Query  1506  NPTQESPTRSLFGGIFKSRSFCNFGLVRSYS  1598
              P +E     LFG +FK R+  +  L+ SY+
Sbjct  419   LP-EEGTISYLFGSLFKVRTLQSLKLIGSYT  448



>emb|CDX74326.1| BnaA03g27210D [Brassica napus]
Length=431

 Score =   509 bits (1311),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 259/431 (60%), Positives = 321/431 (74%), Gaps = 8/431 (2%)
 Frame = +3

Query  291   DDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYIC  470
             DDEY KL RRMNPPRVVIDN+A  +ATVIQVDS NK GTLLEVVQVLTD+NL+I KAYI 
Sbjct  3     DDEYAKLFRRMNPPRVVIDNKASDDATVIQVDSVNKQGTLLEVVQVLTDMNLVIKKAYIS  62

Query  471   SDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDS-CFASSMRRSVGVTSGTDHTSIE  647
             SDGGWFMDVF V +Q+G+KI D  +LD+I   +  ++  F   +R SVGV    ++T+IE
Sbjct  63    SDGGWFMDVFKVIHQDGNKITDTQLLDFIQMRIERNAGWFIPPLRSSVGVMPSDEYTTIE  122

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L CNVVNAE+WTHNTRAAA++  TD  T  A+TDP  LS I
Sbjct  123   LAGTDRPGLLSEVSAVLTDLHCNVVNAEIWTHNTRAAAVIHATDNTTNSAITDPLRLSTI  182

Query  828   KKLLCNVLKGSNKSRHAKTQITHGA-THTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             K LLCNV+  ++ SR AKT  +  + TH +RRLHQ+MF DRDYE           RP V+
Sbjct  183   KHLLCNVVGTNSGSRAAKTVFSSCSDTHRERRLHQIMFDDRDYEGVKKRP--RTSRPCVT  240

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             +TN  D+DY+VVT+R KDRPKL+FDV+CTLTDM+YVVFHG V  E  EAYQE+ IRH+DG
Sbjct  241   LTNI-DKDYTVVTMRSKDRPKLVFDVVCTLTDMQYVVFHGMVSTEPLEAYQEFYIRHVDG  299

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
              P+ S+AE++RVI CLEAAIERR SEGL+LEL   DRVGLLS++TR FRENSLT+ RAE+
Sbjct  300   LPINSEAEQERVIQCLEAAIERRTSEGLELELSAEDRVGLLSDITRTFRENSLTIVRAEI  359

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNP---EEQNPTQESPTRS  1535
             +TR GKA +TFYV D +G  V+++I+ES+R+ IG + L+VK           +QE+    
Sbjct  360   STREGKAKDTFYVTDVTGNAVESKIVESIRKEIGVSKLKVKECSVLGTSSRGSQETTIGY  419

Query  1536  LFGGIFKSRSF  1568
             L   IFKS+  
Sbjct  420   LLSNIFKSKPL  430



>ref|XP_007139290.1| hypothetical protein PHAVU_008G016800g [Phaseolus vulgaris]
 gb|ESW11284.1| hypothetical protein PHAVU_008G016800g [Phaseolus vulgaris]
Length=450

 Score =   510 bits (1313),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 261/442 (59%), Positives = 328/442 (74%), Gaps = 6/442 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             + DE+EKL+ RMNPPRV +DN + +  TVI+VDSAN+ G+LLEVVQVLTD+NL + +AYI
Sbjct  10    LHDEFEKLVIRMNPPRVTVDNVSSRTDTVIKVDSANRRGSLLEVVQVLTDMNLGVRRAYI  69

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDG WFMDVF+VT+Q G K   + V D I +SLGP +    S+RRSVGV +  +HT+IE
Sbjct  70    SSDGEWFMDVFHVTDQNGKKFEQDDVADRIQQSLGPRASSFRSLRRSVGVQAEAEHTTIE  129

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G DRPGLLSEV AVL +LKCNVV AEVWTHN+R A+++ +TDE TG ++ +P+ L+ I
Sbjct  130   LTGRDRPGLLSEVFAVLADLKCNVVAAEVWTHNSRMASVVYITDEATGLSIDNPDRLAKI  189

