BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23317_g3_i1 len=3542 path=[6891:0-2257 9149:2258-2291
9183:2292-3541]

Length=3542
                                                                      Score     E

ref|XP_009605496.1|  PREDICTED: uncharacterized protein LOC104100042   1320   0.0      
ref|XP_009790578.1|  PREDICTED: uncharacterized protein LOC104238021   1313   0.0      
ref|XP_006359246.1|  PREDICTED: uncharacterized protein LOC102601...   1256   0.0      
ref|XP_004245794.1|  PREDICTED: uncharacterized protein LOC101264658   1252   0.0      
emb|CBI29086.3|  unnamed protein product                               1197   0.0      
ref|XP_002271166.1|  PREDICTED: uncharacterized protein LOC100264354   1196   0.0      Vitis vinifera
ref|XP_006375222.1|  hypothetical protein POPTR_0014s05410g            1191   0.0      
ref|XP_011032909.1|  PREDICTED: uncharacterized protein LOC105131568   1189   0.0      
ref|XP_006375216.1|  hypothetical protein POPTR_0014s05360g            1182   0.0      
ref|XP_007052246.1|  Zinc ion binding protein isoform 1                1168   0.0      
ref|XP_011088310.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1160   0.0      
ref|XP_010269623.1|  PREDICTED: uncharacterized protein LOC104606193   1150   0.0      
gb|KHG00863.1|  CUE domain-containing 5                                1147   0.0      
emb|CDP15763.1|  unnamed protein product                               1144   0.0      
ref|XP_006445380.1|  hypothetical protein CICLE_v10018658mg            1142   0.0      
ref|XP_007203395.1|  hypothetical protein PRUPE_ppa021037mg            1139   0.0      
gb|KDP28838.1|  hypothetical protein JCGZ_14609                        1137   0.0      
ref|XP_010053257.1|  PREDICTED: uncharacterized protein LOC104441745   1132   0.0      
ref|XP_009349923.1|  PREDICTED: uncharacterized protein LOC103941455   1114   0.0      
gb|EYU37722.1|  hypothetical protein MIMGU_mgv1a023319mg               1112   0.0      
ref|XP_007146127.1|  hypothetical protein PHAVU_006G014600g            1110   0.0      
ref|XP_002528170.1|  conserved hypothetical protein                    1108   0.0      Ricinus communis
ref|XP_007138737.1|  hypothetical protein PHAVU_009G233100g            1108   0.0      
ref|XP_003528591.1|  PREDICTED: uncharacterized protein LOC100819...   1092   0.0      
ref|XP_004158072.1|  PREDICTED: uncharacterized LOC101211068           1087   0.0      
ref|XP_004135549.1|  PREDICTED: uncharacterized protein LOC101211068   1086   0.0      
ref|XP_004513230.1|  PREDICTED: uncharacterized protein LOC101502422   1085   0.0      
ref|XP_008445258.1|  PREDICTED: uncharacterized protein LOC103488...   1083   0.0      
ref|XP_008381415.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1080   0.0      
ref|XP_008445298.1|  PREDICTED: uncharacterized protein LOC103488...   1079   0.0      
ref|XP_008232361.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1079   0.0      
ref|XP_004295012.1|  PREDICTED: uncharacterized protein LOC101310972   1077   0.0      
ref|XP_010921093.1|  PREDICTED: uncharacterized protein LOC105044782   1062   0.0      
gb|AES89835.2|  zinc ion-binding protein                               1058   0.0      
ref|XP_008782616.1|  PREDICTED: uncharacterized protein LOC103702098   1054   0.0      
ref|XP_010540374.1|  PREDICTED: uncharacterized protein LOC104814172   1043   0.0      
ref|XP_003607638.1|  hypothetical protein MTR_4g080580                 1039   0.0      
ref|XP_010692100.1|  PREDICTED: uncharacterized protein LOC104905308   1037   0.0      
ref|XP_009139573.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1030   0.0      
ref|XP_006414836.1|  hypothetical protein EUTSA_v10024472mg            1030   0.0      
emb|CDY01179.1|  BnaA04g06400D                                         1029   0.0      
ref|XP_009406639.1|  PREDICTED: uncharacterized protein LOC103989501   1025   0.0      
ref|XP_002868324.1|  zinc ion binding protein                          1024   0.0      
ref|XP_010450122.1|  PREDICTED: uncharacterized protein LOC104732283   1023   0.0      
emb|CDY50427.1|  BnaCnng19360D                                         1023   0.0      
ref|NP_193133.3|  zinc ion binding protein                             1019   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450143.1|  PREDICTED: uncharacterized protein LOC104732307   1016   0.0      
ref|XP_006283161.1|  hypothetical protein CARUB_v10004191mg            1016   0.0      
ref|XP_007052247.1|  Zinc ion binding protein isoform 2                 998   0.0      
ref|XP_002301246.2|  hypothetical protein POPTR_0002s14170g             981   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003566605.1|  PREDICTED: uncharacterized protein LOC100828484    964   0.0      
ref|NP_001059218.1|  Os07g0227700                                       964   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670947.1|  PREDICTED: uncharacterized protein LOC103648233    956   0.0      
ref|XP_002461610.1|  hypothetical protein SORBIDRAFT_02g005340          956   0.0      Sorghum bicolor [broomcorn]
dbj|BAK03605.1|  predicted protein                                      946   0.0      
gb|EMS58193.1|  hypothetical protein TRIUR3_12822                       938   0.0      
ref|XP_006858725.1|  hypothetical protein AMTR_s00066p00115970          924   0.0      
ref|XP_008445306.1|  PREDICTED: uncharacterized protein LOC103488...    921   0.0      
dbj|BAC84431.1|  hypothetical protein                                   888   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC81754.1|  hypothetical protein OsI_25420                          844   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMT07282.1|  hypothetical protein F775_09518                         798   0.0      
emb|CAB10176.1|  hypothetical protein                                   710   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108922.1|  hypothetical protein L484_027117                   687   0.0      
ref|XP_011019704.1|  PREDICTED: uncharacterized protein LOC105122...    676   0.0      
ref|XP_011019705.1|  PREDICTED: uncharacterized protein LOC105122...    671   0.0      
ref|XP_006450581.1|  hypothetical protein CICLE_v10010703mg             662   0.0      
ref|XP_006476176.1|  PREDICTED: uncharacterized protein LOC102625...    662   0.0      
gb|KDO79654.1|  hypothetical protein CISIN_1g039513mg                   660   0.0      
ref|XP_007013718.1|  SWIM zinc finger family protein isoform 2          654   0.0      
gb|KHG17737.1|  Arrestin-C                                              653   0.0      
ref|XP_007013717.1|  SWIM zinc finger family protein isoform 1          650   0.0      
ref|XP_006842250.1|  hypothetical protein AMTR_s00078p00196690          653   0.0      
ref|XP_008378289.1|  PREDICTED: uncharacterized protein LOC103441391    648   0.0      
gb|EPS74375.1|  hypothetical protein M569_00380                         635   0.0      
ref|XP_009377375.1|  PREDICTED: uncharacterized protein LOC103965988    646   0.0      
ref|XP_002516601.1|  conserved hypothetical protein                     644   0.0      Ricinus communis
ref|XP_002309581.2|  hypothetical protein POPTR_0006s26200g             644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002281999.2|  PREDICTED: uncharacterized protein LOC100245...    642   0.0      Vitis vinifera
ref|XP_006840321.1|  hypothetical protein AMTR_s00045p00084300          642   0.0      
gb|KDP43797.1|  hypothetical protein JCGZ_23005                         641   0.0      
ref|XP_007224640.1|  hypothetical protein PRUPE_ppa026389mg             640   0.0      
ref|XP_008219841.1|  PREDICTED: uncharacterized protein LOC103320013    639   0.0      
ref|XP_010249820.1|  PREDICTED: uncharacterized protein LOC104592...    639   0.0      
ref|XP_010095498.1|  hypothetical protein L484_014926                   637   0.0      
gb|KHN10289.1|  hypothetical protein glysoja_017893                     636   0.0      
ref|XP_006578182.1|  PREDICTED: uncharacterized protein LOC100779025    635   0.0      
ref|XP_008787735.1|  PREDICTED: uncharacterized protein LOC103705694    634   0.0      
ref|XP_007040728.1|  SWIM zinc finger family protein                    632   0.0      
gb|KDP32636.1|  hypothetical protein JCGZ_13186                         630   0.0      
dbj|BAF01455.1|  hypothetical protein                                   620   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255617.1|  PREDICTED: uncharacterized protein LOC104596236    626   0.0      
ref|XP_008441058.1|  PREDICTED: uncharacterized protein LOC103485285    625   0.0      
ref|XP_002274170.1|  PREDICTED: uncharacterized protein LOC100247174    624   0.0      Vitis vinifera
ref|XP_010921228.1|  PREDICTED: uncharacterized protein LOC105044872    624   0.0      
ref|XP_004148660.1|  PREDICTED: uncharacterized protein LOC101204643    623   0.0      
ref|XP_007137090.1|  hypothetical protein PHAVU_009G098900g             624   0.0      
ref|XP_004163046.1|  PREDICTED: uncharacterized LOC101204643            621   0.0      
ref|XP_006432214.1|  hypothetical protein CICLE_v10000430mg             620   0.0      
ref|XP_002518981.1|  conserved hypothetical protein                     619   0.0      Ricinus communis
ref|XP_010249825.1|  PREDICTED: uncharacterized protein LOC104592...    618   0.0      
gb|KDO50309.1|  hypothetical protein CISIN_1g005059mg                   618   0.0      
ref|XP_011022940.1|  PREDICTED: uncharacterized protein LOC105124571    616   0.0      
ref|XP_010027651.1|  PREDICTED: uncharacterized protein LOC104418118    616   0.0      
ref|XP_008391981.1|  PREDICTED: uncharacterized protein LOC103454170    616   0.0      
ref|XP_008351508.1|  PREDICTED: uncharacterized protein LOC103414930    616   0.0      
ref|XP_009348880.1|  PREDICTED: uncharacterized protein LOC103940490    616   0.0      
ref|XP_008360601.1|  PREDICTED: uncharacterized protein LOC103424292    616   0.0      
ref|XP_009613006.1|  PREDICTED: uncharacterized protein LOC104106214    615   0.0      
ref|XP_004501270.1|  PREDICTED: uncharacterized protein LOC101505...    614   0.0      
gb|KGN60133.1|  hypothetical protein Csa_3G879510                       612   0.0      
ref|XP_009781835.1|  PREDICTED: uncharacterized protein LOC104230671    613   0.0      
ref|XP_002309914.2|  SWIM zinc finger family protein                    612   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN17186.1|  hypothetical protein glysoja_010645                     612   0.0      
ref|XP_004511186.1|  PREDICTED: uncharacterized protein LOC101498464    614   0.0      
gb|KHN13990.1|  hypothetical protein glysoja_025007                     611   0.0      
ref|XP_011099737.1|  PREDICTED: uncharacterized protein LOC105178078    611   0.0      
ref|XP_003552176.1|  PREDICTED: uncharacterized protein LOC100776331    611   0.0      
ref|XP_006361419.1|  PREDICTED: uncharacterized protein LOC102587868    611   0.0      
ref|XP_010049049.1|  PREDICTED: uncharacterized protein LOC104437...    608   0.0      
ref|XP_006596000.1|  PREDICTED: uncharacterized protein LOC100809...    609   0.0      
gb|AET02590.2|  SWIM zinc finger protein                                609   0.0      
ref|XP_004287787.1|  PREDICTED: uncharacterized protein LOC101292541    606   0.0      
ref|XP_008242047.1|  PREDICTED: uncharacterized protein LOC103340404    606   0.0      
ref|XP_011081859.1|  PREDICTED: uncharacterized protein LOC105164...    605   0.0      
ref|XP_009383179.1|  PREDICTED: uncharacterized protein LOC103970968    606   0.0      
ref|XP_004968166.1|  PREDICTED: uncharacterized protein LOC101763681    605   0.0      
ref|XP_004236786.1|  PREDICTED: uncharacterized protein LOC101247514    605   0.0      
ref|XP_007133525.1|  hypothetical protein PHAVU_011G186500g             605   0.0      
ref|XP_008466356.1|  PREDICTED: uncharacterized protein LOC103503...    603   0.0      
ref|XP_002466103.1|  hypothetical protein SORBIDRAFT_01g001310          605   0.0      Sorghum bicolor [broomcorn]
ref|XP_008466358.1|  PREDICTED: uncharacterized protein LOC103503...    603   0.0      
emb|CDP09645.1|  unnamed protein product                                604   0.0      
emb|CAN60858.1|  hypothetical protein VITISV_039453                     603   0.0      Vitis vinifera
ref|XP_007204630.1|  hypothetical protein PRUPE_ppa002073mg             602   0.0      
ref|XP_002886608.1|  predicted protein                                  601   0.0      
ref|XP_010674758.1|  PREDICTED: uncharacterized protein LOC104890846    601   0.0      
ref|NP_176256.2|  SWIM zinc finger domain-containing protein            600   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003628114.1|  hypothetical protein MTR_8g043760                  601   0.0      
emb|CAN76964.1|  hypothetical protein VITISV_043960                     600   0.0      Vitis vinifera
ref|XP_003576405.1|  PREDICTED: uncharacterized protein LOC100828723    599   0.0      
gb|EYU21901.1|  hypothetical protein MIMGU_mgv1a023458mg                596   0.0      
ref|NP_001062830.1|  Os09g0309100                                       597   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC84321.1|  hypothetical protein OsI_30820                          596   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006300800.1|  hypothetical protein CARUB_v10019879mg             594   0.0      
ref|XP_010417988.1|  PREDICTED: uncharacterized protein LOC104703...    592   0.0      
ref|XP_006660525.1|  PREDICTED: uncharacterized protein LOC102707611    592   0.0      
ref|XP_010542310.1|  PREDICTED: uncharacterized protein LOC104815571    591   0.0      
ref|XP_010473234.1|  PREDICTED: uncharacterized protein LOC104752724    590   0.0      
ref|XP_006392152.1|  hypothetical protein EUTSA_v10023307mg             590   0.0      
gb|EYU23749.1|  hypothetical protein MIMGU_mgv1a002058mg                590   0.0      
ref|XP_009103823.1|  PREDICTED: uncharacterized protein LOC103829887    588   0.0      
dbj|BAK04195.1|  predicted protein                                      589   0.0      
gb|KFK40774.1|  hypothetical protein AALP_AA2G039200                    588   0.0      
ref|XP_004136464.1|  PREDICTED: uncharacterized protein LOC101215653    583   0.0      
ref|XP_010510937.1|  PREDICTED: uncharacterized protein LOC104787...    584   0.0      
emb|CDY24539.1|  BnaA01g22430D                                          580   0.0      
ref|XP_008644121.1|  PREDICTED: uncharacterized protein LOC100383...    579   0.0      
emb|CDY34123.1|  BnaC01g28630D                                          559   1e-180   
gb|AES96430.2|  zinc ion-binding protein                                556   9e-180   
gb|EMT08273.1|  hypothetical protein F775_06016                         551   4e-177   
ref|XP_011019706.1|  PREDICTED: uncharacterized protein LOC105122...    543   4e-176   
gb|EPS61942.1|  hypothetical protein M569_12851                         545   4e-175   
ref|XP_003613472.1|  hypothetical protein MTR_5g037070                  541   1e-173   
gb|KHG17736.1|  Sacsin                                                  528   2e-171   
gb|AAB71951.1|  Hypothetical Protein                                    529   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013719.1|  SWIM zinc finger family protein isoform 3          526   2e-169   
gb|KDO50310.1|  hypothetical protein CISIN_1g005059mg                   523   2e-167   
ref|XP_003628100.1|  hypothetical protein MTR_8g043530                  525   4e-166   
ref|XP_010648578.1|  PREDICTED: uncharacterized protein LOC100245...    510   1e-163   
gb|EMS61136.1|  hypothetical protein TRIUR3_35179                       512   5e-163   
ref|XP_010049050.1|  PREDICTED: uncharacterized protein LOC104437...    510   8e-163   
ref|XP_004292961.1|  PREDICTED: uncharacterized protein LOC101313282    508   9e-163   
ref|NP_974054.1|  SWIM zinc finger domain-containing protein            495   5e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081862.1|  PREDICTED: uncharacterized protein LOC105164...    471   6e-149   
gb|AES73739.2|  zinc ion-binding protein                                467   1e-147   
ref|XP_003603488.1|  hypothetical protein MTR_3g108220                  455   9e-143   
gb|KFK40773.1|  hypothetical protein AALP_AA2G039200                    451   3e-140   
ref|XP_010090844.1|  hypothetical protein L484_020703                   383   4e-118   
ref|XP_010108923.1|  hypothetical protein L484_027118                   381   3e-116   
ref|XP_004162497.1|  PREDICTED: uncharacterized LOC101215653            381   7e-116   
ref|XP_006827055.1|  hypothetical protein AMTR_s00010p00231990          382   2e-112   
gb|EYU33119.1|  hypothetical protein MIMGU_mgv1a009920mg                349   3e-106   
gb|AFK48408.1|  unknown                                                 325   3e-99    
tpg|DAA42489.1|  TPA: hypothetical protein ZEAMMB73_890904              314   7e-95    
gb|AFW66989.1|  hypothetical protein ZEAMMB73_942101                    309   2e-91    
gb|KHN16480.1|  hypothetical protein glysoja_036582                     260   4e-73    
tpg|DAA42494.1|  TPA: hypothetical protein ZEAMMB73_619750              246   2e-71    
gb|EYU24925.1|  hypothetical protein MIMGU_mgv1a022371mg                249   3e-70    
gb|AGZ89234.1|  MLOC_22581-like protein                                 224   4e-64    
ref|NP_001169995.1|  uncharacterized protein LOC100383900               231   3e-63    Zea mays [maize]
gb|KHN38118.1|  hypothetical protein glysoja_007160                     159   6e-39    
ref|XP_003624419.1|  hypothetical protein MTR_7g082990                  145   3e-36    
ref|XP_010090843.1|  hypothetical protein L484_020702                   146   5e-35    
ref|XP_004291410.1|  PREDICTED: uncharacterized protein LOC101296739    126   1e-29    
gb|KHN10140.1|  hypothetical protein glysoja_023721                   93.2    1e-17    
ref|XP_006855942.1|  hypothetical protein AMTR_s00037p00218460        93.6    2e-17    
ref|XP_003628102.1|  Cellulose synthase                               96.3    2e-17    
gb|KDO36953.1|  hypothetical protein CISIN_1g034580mg                 82.0    2e-14    
gb|KFM22548.1|  hypothetical protein F751_0052                        86.7    8e-14    
ref|XP_003390496.1|  PREDICTED: hypothetical protein LOC100636472     86.3    1e-13    
gb|KFM69083.1|  hypothetical protein X975_14697                       85.5    2e-13    
gb|EYU23542.1|  hypothetical protein MIMGU_mgv1a019642mg              73.9    8e-12    
gb|EYU40888.1|  hypothetical protein MIMGU_mgv1a018026mg              73.9    9e-12    
ref|XP_003388723.1|  PREDICTED: hypothetical protein LOC100638179     79.3    2e-11    
ref|XP_003390653.1|  PREDICTED: hypothetical protein LOC100639460     78.2    2e-11    
emb|CEG00893.1|  Peptidase C48, SUMO/Sentrin/Ubl1                     72.8    1e-09    
ref|XP_003074723.1|  Protease, Ulp1 family (ISS)                      72.0    2e-09    
ref|XP_793556.3|  PREDICTED: uncharacterized protein LOC588798        70.9    3e-09    Strongylocentrotus purpuratus [purple urchin]
ref|XP_003391041.1|  PREDICTED: hypothetical protein LOC100636384     71.2    4e-09    
gb|EIE89847.1|  hypothetical protein RO3G_14558                       67.0    2e-08    
ref|XP_008189988.1|  PREDICTED: uncharacterized protein LOC103311925  68.2    3e-08    
ref|XP_008183964.1|  PREDICTED: uncharacterized protein LOC103309676  68.6    3e-08    
gb|EIE76341.1|  hypothetical protein RO3G_01045                       67.0    5e-08    
gb|KHJ95183.1|  hypothetical protein OESDEN_04875                     67.8    5e-08    
ref|XP_002585982.1|  hypothetical protein BRAFLDRAFT_110252           67.0    9e-08    Branchiostoma floridae
ref|XP_008475837.1|  PREDICTED: uncharacterized protein LOC103512829  66.2    1e-07    
gb|KFM78090.1|  hypothetical protein X975_08556                       63.5    1e-07    
ref|XP_002416515.1|  conserved hypothetical protein                   65.9    2e-07    Ixodes scapularis [blacklegged tick]
ref|XP_004211156.1|  PREDICTED: uncharacterized protein LOC101241630  65.1    3e-07    
ref|XP_005091692.1|  PREDICTED: uncharacterized protein LOC101864592  65.9    3e-07    
ref|XP_002587205.1|  hypothetical protein BRAFLDRAFT_102090           64.7    3e-07    Branchiostoma floridae
ref|XP_008178421.1|  PREDICTED: uncharacterized protein LOC100568494  64.7    4e-07    
ref|XP_003387167.1|  PREDICTED: hypothetical protein LOC100634859     64.3    7e-07    
ref|XP_005851835.1|  hypothetical protein CHLNCDRAFT_133328           61.6    2e-06    
ref|XP_005846663.1|  hypothetical protein CHLNCDRAFT_135360           61.2    3e-06    
ref|XP_005843545.1|  hypothetical protein CHLNCDRAFT_140162           62.0    3e-06    
ref|XP_005846407.1|  hypothetical protein CHLNCDRAFT_58222            61.6    5e-06    
ref|XP_005845169.1|  hypothetical protein CHLNCDRAFT_137356           60.8    6e-06    
gb|KFM58447.1|  hypothetical protein X975_10518                       60.8    7e-06    
gb|ADE77528.1|  unknown                                               57.4    8e-06    
ref|XP_005848966.1|  hypothetical protein CHLNCDRAFT_144489           60.1    1e-05    
emb|CEJ00747.1|  hypothetical protein RMCBS344292_14795               59.3    2e-05    
gb|EIE90463.1|  hypothetical protein RO3G_15174                       59.7    2e-05    
ref|XP_008185710.1|  PREDICTED: uncharacterized protein LOC103310160  59.3    2e-05    
ref|XP_002123387.1|  PREDICTED: uncharacterized protein zf(c2h2/s...  59.7    2e-05    Ciona intestinalis [sea vase]
tpd|FAA00144.1|  TPA: zinc finger protein                             59.7    2e-05    
ref|XP_008179308.1|  PREDICTED: uncharacterized protein LOC103308155  58.2    3e-05    
ref|XP_008184675.1|  PREDICTED: uncharacterized protein LOC100575142  58.5    3e-05    
ref|XP_005451942.1|  PREDICTED: uncharacterized protein LOC102078155  55.8    4e-05    
gb|KFM68785.1|  putative zinc finger transcription factor protein 17  57.4    8e-05    
gb|ADE76062.1|  unknown                                               53.5    9e-05    
gb|EYC40549.1|  hypothetical protein Y032_0607g586                    57.4    1e-04    
gb|EYC40547.1|  hypothetical protein Y032_0607g586                    57.4    1e-04    
gb|EYC40548.1|  hypothetical protein Y032_0607g586                    57.0    1e-04    
gb|EYC40546.1|  hypothetical protein Y032_0607g586                    57.0    1e-04    
gb|EYC40550.1|  hypothetical protein Y032_0607g586                    57.0    1e-04    
gb|KFM73864.1|  putative zinc finger transcription factor protein 17  57.0    1e-04    
gb|KFM66875.1|  hypothetical protein X975_01819                       56.2    2e-04    
ref|XP_002607282.1|  hypothetical protein BRAFLDRAFT_88230            54.3    2e-04    Branchiostoma floridae
ref|XP_003392145.1|  PREDICTED: hypothetical protein LOC100638283     53.5    3e-04    
gb|EIE75499.1|  hypothetical protein RO3G_00203                       55.5    3e-04    
ref|XP_005846805.1|  hypothetical protein CHLNCDRAFT_135359           52.0    4e-04    
ref|XP_003628101.1|  hypothetical protein MTR_8g043550                51.2    7e-04    
gb|EIE84655.1|  hypothetical protein RO3G_09365                       54.3    7e-04    
ref|XP_003386977.1|  PREDICTED: hypothetical protein LOC100639658     51.2    8e-04    
gb|EIE76546.1|  hypothetical protein RO3G_01250                       53.5    8e-04    
ref|XP_008179519.1|  PREDICTED: uncharacterized protein LOC103308233  53.9    8e-04    
gb|KFM81995.1|  hypothetical protein X975_18918                       53.1    0.001    
ref|XP_008178898.1|  PREDICTED: uncharacterized protein LOC103308041  53.1    0.001    



>ref|XP_009605496.1| PREDICTED: uncharacterized protein LOC104100042 [Nicotiana tomentosiformis]
Length=895

 Score =  1320 bits (3416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/890 (71%), Positives = 731/890 (82%), Gaps = 10/890 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+ILSLPVQNPPTLEFSS+++VWSKVEGWRDNIDRVALIP+ARVDDFVRGESAN+E
Sbjct  1     MARWDQILSLPVQNPPTLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANRE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR A+ +YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK 
Sbjct  61    CPTRFHVEARRRRPAEITYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDK GLPCHGPQDKKAAGTRAMYAP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKNGLPCHGPQDKKAAGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD+DDA+SIS+WVESHQNH+FFY++FSDSDPFVLGIQTEWQLQQ+IRFGN GLLASD+
Sbjct  241   YELDSDDAVSISMWVESHQNHVFFYENFSDSDPFVLGIQTEWQLQQLIRFGNHGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFA  DT+RWMRALYNRVH KDP WKLA
Sbjct  301   KFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFARGDTLRWMRALYNRVHMKDPKWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+PAIREVFQCSVLI FWRVRHAWHKNL+K+CSEME    IAKRLG+ +H 
Sbjct  361   GFIVDDPSADVPAIREVFQCSVLICFWRVRHAWHKNLIKKCSEMETCAAIAKRLGQAVHR  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G   A  FE FMEDFVDA +F+DYFKATWYPRLGLW++ALR LPLASQETC+A+E+Y
Sbjct  421   ICRGDGIAVLFEEFMEDFVDAADFLDYFKATWYPRLGLWTSALRTLPLASQETCSAMEYY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+++SVYERADWLVDKL TTVHSYFWLDEYSGKD+FARYWK+EW+SGLTA
Sbjct  481   HNQLKLRLLNEKEISVYERADWLVDKLDTTVHSYFWLDEYSGKDEFARYWKNEWMSGLTA  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W+KSLQIPD DV ++G+ + VVDQ D++ +HV+ +P+SE+A+CDCN A MGNLCEH  KS
Sbjct  541   WQKSLQIPDSDVLVEGDYSNVVDQEDRHQLHVVRSPASEYAICDCNWAKMGNLCEHTLKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI----G  1249
             IKYLRD+GS T S SMFQY QAL+ MLHCPPYDSLIRDHALS+AVWVQ QLN+Q+    G
Sbjct  601   IKYLRDKGSITPSTSMFQYMQALVDMLHCPPYDSLIRDHALSLAVWVQTQLNAQLGPGSG  660

Query  1248  QESVQVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHS-VDHIVA  1072
             Q   Q +  T    G   + VN S    T      G  +L HS    + L    +D +  
Sbjct  661   QSKRQGLQLTAATPGHYTEVVNASNRTDTLPYVVGGLTELQHSSSATDNLSGGQIDRVCT  720

Query  1071  RNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGPD  892
              NG C +     +VE   + +  SP S+     QLFS+DEVTS D+ AENG V+I    +
Sbjct  721   ENGTCADIVP--SVENSPVAMETSPLSISACATQLFSLDEVTSADVFAENGGVMIGEELE  778

Query  891   ITENLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQNGV  715
              T+NLP TD SF+N N F D+VLNK D    +D + Q L++     +SL+Q   +QQN +
Sbjct  779   TTKNLPSTDTSFANSNSFEDDVLNKADCATMVDEQPQPLYVA-PAEKSLDQCLKNQQNDL  837

Query  714   CGNRKDTWVGPCIVSVGGKTDKDSSETSEPVDSCLVNVGESSNFIEEGVR  565
             C N  +  V P + +V  + D   S T++PV S L+N+ E+S  +E+ +R
Sbjct  838   CCNSIEPEVSPRLQNVDNRIDNAISSTTKPVQSSLINMAEASE-VEKHMR  886



>ref|XP_009790578.1| PREDICTED: uncharacterized protein LOC104238021 [Nicotiana sylvestris]
 ref|XP_009790580.1| PREDICTED: uncharacterized protein LOC104238021 [Nicotiana sylvestris]
Length=898

 Score =  1313 bits (3398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/898 (71%), Positives = 736/898 (82%), Gaps = 12/898 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+ILSLPVQNPPTLEFSS+++VWSKVEGWRDNIDRVALIP+ARVDDFVRGESANKE
Sbjct  1     MARWDQILSLPVQNPPTLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR A+ +YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK 
Sbjct  61    CPTRFHVEARRRRPAEITYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKH+DK GLPCHGPQDKKAAGTRAMYAP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHIDKNGLPCHGPQDKKAAGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD+DDA+SIS+WVESHQNH+FFY++FSDSDPFVLGIQTEWQLQQ+IRFGN GLLASD+
Sbjct  241   YELDSDDAVSISMWVESHQNHVFFYENFSDSDPFVLGIQTEWQLQQLIRFGNHGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRF+S DT+RWMRALYNRVH KDP WKLA
Sbjct  301   KFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFSSGDTLRWMRALYNRVHMKDPKWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+PAIREVFQCSVLI FWRVRHAWHKNL+K+CSEME    IAK LG+ +H 
Sbjct  361   GFIVDDPSADVPAIREVFQCSVLICFWRVRHAWHKNLIKKCSEMETCAAIAKWLGQAVHH  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG   A  FE FMEDFVDA +F+DYFKATWYPRLGLW++ALR LPLASQETC+A+E+Y
Sbjct  421   ICKGDGTAVLFEEFMEDFVDAADFMDYFKATWYPRLGLWTSALRTLPLASQETCSAMEYY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE++LSVYERADWLVDKL TTVHSYFWLDEYSGKD+FARYWK+EW+SGLTA
Sbjct  481   HNQLKLRLLNEKELSVYERADWLVDKLDTTVHSYFWLDEYSGKDEFARYWKNEWMSGLTA  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W+KSLQIPD DV ++G+ +KVVDQ D++ +HV+ +P+SE+A+CDCN A MGNLCEH  KS
Sbjct  541   WQKSLQIPDSDVLVEGDYSKVVDQEDRHQLHVVRSPASEYAICDCNWAKMGNLCEHTLKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IKYLRD+GS T S SMFQY QAL+ ML CPPYDSLIRDHALS+AVWVQ QL++Q+G  S 
Sbjct  601   IKYLRDKGSITPSTSMFQYMQALVDMLRCPPYDSLIRDHALSLAVWVQTQLDAQLGPGSG  660

Query  1236  QVVGP----TTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHSVDHIVAR  1069
             Q +      T    G   + VN S    T      G  +L HS    + L       + +
Sbjct  661   QFMRQGLQLTAATPGHYTEVVNASNRRDTLPYVVGGLTELQHSSSAADNLSGGQ---IDQ  717

Query  1068  NGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGPDI  889
             +G C +     AVE   +E+  SP S+     QLFS+D VTS D+ AENG V++    D 
Sbjct  718   DGTCADRVP--AVENSPVEMETSPLSISACATQLFSLDGVTSADVFAENGGVMVGEELDT  775

Query  888   TENLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQNGVC  712
             T+NLP TD SF+N N F D+VLNK D    +D + Q L++     +SL+Q   +QQN +C
Sbjct  776   TKNLPSTDTSFANSNGFEDDVLNKADCATMVDEQPQPLYVA-PAEKSLDQCLRNQQNDLC  834

Query  711   GNRKDTWVGPCIVSVGGKTDKDSSETSEPVDSCLVNVGESSNFIEEGVREGPENQSAG  538
              N  +  + P + +V  + D   S T++PV+S LVN+ E+S  +E+ +R    +++AG
Sbjct  835   CNSIEPEISPRLQNVDNRIDNAISSTTKPVESSLVNMAEASE-VEKHMRIDSIDENAG  891



>ref|XP_006359246.1| PREDICTED: uncharacterized protein LOC102601875 isoform X1 [Solanum 
tuberosum]
 ref|XP_006359247.1| PREDICTED: uncharacterized protein LOC102601875 isoform X2 [Solanum 
tuberosum]
Length=788

 Score =  1256 bits (3250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/792 (76%), Positives = 672/792 (85%), Gaps = 11/792 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+ILSLPVQ+PP+LEFSS+++VWSKVEGWRDNIDRVALIP+ARVDDFVRGESANKE
Sbjct  1     MARWDQILSLPVQSPPSLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR A+++YKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKK 
Sbjct  61    CPTRFHVEARRRRPAESTYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             +GRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKH+DKKGLPCHGPQDKK+AGTRAMYAP
Sbjct  121   SGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHMDKKGLPCHGPQDKKSAGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SI++WVESHQN +FFY++FSDSDPFVLGIQTEWQLQQ+IRFGN GLLASD+
Sbjct  241   YELDTDDAVSINMWVESHQNQVFFYENFSDSDPFVLGIQTEWQLQQLIRFGNHGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYPI SLVVFNSDNKAIPVAWII PRFAS DT+RWMRALYNRVH KDP WKLA
Sbjct  301   KFGTNKLKYPIRSLVVFNSDNKAIPVAWIITPRFASGDTLRWMRALYNRVHMKDPKWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI AIREVFQCSVLI FWRVRHAWHKNL+K+CSE+E    IAKRLG+ +  
Sbjct  361   GFIVDDPSADILAIREVFQCSVLICFWRVRHAWHKNLIKKCSELETCAVIAKRLGQAVQR  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG   A+ FE FMEDFVDA +F DYFKA WYPRLGLW++ALR LPLASQE C+++E+Y
Sbjct  421   ICKGDGTADLFEEFMEDFVDAADFSDYFKAIWYPRLGLWTSALRTLPLASQEMCSSMEYY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE++ SVY+RADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEW+SGLTA
Sbjct  481   HNQLKLRLLNEKEKSVYQRADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWMSGLTA  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W+KSLQIPD DV I+G+ +KVVDQ D++ VHV+ NP+SE+ALCDCN A MGNLCEH+ KS
Sbjct  541   WQKSLQIPDSDVLIEGDYSKVVDQEDRHKVHVVRNPASEYALCDCNWAKMGNLCEHILKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI----G  1249
             IK LRD+GS T S+SMFQY QAL+ MLHCPP+DSLIRDHALS+AVWVQ QLN+Q+    G
Sbjct  601   IKCLRDKGSITPSLSMFQYMQALVDMLHCPPHDSLIRDHALSLAVWVQTQLNAQLGPGSG  660

Query  1248  QESVQVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHH-SGFTKNQLCHSVDHIVA  1072
             Q   Q +  TT   G     V  S    T     +   +L H S  T N     +D +  
Sbjct  661   QSKRQALQLTTATPG----VVRASNRTHTLVNVENDLTELQHPSSATGNLSGGKIDRVAT  716

Query  1071  RNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGPD  892
              NG CT+     AVE P +E+  SP S+     QLFS+D +TS ++ AENG V+ID   D
Sbjct  717   ENGTCTDIGS--AVEHPSVEMQTSPVSISACATQLFSLDGITSANVFAENGDVMIDEELD  774

Query  891   ITENLPCTDMSF  856
              T+N+P TD S 
Sbjct  775   TTKNIPSTDASL  786



>ref|XP_004245794.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
 ref|XP_010325505.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
 ref|XP_010325506.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
Length=788

 Score =  1252 bits (3239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/785 (76%), Positives = 668/785 (85%), Gaps = 3/785 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+ILSLPVQ+PPTLEFSS+++VWSKVEGWRDNIDRVALIP+ARVDDFVRGESANKE
Sbjct  1     MARWDQILSLPVQSPPTLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR A+++YKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKK 
Sbjct  61    CPTRFHVEARRRRPAESTYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             +GRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKK+AGTRAMYAP
Sbjct  121   SGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKSAGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SI++WVESHQN +FFY++FSDSDPFVLGIQTEWQLQQ+IRFGN GLLASD+
Sbjct  241   YELDTDDAVSINMWVESHQNQVFFYENFSDSDPFVLGIQTEWQLQQLIRFGNHGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYPI SLVVFNSDNKAIPVAWII PRFAS DT+RWMRALYNRVH KDPTWKLA
Sbjct  301   KFGTNKLKYPIRSLVVFNSDNKAIPVAWIITPRFASGDTLRWMRALYNRVHMKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI AIREVFQCSVLI FWRVRHAWHKNL+K+CSE+E    IAKRLG+ +  
Sbjct  361   GFIVDDPSADILAIREVFQCSVLICFWRVRHAWHKNLIKKCSELETCAVIAKRLGQAVQR  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG   A+ FE FME+FVDA +F+DYFKA WYPRLGLW++ALR+LPLASQE C+++E+Y
Sbjct  421   ICKGDGTADLFEEFMEEFVDAADFLDYFKAIWYPRLGLWTSALRSLPLASQEMCSSMEYY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE++  VY+RADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEW+SGLTA
Sbjct  481   HNQLKLRLLNEKEKCVYQRADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWMSGLTA  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W+KSLQIPD DV I+G+ +KVVDQ D++ VHV+WNP+SE+ALCDCN A MGNLCEH+ KS
Sbjct  541   WQKSLQIPDSDVLIEGDYSKVVDQEDRHKVHVVWNPASEYALCDCNWAKMGNLCEHILKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IK LRD+GS T SVSMFQY QAL+ MLHCPP+DSLIRDHALS+AVWVQ QLN+Q+G  S 
Sbjct  601   IKCLRDKGSNTPSVSMFQYMQALVDMLHCPPHDSLIRDHALSLAVWVQTQLNAQLGPGSG  660

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHH-SGFTKNQLCHSVDHIVARNGI  1060
             Q             D V  S    T     +   +L H S  T N     +D +  +NG 
Sbjct  661   QSKRQALQLTTAKPDVVTASNRTHTLVNVENDLTELQHPSSATCNLSGGKIDRVATQNG-  719

Query  1059  CTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGPDITEN  880
              T +    AVE P +E+  SP S+     QLFS+D +TS ++  ENG V+ID   D T N
Sbjct  720   -TRTDIGSAVEHPSVEMQTSPVSISACASQLFSLDGITSANVFDENGDVMIDEELDTTNN  778

Query  879   LPCTD  865
             +P  D
Sbjct  779   IPSAD  783



>emb|CBI29086.3| unnamed protein product [Vitis vinifera]
Length=962

 Score =  1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/914 (65%), Positives = 698/914 (76%), Gaps = 29/914 (3%)
 Frame = -3

Query  3219  QMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANK  3040
             QMARWDEILSLPVQNPPTLEFSS++IVWSKVEGWRDNIDRVALIP+ARVDDFVRGESANK
Sbjct  54    QMARWDEILSLPVQNPPTLEFSSAEIVWSKVEGWRDNIDRVALIPFARVDDFVRGESANK  113

Query  3039  ECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKK  2860
             +CPT+FHVEARRRR  +  YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR+TYVPKKK
Sbjct  114   DCPTRFHVEARRRRPPEMPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYVPKKK  173

Query  2859  SAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYA  2680
             SAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM+A
Sbjct  174   SAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFA  233

Query  2679  PYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRS  2500
             PYISEDLRLRVLSLL+VGVSVETIMQRH+ESV+RQGGPCNRDDLLTHRYVRRQERSIRRS
Sbjct  234   PYISEDLRLRVLSLLHVGVSVETIMQRHSESVKRQGGPCNRDDLLTHRYVRRQERSIRRS  293

Query  2499  TYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASD  2320
             TYELD DDAISI +WVESHQ+H+FFY+DFSDS+PF LGIQTEWQLQQMIRFGNR L+ASD
Sbjct  294   TYELDTDDAISIRMWVESHQSHVFFYQDFSDSEPFTLGIQTEWQLQQMIRFGNRSLVASD  353

Query  2319  ARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKL  2140
             +RFG+NKLKYPIHSL+VFNSD KAIPVAWII+P F+S D  +WMRALYNRVHTKDPTWKL
Sbjct  354   SRFGSNKLKYPIHSLIVFNSDKKAIPVAWIISPIFSSGDAHKWMRALYNRVHTKDPTWKL  413

Query  2139  AGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIH  1960
             AGFIVDDPL D+  IREVFQCSVLI FWRVRHAWHKNL+K+CS +E+R  I+++LG+ + 
Sbjct  414   AGFIVDDPLADVLTIREVFQCSVLICFWRVRHAWHKNLVKKCSGIEMRAEISRQLGQAVS  473

Query  1959  SICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEF  1780
              +C+G      FE  MED VD+ +F+DYFKA WYPR+G+W +AL+ LPLASQETCAA+EF
Sbjct  474   KVCRGHATVGVFEDIMEDLVDSSDFMDYFKAIWYPRMGVWISALQTLPLASQETCAAMEF  533

Query  1779  YHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLT  1600
             YHNQLKLRLLNE++ SVY+RADWL+DKLGT VHSYFWLDEYSGKDDF+RYW+DEW+SGLT
Sbjct  534   YHNQLKLRLLNEKEPSVYQRADWLIDKLGTKVHSYFWLDEYSGKDDFSRYWRDEWVSGLT  593

Query  1599  AWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFK  1420
             +WRK+L+IPD DV ++   AKV+DQ D++  H++WNP SE+A+CDC  A MGNLCEHVFK
Sbjct  594   SWRKALKIPDSDVVLERRFAKVIDQQDQDRAHIVWNPGSEYAICDCGWAEMGNLCEHVFK  653

Query  1419  SIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQES  1240
              I   R+ GS+ SS+S+FQY+QALI ML+CPP DSLIRDHA+S+AV VQ QLN+ +  ES
Sbjct  654   VISVCRNNGSSMSSISLFQYKQALINMLNCPPNDSLIRDHAVSLAVHVQIQLNTLVDPES  713

Query  1239  VQVVGPT-------TTYGGQCGDTVngs----kgnstsscngsgsNKLHHSGFTKNQLCH  1093
              Q +               Q  D V  S    +  S+S  +G         G        
Sbjct  714   SQTIVDVNKQQHNGVASADQQRDIVQESNCPKENVSSSRESGDSVGHEGPGGIGGVLGGD  773

Query  1092  SVDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENG-R  916
              +D + +  G C  ++ +   EIPC ++   P S+C     LFS+D + S+D+ +ENG R
Sbjct  774   LIDKVASGEGYCGETAGD---EIPCSDMDVDPSSICNPPSGLFSLDGLVSSDIFSENGER  830

Query  915   VLIDTGPDITENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNS  736
              L+D   D+ EN P    +F+  N F++  +       MD E    HI     ES  + +
Sbjct  831   CLVDAELDMPENHPSEGDAFTIRNGFEDDDSDTPLLNMMDMEP---HIHSQMVESPEECN  887

Query  735   GSQQNGVCGNRKDTWVGPCIVSVGGKTDKDSSET-------SEPVDSCLVNVGESSNFIE  577
                QNG C        GP IVS     +   SET         PV+   V++ E+S   E
Sbjct  888   MIHQNGDCSEN----AGPLIVSNTVDGNPQFSETFPPSISKPSPVEVHPVDMVETSGVTE  943

Query  576   EGVREGPENQSAGK  535
             +  R   E + + K
Sbjct  944   DKERTDLEIERSLK  957



>ref|XP_002271166.1| PREDICTED: uncharacterized protein LOC100264354 [Vitis vinifera]
 ref|XP_010658922.1| PREDICTED: uncharacterized protein LOC100264354 [Vitis vinifera]
Length=965