Query  828   KKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHPDRPN--V  1001
             K+LL  VLKG    + A T ++ G+TH DRRLHQLM+ADRDY+    ++ +  DR    V
Sbjct  190   KQLLLYVLKGDIDKKSANTAVSVGSTHKDRRLHQLMYADRDYDIDDGDSGSTSDRNKLLV  249

Query  1002  SVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHID  1181
             +V +  D+ Y+VV +RC DRPKLLFD +CTLTDM+YVV+HG V AEGPEAYQEY IRH+D
Sbjct  250   TVDDCIDKGYTVVNLRCPDRPKLLFDTVCTLTDMQYVVYHGTVIAEGPEAYQEYFIRHVD  309

Query  1182  GSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAE  1361
             G P+ S+AERQRVIHCLEAAI RR SEG+KLELC  DRVGLLS+VTRIFREN L V RAE
Sbjct  310   GCPISSEAERQRVIHCLEAAIRRRTSEGIKLELCGEDRVGLLSDVTRIFRENGLLVNRAE  369

Query  1362  VATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRSLF  1541
             V TRG +A+N FYV D +G PV +  IE+VR+ IG  IL VK +   + P  E    SL 
Sbjct  370   VTTRGTQAMNVFYVTDVTGNPVKSETIEAVRKEIGLAILHVKDDVCSKPPPHERGKFSL-  428

Query  1542  GGIFKSRS---FCNFGLVRSYS  1598
              G+F+S S    CN GL++SYS
Sbjct  429   SGLFRSSSEKFLCNLGLMKSYS  450



>ref|XP_009611121.1| PREDICTED: uncharacterized protein LOC104104686 isoform X1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 331/446 (74%), Gaps = 5/446 (1%)
 Frame = +3

Query  273   SYSQNMDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLII  452
             S S  +DDE+EKL+ RMNPPRV +DN + K  T+I+VDSANK G+LLEVVQVLTDLNLII
Sbjct  5     SSSLTVDDEFEKLVLRMNPPRVTVDNTSDKKTTLIKVDSANKRGSLLEVVQVLTDLNLII  64

Query  453   TKAYICSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTD  632
              +AYI SDG WFMDVF+VT++ G+K+ ++ V + I +SLGP  C   S+ RSVGV S  +
Sbjct  65    RRAYISSDGEWFMDVFHVTDEYGNKLSEDNVAERIQQSLGPRGCSFRSLARSVGVQSAAE  124

Query  633   HTSIELIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPE  812
              T+IEL G DRPGLLSE+ AVLT+ +CNV+ AEVWTHN+R A+++ ++DEE G A+ D +
Sbjct  125   QTTIELTGRDRPGLLSEIFAVLTDHRCNVIAAEVWTHNSRMASVVYISDEENGLAIDDTD  184

Query  813   TLSMIKKLLCNVLKGSNKSRHAKTQITHGATHTDRRLHQLMFADRDYERASDEALNHP-D  989
              L+ I++LL  VLKG      A T ++  +TH +RRLHQ+M+ADRDY++     ++    
Sbjct  185   RLAKIRQLLLYVLKGDRDRPSANTAVSVDSTHKERRLHQMMYADRDYDKDDTNCISSDRT  244

Query  990   RPNVSVTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCI  1169
             +P V+V N  D+ Y+VV +R  DRPKL+FD +CTLTDM+YVV+HG + AEG EAYQEY I
Sbjct  245   KPLVTVENCTDKGYTVVNLRGPDRPKLIFDTVCTLTDMQYVVYHGTIIAEGREAYQEYYI  304

Query  1170  RHIDGSPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTV  1349
             RH+DG P+ S+AERQRVI CLEAAI+RR S G++LELC  DR+G LS+VTRIFREN L+V
Sbjct  305   RHMDGCPISSEAERQRVIQCLEAAIKRRTSNGIRLELCGDDRIGFLSDVTRIFRENGLSV  364