 Score =  1196 bits (3095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/915 (65%), Positives = 698/915 (76%), Gaps = 30/915 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFSS++IVWSKVEGWRDNIDRVALIP+ARVDDFVRGESANK+
Sbjct  1     MARWDEILSLPVQNPPTLEFSSAEIVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  +  YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR+TYVPKKKS
Sbjct  61    CPTRFHVEARRRRPPEMPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYVPKKKS  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLL+VGVSVETIMQRH+ESV+RQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLHVGVSVETIMQRHSESVKRQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDAISI +WVESHQ+H+FFY+DFSDS+PF LGIQTEWQLQQMIRFGNR L+ASD+
Sbjct  241   YELDTDDAISIRMWVESHQSHVFFYQDFSDSEPFTLGIQTEWQLQQMIRFGNRSLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFG+NKLKYPIHSL+VFNSD KAIPVAWII+P F+S D  +WMRALYNRVHTKDPTWKLA
Sbjct  301   RFGSNKLKYPIHSLIVFNSDKKAIPVAWIISPIFSSGDAHKWMRALYNRVHTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL D+  IREVFQCSVLI FWRVRHAWHKNL+K+CS +E+R  I+++LG+ +  
Sbjct  361   GFIVDDPLADVLTIREVFQCSVLICFWRVRHAWHKNLVKKCSGIEMRAEISRQLGQAVSK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             +C+G      FE  MED VD+ +F+DYFKA WYPR+G+W +AL+ LPLASQETCAA+EFY
Sbjct  421   VCRGHATVGVFEDIMEDLVDSSDFMDYFKAIWYPRMGVWISALQTLPLASQETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE++ SVY+RADWL+DKLGT VHSYFWLDEYSGKDDF+RYW+DEW+SGLT+
Sbjct  481   HNQLKLRLLNEKEPSVYQRADWLIDKLGTKVHSYFWLDEYSGKDDFSRYWRDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV ++   AKV+DQ D++  H++WNP SE+A+CDC  A MGNLCEHVFK 
Sbjct  541   WRKALKIPDSDVVLERRFAKVIDQQDQDRAHIVWNPGSEYAICDCGWAEMGNLCEHVFKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I   R+ GS+ SS+S+FQY+QALI ML+CPP DSLIRDHA+S+AV VQ QLN+ +  ES 
Sbjct  601   ISVCRNNGSSMSSISLFQYKQALINMLNCPPNDSLIRDHAVSLAVHVQIQLNTLVDPESS  660

Query  1236  QVVGPT-------TTYGGQCGDTVngs----kgnstsscngsgsNKLHHSGFTKNQLCHS  1090
             Q +               Q  D V  S    +  S+S  +G         G         
Sbjct  661   QTIVDVNKQQHNGVASADQQRDIVQESNCPKENVSSSRESGDSVGHEGPGGIGGVLGGDL  720

Query  1089  VDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENG-RV  913
             +D + +  G C  ++ +   EIPC ++   P S+C     LFS+D + S+D+ +ENG R 
Sbjct  721   IDKVASGEGYCGETAGD---EIPCSDMDVDPSSICNPPSGLFSLDGLVSSDIFSENGERC  777

Query  912   LIDTGPDITENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSG  733
             L+D   D+ EN P    +F+  N F++  +       MD E    HI     ES  + + 
Sbjct  778   LVDAELDMPENHPSEGDAFTIRNGFEDDDSDTPLLNMMDMEP---HIHSQMVESPEECNM  834

Query  732   SQQNGVCGNRKDTWVGPCIVSVGGKTDKDSSET-------SEPVDSCLVNVGESSNFIEE  574
               QNG C        GP IVS     +   SET         PV+   V++ E+S   E+
Sbjct  835   IHQNGDCSEN----AGPLIVSNTVDGNPQFSETFPPSISKPSPVEVHPVDMVETSGVTED  890

Query  573   GVREGPE-NQSAGKN  532
               R   E  +S  KN
Sbjct  891   KERTDLEIERSLSKN  905



>ref|XP_006375222.1| hypothetical protein POPTR_0014s05410g [Populus trichocarpa]
 gb|ERP53019.1| hypothetical protein POPTR_0014s05410g [Populus trichocarpa]
Length=1067

 Score =  1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/828 (69%), Positives = 657/828 (79%), Gaps = 18/828 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFS+SDIVWSKVEGWRDN+DR+ALIP+ARVDDFVRGESANK+
Sbjct  1     MARWDEILSLPVQNPPTLEFSASDIVWSKVEGWRDNLDRLALIPFARVDDFVRGESANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  QTSYK KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGP+DKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPRDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD+DDA+SI++WVESHQN +FF++DFSDS+PF LGIQTEWQLQQMIRFGNRGL+ASD+
Sbjct  241   YELDSDDAVSINMWVESHQNQVFFFEDFSDSEPFTLGIQTEWQLQQMIRFGNRGLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLVVFNSDNKAIPVAWII PRFAS D  RWMRALYNRV  KDP+WKLA
Sbjct  301   RFGTNKLKYPVHSLVVFNSDNKAIPVAWIITPRFASADAHRWMRALYNRVCMKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPLTDI  IREVFQCSVLISFWRVRHAWHKNL+KRC E E+RV I++RLG+ +  
Sbjct  361   GFIVDDPLTDILTIREVFQCSVLISFWRVRHAWHKNLIKRCMETEMRVQISRRLGQTVDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G    + FE  MEDFVD   F+DYFKATWYPR+G W+ AL+ LPLASQETCAA+EFY
Sbjct  421   ICRGQGTVHLFEVLMEDFVDGSSFMDYFKATWYPRIGSWTTALKNLPLASQETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK+RLLNE++  VY+RADWLVDKLGT VHSYFWLDEYS +DDFARYWKDEWISGLT+
Sbjct  481   HRQLKVRLLNEKNPGVYQRADWLVDKLGTKVHSYFWLDEYSERDDFARYWKDEWISGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV ++   AKV DQ D++ VHV+WNP SEFA+CDC  A MGNLCEHVFK 
Sbjct  541   WRKALKIPDSDVVVEYRCAKVTDQLDRDRVHVVWNPGSEFAICDCKWAEMGNLCEHVFKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IK  RD+GS  SS+S+FQY QALI ML CPPYD LIRDHA S+AV VQKQL+  +  +  
Sbjct  601   IKLYRDKGSRKSSISLFQYNQALINMLRCPPYDCLIRDHAASLAVAVQKQLDGIVNLDGS  660

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHH-----SGFTKNQLCHSVDHIVA  1072
             Q    TT              G  +S+ +    N  HH       +T+N       H ++
Sbjct  661   QTNADTTEKKSANSLEQQVVCGTDSSNQDKEVVNANHHIDKDLPSYTENDCQERDAHEIS  720

Query  1071  RNGICTNSSHNIAVEIPCLEIGASPYSMCRSEP--------QLFSIDEVTSTDMLAENGR  916
             R G+  +    +  E  C  +   P S C S P         L S+D+VT   +  ++ +
Sbjct  721   R-GVTGDFVDGVREESACARMDVDPSSNCISPPGIIILTDSSLRSVDDVTRNQVDLDSNQ  779

Query  915   VLIDTGPDITENLPCTDMSFSNL-NDFDNVLNKNDSTAKMDAESQSLH  775
               +D       +     MS +NL N    ++N+ND   +MD +  SL+
Sbjct  780   SAVDATQKQALDSLEQQMSGTNLSNQARELVNEND---RMDKDVSSLY  824



>ref|XP_011032909.1| PREDICTED: uncharacterized protein LOC105131568 [Populus euphratica]
 ref|XP_011012198.1| PREDICTED: uncharacterized protein LOC105116502 [Populus euphratica]
Length=1080

 Score =  1189 bits (3075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/819 (70%), Positives = 652/819 (80%), Gaps = 11/819 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFS+SDIVWSKVEGWRDN+DR+ALIP+ARVDDFVRGESANK+
Sbjct  1     MARWDEILSLPVQNPPTLEFSASDIVWSKVEGWRDNLDRLALIPFARVDDFVRGESANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  QTSYK KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGP+DKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPRDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRS 
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSA  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD+DDA+SI++WVESHQN +FF++DFSDS+PF LGIQTEWQLQQMIRFGN GL+ASD+
Sbjct  241   YELDSDDAVSINMWVESHQNQVFFFEDFSDSEPFTLGIQTEWQLQQMIRFGNHGLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLVVFNSDNKAIPVAWII PRFAS D  RWMRALYNRV  KDP+WKLA
Sbjct  301   RFGTNKLKYPVHSLVVFNSDNKAIPVAWIITPRFASADAHRWMRALYNRVCMKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPLTDI  IREVFQCSVL+SFWRVRHAWHKNL+KRC E E+RV I++RLG+ +  
Sbjct  361   GFIVDDPLTDILTIREVFQCSVLLSFWRVRHAWHKNLIKRCLETEMRVQISRRLGQTVDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG      FE  MEDFVD   F+DYFKATWYPR+G W+ AL+ LPLASQETCAA+EFY
Sbjct  421   ICKGQGTVRLFEDLMEDFVDGSSFMDYFKATWYPRIGSWTTALKNLPLASQETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK+RLLNE++  VY+RADWLVDKLGT VHSYFWLDEYS +DDFARYWKDEW+SGLT+
Sbjct  481   HRQLKVRLLNEKNPGVYQRADWLVDKLGTKVHSYFWLDEYSERDDFARYWKDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV ++   AKV DQ D++ VHV+WNP SEFA+CDC  A MGNLCEHVFK 
Sbjct  541   WRKALKIPDSDVVVEYRCAKVTDQLDRDRVHVVWNPGSEFAICDCKWAEMGNLCEHVFKI  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IK  RD+GS  SS+S+FQY QALI ML CPPYD LIRDHA S+AV VQKQL+  +  +  
Sbjct  601   IKLYRDKGSRKSSISLFQYNQALINMLRCPPYDCLIRDHAASLAVAVQKQLDGIVNLDGS  660

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHH-----SGFTKNQLCHSVDHIVA  1072
             Q    TT              G  +S+ +    N  HH       +T+N       H ++
Sbjct  661   QTNADTTEKKSANSLEQQVVCGTDSSNQDKEVVNATHHIDKDLPSYTENDCQERNAHEIS  720

Query  1071  RNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGPD  892
             R    T     +  E  C ++   P S C S P + S+D+VT   +  ++ +  +D    
Sbjct  721   RG--VTGDFVGVGEESACAQMDVDPSSNCISPPGIHSVDDVTRNQVDLDSNQSAVDATQK  778

Query  891   ITENLPCTDMSFSNL-NDFDNVLNKNDSTAKMDAESQSL  778
                +     MS +NL N    ++N++D   +MD +  SL
Sbjct  779   QALDSLEQQMSGTNLSNQARELVNESD---RMDKDVSSL  814



>ref|XP_006375216.1| hypothetical protein POPTR_0014s05360g [Populus trichocarpa]
 gb|ERP53013.1| hypothetical protein POPTR_0014s05360g [Populus trichocarpa]
Length=1059

 Score =  1182 bits (3057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/815 (70%), Positives = 650/815 (80%), Gaps = 22/815 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFS+SDIVWSKVEGWRDN+DR+ALIP+ARVDDFVRGESANK+
Sbjct  1     MARWDEILSLPVQNPPTLEFSASDIVWSKVEGWRDNLDRLALIPFARVDDFVRGESANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  QTSYK KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGP+DKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPRDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD+DDA+SI++WVESHQN +FF++DFSDS+PF LGIQTEWQLQQMIRFGNRGL+ASD+
Sbjct  241   YELDSDDAVSINMWVESHQNQVFFFEDFSDSEPFTLGIQTEWQLQQMIRFGNRGLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLVVFNSDNKAIPVAWII PRFAS D  RWMRALYNRV  KDP+WKLA
Sbjct  301   RFGTNKLKYPVHSLVVFNSDNKAIPVAWIITPRFASADAHRWMRALYNRVCMKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPLTDI  IREVFQCSVLISFWRVRHAWHKNL+KRC E E+RV I++RLG+ +  
Sbjct  361   GFIVDDPLTDILTIREVFQCSVLISFWRVRHAWHKNLIKRCMETEMRVQISRRLGQTVDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG      FE  MEDFVD   F+ YFKATWYPR+G W+ AL+ LPLASQETCAA+EFY
Sbjct  421   ICKGQGTVRLFEVLMEDFVDGSSFMYYFKATWYPRIGSWTTALKNLPLASQETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK+RLLNE++  VY+RADWLVDKLGT VHSYFWLDEYS +DDFARYWKDEW+SGLT+
Sbjct  481   HRQLKVRLLNEKNPGVYQRADWLVDKLGTKVHSYFWLDEYSERDDFARYWKDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV ++   AKV DQ D++ VHV+WNP SEFA+CDC  A MGNLCEHVFK 
Sbjct  541   WRKALKIPDSDVVVEYRCAKVTDQLDRDRVHVVWNPGSEFAICDCKWAEMGNLCEHVFKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IK  RD+GS  SS+S+FQY QALI ML CPPYD LIRDHA S+AV VQKQL+  +  +  
Sbjct  601   IKLYRDKGSRKSSISLFQYNQALINMLRCPPYDCLIRDHAASLAVAVQKQLDGIVNLDGS  660

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHSVDHIVARNGIC  1057
             Q    TT                       S   ++     + NQ      H ++R G+ 
Sbjct  661   QTNADTT-----------------EKKSANSLEQQVVCGTDSSNQDKERDAHEISR-GVT  702

Query  1056  TNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGPDITENL  877
              +    +  E  C ++   P S C S P + S+D+VT   +  ++ +  +D       + 
Sbjct  703   GDFVGGVREESACAQMDVDPSSNCISPPGILSVDDVTRNQVDLDSNQSAVDATQKQALDS  762

Query  876   PCTDMSFSNL-NDFDNVLNKNDSTAKMDAESQSLH  775
                 +S +NL N    ++N++D   +MD +  SL+
Sbjct  763   LEQQISGTNLSNQARELVNESD---RMDKDVSSLN  794



>ref|XP_007052246.1| Zinc ion binding protein isoform 1 [Theobroma cacao]
 gb|EOX96403.1| Zinc ion binding protein isoform 1 [Theobroma cacao]
Length=1030

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/851 (67%), Positives = 669/851 (79%), Gaps = 29/851 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+ILSLPVQNPPTLEFS++D+VWSKVEGWRDNIDRVALIP+ARVDDFVRGESANK+
Sbjct  1     MARWDQILSLPVQNPPTLEFSAADLVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  +  YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR TY+PKK +
Sbjct  61    CPTRFHVEARRRRPPKAPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRNTYIPKKTN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEP+VALIIYNQ+KHVDKKGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPTVALIIYNQEKHVDKKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPYNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+S+++WVESHQNH+FFY+DF+DSDPF LGIQTEWQLQQMIRFGN  L+ASD+
Sbjct  241   YELDADDAVSVNMWVESHQNHVFFYEDFTDSDPFTLGIQTEWQLQQMIRFGNCSLIASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSL+VFNSD KAIPVAWII PRFAS D  RWMRALYNRV TKDPTWKLA
Sbjct  301   RFGTNKLKYPVHSLIVFNSDKKAIPVAWIITPRFASVDAHRWMRALYNRVRTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IR+VF+CSVLISFWRVRHAWHKNL+KRCSE E+RV I++RLG     
Sbjct  361   GFIVDDPSVDVLTIRDVFECSVLISFWRVRHAWHKNLLKRCSETEMRVEISRRLGMAFDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I + C   + FE FMEDFVD ++F+DYFKA WYPR+G W +AL  LPLAS ETCAA+EFY
Sbjct  421   ISRRCGNVDLFEKFMEDFVDCLDFMDYFKAIWYPRIGAWISALGTLPLASLETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+D SVY+R DWLV+KLGT VHSYFWLDEYSGKDDFARYWKDEW+SGLT+
Sbjct  481   HNQLKLRLLNEKDPSVYQRTDWLVNKLGTKVHSYFWLDEYSGKDDFARYWKDEWMSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV I+G+ AKV DQ D++ V+V+WNP S++ +CDC  A MG LCEHVFK 
Sbjct  541   WRKALKIPDSDVAIEGQCAKVTDQLDRDRVYVVWNPGSQYGICDCTWAEMGYLCEHVFKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI-----  1252
             IK   ++GS   SVS+FQY +ALI MLHCPP+DSLIRDHA+S+A++VQKQLNS +     
Sbjct  601   IKVFHEKGSILPSVSLFQYNKALIDMLHCPPHDSLIRDHAVSLAIYVQKQLNSLVDPIQK  660

Query  1251  -GQESVQVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGF----------TKN  1105
               ++S Q    T     Q    V+     +    +       H +G+            +
Sbjct  661   QAKDSSQDASATVVSAKQNRGLVDEGPCVNGIISSN------HENGYADCSEAPVSIASD  714

Query  1104  QLCHSVDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAE  925
                 SVD +V  NGIC  ++      I   E+   P S C S P+L S++EV + ++ +E
Sbjct  715   LGSESVDGLVGINGICGKAA---GEGISGSEMDVDPPS-CISPPELPSLNEVVAGNVFSE  770

Query  924   NGRV-LIDTGPDITENLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAES  751
             +G   LI+  P++   +P  D +  + +   +++ NKN   + M AE Q   I   T + 
Sbjct  771   HGDSDLINNVPNMKSKVPPKDNALRDESGCEEDIFNKNCHESVMAAELQPDEIP-QTRQL  829

Query  750   LNQNSGSQQNG  718
             L   + + Q+G
Sbjct  830   LKPCTATHQDG  840



>ref|XP_011088310.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105169583 
[Sesamum indicum]
Length=914

 Score =  1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/868 (66%), Positives = 664/868 (76%), Gaps = 33/868 (4%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFSS+D+VWSKVEGWRDNIDR+ALIP+ARVDDFVRGES NKE
Sbjct  1     MARWDEILSLPVQNPPTLEFSSTDLVWSKVEGWRDNIDRLALIPFARVDDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRRT +T YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPK KS
Sbjct  61    CPTRFHVEARRRRTPKTPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKNKS  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQ             
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQ-------------  167

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
                   RLRVLSLL+VGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVRRQERSIRRS+
Sbjct  168   ------RLRVLSLLHVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRRQERSIRRSS  221

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SIS+WVESHQN+IFFY+DFSDSDP +LGIQTEWQLQQMIRFGN  LLA ++
Sbjct  222   YELDEDDAVSISMWVESHQNNIFFYEDFSDSDPLILGIQTEWQLQQMIRFGNCRLLAYNS  281

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG+NKLKYPIHSLVVFNSDNKAIPVAWII PRFAS DT RWMRALYNRV  KDPTWKLA
Sbjct  282   NFGSNKLKYPIHSLVVFNSDNKAIPVAWIITPRFASRDTHRWMRALYNRVRAKDPTWKLA  341

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL+DI AIREVFQCSVLI FW VRHAWHKNLMKRCSEME+R  IAK+LGE ++ 
Sbjct  342   GFIVDDPLSDILAIREVFQCSVLICFWHVRHAWHKNLMKRCSEMEMRAEIAKQLGEAVNK  401

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG   AN FE FM++FVDA EF+DYFKA WYPR+G+W+ AL+ LPLASQETCAA+EFY
Sbjct  402   ICKGPGTANAFEDFMQNFVDAAEFMDYFKAIWYPRIGMWARALKTLPLASQETCAAMEFY  461

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+D SVY+RADWLV+KLG  VHSYFWLDEYSGK+DFARYWKDEW+SG TA
Sbjct  462   HNQLKLRLLNEKDQSVYQRADWLVNKLGAKVHSYFWLDEYSGKEDFARYWKDEWMSGPTA  521

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRKSL+IPD +V ++G+ AKV++  D++  H+IWNP SE+A+CDC+ A +GN+CEH+FK 
Sbjct  522   WRKSLRIPDANVVMEGKCAKVIELEDQDSAHLIWNPGSEYAICDCSWAKLGNMCEHIFKI  581

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQES-  1240
             IK+ RD+GS   SVSMFQY QALI MLHCPP+DSL+RDHA+S+A+WVQ QLNSQI  +S 
Sbjct  582   IKFFRDKGSICPSVSMFQYSQALINMLHCPPFDSLVRDHAVSLAIWVQMQLNSQITPKSK  641

Query  1239  -------VQVVGPTTTYGGQCGDTVngs-kgnstsscngsgsNKLHHSGFTKNQLCHSVD  1084
                     Q V P+ +   +  D ++ S     +S  +     K   +G       +S+ 
Sbjct  642   DEGNTMEQQTVEPSVSSPYRNLDDIDQSPNKALSSQVDNQSRVKRKRTGCEAGDFGNSLI  701

Query  1083  HIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLID  904
               +    +  N +  + +  P +E+ +S  S+C S PQLFS +  TS  +  EN    ID
Sbjct  702   QQLTSENVDHNGAQ-LEISTPDMEVDSS--SICTSAPQLFSRNGNTSFGLFVENDADFID  758

Query  903   TGPDITENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQ  724
                   +N   TD      + F N   + D    +    +S+  +LS   SL+  + + Q
Sbjct  759   GDLGTRKNFTSTDAELKATDGFKN--QEKDHYLTLVEVPESIADLLSADNSLDPLADTLQ  816

Query  723   NGVCGNRKDTWVGPCIVSVGGKTDKDSS  640
              G   +     +    V V  K D  ++
Sbjct  817   TGSTESDAGINISSTPVDVNRKIDSPTT  844



>ref|XP_010269623.1| PREDICTED: uncharacterized protein LOC104606193 [Nelumbo nucifera]
Length=1107

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/884 (64%), Positives = 672/884 (76%), Gaps = 38/884 (4%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PPTLEFSS+DIVWSKVEGWRDNIDRVALIP+ARVDDFVRGES+NKE
Sbjct  1     MARWDEILSLPVQSPPTLEFSSADIVWSKVEGWRDNIDRVALIPFARVDDFVRGESSNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  +  YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR+TY+PKKKS
Sbjct  61    CPTRFHVEARRRRPPEMPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYIPKKKS  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAVGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS+DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISDDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +SI++WVESHQ+H+FFY+DFSD+DPFVLGIQTEWQLQQMIRFGNR L+ASD+
Sbjct  241   YELDEDDMVSIAMWVESHQSHVFFYEDFSDTDPFVLGIQTEWQLQQMIRFGNRSLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSL+VF+SDNKAIPVAWI+APRFAS D  +W+RALYNRVH+KDPTWKLA
Sbjct  301   RFGTNKLKYPVHSLLVFDSDNKAIPVAWIVAPRFASGDAHKWIRALYNRVHSKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IREVFQCSVLI FWRVRHAWHKNL+K+C ++++R  I++RLGE +++
Sbjct  361   GFIVDDPAADVLTIREVFQCSVLICFWRVRHAWHKNLVKKCLDIQMRAEISRRLGEAVYA  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG    + FE FM DF+D ++F+DYF+A W+PR+GLW+ AL+ LPLASQET AA+E+Y
Sbjct  421   ICKGNGNVDLFEDFMGDFLDCLDFLDYFRAIWFPRIGLWTTALKTLPLASQETSAAMEYY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+QLKLRL NE++ SVY+R DWLVDKLGT VHSYFWLDEYSGKDDF RY K+EW+SGLT+
Sbjct  481   HHQLKLRLFNEKNPSVYQRTDWLVDKLGTKVHSYFWLDEYSGKDDFGRYRKNEWMSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++L+I D DV ++G  AKV+ Q +K M HV+ NP SEFA+CDCN + MGNLC+HV K 
Sbjct  541   WRQALEITDADVVLEGRCAKVLSQHNKGMAHVVHNPGSEFAICDCNWSQMGNLCKHVIKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
              K  RDR SA SS+S+F+Y Q LI +LHCPP+DSLIRDHA+S+A++VQ QLN+ +  E+ 
Sbjct  601   SKVCRDRSSAVSSISLFEYNQTLINILHCPPHDSLIRDHAVSLAIFVQMQLNALVQPENG  660