Query  1350  TRAEVATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPT  1529
             +RAEV TRG +AVN FYV DASG  V +  IE+VR+ IGQT+L+VK +    +P Q++  
Sbjct  365   SRAEVTTRGSQAVNVFYVTDASGSQVKSETIEAVRKEIGQTVLRVKDDVYSDSPPQQTAR  424

Query  1530  RSLFGGIFKSRS---FCNFGLVRSYS  1598
              SL G IF+S S     N GL++S S
Sbjct  425   FSL-GHIFRSSSEKFLFNLGLIKSCS  449



>gb|KDO64432.1| hypothetical protein CISIN_1g013722mg [Citrus sinensis]
Length=437

 Score =   508 bits (1308),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 256/439 (58%), Positives = 326/439 (74%), Gaps = 4/439 (1%)
 Frame = +3

Query  288   MDDEYEKLIRRMNPPRVVIDNEACKNATVIQVDSANKHGTLLEVVQVLTDLNLIITKAYI  467
             MDDE+ KLIRRMNPPRVVIDN+ C++ATVIQVDS N+HG LLEV+Q L DLNL+ITKAYI
Sbjct  1     MDDEFAKLIRRMNPPRVVIDNDVCEHATVIQVDSVNRHGILLEVIQFLVDLNLVITKAYI  60

Query  468   CSDGGWFMDVFNVTNQEGSKIMDEAVLDYIMKSLGPDSCFASSMRRSVGVTSGTDHTSIE  647
              SDGG+ MDVF VT+  G KI D+A + YI  ++  ++ F +SMR SVGV    ++TSIE
Sbjct  61    SSDGGYLMDVFYVTDINGQKIGDQATISYIKTTVETNASFLNSMRSSVGVVPSKEYTSIE  120

Query  648   LIGSDRPGLLSEVSAVLTNLKCNVVNAEVWTHNTRAAAIMQVTDEETGGAVTDPETLSMI  827
             L G+DRPGLLSEVSAVLT+L C+VV+AE+WTHN RAAA++ V D+ +G A+ D + L  I
Sbjct  121   LTGTDRPGLLSEVSAVLTDLSCSVVSAEIWTHNARAAALLHVKDQSSGCAIEDQKRLLKI  180

Query  828   KKLLCNVLKGSNKSRHAKTQITHG-ATHTDRRLHQLMFADRDYERASDEALNHPDRPNVS  1004
             KKLLCNVL+ +   R     I+     H +RRLHQ++FADRD+ER   + +N+  RP+V+
Sbjct  181   KKLLCNVLRTNGDLRTPSMSISSARVLHGERRLHQMLFADRDFERL--DCVNYNSRPHVT  238

Query  1005  VTNWHDRDYSVVTIRCKDRPKLLFDVICTLTDMEYVVFHGNVDAEGPEAYQEYCIRHIDG  1184
             + +  DRDY+ VTIR KDRPKLLFD +C LTDM+YVV+HG V     EAYQEY I+H+DG
Sbjct  239   ILDCSDRDYTAVTIRSKDRPKLLFDTVCCLTDMQYVVYHGTVVTGRMEAYQEYYIKHVDG  298

Query  1185  SPVKSDAERQRVIHCLEAAIERRVSEGLKLELCTTDRVGLLSNVTRIFRENSLTVTRAEV  1364
              P+ S+AERQRV+ CLEAAIERR SEGL+LEL T DR GLLS++TRI RE  L + RAE+
Sbjct  299   FPISSEAERQRVMACLEAAIERRASEGLELELYTDDRFGLLSDITRILREYGLCIRRAEI  358

Query  1365  ATRGGKAVNTFYVGDASGYPVDARIIESVRQTIGQTILQVKGNPEEQNPTQESPTRS-LF  1541
             +T G K  +TF+V DASG PVD +I++S++  IG+TILQVKGN        + P RS  F
Sbjct  359   STMGRKVKDTFFVTDASGNPVDPKIVDSIQHQIGRTILQVKGNLNTPPKLPQEPARSFFF  418

Query  1542  GGIFKSRSFCNFGLVRSYS  1598
                FK RSF +F L++S S
Sbjct  419   TNFFKGRSFQSFKLIKSCS  437



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5681893186740