Query  1236  QVVGP-----TTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHSV-----  1087
             +V  P     T      C      ++    S    S +      G  +  +   +     
Sbjct  661   RVDVPPVEKQTQNKHSACKHANLINESQCASKKILSCNENPAEDGDDEENVVGDLSSDDV  720

Query  1086  -DHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRV-  913
              + +   NG C+ S+  I   I   E+   P S+C S  +L  +D VTST+    NG   
Sbjct  721   TNGVACENGFCSESAQEI---IASTEMDVDPLSICASPSELLPLDVVTSTNDHFSNGNAS  777

Query  912   LIDTGPDITENLPCTDMSFSNLNDFDNVLNKN--------DSTAKMDAESQSLHIVLSTA  757
              I  G         T     N+   D V++KN         + + MD + +      ST+
Sbjct  778   TIRNG---------TQDEVLNVAFHDKVVDKNHHGNVEGSTTGSMMDVDPKFTETPCSTS  828

Query  756   ESLNQNSGSQQNGVCGNRKDTWVGPCIVSVGGKTDKDSSETSEP  625
              + +    S  NGVC N       P +       +  S ETS+P
Sbjct  829   RAFDPCMVS--NGVCSN----LANPTVTGDTIDVNPQSIETSQP  866



>gb|KHG00863.1| CUE domain-containing 5 [Gossypium arboreum]
 gb|KHG00916.1| CUE domain-containing 5 [Gossypium arboreum]
Length=997

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/657 (79%), Positives = 592/657 (90%), Gaps = 0/657 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFS+ DIVWSKVEGWRDNIDRVALIP+ARVDDFVRGES+NK+
Sbjct  1     MARWDEILSLPVQNPPTLEFSAHDIVWSKVEGWRDNIDRVALIPFARVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+ +  YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR TY+PKK +
Sbjct  61    CPTRFHVEARRRRSPKAPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSRNTYIPKKTN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLL+VGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLHVGVSVETIMQRHNESVEKQGGPYNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+S+S+WVESHQN +FFYKDF+DSDPF+LGIQTEWQLQQMIRFGN  L+ SD+
Sbjct  241   YELDADDAVSVSMWVESHQNCVFFYKDFTDSDPFILGIQTEWQLQQMIRFGNHSLIVSDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RF TNKLKYPIHS++VFNSD KAIPVAWII PRFAS D  RWMRALYNRV TKDPTWKLA
Sbjct  301   RFATNKLKYPIHSVIVFNSDKKAIPVAWIITPRFASVDAHRWMRALYNRVRTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  +R+VF+C+VLISFWRVRHAWHKNL+KRCSE E+RV ++++LG+ +  
Sbjct  361   GFIVDDPSIDVHTVRDVFECTVLISFWRVRHAWHKNLVKRCSETEMRVEMSRQLGQTVDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+GC   + FE FMEDFVD ++F+DYFKA WYPR+G W +AL+ LPLAS ETCAA+EFY
Sbjct  421   ICRGCGNVDLFEKFMEDFVDCLDFMDYFKAVWYPRIGTWVSALKTLPLASLETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+D +VY+R DWLVDKLGT VHSYFWLDEYSGKDDFARYWKDEW+SGLT+
Sbjct  481   HNQLKLRLLNEKDPAVYQRTDWLVDKLGTKVHSYFWLDEYSGKDDFARYWKDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV  +   AKV DQ D++ V+V+WNP S+F +CDC+ A MG LCEHV K 
Sbjct  541   WRKALKIPDSDVASERRFAKVTDQLDRDTVYVVWNPGSQFGICDCSWAEMGYLCEHVLKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             IK  R++GS + SVS+FQY +ALI MLHCPP+DSLIRDHA+S+A++VQKQLNS +G 
Sbjct  601   IKVYREKGSISPSVSIFQYNKALIDMLHCPPHDSLIRDHAVSLAIFVQKQLNSLVGH  657



>emb|CDP15763.1| unnamed protein product [Coffea canephora]
Length=750

 Score =  1144 bits (2960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/655 (82%), Positives = 585/655 (89%), Gaps = 0/655 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFSSSD+VWSKVEGWRDNIDRV LIP+ARVDDFVRGESAN +
Sbjct  1     MARWDEILSLPVQNPPTLEFSSSDLVWSKVEGWRDNIDRVCLIPFARVDDFVRGESANND  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  + SYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS
Sbjct  61    CPTRFHVEARRRRPPEMSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLL+VGVSVETIMQRHNESVERQGGP NRDDLLTHRYVRRQERSIRRS 
Sbjct  181   YISEDLRLRVLSLLHVGVSVETIMQRHNESVERQGGPSNRDDLLTHRYVRRQERSIRRSL  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SIS+WV++HQN +FF++DFSDSDPFVLGIQT+WQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDAVSISIWVKTHQNCVFFFEDFSDSDPFVLGIQTDWQLQQMIRFGNHRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVFN DNKAIPVAWIIAPR A  D  RWMRALYNRV TKDP+WKLA
Sbjct  301   RFGTNKLKYPIHSLVVFNLDNKAIPVAWIIAPRLAVGDAHRWMRALYNRVRTKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDPL DI AIREVFQCSVLI FWRVRHAWHKNLMKRCS ME+R  IAK LG+ + +
Sbjct  361   GFIIDDPLFDILAIREVFQCSVLICFWRVRHAWHKNLMKRCSTMEIRAEIAKMLGQTVLN  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG   AN FE  MEDFVDA +F +YFK+ W PRLG+W   L+ LPLASQET AA+EFY
Sbjct  421   ICKGSSSANVFEDMMEDFVDATDFAEYFKSVWLPRLGVWFTVLKTLPLASQETSAAIEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RL+NE++ +VY+RADWLVDKLG+ VHSYFWLDEYS KDDFARYWKDEW+SGLT 
Sbjct  481   HIQLKARLMNEKECNVYQRADWLVDKLGSKVHSYFWLDEYSCKDDFARYWKDEWLSGLTK  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRKS++IPD D+ IDG+ AKV+D  D++ VHV+WNP SE+ALCDCN ++ GNLCEHV K+
Sbjct  541   WRKSMKIPDADIAIDGKCAKVIDLEDRDSVHVVWNPGSEYALCDCNWSSTGNLCEHVVKT  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
             IK+ RD+     SVSM QY QALI MLHCPPYDSL+RDHA+S+AV VQ QLN QI
Sbjct  601   IKFCRDKKYVVPSVSMLQYTQALINMLHCPPYDSLVRDHAVSLAVSVQMQLNGQI  655



>ref|XP_006445380.1| hypothetical protein CICLE_v10018658mg [Citrus clementina]
 ref|XP_006464455.1| PREDICTED: uncharacterized protein LOC102610616 isoform X1 [Citrus 
sinensis]
 ref|XP_006464456.1| PREDICTED: uncharacterized protein LOC102610616 isoform X2 [Citrus 
sinensis]
 gb|ESR58620.1| hypothetical protein CICLE_v10018658mg [Citrus clementina]
 gb|KDO85575.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
 gb|KDO85576.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
 gb|KDO85577.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
Length=1021

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/921 (61%), Positives = 673/921 (73%), Gaps = 23/921 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEF+S D+VWSKVEGWRD +DRVALIP+ARVDDFVRGES+NK+
Sbjct  1     MARWDEILSLPVQNPPTLEFASVDLVWSKVEGWRDKLDRVALIPFARVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+  TS KPKVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRSTSTSCKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN +KHVDK GLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNDEKHVDKNGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLL+VGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLHVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SI++WVESHQ+++FFY+DFS+ DPF LGIQTEWQLQQMIRFGNR LLASD+
Sbjct  241   YELDLDDAVSINMWVESHQSYVFFYEDFSEYDPFTLGIQTEWQLQQMIRFGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSL+VFNSD KAIPVAW+IAP F+S DT RWMRALYNRV TKDPTW LA
Sbjct  301   RFGTNKLKYPLHSLIVFNSDKKAIPVAWVIAPSFSSADTHRWMRALYNRVRTKDPTWNLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IR+VFQCSVL+SFWRVRHAWHKNL+KRCSE+ +R  I + LG  +  
Sbjct  361   GFIVDDPSADVHTIRDVFQCSVLVSFWRVRHAWHKNLVKRCSEIGMRAEIFRCLGVAVDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG      FE  MEDF+D  +F+DYFKA WYPR+G W   L+ LPLASQET AA+EFY
Sbjct  421   ICKGHGTIALFENCMEDFMDGSDFMDYFKAVWYPRIGAWITVLKTLPLASQETSAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+D  VY+R DWLVDKLGT VHSYFWLDEY+GKDDFARYWKDEW+SGLT 
Sbjct  481   HNQLKVRLLNEKDSGVYQRTDWLVDKLGTKVHSYFWLDEYTGKDDFARYWKDEWVSGLTC  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+I D DV I+G   KV DQ D N V+V+ NP S+F +C+C+ A MG LCEH+ K 
Sbjct  541   WRKALKILDSDVVIEGRCGKVTDQLDGNKVYVVRNPGSQFGICNCSWAEMGYLCEHLLKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I   R +GS   S+S+FQY +AL+ MLHC P+DSLIRDHA+S+AV +QKQLN+ +  ES 
Sbjct  601   IIVCRKKGSVKPSISLFQYNKALMDMLHCTPHDSLIRDHAISLAVSIQKQLNASVDFESS  660

Query  1236  QV-----------VGPTTTYGGQCGDTVngskgnstsscngsgsNK-------LHHSGFT  1111
             Q+                T G    D             +   S K       L  SG T
Sbjct  661   QISVASVEKQIVETNEQQTVGTFHADQDRELVNEGHCVNDDVSSQKGRNRGEELVASGGT  720

Query  1110  KNQLCHS-VDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDM  934
              N+L    ++ +V+ N +C  ++    +     ++  SP  +  S P L S+DE+ S+  
Sbjct  721   ANELAGGLINQLVSANSLCGGTTEE-EISFAKTDVEQSPIYI--STPGLVSVDELASSGG  777

Query  933   LAENGRVLIDTGPDITENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTAE  754
              ++N +  + +  +I+      D + ++ N+ +  ++  D    +D E  ++ +   T E
Sbjct  778   FSKNEQRALVSDAEISGYTHSKDAAVTDQNEAEEGISDKDCHQDLDVEPFTIDMPPPTME  837

Query  753   SLNQNSGSQQNGVCGNRKDTWVGPCIVSVGGKTDKDSSETSEPVDSCLVNVGESSNFIEE  574
              L Q + S QNG+        V          +DK S     PV+S  V V E++  + +
Sbjct  838   FLEQCTVSPQNGISSLDPQLPVLSNKADADSHSDKASRPMYMPVESKAVGVSETAGIVGD  897

Query  573   GVREGPENQSAGKNNSFISMD  511
                E   N   G   S  S D
Sbjct  898   NENE-VGNAKGGAAKSPCSTD  917



>ref|XP_007203395.1| hypothetical protein PRUPE_ppa021037mg [Prunus persica]
 gb|EMJ04594.1| hypothetical protein PRUPE_ppa021037mg [Prunus persica]
Length=1053

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/912 (62%), Positives = 681/912 (75%), Gaps = 39/912 (4%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PPTLEFSS DIVWSKVEGWRDN DRVALIP+ARVDDF+RGESANKE
Sbjct  1     MARWDEILSLPVQSPPTLEFSSGDIVWSKVEGWRDNKDRVALIPFARVDDFLRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR A+T YKPKVDG+LEYILYWCSFGPDDHRKGGVVRPSRTTY+PKKK+
Sbjct  61    CPTRFHVEARRRRQAKTPYKPKVDGVLEYILYWCSFGPDDHRKGGVVRPSRTTYLPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVAL+IYNQDKHVDKKG+PCHGPQDK AAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALVIYNQDKHVDKKGVPCHGPQDKMAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRRQER IRRS 
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRQERIIRRSR  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+SIS+WVE+HQ+++F+Y+DFSD DPF LGIQT+WQLQQMIRFGNR LLASD+
Sbjct  241   YELDADDAVSISMWVENHQSNVFYYEDFSDVDPFTLGIQTDWQLQQMIRFGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKY +HSL+VFN DNKAIPVAWI+AP+F S +  +WMRALYNRV TKDP WKLA
Sbjct  301   RFGTNKLKYSVHSLLVFNDDNKAIPVAWIVAPKFESSNAHKWMRALYNRVQTKDPAWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL D+  IR+VFQCSVLISFWRVRHAWHKNL+K+C + E+R  I++R  + + +
Sbjct  361   GFIVDDPLADVLTIRDVFQCSVLISFWRVRHAWHKNLVKKCVDNEMRAAISRRFHQAMDN  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+       FE F+EDF+D  +F+DYFKATWYPR+G+W +AL+ LPLASQETCAA+EFY
Sbjct  421   ICQQRGTEGLFEDFIEDFLDESDFMDYFKATWYPRIGMWISALQNLPLASQETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+  SVY R DWLVDKLGT VHSYFWLDEYS KDDFARYWKDEW+SGLT+
Sbjct  481   HNQLKLRLLNEKKPSVYTRVDWLVDKLGTKVHSYFWLDEYSEKDDFARYWKDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD +V ++G  AKV++Q D++  +++WNP S+F +C+C+ A MGNLCEHV K 
Sbjct  541   WRKALKIPDSNVVMEGTCAKVINQLDQDKAYLVWNPGSQFGICNCSWAEMGNLCEHVLKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I   R + SA  S+S+ QY QALI MLHCPP+DSLIRDHA+S+AV+VQ QLN  +  ES 
Sbjct  601   ISVCR-KKSAMPSISLLQYHQALIDMLHCPPHDSLIRDHAVSLAVFVQNQLNGLVNLESC  659

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGF-TKNQLCHSVDHIVARNGI  1060
                   T +  +  + VN    +   +  G G    H +   TK +L     ++VAR   
Sbjct  660   NTTMDVTPFADRDRELVNEEVVSHNENDCGDG----HVTAVRTKGKLGTEQSNLVARGNR  715

Query  1059  CTNSSHNIAVEIPCLEIGASPYSMCRSEPQLF-SIDEVTSTDMLAENGRVLIDTGPDITE  883
               N S     E+ C E+   P S+C S P L+   + V+S+       R L +     TE
Sbjct  716   TCNES--CGEEVSCDEMDVDPSSICISPPGLYSVDEVVSSSVFSGSRQRSLFNRE---TE  770

Query  882   NLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQNG----  718
             +L   D + +N   + D++LN+N     MD   + + I  ST E + Q + +  +     
Sbjct  771   DLASADDALTNPTGYEDDILNRNRQENAMD---EDIDIPSSTMEFVEQCTVTHPDDDHIH  827

Query  717   ------VCGNRKDTWVGPCIVSVGGKTDKDSSETSEPVDSCLVNVGESSNFI---EEGVR  565
                   +C    D  V           +K S   S PV+  +V V E+S  I   E+   
Sbjct  828   DIEPTVICKTSDDNTV----------YNKISPSASIPVELHVVEVAETSGVITGNEQMET  877

Query  564   EGPENQSAGKNN  529
             EG     A  NN
Sbjct  878   EGKNGMEASDNN  889



>gb|KDP28838.1| hypothetical protein JCGZ_14609 [Jatropha curcas]
Length=979

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/767 (71%), Positives = 623/767 (81%), Gaps = 18/767 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFS++D+VWSK+EGWRD IDR+ALIP+ARVDDFVRGESANKE
Sbjct  1     MARWDEILSLPVQNPPTLEFSATDLVWSKIEGWRDKIDRLALIPFARVDDFVRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR ++TSYK KVDGILEYILYWCSFGPDDHRKGG+VRPSR+ YVPKKK+
Sbjct  61    CPTRFHVEARRRRPSETSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRSVYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SISLWVE HQN++FFY+DFSDSDP  LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDMDDAVSISLWVECHQNNVFFYEDFSDSDPLTLGIQTEWQLQQMIRFGNFSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLVVFNSD KAIPVAWI+ PRFA+ D  +WMRALYNRV TKDPT+KLA
Sbjct  301   RFGTNKLKYPVHSLVVFNSDKKAIPVAWIMTPRFATADAHKWMRALYNRVCTKDPTFKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP TDI  IR+VFQC VLISFWRVR AWHKNL++RCSE+++R  I KRLGE I  
Sbjct  361   GFIVDDPSTDILTIRDVFQCPVLISFWRVRQAWHKNLLRRCSEIQMRAQIWKRLGEAIDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G    + FE FMEDFVD  +F+DYFKA WYPRLGLW++AL+  PLASQET AA+E Y
Sbjct  421   ICRGPGSVDLFEVFMEDFVDCSDFMDYFKAVWYPRLGLWTHALKNFPLASQETSAAIELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+D SVY+RADWLVDKLGT VHSYFWLDEYS KD+FARYWKDEW SGLTA
Sbjct  481   HNQLKVRLLNEKDPSVYQRADWLVDKLGTKVHSYFWLDEYSEKDEFARYWKDEWDSGLTA  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV ++G  A+V DQ D++  HV+WNP S FALCDC+ A MGNLCEHVFK 
Sbjct  541   WRKALKIPDLDVVMEGRCARVADQLDRDRFHVVWNPRSNFALCDCSWAEMGNLCEHVFKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I+   ++G    S+S+ QY QALI MLHCPP+DSLIRDHA+S+AV VQKQL++    +S 
Sbjct  601   IRMSSNKGYRKPSISLSQYNQALIDMLHCPPHDSLIRDHAVSLAVTVQKQLDAMAVLDSS  660

Query  1236  QVVGPTTTY--GGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHSVDHIVARNG  1063
                  +T Y    Q  + +    G++            H++    ++      H V+  G
Sbjct  661   N----STAYPIQKQAVEILEQQTGDADGRHLMDKDVSFHNTDDCGDR------HEVSGGG  710

Query  1062  ICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAEN  922
             +  +S+  I  +  C E+     S C        +DEV   D+  EN
Sbjct  711   VAGDSAEPIGEKTTCAEMDVDQSSNC------IPVDEVVINDVFMEN  751



>ref|XP_010053257.1| PREDICTED: uncharacterized protein LOC104441745 [Eucalyptus grandis]
 ref|XP_010053258.1| PREDICTED: uncharacterized protein LOC104441745 [Eucalyptus grandis]
 gb|KCW77515.1| hypothetical protein EUGRSUZ_D01843 [Eucalyptus grandis]
 gb|KCW77516.1| hypothetical protein EUGRSUZ_D01843 [Eucalyptus grandis]
Length=797

 Score =  1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/776 (69%), Positives = 637/776 (82%), Gaps = 14/776 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPP+LEFS++D+VWSKVEGWRDNIDRVALIPYARVDDFVRGES+NK+
Sbjct  1     MARWDEILSLPVQNPPSLEFSAADLVWSKVEGWRDNIDRVALIPYARVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP++FHVEARR+R  + +YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSRT YVPKK +
Sbjct  61    CPSRFHVEARRKRPLEMAYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTNYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGP NRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPTNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDAISI +WVESHQ+H+FFY++FSDS+PF LGIQTEWQLQQMIRFGNR L+ASD+
Sbjct  241   YELDADDAISIDMWVESHQSHVFFYEEFSDSEPFTLGIQTEWQLQQMIRFGNRSLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSL+VF+SDNKAIPVAW+IAP F S +T RWMRALYNRV  KDP+WKLA
Sbjct  301   RFGTNKLKYPIHSLLVFDSDNKAIPVAWVIAPAFGSTETHRWMRALYNRVCAKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL D+ AIR+VFQCSVL+ FWR+RHAWHKNL+KRC E E+RV +A++LG+ + +
Sbjct  361   GFIVDDPLADVLAIRDVFQCSVLLCFWRLRHAWHKNLVKRCQETEMRVEMARQLGQAVDN  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G    N F++FM+DFV+A  F+DYFKA WYPR+G W+ AL+ LPLASQETCAALEFY
Sbjct  421   ICRGDGNVNLFQSFMDDFVEAHHFMDYFKAAWYPRIGSWTAALKNLPLASQETCAALEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQL+LRLLNE + S Y+RADWLVDKLGTTVH++FWLDEYS K+DF+RY KDEW SGLT+
Sbjct  481   HNQLRLRLLNEDNTSAYQRADWLVDKLGTTVHAFFWLDEYSEKEDFSRYRKDEWASGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR +L+IPD DVT++GE AKV  Q  ++ VH++WNP S F+LCDC  A+MG LCEHVFK 
Sbjct  541   WRNALKIPDSDVTLEGECAKVTSQTLRDKVHIVWNPGSVFSLCDCKWADMGYLCEHVFKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IK  R+RGSA  S+S+FQY++AL++ML CPP+DS+IRDHA+S+AV+VQKQL++ I + S 
Sbjct  601   IKVCRERGSALPSISLFQYKRALLEMLRCPPHDSVIRDHAISLAVFVQKQLSTLIDEGSS  660

Query  1236  QVVGPTTTY----GGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHSV-----D  1084
              +   + +       Q GD +      + +S + S  +       T  ++  ++     D
Sbjct  661   NITDKSQSIRVISENQGGDLIEERNCLNENSLSSSDGHNCMDMSETPGRITENLGGNLTD  720

Query  1083  HIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGR  916
               V  NG C  +         C ++     S   S  +L  ++E  S   L ENG+
Sbjct  721   MAVKPNGFCNETDTE-----NCGKMDVDRPSTRSSTRRLLHVEEGASNGFLLENGK  771



>ref|XP_009349923.1| PREDICTED: uncharacterized protein LOC103941455 [Pyrus x bretschneideri]
Length=974

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/911 (62%), Positives = 676/911 (74%), Gaps = 22/911 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PP LEFSSSD+VWSKVEGWRD  DRVALIP+ RVDDF+RGES++KE
Sbjct  1     MARWDEILSLPVQSPPALEFSSSDLVWSKVEGWRDKKDRVALIPFPRVDDFLRGESSSKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPTKFHVEARRRR  +T YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR   VPKKK+
Sbjct  61    CPTKFHVEARRRRQPKTPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSRIN-VPKKKN  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVD+KG PCHGPQDK AAGTRAM+AP
Sbjct  120   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDRKGAPCHGPQDKMAAGTRAMFAP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRV SLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRRQER IRRS 
Sbjct  180   YISEDLRLRVQSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRQERVIRRSI  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADD +SISLWVE+HQ+H+FFY+DFSD DPF LGIQTEWQLQQMIRFGNR L+ASD+
Sbjct  240   YELDADDVVSISLWVENHQSHVFFYEDFSDVDPFTLGIQTEWQLQQMIRFGNRSLIASDS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGT KLKYP+HSL+VFN DNKAIPVAWI+AP+F S +  +WMRAL NRV TKDP WKLA
Sbjct  300   RFGTTKLKYPVHSLLVFNEDNKAIPVAWIVAPKFESSNAHKWMRALCNRVQTKDPAWKLA  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL D+  IR+VFQCSVLISFWRVRHAWHKNL+K C + E+R TI++RL + + +
Sbjct  360   GFIVDDPLADVLTIRDVFQCSVLISFWRVRHAWHKNLVKNCVDNEMRATISRRLHQAMDN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+       FE F+EDF+D  +F+DYFKATWYPR G+W +AL+ LPLASQET AA+EFY
Sbjct  420   ICQQRGTERLFEDFIEDFLDESDFMDYFKATWYPRTGMWISALQNLPLASQETSAAMEFY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+  SVY+R DWLVDKLGT VHSYFWLDEYS KDDFARYWKDEW SGLT+
Sbjct  480   HNQLKLRLLNEKKPSVYKRVDWLVDKLGTKVHSYFWLDEYSEKDDFARYWKDEWASGLTS  539

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD ++ I+G  AKV+D+ D++ V+V+WNP S+F +C+C  A MGNLCEH+ K 
Sbjct  540   WRKALKIPDRNIVIEGTRAKVIDELDQDRVYVVWNPGSQFGICNCRWAEMGNLCEHILKV  599

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I   R R S+T S+S+ QY +ALI MLHCPP+DSLIRDHA+S+AV+VQKQL+  +  ES 
Sbjct  600   INVCRKR-SSTPSISLLQYHKALIDMLHCPPHDSLIRDHAVSLAVFVQKQLSGLVNLESN  658

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGF--TKNQLCHSVDHIVARNG  1063
                     +  Q  + VN    N         +          TK ++     ++VAR  
Sbjct  659   NTAMDVAFFANQDQELVNEDPINEEVLSLNENNCGDGDVAAERTKGKVATESSNLVARGD  718

Query  1062  ICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAE-NGRVLIDTGPDIT  886
                N S+    EI   E+   P S+C S P L S+DEV S+ +  E   R L +      
Sbjct  719   DICNESY--GEEITGDEMDVDPSSICISPPGLHSVDEVVSSSVFPERRHRSLFNRE---L  773

Query  885   ENLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQNGVCG  709
             E+LP  D + +N   F D++LN+N     MD   + ++I  ST E + Q + +  +    
Sbjct  774   EDLPSADDARTNPTGFEDDILNRNSQENTMD---EDMNIPSSTMEFVEQCTVTHPD----  826

Query  708   NRKDTWVGPCIVSVGGKTD----KDSSETSEPVDSCLVNVGESSNFIEEGVREGPENQSA  541
             +     + P ++    + +    K +   S PV+S +V V E    I E  R   EN++ 
Sbjct  827   DHHSHDIEPAVICKTSEDNTVYTKTAPSASMPVESQVVEVAEVPGVISESDRMETENKNG  886

Query  540   GKNNSFISMDD  508
               +N   S DD
Sbjct  887   STSNHPSSADD  897



>gb|EYU37722.1| hypothetical protein MIMGU_mgv1a023319mg, partial [Erythranthe 
guttata]
Length=672

 Score =  1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/661 (78%), Positives = 580/661 (88%), Gaps = 3/661 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PPTLEF+SSD+VWSK+EGWRDNIDR+ALIP+ARVDDFVRGES NKE
Sbjct  1     MARWDEILSLPVQSPPTLEFASSDLVWSKIEGWRDNIDRLALIPFARVDDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRRTA+TSYKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR+TYVPK K 
Sbjct  61    CPTRFHVEARRRRTAKTSYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYVPKNKP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             +GRPNTKRGCTCHFIVKRLIAEPSVAL+IYNQDKHVDKKG PCHGPQDKKA GTRAMYAP
Sbjct  121   SGRPNTKRGCTCHFIVKRLIAEPSVALVIYNQDKHVDKKGSPCHGPQDKKAVGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISE+LRLRVLSLL+VGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISEELRLRVLSLLHVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +SISLWVESHQN++FFY+D SDSDP VLGIQTEWQLQQMI+FGN  L+A  +
Sbjct  241   YELDEDDVVSISLWVESHQNNVFFYEDVSDSDPLVLGIQTEWQLQQMIQFGNCRLVAYHS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG+NKLKYP+ +LVVFNS+NKAIPVAWII PRFAS    RWMRALYNRV  KDPTWKLA
Sbjct  301   EFGSNKLKYPVQTLVVFNSENKAIPVAWIITPRFASRGIHRWMRALYNRVRAKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF+VD+P  DI AIREVF CS+LI FWRVRHAWHKNLMKRCSEME R  IAK+LG+ ++ 
Sbjct  361   GFVVDEPSADILAIREVFHCSILICFWRVRHAWHKNLMKRCSEMETRAEIAKKLGQAVNK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             +CKG   A+  E F E   DA EF+DYFKA WYP+LG W+ AL  LPLASQETCAA+EFY
Sbjct  421   VCKGPGSASALEDFTE---DAAEFMDYFKAIWYPKLGTWARALETLPLASQETCAAMEFY  477

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLKLRLLNE+D SVYERADWLV+KLG  VHSYFWLDEYSGK DFARY K EW+SG TA
Sbjct  478   HKQLKLRLLNEKDQSVYERADWLVNKLGNKVHSYFWLDEYSGKADFARYSKGEWLSGPTA  537

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRKSL+IPD  V I+G+ AKV+   D++  H++ NP SE+A+CDC  + MGNLCEHVFK+
Sbjct  538   WRKSLRIPDSHVNIEGQCAKVIGLKDQDKAHLVLNPGSEYAICDCGWSKMGNLCEHVFKA  597

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             IK+ RD+GS T S+SMFQY +ALIK+L+C P+DSL+RDHA S+AVWVQ QLN QIG E  
Sbjct  598   IKFCRDKGSVTPSMSMFQYSKALIKILNCSPFDSLVRDHAASLAVWVQMQLNGQIGPEKD  657

Query  1236  Q  1234
             Q
Sbjct  658   Q  658



>ref|XP_007146127.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 ref|XP_007146128.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 ref|XP_007146129.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18121.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18122.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18123.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
Length=861

 Score =  1110 bits (2872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/854 (64%), Positives = 657/854 (77%), Gaps = 26/854 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD ILSLPVQNPPTLE SS D+VWSKVEGW D +DRVALIP+ARVDDFVRGES NKE
Sbjct  1     MARWDAILSLPVQNPPTLEISSLDLVWSKVEGWHDKLDRVALIPFARVDDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+  T +K KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRSPSTPFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN DKHVDKKG PCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGFPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISE+L LRVLSLLYVGVSVETIMQRHNESVERQGGP NRDDLLTHRYVRRQER+IRRST
Sbjct  181   YISEELCLRVLSLLYVGVSVETIMQRHNESVERQGGPSNRDDLLTHRYVRRQERAIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+SIS+WVESHQN +FFY+DFSDSDPF LGIQTEWQLQQ+IRFGNRGLLASD+
Sbjct  241   YELDADDAVSISMWVESHQNQVFFYEDFSDSDPFTLGIQTEWQLQQLIRFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             R GTNKL+YPIHSL+VFNSD KAIPVAWIIAPRF+S D  RWMRALYNRVHTKDPTWKLA
Sbjct  301   RLGTNKLQYPIHSLLVFNSDKKAIPVAWIIAPRFSSLDAHRWMRALYNRVHTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL DI AIR+VFQC+V+ISFWR+RH WHKN++K C + ++++ I++RLG ++ +
Sbjct  361   GFIVDDPLYDILAIRDVFQCTVMISFWRIRHLWHKNIVK-CLKSDMQIKISRRLGWIVDN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+     + FE FME+F+D  +F+DYFK+TW+PR+G W NAL+ LPL SQE+CAA+E Y
Sbjct  420   ICRLQGNMSLFEEFMEEFIDESKFMDYFKSTWHPRIGAWINALQTLPLVSQESCAAMELY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+++ VY+RADWLVDKLGT VHSYFWLDEYSGKDDFARYWK+EW+SGLT+
Sbjct  480   HNQLKIRLLNEKEIGVYQRADWLVDKLGTKVHSYFWLDEYSGKDDFARYWKNEWMSGLTS  539

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV+I+   AKV DQ D++   V+WN  S  ++CDC+ A  GNLCEH+ K 
Sbjct  540   WRKALKIPDSDVSIEDGCAKVTDQDDRDKAFVVWNTGSMLSICDCSWAQDGNLCEHILKV  599

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             +   R RGS   SV++FQY QAL  MLHCPP+DSLIRDHA+S+AV VQKQLN+ + +ESV
Sbjct  600   LSICRKRGSVLPSVTLFQYHQALNNMLHCPPFDSLIRDHAVSLAVSVQKQLNTLLDKESV  659

Query  1236  QVVG-----------PTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHS  1090
             Q V            P  ++    G+     K + T+        +  H    +   C S
Sbjct  660   QTVTNPMEERIGIDIPLESFRVVSGNRGQVIKKHVTNDVLSLDGGEDRHDS-NEAPGCAS  718

Query  1089  VDHIVA---RNGICTNSSHNI---AVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLA  928
               H +A    +G+ T +       AV+    ++   P S   S+P L  +D+   +  L 
Sbjct  719   AMHDIADQGEDGVITRNGERFGSAAVDSLTADMNVDPPST--SDPVLHPVDDTDPSYTLQ  776

Query  927   ENGRVLIDTGPDITENLPCTDM-SFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTAES  751
             EN    + T   I   +  ++  +FSN    DN+L+K      MD +  +L    ST + 
Sbjct  777   ENKEWSLAT---IENEISASESGAFSNDKIEDNILDKGSKDCAMDVDPPTLATHSSTTQE  833

Query  750   LNQNSGSQQNGVCG  709
             + ++  + + GV G
Sbjct  834   V-KHCETHEKGVNG  846



>ref|XP_002528170.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34221.1| conserved hypothetical protein [Ricinus communis]
Length=681

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/655 (78%), Positives = 582/655 (89%), Gaps = 0/655 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEFS++D+VWSK+EGWRDNIDR+ALIP+ RV DFVRGESANK+
Sbjct  1     MARWDEILSLPVQNPPTLEFSANDLVWSKIEGWRDNIDRLALIPFDRVADFVRGESANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  + SYK KVDGILEYILYWCSFGPDDHRKGG+VRPSRTT VPKKK+
Sbjct  61    CPTRFHVEARRRRPTEASYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTNVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA GTRAMYAP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAEGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   YISDELRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SIS+WVESH NH+FFY+DF++SDPF LGIQTEWQLQQMI+FGNRGLLASD+
Sbjct  241   YELDTDDAVSISMWVESHHNHVFFYEDFNNSDPFTLGIQTEWQLQQMIQFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLVVFNS+ K IPVAWII PRFA+ D  +WMRALYNRV TKDPTWKLA
Sbjct  301   RFGTNKLKYPVHSLVVFNSEKKVIPVAWIITPRFATADAHKWMRALYNRVRTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPLTDI  IR+VF+CSVLISFWRVRHAWHKNL+KRCSE E+RV +++RLG+++  
Sbjct  361   GFIVDDPLTDIHTIRDVFECSVLISFWRVRHAWHKNLVKRCSETEMRVQMSRRLGDVVDD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G    + FE F+EDFVD  +F+DYFKA WYPR+G+W+ AL+ALPLAS ETCAA+E Y
Sbjct  421   ISSGHGTLDLFEIFIEDFVDGSDFMDYFKAVWYPRIGIWTAALKALPLASLETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLL+E+D  VY+RADWLVDKLGT VHSYFWLDEYS KDDF RYWKDEW +GLTA
Sbjct  481   HNQLKVRLLSEKDPGVYQRADWLVDKLGTKVHSYFWLDEYSEKDDFVRYWKDEWATGLTA  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++L +PD DV ++G  AKV DQ D++ VHV+WNP S+FA+CDC+ A MGNLCEHV K 
Sbjct  541   WRRALNVPDVDVVMEGRCAKVYDQLDRDKVHVVWNPGSDFAICDCSLAEMGNLCEHVIKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
              +   ++G    S+S+ QY  ALI ML+CPP+DSLI DHA+S+AV V K+L++ +
Sbjct  601   RRICHEKGYRRPSISLLQYNHALIDMLYCPPHDSLIHDHAVSLAVAVNKELDALV  655



>ref|XP_007138737.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 ref|XP_007138738.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 ref|XP_007138739.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10731.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10732.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10733.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
Length=810

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/664 (77%), Positives = 588/664 (89%), Gaps = 1/664 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD ILSLPVQNPPTLE SS D+VWSKVEGW D +DRVALIP+ARVDDFVRGES NKE
Sbjct  1     MARWDAILSLPVQNPPTLEISSLDLVWSKVEGWHDKLDRVALIPFARVDDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+  T +K KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRSPSTPFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN DKHVDKKG PCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGFPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISE+LRLRVLSLLYVGVSVETIMQRHNESVERQGGP NRDDLLTHRYVRRQER+IRRST
Sbjct  181   YISEELRLRVLSLLYVGVSVETIMQRHNESVERQGGPSNRDDLLTHRYVRRQERAIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+SIS+WVESHQN +FFY+DFSDSDPF LGIQTEWQLQQ+IRFGNRGLLASD+
Sbjct  241   YELDADDAVSISMWVESHQNQVFFYEDFSDSDPFTLGIQTEWQLQQLIRFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTN L+YPIHSL+VFNSD KAIPVAWIIAPRF+S D  RWMRALYNRVHTKDPTWKLA
Sbjct  301   RFGTNNLQYPIHSLLVFNSDKKAIPVAWIIAPRFSSLDAHRWMRALYNRVHTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL DI AIR+VFQC+V+ISFWR+RH WHKNL+K C + ++++ I++RLG ++ +
Sbjct  361   GFIVDDPLYDILAIRDVFQCTVMISFWRIRHLWHKNLVK-CLKSDMQIKISRRLGWIVDN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+     + FE FM++F+D  +F+DYFK+TW+PR+G W NAL+ LPLASQE+CAA+E Y
Sbjct  420   ICRLQGNMSLFEEFMQEFIDESKFMDYFKSTWHPRIGAWINALQTLPLASQESCAAMELY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+++ +Y+RADWLVDKLGT VHSYFWLDEYSGKDDFARYWK+EW+SGLT+
Sbjct  480   HNQLKIRLLNEKEIGLYQRADWLVDKLGTKVHSYFWLDEYSGKDDFARYWKNEWMSGLTS  539

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV+I+   AKV DQ D++   V+WN  S  ++CDC+ A  GNLCEH+ K+
Sbjct  540   WRKALKIPDSDVSIEDGCAKVTDQDDRDKAFVVWNTGSMLSICDCSWAQDGNLCEHILKA  599

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             +   R RGS   SV++FQY QAL  MLHCPP+DSLIRDHA+S+AV VQKQLN+ + +ESV
Sbjct  600   LSICRKRGSVLPSVTLFQYHQALNNMLHCPPFDSLIRDHAVSLAVSVQKQLNTLLDKESV  659

Query  1236  QVVG  1225
             Q V 
Sbjct  660   QTVA  663



>ref|XP_003528591.1| PREDICTED: uncharacterized protein LOC100819719 isoform X1 [Glycine 
max]
 ref|XP_006583971.1| PREDICTED: uncharacterized protein LOC100819719 isoform X2 [Glycine 
max]
 gb|KHN28159.1| hypothetical protein glysoja_023977 [Glycine soja]
Length=893

 Score =  1092 bits (2825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/663 (76%), Positives = 581/663 (88%), Gaps = 4/663 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD ILSLPVQNPPTLE SS+++VWSKVEGW D +DRVALIPYARVDDFVRGES NKE
Sbjct  1     MARWDAILSLPVQNPPTLEISSAELVWSKVEGWHDKLDRVALIPYARVDDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+  T +K KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRSPSTPFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPSVALIIYN DKHVDKKGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCICHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQER+IRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERAIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SIS+WVESHQN +FFY+DFSDS+PF LGIQTEWQLQQMIRFGN G+LASD+
Sbjct  241   YELDDDDAVSISMWVESHQNLVFFYEDFSDSNPFTLGIQTEWQLQQMIRFGNSGMLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKL+YPIHSL+VFN D KAIPVAWIIAP+F+S D  RWMRALYNRVHTKDPTWKLA
Sbjct  301   RFGTNKLQYPIHSLLVFNLDKKAIPVAWIIAPKFSSLDAHRWMRALYNRVHTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+ AIR+VFQC+V+ISFWR+RH WHKN++K C E ++++ I++RLG ++ +
Sbjct  361   GFIVDDPSYDVLAIRDVFQCTVMISFWRIRHLWHKNIVK-CLETDMQIKISRRLGWIVDN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+     + FE FMEDF+D  +F+DYFKATW+PR+G W NAL+ LPLASQE+CAA+EFY
Sbjct  420   ICRHQGSMSLFEEFMEDFIDESKFMDYFKATWHPRIGTWINALQTLPLASQESCAAMEFY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+D+ VY+RADWLVDKLGT VHSYFWLDEYS KDDFARYWK+EW+SGLT+
Sbjct  480   HNQLKIRLLNEKDICVYQRADWLVDKLGTKVHSYFWLDEYSEKDDFARYWKNEWMSGLTS  539

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD DV ++   AKV DQ   +   V+WN  S  ++C+C+ A  GNLCEH+ K 
Sbjct  540   WRKALKIPDTDVIMEDGCAKVTDQ---DKAFVVWNTGSMLSICNCSWAQDGNLCEHILKV  596

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             +   R RGS   SV++FQY QAL  MLHCPP+DS IRDHA+S+AV VQKQLN+ + +ES 
Sbjct  597   LSICRKRGSILPSVTLFQYHQALNNMLHCPPFDSFIRDHAVSLAVSVQKQLNTLLDKESD  656

Query  1236  QVV  1228
             Q V
Sbjct  657   QTV  659



>ref|XP_004158072.1| PREDICTED: uncharacterized LOC101211068 [Cucumis sativus]
Length=855

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/854 (63%), Positives = 647/854 (76%), Gaps = 30/854 (4%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEI SLPVQNPPTLEFSS+D+VWSKVEGWRDN+DRVA+IP+ARV DFVRGES+NKE
Sbjct  1     MARWDEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFARVGDFVRGESSNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  +  +K KVDG+LEYILYWCSFGPDDHRKGGV RPSR+TYVPKKK+
Sbjct  61    CPTRFHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGVRRPSRSTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPS+ALIIYN+DKHVDKKGLPCHGPQDKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGPQDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLR+LSLLYVGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVR QERSIRRST
Sbjct  181   YISEDLRLRILSLLYVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRIQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DDA+S+S+WVE HQ+++FFY+DF+D+D F LGIQTEWQLQQMIRFGNRGLLASD+
Sbjct  241   HELDEDDAVSLSIWVEGHQSNVFFYEDFTDTDTFTLGIQTEWQLQQMIRFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLV FNSD  AIPVAWII+ RFAS D  RWMRAL++RV TKDP+W+LA
Sbjct  301   RFGTNKLKYPVHSLVAFNSDYNAIPVAWIISTRFASGDAHRWMRALHSRVQTKDPSWRLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF+VDDPL D+  IRE+FQCSVL+SFWRVRHAWHKN++K+CSE E R  I ++L + +  
Sbjct  361   GFVVDDPLADVQTIREIFQCSVLLSFWRVRHAWHKNILKKCSENEKRAEILRQLEKTVDG  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             + +G E  ++FE  ++D  D  EFVDYFKATW PRLG+W+ AL +LPLAS ETCAA+EFY
Sbjct  421   VRQGDENVDSFEQMIKDQADDPEFVDYFKATWCPRLGMWTTALTSLPLASLETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+QLKLRLLNE+D +VY+R DWLVDKLGT VHSYFWLDEYS K++F+RYWKDEW+SGLT 
Sbjct  481   HSQLKLRLLNEKDCAVYQRTDWLVDKLGTKVHSYFWLDEYSEKNNFSRYWKDEWMSGLTY  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++L+IPD DV I+G  AKV DQ  ++   V+WNP S F +CDC  A MGNLCEH+ K 
Sbjct  541   WRRALRIPDSDVIIEGGIAKVTDQITRDRKFVVWNPGSHFGICDCQWAEMGNLCEHMCKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ-ES  1240
             I   R +G+   SVS+ QY++AL  MLH PP+DSLIRDHA+S A+ VQKQLN+ I     
Sbjct  601   INMCRKKGTTRPSVSLLQYQKALTDMLHRPPHDSLIRDHAVSFAMSVQKQLNALISMGND  660

Query  1239  VQVVGP-----TTTYGGQCGDTVngskgnstsscngsgsNKLHH------------SGFT  1111
             +++ GP       T   Q    V+     S         +KL+             +  T
Sbjct  661   LELRGPFQARMIKTLENQIVREVSTGDTESFRDNVLRNKSKLNQNESDCASGQEASNNIT  720

Query  1110  KNQLCHSVDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDML  931
              N     VD  V  N +   ++     E PC E+     S+C S P+L S++EV   +  
Sbjct  721   DNSSSELVDLTVTGNRVDGATAEK---ECPCTEMDIDTTSICISPPRLSSVEEVVGGNSF  777

Query  930   --AENGRVLIDTGPDITENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTA  757
               ++NG V ID   DI   LP +  +  +LN F   ++      K++ +S  ++  ++ A
Sbjct  778   QQSKNG-VQIDMEFDI---LPSSYDAVCSLNKF---VDNQHHHEKIEVDSSLMNDPVTAA  830

Query  756   ESLNQNSGSQQNGV  715
             +   Q     QNG+
Sbjct  831   DFSVQCMMKSQNGI  844



>ref|XP_004135549.1| PREDICTED: uncharacterized protein LOC101211068 [Cucumis sativus]
 gb|KGN65922.1| hypothetical protein Csa_1G538200 [Cucumis sativus]
Length=855

 Score =  1086 bits (2809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/854 (62%), Positives = 647/854 (76%), Gaps = 30/854 (4%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEI SLPVQNPPTLEFSS+D+VWSKVEGWRDN+DRVA+IP+ARV DFVRGES+NKE
Sbjct  1     MARWDEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFARVGDFVRGESSNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  +  +K KVDG+LEYILYWCSFGPDDHRKGGV RPSR+TYVPKKK+
Sbjct  61    CPTRFHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGVRRPSRSTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPS+ALIIYN+DKHVDKKGLPCHGPQDKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGPQDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLR+LSLLYVGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVR QERSIRRST
Sbjct  181   YISEDLRLRILSLLYVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRIQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DDA+S+S+WVE HQ+++FFY+DF+D+D F LGIQTEWQLQQMIRFGNRGLLASD+
Sbjct  241   HELDEDDAVSLSIWVEGHQSNVFFYEDFTDTDTFTLGIQTEWQLQQMIRFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLV FNSD  AIPVAWII+ RFAS D  RWMRAL++RV TKDP+W+LA
Sbjct  301   RFGTNKLKYPVHSLVAFNSDYNAIPVAWIISTRFASGDAHRWMRALHSRVQTKDPSWRLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF+VDDPL D+  IRE+FQCSVL+SFWRVRHAWHKN++K+CSE E R  I ++L + +  
Sbjct  361   GFVVDDPLADVQTIREIFQCSVLLSFWRVRHAWHKNILKKCSENEKRAEILRQLEKTVDG  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             + +G E  ++FE  ++D  D  EFVDYFKATW PRLG+W+ AL +LPLAS ETCAA+EFY
Sbjct  421   VRQGDENVDSFEQMIKDQADDPEFVDYFKATWCPRLGMWTTALTSLPLASLETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+QLKLRLLNE+D +VY+R DWLVDKLGT VHSYFWLDEYS K++F+RYWKDEW+SGLT 
Sbjct  481   HSQLKLRLLNEKDCAVYQRTDWLVDKLGTKVHSYFWLDEYSEKNNFSRYWKDEWMSGLTY  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++L+IPD DV I+G  AKV DQ  ++   V+WNP S F +CDC  A MGNLCEH+ K 
Sbjct  541   WRRALRIPDSDVIIEGGIAKVTDQITRDRKFVVWNPGSHFGICDCQWAEMGNLCEHMCKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ-ES  1240
             I   R +G+   SVS+ QY++AL  MLH PP+DSLIRDHA+S A+ VQKQLN+ I     
Sbjct  601   INMCRKKGTTRPSVSLLQYQKALTDMLHRPPHDSLIRDHAVSFAMSVQKQLNALISMGND  660

Query  1239  VQVVGP-----TTTYGGQCGDTVngskgnstsscngsgsNKLHH------------SGFT  1111
             +++ GP       T   +    V+     S         +KL+             +  T
Sbjct  661   LELRGPFQARMIKTLENKIDREVSTGDTESFRDNVLRNKSKLNQNESDCASGQEASNNIT  720

Query  1110  KNQLCHSVDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDML  931
              N     VD  V  N +   ++     E PC E+     S+C S P+L S++EV   +  
Sbjct  721   DNSSSELVDLTVTGNRVDGATAEE---ECPCTEMDIDTTSICISPPRLSSVEEVVGGNSF  777

Query  930   --AENGRVLIDTGPDITENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTA  757
               ++NG V ID   DI   LP +  +  +LN F   ++      K++ +S  ++  ++ A
Sbjct  778   QQSKNG-VQIDMEFDI---LPSSYDAVCSLNKF---VDNQHHHEKIEVDSSLMNDPVTAA  830

Query  756   ESLNQNSGSQQNGV  715
             +   Q     QNG+
Sbjct  831   DFSVQCMMKSQNGI  844



>ref|XP_004513230.1| PREDICTED: uncharacterized protein LOC101502422 [Cicer arietinum]
Length=803

 Score =  1085 bits (2805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/660 (76%), Positives = 579/660 (88%), Gaps = 1/660 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD ILSLPVQNPPTLE SS++IVWSKVEGW D +DRVALIP+ RVDDFVRGES NKE
Sbjct  1     MARWDAILSLPVQNPPTLEISSAEIVWSKVEGWHDKLDRVALIPFPRVDDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR   TS+K KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRAPSTSFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN DKHVDKKGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQER+IRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERAIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADD++SIS+WVESHQ+++FFY+DFS+SDPF+LGIQTEWQLQQMI+FGNRGLLASD+
Sbjct  241   YELDADDSVSISMWVESHQSNVFFYEDFSESDPFILGIQTEWQLQQMIKFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FGTNKLKYP+HSL+VFNSD KAIPVAWI+ PRF+  D  RWMRALYNRVHTKDPTWKLA
Sbjct  301   SFGTNKLKYPVHSLLVFNSDKKAIPVAWILTPRFSCLDAHRWMRALYNRVHTKDPTWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+ AIR+VFQCS+LISFWRVRH WHKN++K   E  +++ I+KRLG ++ +
Sbjct  361   GFIVDDPHYDVLAIRDVFQCSILISFWRVRHLWHKNIIKHM-EAGMQIKISKRLGWIMDN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I +     + FE F+EDF+D   F+DYFKATWYPR+G W++ALR LPLAS+E+CAA+EFY
Sbjct  420   IFRHQGTVSLFEDFVEDFIDESNFMDYFKATWYPRMGAWADALRTLPLASEESCAAMEFY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+D+ VY+RADWLVDKLGT VHSYFWLDEYS KDDFARYWK+EW SGLT 
Sbjct  480   HNQLKIRLLNEKDIDVYQRADWLVDKLGTKVHSYFWLDEYSDKDDFARYWKNEWTSGLTP  539

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD +V ++   AKV D+ D++  +++ NP S  ++CDC  A  GNLCEH+ K 
Sbjct  540   WRKALKIPDINVLMEDGCAKVTDEHDQDKAYIVCNPGSMLSICDCCWAKDGNLCEHMLKV  599

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             +   R +GS   SVS+FQY + L  MLHCPP+DSLIRDHA+S+AV VQKQLN Q+ +ES+
Sbjct  600   LSICRSQGSVQPSVSLFQYHRVLNSMLHCPPFDSLIRDHAVSLAVSVQKQLNMQLDKESL  659



>ref|XP_008445258.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445266.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445273.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445282.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445289.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
Length=874

 Score =  1083 bits (2800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/826 (64%), Positives = 632/826 (77%), Gaps = 25/826 (3%)
 Frame = -3

Query  3258  SEVQNPNSRNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYA  3079
             S + +  S   + +MARWDEI SLPVQNPPTLEFSS+D+VWSKVEGWRDN+DRVA+IP+A
Sbjct  6     STLDHIRSAEEKTKMARWDEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFA  65

Query  3078  RVDDFVRGESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGV  2899
             RV DFVRGES+NKECPT+FHVEARRRR  +  +K KVDG+LEYILYWCSFGPDDHRKGGV
Sbjct  66    RVGDFVRGESSNKECPTRFHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGV  125

Query  2898  VRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGP  2719
              RPSR+TYVPKKK+AGRPNTKRGCTCHFIVKRLIAEPS+ALIIYN+DKHVDKKGLPCHGP
Sbjct  126   RRPSRSTYVPKKKNAGRPNTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGP  185

Query  2718  QDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTH  2539
             QDKKA GTRAM+APYISEDLRLR+LSLLYVGVSVETIMQRHNE+VE+QGGPCNRDDLLTH
Sbjct  186   QDKKAEGTRAMFAPYISEDLRLRILSLLYVGVSVETIMQRHNETVEKQGGPCNRDDLLTH  245

Query  2538  RYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQ  2359
             RYVR QERSIRRST+ELD DDA+S+S+WVE H++++FFY+DF+D+D F LGIQTEWQLQQ
Sbjct  246   RYVRIQERSIRRSTHELDEDDAVSLSIWVEGHRSNVFFYEDFTDTDTFTLGIQTEWQLQQ  305

Query  2358  MIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRAL  2179
             MIRFGNRGLLASD+RFGTNKLKYP+HSLV FNSD  AIPVAWI++PRFAS D  RWMRAL
Sbjct  306   MIRFGNRGLLASDSRFGTNKLKYPVHSLVAFNSDYNAIPVAWIVSPRFASGDAHRWMRAL  365

Query  2178  YNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEV  1999
             ++RV TKDP+WKLAGF+VDDPL D+  IRE+FQCSVL+SFWRVRHAWHKN++K+C E E 
Sbjct  366   HSRVQTKDPSWKLAGFVVDDPLADVQTIREIFQCSVLLSFWRVRHAWHKNILKKCVENEK  425

Query  1998  RVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRAL  1819
             R  I ++L + +  +C+G E  ++FE  ++D  D  EFVDYFKATW  RLG+W+ AL +L
Sbjct  426   RAEILRQLEKTVDGVCRGDENVDSFELMIKDQADDPEFVDYFKATWCSRLGMWTTALTSL  485

Query  1818  PLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDF  1639
             PLAS ETCAA+EFYH+QLKLRLLNE+D +VY+R DWLVDKLGT VHSYFWLDEY  K++F
Sbjct  486   PLASLETCAAMEFYHSQLKLRLLNEKDSAVYQRTDWLVDKLGTKVHSYFWLDEYPEKNNF  545

Query  1638  ARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCN  1459
              RYWKDEW+SGLT WR++L IPD DV I+G  AKV +Q  ++   V+WNP S+F +CDC 
Sbjct  546   CRYWKDEWMSGLTYWRRALGIPDSDVIIEGGIAKVTNQITRDRKFVVWNPGSQFGICDCQ  605

Query  1458  SANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVW  1279
              A MGNLCEH+ K I   R +G+   SVS+ QY++ LI MLH PP+DSLIRDHA+S A+ 
Sbjct  606   WAEMGNLCEHMCKVINICRKKGTTRPSVSLLQYQKTLIDMLHRPPHDSLIRDHAVSFAMS  665

Query  1278  VQKQLNSQIGQES-VQVVGP-----TTTYGGQCGDTVngskgnstsscngsgsNKLHH--  1123
             VQKQLN+ I   S +++ GP       T   Q    V+     S         +KL+   
Sbjct  666   VQKQLNALISMGSDLELRGPFQDRVIKTLENQIDREVSTGDTESFRDNVLRNKSKLNQNE  725

Query  1122  ----------SGFTKNQLCHSVDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEP  973
                       +  T N     VD  V  N  C + +     E PC ++     S+C   P
Sbjct  726   SECASGQEASNNITDNSSSELVDLTVTGN--CVDGA-TAGEECPCTQMDIDTTSICILPP  782

Query  972   QLFSIDEVTSTDMLAEN-GRVLIDTGPDITENLPCTDMSFSNLNDF  838
             +L S++EV   + L +N   V ID   D   +LP +  +  NLN F
Sbjct  783   RLSSVEEVVGGNSLLQNKNAVQIDMEYD---SLPSSYNAVCNLNKF  825



>ref|XP_008381415.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444267 
[Malus domestica]
Length=972

 Score =  1080 bits (2792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/828 (65%), Positives = 638/828 (77%), Gaps = 14/828 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PP LEFSSSD+VWSKVEGWRD  DRVALIP+ RVDDF+RGES++KE
Sbjct  1     MARWDEILSLPVQSPPALEFSSSDLVWSKVEGWRDKKDRVALIPFPRVDDFLRGESSSKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPTKFHVEARRRR  +T YKPKVDGILEYILYWCSFGPDDHRKGG+VRPSR   +PKKK+
Sbjct  61    CPTKFHVEARRRRQPKTPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSRVN-IPKKKN  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVD+KG PCHGPQDK AAGTRAM+AP
Sbjct  120   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDRKGEPCHGPQDKMAAGTRAMFAP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRV SLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRRQER IRRS 
Sbjct  180   YISEDLRLRVQSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRQERVIRRSV  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADD +SISLWVE+HQ+H+FFY+DFSD DPF LGIQTEWQLQQMIRFGNR L+ASD+
Sbjct  240   YELDADDVVSISLWVENHQSHVFFYEDFSDVDPFTLGIQTEWQLQQMIRFGNRSLIASDS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGT KLKYP+HSL+VFN DNKAIPVAWI+AP+F S +  +WMRALYNRV TKDP WKLA
Sbjct  300   RFGTTKLKYPVHSLLVFNEDNKAIPVAWIVAPKFESSNAHKWMRALYNRVQTKDPAWKLA  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL D+  IR+VFQCSVLISFWRVRHAWHKNL K+C + E+R TI++RL + + +
Sbjct  360   GFIVDDPLADVLTIRDVFQCSVLISFWRVRHAWHKNLXKKCVDNEMRATISRRLHQAMDN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+       FE  +EDF+D  +F+DYFKATWYPR G+W +AL+ LPLASQET AA+EFY
Sbjct  420   ICZQXGTERLFEDLIEDFLDESDFMDYFKATWYPRTGMWISALQNLPLASQETSAAMEFY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+  SVY+R DWLVDKLGT V S FWLDEYS KDDFARYWKDEW SGLT+
Sbjct  480   HNQLKLRLLNEKKPSVYKRVDWLVDKLGTKVXSNFWLDEYSEKDDFARYWKDEWASGLTS  539

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD ++ I+G  AKV+D+ D++ V+V+WNP S+F++C+C  A MGNLCEH+ K 
Sbjct  540   WRKALKIPDRNIVIEGTRAKVIDELDQDRVYVVWNPGSQFSICNCRWAEMGNLCEHILKV  599

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I   R R S+T S+S+ QY +ALI  LHCPP+DSLIRDHA+S+AV+VQKQL+     ES 
Sbjct  600   INVCRKR-SSTPSISLLQYHKALIDXLHCPPHDSLIRDHAVSLAVFVQKQLSGLNNLESN  658

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGF--TKNQLCHSVDHIVARNG  1063
                     +  +  + VN    N         +          TK ++      +VA   
Sbjct  659   NTAMDVAFFANRDQELVNEDPINEEVLSLNENNCGDGDVAAERTKGKVATESSSLVACGD  718

Query  1062  ICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAEN-GRVLIDTGPDIT  886
                N S+    EI   E+   P S+C S P L S+DEV S+ +  E+  R L +      
Sbjct  719   DICNESY--GEEITXDEMDVDPSSICISPPGLHSVDEVVSSSVFPESRQRSLFNRE---L  773

Query  885   ENLPCTDMSFSNLNDFDNVLNKNDSTAKMDAESQSLHIVLSTAESLNQ  742
             E+LP  D + +   + D++LN+N     MD   + ++I  ST E + Q
Sbjct  774   EDLPPADDARTTGFE-DDILNRNSQENTMD---EDMNIPSSTMEFVEQ  817



>ref|XP_008445298.1| PREDICTED: uncharacterized protein LOC103488340 isoform X2 [Cucumis 
melo]
Length=855

 Score =  1079 bits (2791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/812 (64%), Positives = 626/812 (77%), Gaps = 25/812 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEI SLPVQNPPTLEFSS+D+VWSKVEGWRDN+DRVA+IP+ARV DFVRGES+NKE
Sbjct  1     MARWDEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFARVGDFVRGESSNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  +  +K KVDG+LEYILYWCSFGPDDHRKGGV RPSR+TYVPKKK+
Sbjct  61    CPTRFHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGVRRPSRSTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPS+ALIIYN+DKHVDKKGLPCHGPQDKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGPQDKKAEGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLR+LSLLYVGVSVETIMQRHNE+VE+QGGPCNRDDLLTHRYVR QERSIRRST
Sbjct  181   YISEDLRLRILSLLYVGVSVETIMQRHNETVEKQGGPCNRDDLLTHRYVRIQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DDA+S+S+WVE H++++FFY+DF+D+D F LGIQTEWQLQQMIRFGNRGLLASD+
Sbjct  241   HELDEDDAVSLSIWVEGHRSNVFFYEDFTDTDTFTLGIQTEWQLQQMIRFGNRGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLV FNSD  AIPVAWI++PRFAS D  RWMRAL++RV TKDP+WKLA
Sbjct  301   RFGTNKLKYPVHSLVAFNSDYNAIPVAWIVSPRFASGDAHRWMRALHSRVQTKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF+VDDPL D+  IRE+FQCSVL+SFWRVRHAWHKN++K+C E E R  I ++L + +  
Sbjct  361   GFVVDDPLADVQTIREIFQCSVLLSFWRVRHAWHKNILKKCVENEKRAEILRQLEKTVDG  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             +C+G E  ++FE  ++D  D  EFVDYFKATW  RLG+W+ AL +LPLAS ETCAA+EFY
Sbjct  421   VCRGDENVDSFELMIKDQADDPEFVDYFKATWCSRLGMWTTALTSLPLASLETCAAMEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+QLKLRLLNE+D +VY+R DWLVDKLGT VHSYFWLDEY  K++F RYWKDEW+SGLT 
Sbjct  481   HSQLKLRLLNEKDSAVYQRTDWLVDKLGTKVHSYFWLDEYPEKNNFCRYWKDEWMSGLTY  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++L IPD DV I+G  AKV +Q  ++   V+WNP S+F +CDC  A MGNLCEH+ K 
Sbjct  541   WRRALGIPDSDVIIEGGIAKVTNQITRDRKFVVWNPGSQFGICDCQWAEMGNLCEHMCKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQES-  1240
             I   R +G+   SVS+ QY++ LI MLH PP+DSLIRDHA+S A+ VQKQLN+ I   S 
Sbjct  601   INICRKKGTTRPSVSLLQYQKTLIDMLHRPPHDSLIRDHAVSFAMSVQKQLNALISMGSD  660

Query  1239  VQVVGP-----TTTYGGQCGDTVngskgnstsscngsgsNKLHH------------SGFT  1111
             +++ GP       T   Q    V+     S         +KL+             +  T
Sbjct  661   LELRGPFQDRVIKTLENQIDREVSTGDTESFRDNVLRNKSKLNQNESECASGQEASNNIT  720

Query  1110  KNQLCHSVDHIVARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDML  931
              N     VD  V  N  C + +     E PC ++     S+C   P+L S++EV   + L
Sbjct  721   DNSSSELVDLTVTGN--CVDGA-TAGEECPCTQMDIDTTSICILPPRLSSVEEVVGGNSL  777

Query  930   AEN-GRVLIDTGPDITENLPCTDMSFSNLNDF  838
              +N   V ID   D   +LP +  +  NLN F
Sbjct  778   LQNKNAVQIDMEYD---SLPSSYNAVCNLNKF  806



>ref|XP_008232361.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103331512 
[Prunus mume]
Length=1089

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/923 (60%), Positives = 667/923 (72%), Gaps = 56/923 (6%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PPTLEFSS+DIVWSKVEGWRDN DRVALIP+ARVDDF+RGESANKE
Sbjct  1     MARWDEILSLPVQSPPTLEFSSADIVWSKVEGWRDNKDRVALIPFARVDDFLRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR A+T YKPKVDG+LEYILYWCSFGPDDHRKGGVVRPSRTTY+PKKK+
Sbjct  61    CPTRFHVEARRRRQAKTPYKPKVDGVLEYILYWCSFGPDDHRKGGVVRPSRTTYLPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVAL+IYNQDKHVDKKG+PCHGPQDK AAGTRAM+AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALVIYNQDKHVDKKGVPCHGPQDKMAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRRQER IRRS 
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRQERIIRRSR  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+SIS+WVE+HQ+++F+Y+DFSD DPF LGIQT+WQLQQMIRFGNR LLASD+
Sbjct  241   YELDADDAVSISMWVENHQSNVFYYEDFSDVDPFTLGIQTDWQLQQMIRFGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKY +HSL+VFN DNKAIPVAWI+AP+F S +  +WMRALYNRV TKDP WKLA
Sbjct  301   RFGTNKLKYSVHSLLVFNDDNKAIPVAWIVAPKFESSNAHKWMRALYNRVQTKDPAWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAK-RLGEMIH  1960
             GFIVDDPL D+  IR+VFQCSVLISFWRVRHAWHKNL+K+C + E+R  I++ R  E  +
Sbjct  361   GFIVDDPLADVLTIRDVFQCSVLISFWRVRHAWHKNLVKKCVDNEMRAAISRERERERYY  420

Query  1959  SICKGCEP-------------ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRAL  1819
                 G +              +  F        +   F        +  +G+W +AL+ L
Sbjct  421   HDINGTDQDSGLFVFFLPFLLSLFFFFLFFXIXNFALFXITHSRKMFFDIGMWISALQNL  480

Query  1818  PLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDF  1639
             PLASQETCAA+EFYHNQLKLRLLNE+  SVY R DWLVDKLGT VHSYFWLDEYS KDDF
Sbjct  481   PLASQETCAAMEFYHNQLKLRLLNEKKPSVYTRVDWLVDKLGTKVHSYFWLDEYSEKDDF  540

Query  1638  ARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCN  1459
             ARYWKDEW+SGLT+WRK+L+IPD +V ++G  AKV+ Q D++  +++WNP S+F +C+C+
Sbjct  541   ARYWKDEWVSGLTSWRKALKIPDSNVVMEGTCAKVISQLDQDRAYLVWNPGSQFGICNCS  600

Query  1458  SANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVW  1279
              A MGNLCEHV K I   R + SA  S+S+ QY QALI MLHCPP+DSLIRDHA+S+AV+
Sbjct  601   WAEMGNLCEHVLKVISVCR-KKSAMPSISLLQYHQALIDMLHCPPHDSLIRDHAVSLAVF  659

Query  1278  VQKQLNSQIGQESVQVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQL  1099
             VQ QLN  +  ES       T++  +  + VN    +   +  G G         TK +L
Sbjct  660   VQNQLNGLVNLESCNTTMDVTSFADRDRELVNEEVVSHNENDCGDGHVTAER---TKGKL  716

Query  1098  CHSVDHIVAR-NGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLF-SIDEVTSTDMLAE  925
                  ++VAR +GIC  S      E+ C E+   P S+C S P L+   + V+S+     
Sbjct  717   GTEQSNLVARGSGICNES---CGEEVSCDEMDVDPSSICISPPGLYSVDEVVSSSVFSGS  773

Query  924   NGRVLIDTGPDITENLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESL  748
               R L +T    TE+L  TD   +N   + D++LN+N     MD   + + I  ST E +
Sbjct  774   RQRSLFNTE---TEDLASTDDPLTNPTGYEDDILNRNRQEIAMD---EDIDIPSSTMEFV  827

Query  747   NQNSGS----------QQNGVCGNRKDTWVGPCIVSVGGKTDKDSSETSEPVDSCLVNVG  598
              Q + +          +   +C    D  V           +K S   S PV+S +V V 
Sbjct  828   EQCTITHPDDDHIHDIEHTVICKTSDDHTV----------YNKISPSASIPVESQVVEVA  877

Query  597   ESSNFIEEGVREGPEN-QSAGKN  532
             E+S     GV  G E  ++ GKN
Sbjct  878   ETS-----GVITGNEQMETEGKN  895



>ref|XP_004295012.1| PREDICTED: uncharacterized protein LOC101310972 [Fragaria vesca 
subsp. vesca]
Length=1030

 Score =  1077 bits (2784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/829 (64%), Positives = 636/829 (77%), Gaps = 21/829 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPPTLEF ++D+VWSKVEGW D  DRVA+IP+ARVDDFVRGESANKE
Sbjct  1     MARWDEILSLPVQNPPTLEFCAADLVWSKVEGWCDKKDRVAVIPFARVDDFVRGESANKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPTKFHVEARR+R A+ ++KPKVDGILEYILYWCSFGPDDHR GG  RPSRT + PKKK+
Sbjct  61    CPTKFHVEARRKRHAKANFKPKVDGILEYILYWCSFGPDDHRAGGSRRPSRTHFAPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             +GRPNTKRGCTCHFIVKRLIAEPSVAL++YN  KHVDKKGLPCHGP+DK AAGTRAM+AP
Sbjct  121   SGRPNTKRGCTCHFIVKRLIAEPSVALLVYNSFKHVDKKGLPCHGPEDKMAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             +ISEDLRLRVLSLLYVGVSVETIMQRH+ESVERQGGPCNRDDLLTHR VR QER+IRRST
Sbjct  181   HISEDLRLRVLSLLYVGVSVETIMQRHSESVERQGGPCNRDDLLTHRSVRSQERNIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD+DDA+SISLWVE+HQ+ IFFY+DFS++DPF LGIQT+WQLQQMIRFGN  L+ASD+
Sbjct  241   YELDSDDAVSISLWVETHQSSIFFYEDFSETDPFTLGIQTDWQLQQMIRFGNYSLIASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSL+VFN DNKAIPVAWI+ P+ AS DT +WMRALYNRV  KDP+WKLA
Sbjct  301   RFGTNKLKYPVHSLLVFNQDNKAIPVAWIVNPKSASSDTYKWMRALYNRVQAKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IR+VF CSVLISFWRVRHAWHKNL+++CSE E+R TIA+RL + +  
Sbjct  361   GFIVDDPQADVLTIRDVFHCSVLISFWRVRHAWHKNLVRKCSEEEMRATIARRLHQAVDI  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+       F  FMEDFVDA +FVDYFKATWYPR+G W+ AL++LPLASQETCAA+EF+
Sbjct  421   ICQRRGTDGLFVDFMEDFVDASDFVDYFKATWYPRIGKWTTALQSLPLASQETCAAMEFF  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLKLRLLNE+  SVY R DWLV KLGT VHSYFWLDEYS KDDFARYWKDEW+SGLT+
Sbjct  481   HNQLKLRLLNEKKPSVYNRVDWLVHKLGTQVHSYFWLDEYSEKDDFARYWKDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR +L+IPD +V I+G  AKV DQ D    +V+WNP S+F +C+C+ A MGNLCEH+ K 
Sbjct  541   WRTALEIPDSNVVIEGTCAKVTDQLDNEKTYVVWNPGSQFGICNCSWAEMGNLCEHILKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             I   R R     SV++ Q+ QAL+ MLH PP+DSLIRDHA+S+A +V  QL+        
Sbjct  601   ISVCRKRSHPMPSVNLLQFHQALLDMLHMPPHDSLIRDHAVSLAAFVHNQLS--------  652

Query  1236  QVVGPTTTYGGQCGDTVngskgnstsscngsgsNKLHHSGFTKNQLCHSVDHIVARNGI-  1060
                GP +        T   +  +      G  S + H+     ++  H V     R+   
Sbjct  653   ---GPNSESSNSTMVTA-LADKDQVLIDEGPASEEAHNENSCVDE--HVVVTTETRSPFA  706

Query  1059  CTNSSHNIAV-EIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENG-RVLIDTGPDIT  886
             C N  +N    E    E+   P S+C S P L S+DEV S+ +L+ +  R L++T    T
Sbjct  707   CGNGIYNEGCGEENTSEMDVDPSSICISPPGLHSVDEVVSSGVLSGSSQRPLVNTE---T  763

Query  885   ENLPCTDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQ  742
             E L   D + SN ++  D++L++N     ++ +  SL I  ST E + Q
Sbjct  764   EELLSADDALSNSSENEDDMLDENCKENVLNTDPLSLDIPCSTMEFVEQ  812



>ref|XP_010921093.1| PREDICTED: uncharacterized protein LOC105044782 [Elaeis guineensis]
Length=1104

 Score =  1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/666 (72%), Positives = 571/666 (86%), Gaps = 1/666 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEIL+LPVQNPPTLEFS++DIVWS+VEGWR+ +DR+ALIP++RV+DFVRGES NKE
Sbjct  1     MARWDEILTLPVQNPPTLEFSAADIVWSRVEGWREQMDRLALIPFSRVNDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  + +YKPKVDGILEYILYWCSFGPDDHRKGGVVRPSR     +K  
Sbjct  61    CPTRFHVEARRRRPPEMAYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRNYTAKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGP DKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPMDKKAVGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+++SLLYVGV VETIMQRH E VE+QGGP NRDDLLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQIMSLLYVGVPVETIMQRHTEMVEKQGGPSNRDDLLTHRYVRRLERKIRRSM  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADD++SI +W+E+H++HIFFY+DFS++DPFVLGIQTEWQLQQMI FGNR LLASD+
Sbjct  241   YELDADDSVSIGMWIENHRDHIFFYEDFSETDPFVLGIQTEWQLQQMIHFGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPI+SL+VF+S+N AIPVAWII P FA+ D  RW+ ALY+RVH+KDPTW+L 
Sbjct  301   RFGTNKLKYPIYSLLVFDSNNNAIPVAWIITPNFANGDIHRWIGALYDRVHSKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IREVFQCS+LISFWRV HAW KNLM++CS  E+R  +++RLGE + S
Sbjct  361   GFIVDDPSADVLTIREVFQCSILISFWRVHHAWRKNLMEKCSAPEMRAMMSRRLGEAVSS  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G    + F+AF+EDFVD  +F+DYF A W+PR+G+W+ AL+ALPLAS E  AA+E Y
Sbjct  421   ICRGSGDMHLFDAFLEDFVDCSDFLDYFMAIWFPRIGVWTAALKALPLASSEVSAAIECY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE++ SVY+RADWL+DKLGT VHSY+WLDEYSGKD+F+RYWKDEW SGLT+
Sbjct  481   HHLLKLRLLNEKNPSVYQRADWLIDKLGTKVHSYYWLDEYSGKDNFSRYWKDEWKSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++LQIPD DV +DG+ AKVV Q D+  +H + NP SEFA+CDC  + MGNLC+HV KS
Sbjct  541   WRQALQIPDSDVVLDGKCAKVVSQKDREKMHTVLNPGSEFAICDCGWSMMGNLCKHVIKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQE-S  1240
              K  RDRG A SS S+F+Y + L+ +L+CPP+DS+IRDHA+++AV VQ QLN+   QE S
Sbjct  601   TKIYRDRGLAASSTSLFEYNRTLMSILNCPPHDSVIRDHAVALAVCVQTQLNALFDQENS  660

Query  1239  VQVVGP  1222
             V   GP
Sbjct  661   VTTSGP  666



>gb|AES89835.2| zinc ion-binding protein [Medicago truncatula]
Length=761

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/660 (74%), Positives = 570/660 (86%), Gaps = 2/660 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD ILSLPVQNP TLE SS ++VWSKVEGW D +DRVALIP+ARV+DFV+GES NKE
Sbjct  1     MARWDAILSLPVQNP-TLEISSDNLVWSKVEGWHDKLDRVALIPFARVNDFVKGESNNKE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+  T+ K KVDGILEYILYWCSFGPDDHRKGGVVRPSRT+Y PKKK+
Sbjct  60    CPTRFHVEARRRRSPSTTSKKKVDGILEYILYWCSFGPDDHRKGGVVRPSRTSYAPKKKN  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN DKHVDKKGLPCHGPQDKKAAGT A +AP
Sbjct  120   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTPAEFAP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVRRQER IRRST
Sbjct  180   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRRQEREIRRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADD++SIS+WVES Q+++FFY+DFSDSDPF+LGIQTEWQLQQMI+FGNRGLLASD+
Sbjct  240   YELDADDSVSISMWVESRQSNVFFYQDFSDSDPFILGIQTEWQLQQMIKFGNRGLLASDS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTN LKYP+HSL+VFNSD KAIPVAWII P+F+  D  RWMRAL+NRVH KDPTWKLA
Sbjct  300   RFGTNTLKYPVHSLLVFNSDKKAIPVAWIITPKFSCLDAHRWMRALHNRVHNKDPTWKLA  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+PAIR+VFQCSVLISFWRVRH WHKN+MK C E ++++ I++RLG ++ S
Sbjct  360   GFIVDDPQYDVPAIRDVFQCSVLISFWRVRHLWHKNIMK-CLETDMQIKISQRLGWIMDS  418

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+     + FE F+EDF+D   F+DYFKATWYPR+G W++AL+  PLASQE+ AA+E Y
Sbjct  419   ICRRQGTMSLFEDFVEDFIDEFNFMDYFKATWYPRMGAWADALKTFPLASQESWAAIELY  478

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+D+  Y+RADWLVDKLGT VHSYFWLDE S KD FARYWK+EW SGL +
Sbjct  479   HNQLKIRLLNEKDVDAYQRADWLVDKLGTKVHSYFWLDECSDKDGFARYWKNEWTSGLAS  538

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WRK+L+IPD +V ++   AKV D+ D++  +++ NP S  ++CDC  A  GNLCEH+ K 
Sbjct  539   WRKALKIPDTNVLMEDGRAKVKDEDDQDKTYIVSNPGSMLSICDCCWAKDGNLCEHILKV  598

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
             +   R RGS   S+S+ QY QAL  MLHCPP+DSLIRDHA+S+AV VQ+QLN+ + +ESV
Sbjct  599   LSVFRSRGSVLPSISLLQYHQALKSMLHCPPFDSLIRDHAVSLAVSVQRQLNTLLDKESV  658



>ref|XP_008782616.1| PREDICTED: uncharacterized protein LOC103702098 [Phoenix dactylifera]
Length=1107

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/653 (73%), Positives = 562/653 (86%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEIL+LPVQNPPTLEFS++DIVWS+VEGWR+ +DR+ALIP++RV+DFVRGES NKE
Sbjct  1     MARWDEILTLPVQNPPTLEFSAADIVWSRVEGWREQMDRLALIPFSRVNDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  + +YKPKVDGILEYILYWCSFGPDDHRKGGVVRPSR     +K  
Sbjct  61    CPTRFHVEARRRRPPEMAYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRNYTAKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPSVALIIYNQDKHVDKKG PCHGP DKKA GTRAM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIAEPSVALIIYNQDKHVDKKGNPCHGPMDKKAVGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+++SLLYVGV VETIMQRH E VE+QGGP NRDDLLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQIMSLLYVGVPVETIMQRHTEMVEKQGGPSNRDDLLTHRYVRRLERKIRRSM  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SI +W+E+H++HIFFY+DFS++DPFVLGIQTEWQLQQMIRFGNR LLASD+
Sbjct  241   YELDPDDALSIGMWIENHRDHIFFYEDFSETDPFVLGIQTEWQLQQMIRFGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPI+SL+VF+S+N AIPVAWII P FA+    RW+ ALY+RVH+KDPTW+L 
Sbjct  301   RFGTNKLKYPIYSLLVFDSNNNAIPVAWIITPNFANGGIHRWIGALYDRVHSKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IREVFQCS+LISFWRV HAW KNLM++CS  E+R  +++RLGE I S
Sbjct  361   GFIVDDPSADVLTIREVFQCSILISFWRVHHAWRKNLMEKCSAPEMRAMMSRRLGEAISS  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G    + FEAF+EDFVD  +F+DYFKA W+PR+G+W+ AL+ALPLAS E  AA+E Y
Sbjct  421   ICRGSGDMHLFEAFLEDFVDCSDFLDYFKAIWFPRIGVWTAALKALPLASSEVSAAIECY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE++ SVY+RADWLVDKLGT VHSY+WLDEYSGKD F+RYWKDEW SGLT+
Sbjct  481   HHLLKLRLLNEKNSSVYQRADWLVDKLGTKVHSYYWLDEYSGKDIFSRYWKDEWKSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR++LQIPD DV +DG  AKVV Q D+  VH + NP SEFA+CDC+ + MGNLC+HV KS
Sbjct  541   WRQALQIPDSDVVLDGNCAKVVSQKDREKVHTVLNPGSEFAICDCSWSMMGNLCKHVIKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              K  RDRG A SS  +F+Y + L+ +L+CPP+DS+IRDHA+++AV VQ QLNS
Sbjct  601   TKIYRDRGLAVSSTCLFEYNRTLMSILNCPPHDSVIRDHAVALAVCVQTQLNS  653



>ref|XP_010540374.1| PREDICTED: uncharacterized protein LOC104814172 [Tarenaya hassleriana]
 ref|XP_010540375.1| PREDICTED: uncharacterized protein LOC104814172 [Tarenaya hassleriana]
Length=825

 Score =  1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/653 (72%), Positives = 561/653 (86%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP +LEFSS+D+VWSKVEG+RDNIDRVALIPY RVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTSLEFSSADLVWSKVEGYRDNIDRVALIPYTRVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR++ + +YKPKVDGILEYILYWCSFGPDD+RKGG VRPSR+TYV KK +
Sbjct  61    CPTSFHVEARRRKSVEKNYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVRKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VALIIYN DKH D+KGLPCHGPQD++AAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALIIYNNDKHADEKGLPCHGPQDRQAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVR+ ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRKLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD IS+++WVESHQ+ +FF++ FSDSDPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDDISVNMWVESHQSQVFFFEGFSDSDPFTLGIQTEWQLQQMIRFGNCSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWI+APRF+  DT RWMRALYNRVH KDP+WKLA
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIMAPRFSGGDTYRWMRALYNRVHAKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IR+VFQC VL+ FWRVRHAW KN+ KRC+E E+RV I+++LG  +  
Sbjct  361   GFIVDDPFADVITIRDVFQCPVLLLFWRVRHAWQKNIFKRCAETEIRVEISRQLGHAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+     + FE F+ED VD+ +F++YFKA WYPR+G W+ AL++LPLASQETCAALEFY
Sbjct  421   ICRRQGTFSLFEDFLEDSVDSSDFMEYFKAVWYPRIGAWTTALQSLPLASQETCAALEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNER+  +Y+R DWLV KLGT VHSYFWLDEYSGK++FARYWK+EW+SGLT+
Sbjct  481   HFQLKCRLLNEREPDIYQRVDWLVHKLGTKVHSYFWLDEYSGKENFARYWKEEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV I  +SAK+ D+ D++  +++WNP S+  +C C+ A  G +CEH+ K 
Sbjct  541   FRKALSIPDSDVVITDKSAKITDENDRDKAYIVWNPGSQIGICTCSWAERGYMCEHIIKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
             +K+ R  GS   S S  QY Q LI +LHCPP DSL RD+++S+AV V+KQ+N+
Sbjct  601   MKFCRRNGSTVPSASFLQYCQTLIDLLHCPPRDSLFRDYSVSLAVSVEKQINT  653



>ref|XP_003607638.1| hypothetical protein MTR_4g080580 [Medicago truncatula]
Length=797

 Score =  1039 bits (2686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/696 (70%), Positives = 570/696 (82%), Gaps = 38/696 (5%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD ILSLPVQNP TLE SS ++VWSKVEGW D +DRVALIP+ARV+DFV+GES NKE
Sbjct  1     MARWDAILSLPVQNP-TLEISSDNLVWSKVEGWHDKLDRVALIPFARVNDFVKGESNNKE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+  T+ K KVDGILEYILYWCSFGPDDHRKGGVVRPSRT+Y PKKK+
Sbjct  60    CPTRFHVEARRRRSPSTTSKKKVDGILEYILYWCSFGPDDHRKGGVVRPSRTSYAPKKKN  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN DKHVDKKGLPCHGPQDKKAAGT A +AP
Sbjct  120   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTPAEFAP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGPCNRDDLLTHRYVRRQER IRRST
Sbjct  180   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPCNRDDLLTHRYVRRQEREIRRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADD++SIS+WVES Q+++FFY+DFSDSDPF+LGIQTEWQLQQMI+FGNRGLLASD+
Sbjct  240   YELDADDSVSISMWVESRQSNVFFYQDFSDSDPFILGIQTEWQLQQMIKFGNRGLLASDS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTN LKYP+HSL+VFNSD KAIPVAWII P+F+  D  RWMRAL+NRVH KDPTWKLA
Sbjct  300   RFGTNTLKYPVHSLLVFNSDKKAIPVAWIITPKFSCLDAHRWMRALHNRVHNKDPTWKLA  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+PAIR+VFQCSVLISFWRVRH WHKN+MK C E ++++ I++RLG ++ S
Sbjct  360   GFIVDDPQYDVPAIRDVFQCSVLISFWRVRHLWHKNIMK-CLETDMQIKISQRLGWIMDS  418

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGL----------------------  1843
             IC+     + FE F+EDF+D   F+DYFKATWYPR+ +                      
Sbjct  419   ICRRQGTMSLFEDFVEDFIDEFNFMDYFKATWYPRMEIIVCPEPVIVVFVFIALYALRKE  478

Query  1842  --------------WSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLV  1705
                           W++AL+  PLASQE+ AA+E YHNQLK+RLLNE+D+  Y+RADWLV
Sbjct  479   ENMSFHIKTGLYRAWADALKTFPLASQESWAAIELYHNQLKIRLLNEKDVDAYQRADWLV  538

Query  1704  DKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQ  1525
             DKLGT VHSYFWLDE S KD FARYWK+EW SGL +WRK+L+IPD +V ++   AKV D+
Sbjct  539   DKLGTKVHSYFWLDECSDKDGFARYWKNEWTSGLASWRKALKIPDTNVLMEDGRAKVKDE  598

Query  1524  GDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALI  1345
              D++  +++ NP S  ++CDC  A  GNLCEH+ K +   R RGS   S+S+ QY QAL 
Sbjct  599   DDQDKTYIVSNPGSMLSICDCCWAKDGNLCEHILKVLSVFRSRGSVLPSISLLQYHQALK  658

Query  1344  KMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESV  1237
              MLHCPP+DSLIRDHA+S+AV VQ+QLN+ + +ESV
Sbjct  659   SMLHCPPFDSLIRDHAVSLAVSVQRQLNTLLDKESV  694



>ref|XP_010692100.1| PREDICTED: uncharacterized protein LOC104905308 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692101.1| PREDICTED: uncharacterized protein LOC104905308 [Beta vulgaris 
subsp. vulgaris]
Length=864

 Score =  1037 bits (2682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/653 (73%), Positives = 555/653 (85%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQ+PPT+EFS+ DIVWSKVEGWRDNIDRVALIP+ARV+DF+RGES+NK+
Sbjct  1     MARWDEILSLPVQSPPTMEFSACDIVWSKVEGWRDNIDRVALIPFARVNDFIRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARR R A+ SYK KVDG+LEYILYWCSFGPDD RKGG+VRPSR TY+PKKKS
Sbjct  61    CPTGFHVEARRHRRAKASYKVKVDGVLEYILYWCSFGPDDLRKGGIVRPSRNTYIPKKKS  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLI  PSVALIIYNQDKHVDK GLPCHGPQDKKA GTRAMYAP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIVRPSVALIIYNQDKHVDKNGLPCHGPQDKKAVGTRAMYAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRV SLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHR+VRRQE+ +RR+ 
Sbjct  181   YISEDLRLRVHSLLYVGVSVETIMQRHNESVEKQGGPFNRDDLLTHRFVRRQEKRLRRTK  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELDADDA+S+ LWVESH   +FFYKDFS+S PF +GIQTEWQLQQMIRFGN GLLASD+
Sbjct  241   YELDADDAVSLRLWVESHPTCVFFYKDFSESGPFTIGIQTEWQLQQMIRFGNCGLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNK KYP+HSL+VFNS+NKAIPVAW+I+PRF+  D  +WMRAL+NRV TKDP WKLA
Sbjct  301   RFGTNKFKYPVHSLLVFNSENKAIPVAWVISPRFSGRDLYKWMRALHNRVLTKDPAWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDPLTDI A R+VF+CSVLIS WRVRHAWHK LM+RCS+ E+R+ I+KRLG+++  
Sbjct  361   GFIIDDPLTDINATRDVFECSVLISMWRVRHAWHKALMERCSQNEMRIQISKRLGQVVSE  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC G      F+ FM+D+VD  EFV+YFKA WYPR+G W+  L  LPLA+QET A +EFY
Sbjct  421   ICTGQGNVTLFDDFMKDYVDNSEFVEYFKAVWYPRIGSWATCLETLPLATQETSATIEFY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H Q+ +R+LNE+D SVY+R DWLVDKL T VHS+FWLDEY  K DFARYW+DEW+ GLT+
Sbjct  481   HRQMNVRVLNEKDSSVYQRVDWLVDKLATKVHSFFWLDEYPAKHDFARYWRDEWMDGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR SL+IPD DV ++G  AKV+D  D++  +V+ NP SEF++CDC  +  GNLCEHV K 
Sbjct  541   WRSSLEIPDSDVILEGPRAKVIDPQDRDKFYVVSNPGSEFSICDCTLSEGGNLCEHVCKV  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
                 R + S+  SVS++QY++ALIKML C  +DSLIRDHA+S+   +Q QLN+
Sbjct  601   SFVCRKKESSKPSVSLYQYKRALIKMLCCMSHDSLIRDHAVSLMASLQTQLNA  653



>ref|XP_009139573.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103863577 
[Brassica rapa]
Length=770

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/653 (72%), Positives = 552/653 (85%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+  + +YK KVDGILEYILYWCSFGPDD+RKGG VRP R+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKEKTYKAKVDGILEYILYWCSFGPDDNRKGGSVRPCRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VALIIYN DKHVD+KGLPCHGPQDKK+AGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALIIYNHDKHVDEKGLPCHGPQDKKSAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +S+S+WVESHQ+H+FFY+ FS+++PF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDDVSVSMWVESHQSHVFFYQGFSETEPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPR +S D  RWMRAL NRVH KDP W++A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRVSSGDAYRWMRALCNRVHAKDPLWRVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI  IR+VFQC VL SFWR+RHAWHKN++K+C + E RV I++ LG+ +  
Sbjct  361   GFIVDDPFADITTIRDVFQCPVLFSFWRIRHAWHKNIIKKCPDTETRVEISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  FE  ME FV++ EF++YF+A W PR+G W++AL+ LPLASQE CAA+E Y
Sbjct  421   ICRKQGTATLFEGLMEHFVNSPEFIEYFRAVWSPRIGAWTSALQTLPLASQEICAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H Q+K RLLNERD   Y+R DWLVDKLGT VHSYFWLDEY+GKDDFARYW++EW+SGLT+
Sbjct  481   HYQMKCRLLNERDSEAYQRTDWLVDKLGTKVHSYFWLDEYTGKDDFARYWREEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV I G SAKV D+ D N VHV+W+PSS F +C C+ A  G +C+H+ K 
Sbjct  541   FRKALSIPDSDVVISGMSAKVTDKCDANEVHVVWSPSSHFGVCSCSWAQKGYICQHMIKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +  R   +A  SVS+ QY QAL+ +LH PP DSL RD+A S+AV V+KQ+N+
Sbjct  601   AQVCRGNRTAKESVSLLQYYQALVDLLHLPPGDSLFRDYAASLAVSVEKQINA  653



>ref|XP_006414836.1| hypothetical protein EUTSA_v10024472mg [Eutrema salsugineum]
 gb|ESQ56289.1| hypothetical protein EUTSA_v10024472mg [Eutrema salsugineum]
Length=772

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/654 (74%), Positives = 558/654 (85%), Gaps = 1/654 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSK+EG+RDNIDR+ALIPYARVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSADLVWSKIEGYRDNIDRLALIPYARVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+     YKPKVDGILEYILYWCSFGPDD+RKGG VRPSR+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VAL+IYN DKHVD+KGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +SI++WVESH++H+FFY+ FS++DPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDDVSINMWVESHRSHVFFYEGFSETDPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDPL DI  IR+VFQC VL SFWRVRHAWHKN++KRC + E RV I++ LG+ +  
Sbjct  361   GFIVDDPLADIITIRDVFQCPVLFSFWRVRHAWHKNIIKRCPQTETRVEISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  FE F++DFV + EFVDYF+A W PR+G W++AL++LPLASQETCAA+E Y
Sbjct  421   ICRRQGTATLFEGFVDDFVGSPEFVDYFRAVWSPRIGAWTSALQSLPLASQETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNER   VY+RADWLVDKLGT VHSYFWLDEYSGKDDFARYWK+EW+SGLT+
Sbjct  481   HYQLKCRLLNERGFEVYQRADWLVDKLGTKVHSYFWLDEYSGKDDFARYWKEEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGD-KNMVHVIWNPSSEFALCDCNSANMGNLCEHVFK  1420
             +RK+L IPD DV I G SAK+ D+ D  N VHV+WNP S+F +C C+ A  G +C+H+ K
Sbjct  541   FRKALSIPDSDVVISGMSAKITDECDGGNEVHVVWNPGSQFGVCSCSWAEKGYICKHMIK  600

Query  1419  SIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
               +      +A  S S+ QY Q LI +LHCPP DSL RD+A+S+AV  +KQ+N+
Sbjct  601   LTQVSLGNRAARQSASLLQYYQTLIDLLHCPPRDSLFRDYAVSLAVSAEKQINA  654



>emb|CDY01179.1| BnaA04g06400D [Brassica napus]
Length=756

 Score =  1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/653 (72%), Positives = 552/653 (85%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+  + +YK KVDGILEYILYWCSFGPDD+RKGG VRP R+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKEKTYKAKVDGILEYILYWCSFGPDDNRKGGSVRPCRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VALIIYN DKHVD+KGLPCHGPQDKK+AGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALIIYNHDKHVDEKGLPCHGPQDKKSAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +S+S+WVESHQ+H+FFY+ FS+++PF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDDVSVSMWVESHQSHVFFYQGFSETEPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPR +S D  RWMRAL NRVH KDP W++A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRVSSGDAYRWMRALCNRVHAKDPLWRVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI  IR+VFQC VL SFWR+RHAWHKN++K+C + E RV I++ LG+ +  
Sbjct  361   GFIVDDPFADITTIRDVFQCPVLFSFWRIRHAWHKNIIKKCPDTETRVEISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  FE  ME FV++ EFV+YF+A W PR+G W++AL+ LPLASQE CAA+E Y
Sbjct  421   ICRKQGTATLFEGLMEHFVNSPEFVEYFRAVWSPRIGAWTSALQTLPLASQEICAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H Q+K RLLNERD   Y+R DWLVDKLGT VHSYFWLDEY+GKDDFARYW++EW+SGLT+
Sbjct  481   HYQMKCRLLNERDSEAYQRTDWLVDKLGTKVHSYFWLDEYTGKDDFARYWREEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV I G SAKV D+ D N VHV+W+PSS F +C C+ A  G +C+H+ K 
Sbjct  541   FRKALSIPDSDVVISGMSAKVTDKCDANEVHVVWSPSSHFGVCSCSWAQKGYICQHMIKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +  R   +A  SVS+ QY QAL+ +LH PP DSL RD+A S+AV V+KQ+N+
Sbjct  601   AQVCRGNRTAKESVSLLQYYQALVDLLHLPPGDSLFRDYAASLAVSVEKQINA  653



>ref|XP_009406639.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406640.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406641.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406642.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406643.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
Length=970

 Score =  1025 bits (2649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/659 (71%), Positives = 556/659 (84%), Gaps = 0/659 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEIL+LPVQNPPTLEFS++DIVWS+VEGWR+ +DR+ALIP++RV+DFVRGES NKE
Sbjct  1     MARWDEILTLPVQNPPTLEFSAADIVWSRVEGWREKMDRLALIPFSRVNDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  + +YKPKVDGILEYILYWCSFGPDDHRKGGVVRPSR     +K  
Sbjct  61    CPTRFHVEARRRRPPEMAYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRNYATKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGP DKKAAGTRAM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPLDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+++SLLYVGV VETIMQRH++ V++QGGPC+RDDLLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQIMSLLYVGVPVETIMQRHSQMVQKQGGPCSRDDLLTHRYVRRLERKIRRSA  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +SI LW+ESH++ IFFY++FSDSDPFVLGIQTEWQLQQMI FGNR ++ASD+
Sbjct  241   YELDPDDDVSIGLWIESHRDLIFFYENFSDSDPFVLGIQTEWQLQQMIHFGNRSIIASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGT KLKYPIHSL+VF+S+  AIPVAW+I P FAS +T +WM ALY+RVH+KDPTW+L 
Sbjct  301   RFGTYKLKYPIHSLLVFDSNKNAIPVAWVITPNFASRETHKWMGALYDRVHSKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+ +IREVF+CSVLIS WRV HA  KNLMK+C E E+   +++ LGE + S
Sbjct  361   GFIVDDPSADVLSIREVFRCSVLISLWRVLHALRKNLMKKCPEREMHAMMSRGLGEAVSS  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             ICKG    N FEAF+EDFVD  +F+DYF ATW PR G W++A+++L +AS E   A+E Y
Sbjct  421   ICKGHGDMNLFEAFLEDFVDCSDFLDYFMATWLPRFGAWTDAVKSLLVASSEVSTAIESY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLKLRLLNE D +VY+RADWLVDKLGT VHSY+WLDEYS KD+FARYW+DEW  G T+
Sbjct  481   HQQLKLRLLNENDSNVYQRADWLVDKLGTKVHSYYWLDEYSEKDNFARYWRDEWRCGFTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             WR+++QIPD DV IDG  AKVV+Q ++N VHV+ NP S+FA+CDC+ + MGNLCEHV KS
Sbjct  541   WRQAIQIPDSDVAIDGTCAKVVNQKERNKVHVVSNPGSDFAICDCHWSRMGNLCEHVIKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQES  1240
              K  RDRG A SS S+ Q+ + L  + +CPP+DS+IRDHA+++AV VQ QL + +  ES
Sbjct  601   TKVYRDRGLAASSTSLIQFNRMLTSIFNCPPHDSVIRDHAIALAVSVQTQLKTLVDLES  659



>ref|XP_002868324.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44583.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =  1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/653 (73%), Positives = 554/653 (85%), Gaps = 1/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+     YKPKVDGILEYILYWCSFGPDD+RKGG VRPSR+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VAL+IYN DKHVD+KGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRV SLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRS+
Sbjct  181   YISEDLRLRVSSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRSS  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YEL+ DD ISIS+WVESHQ+H+FF++ FSD+DPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELNEDDDISISMWVESHQSHVFFFEGFSDTDPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTN LKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+A
Sbjct  301   RFGTNTLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI  IR+VFQC VL SFWRVRHAWHKN++KRC E E RV I++ LG+ +  
Sbjct  361   GFIVDDPFADIITIRDVFQCPVLFSFWRVRHAWHKNIIKRCPETETRVDISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  F+ F EDFV + EFV+YF++ W PR+G W++AL++LPLASQETCAA+E Y
Sbjct  421   ICRRQGTATLFDTFAEDFVGSPEFVEYFRSVWSPRIGAWTSALQSLPLASQETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FARYWKDEW+SGLT+
Sbjct  481   HYQLKCRLLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFARYWKDEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV I G SAK+ D+ D N +HV WNP S+F +C C+ A  G LC+H+ K 
Sbjct  541   FRKALSIPDSDVVISGMSAKITDECDGNEIHV-WNPGSQFGVCSCSWAEKGYLCKHMIKL  599

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +      +A  S S+ QY Q LI +LHCPP+DSL RD+A+S+AV V+KQ+N+
Sbjct  600   TQLCLGNRAARQSASLLQYYQTLIDLLHCPPHDSLFRDYAISLAVSVEKQINA  652



>ref|XP_010450122.1| PREDICTED: uncharacterized protein LOC104732283 [Camelina sativa]
Length=777

 Score =  1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/653 (73%), Positives = 553/653 (85%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES N +
Sbjct  1     MARWDQIFSLPVQNPALPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESLNTD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+     YKPKVDGILEYILYWCSFGPDD+R GG VRPSR+TYVPKK  
Sbjct  61    CPTSFHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRTGGAVRPSRSTYVPKKNK  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VAL+IYN DKHVD+KGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +SIS+WVESHQ+H+FF++ FSD+DPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDDVSISIWVESHQSHVFFFEGFSDTDPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI  IR+VFQC VL+SFWRVRHAWHKN+ KRC E E RV I+K LGE +  
Sbjct  361   GFIVDDPFADIITIRDVFQCPVLLSFWRVRHAWHKNIFKRCPETETRVEISKHLGEAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  F++F+EDFV + EFV+YF+A W PR+G W++AL++LPLASQETCAA+E Y
Sbjct  421   ICRRQGTAIVFDSFVEDFVGSPEFVEYFRAVWSPRIGAWTSALQSLPLASQETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FARYWK+EW+SGLT+
Sbjct  481   HYQLKCRLLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFARYWKEEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV + G SAK+ D+ + N +HV+WNP S+F +C C+ A  G +C+H+ K 
Sbjct  541   FRKALSIPDSDVVMSGISAKITDECEGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMVKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +       +  S S+ QY Q LI +LHCPP DSL RD+A+S+AV V+KQ+N+
Sbjct  601   TQLSLGNRVSRQSASLLQYYQTLIDLLHCPPRDSLFRDYAVSLAVSVEKQINA  653



>emb|CDY50427.1| BnaCnng19360D [Brassica napus]
Length=760

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/653 (72%), Positives = 548/653 (84%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+  + +YK KVDGILEYILYWCSFGPDD+RKGG VRP R+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKEKTYKAKVDGILEYILYWCSFGPDDNRKGGSVRPCRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VALIIYN DKHVD+KGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALIIYNHDKHVDEKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD +S+S+WVESHQ+H+FFY+ FSD++PF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   FELDEDDDVSVSMWVESHQSHVFFYQGFSDAEPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPR +S D  RWMRAL NRVH KDP WK+A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRVSSGDAYRWMRALCNRVHAKDPLWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF+VDDP  DI  IR+VFQC VL SFWR+RHAWHKN++KRC + E RV I++ LG+ +  
Sbjct  361   GFVVDDPFADITTIRDVFQCPVLFSFWRIRHAWHKNIIKRCQDTETRVEISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             +C+    A  FE  ME F ++ EFV+YF+A W PR+G W++AL+ LPLASQE CAA+E Y
Sbjct  421   VCRKQGTATLFEGLMEHFGNSPEFVEYFRAVWSPRIGAWTSALQTLPLASQEICAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H Q+K RLLNERD   Y+R DWLVDKLGT VHSYFWLDEYSGKDDFARYW++EW+SGLT+
Sbjct  481   HYQMKCRLLNERDSEAYQRTDWLVDKLGTKVHSYFWLDEYSGKDDFARYWREEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+  IPD  V I G SAKV D+ D N VHV+W+PSS F +C C+ A  G +C+H+ K 
Sbjct  541   FRKASSIPDSHVVISGMSAKVTDKCDVNEVHVVWSPSSHFGVCSCSWAQKGYICQHMIKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +  R   +A  S S+ QY QAL+ +LH PP DSL RD+A S+AV V+KQ+N+
Sbjct  601   AQVCRGNRTAKESASLLQYYQALVDLLHLPPGDSLFRDYAASLAVSVEKQINA  653



>ref|NP_193133.3| zinc ion binding protein [Arabidopsis thaliana]
 gb|AEE83354.1| zinc ion binding protein [Arabidopsis thaliana]
Length=778

 Score =  1019 bits (2635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/653 (72%), Positives = 554/653 (85%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGE +NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSTDLVWSKVEGYRDNIDRLALIPYTRVDDFVRGECSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+     YKPKVDGILEYILYWCSFGPDD+RKGG VRPSR+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGTVRPSRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VAL+IYN DKHVD+KG PCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGFPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRV SLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVSSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD +SIS+WVESHQ+H+FF++ FSD+DPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELDEDDDVSISMWVESHQSHVFFFEGFSDTDPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTN LKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+A
Sbjct  301   RFGTNTLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI AIR+VFQC VL SFWR+RHAWHKN++KRC E + RV I++ LG+ +  
Sbjct  361   GFIVDDPFADIIAIRDVFQCPVLFSFWRLRHAWHKNIIKRCRETKTRVEISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I +    A  F++F+EDFV + EFV+YF++ W PR+G W++AL++LPLASQETCAA+E Y
Sbjct  421   ISRRQGTATLFDSFVEDFVGSPEFVEYFRSVWSPRIGAWTSALQSLPLASQETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FARYWK+EW+SGLT+
Sbjct  481   HYQLKCRLLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFARYWKEEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV I G SAK+ D+ D N +HV+WNP S+F +C C+ A  G +C+H+ K 
Sbjct  541   FRKALSIPDSDVVISGMSAKITDECDGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMIKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +      +A  S S+ QY Q LI +L CPP+DSL RD+A+S+AV V+KQ+N+
Sbjct  601   TQLCLGNRAARQSASLLQYYQTLIDLLRCPPHDSLFRDYAVSLAVSVEKQINA  653



>ref|XP_010450143.1| PREDICTED: uncharacterized protein LOC104732307 [Camelina sativa]
Length=777

 Score =  1016 bits (2628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/653 (73%), Positives = 552/653 (85%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES N +
Sbjct  1     MARWDQIFSLPVQNPALPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESLNTD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+     YKPKVDGILEYILYWCSFGPDD+R GG VRPSR+TYV KK +
Sbjct  61    CPTSFHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRTGGAVRPSRSTYVAKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VAL+IYN DKHVD+KGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YEL+ DD +SIS+WVESHQ+H+FF++  SD+DPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELNEDDDVSISMWVESHQSHVFFFEGISDTDPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  DI  IR+VFQC VL+SFWRVRHAWHKN+ KRC E E RV I++ LGE +  
Sbjct  361   GFIVDDPFADIITIRDVFQCPVLLSFWRVRHAWHKNIFKRCPETETRVEISRHLGEAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  F++F+EDFV + EFV+YF+A W PR+G W++AL +LPLASQETCAA+E Y
Sbjct  421   ICRRQGTAILFDSFVEDFVGSPEFVEYFRAVWSPRIGAWTSALLSLPLASQETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FARYWK+EW+SGLT+
Sbjct  481   HYQLKCRLLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFARYWKEEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK+L IPD DV + G SAK+ D+ + N +HV+WNP S+F +C C+ A  G +C+H+ K 
Sbjct  541   FRKALSIPDSDVVMSGMSAKIRDECEGNEIHVVWNPGSQFGVCSCSWAEKGYICKHMIKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +      ++  S S+ QY Q LI +LHCPP DSL RD+A+S+AV V+KQ+N+
Sbjct  601   TQQCLGNRASRQSASLLQYYQTLINLLHCPPRDSLFRDYAVSLAVSVEKQINA  653



>ref|XP_006283161.1| hypothetical protein CARUB_v10004191mg [Capsella rubella]
 gb|EOA16059.1| hypothetical protein CARUB_v10004191mg [Capsella rubella]
Length=777

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/655 (72%), Positives = 553/655 (84%), Gaps = 0/655 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWD+I SLPVQNP   EFSS+D+VWSKVEG+RDNIDR+ALIPY RVDDFVRGES+NK+
Sbjct  1     MARWDQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT FHVEARRR+     YKPKVDGILEYILYWCSFGPDD+RKGG VRPSR+TYVPKK +
Sbjct  61    CPTSFHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVPKKNN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPN+KRGC CHFIVKRLIAEP+VAL+IYN DKHVD+KGLPCHGPQDKKAAGTRAM+AP
Sbjct  121   AGRPNSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVEKQGGPTNRDDLLTHRYVRRLERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YEL+ DD +S S+WVE+HQ+ +FF++ FSD+DPF LGIQTEWQLQQMIRFGN  LLASD+
Sbjct  241   YELNEDDDVSTSMWVENHQSQVFFFEGFSDTDPFSLGIQTEWQLQQMIRFGNCRLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+A
Sbjct  301   RFGTNKLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVDDP  D+  IR+VFQC VL SFWRVRHAW KN+ KRC E E RV I++ LG+ +  
Sbjct  361   GFIVDDPFADVTTIRDVFQCPVLFSFWRVRHAWQKNIFKRCPETETRVEISRHLGQAVDK  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+    A  F++F+ DFV + EFV+YF+A W PR+G W++AL++LPLASQETCAA+E Y
Sbjct  421   ICRRQGTATLFDSFVGDFVGSPEFVEYFRAVWSPRIGAWTSALQSLPLASQETCAAMELY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H QLK RLLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FARYWK+EW+SGLT+
Sbjct  481   HYQLKCRLLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFARYWKEEWVSGLTS  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             +RK++ IPD DV + G SAK+ D+ + N +HV+WNP S+F +C C+ A  G +C+H+ K 
Sbjct  541   FRKAMSIPDSDVVLSGMSAKITDECEGNKIHVVWNPGSQFGVCSCSWAEKGYICKHMIKL  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
              +      ++  S S+ QY Q LI +L CPP DSL RD+A+S+AV V+KQ+N+ +
Sbjct  601   TQQCLGNRASMQSASLLQYYQTLIDLLRCPPRDSLFRDYAISLAVSVEKQINAPV  655



>ref|XP_007052247.1| Zinc ion binding protein isoform 2 [Theobroma cacao]
 gb|EOX96404.1| Zinc ion binding protein isoform 2 [Theobroma cacao]
Length=973

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/760 (64%), Positives = 582/760 (77%), Gaps = 29/760 (4%)
 Frame = -3

Query  2943  YWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYN  2764
             YWCSFGPDDHRKGG+VRPSR TY+PKK +AGRPNTKRGCTCHFIVKRLIAEP+VALIIYN
Sbjct  35    YWCSFGPDDHRKGGIVRPSRNTYIPKKTNAGRPNTKRGCTCHFIVKRLIAEPTVALIIYN  94

Query  2763  QDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESV  2584
             Q+KHVDKKGLPCHGPQDKKAAGTRAM+APYISEDLRLRVLSLLYVGVSVETIMQRHNESV
Sbjct  95    QEKHVDKKGLPCHGPQDKKAAGTRAMFAPYISEDLRLRVLSLLYVGVSVETIMQRHNESV  154

Query  2583  ERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDS  2404
             E+QGGP NRDDLLTHRYVRRQERSIRRSTYELDADDA+S+++WVESHQNH+FFY+DF+DS
Sbjct  155   EKQGGPYNRDDLLTHRYVRRQERSIRRSTYELDADDAVSVNMWVESHQNHVFFYEDFTDS  214

Query  2403  DPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIA  2224
             DPF LGIQTEWQLQQMIRFGN  L+ASD+RFGTNKLKYP+HSL+VFNSD KAIPVAWII 
Sbjct  215   DPFTLGIQTEWQLQQMIRFGNCSLIASDSRFGTNKLKYPVHSLIVFNSDKKAIPVAWIIT  274

Query  2223  PRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRH  2044
             PRFAS D  RWMRALYNRV TKDPTWKLAGFIVDDP  D+  IR+VF+CSVLISFWRVRH
Sbjct  275   PRFASVDAHRWMRALYNRVRTKDPTWKLAGFIVDDPSVDVLTIRDVFECSVLISFWRVRH  334

Query  2043  AWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKAT  1864
             AWHKNL+KRCSE E+RV I++RLG     I + C   + FE FMEDFVD ++F+DYFKA 
Sbjct  335   AWHKNLLKRCSETEMRVEISRRLGMAFDDISRRCGNVDLFEKFMEDFVDCLDFMDYFKAI  394

Query  1863  WYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTV  1684
             WYPR+G W +AL  LPLAS ETCAA+EFYHNQLKLRLLNE+D SVY+R DWLV+KLGT V
Sbjct  395   WYPRIGAWISALGTLPLASLETCAAMEFYHNQLKLRLLNEKDPSVYQRTDWLVNKLGTKV  454

Query  1683  HSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVH  1504
             HSYFWLDEYSGKDDFARYWKDEW+SGLT+WRK+L+IPD DV I+G+ AKV DQ D++ V+
Sbjct  455   HSYFWLDEYSGKDDFARYWKDEWMSGLTSWRKALKIPDSDVAIEGQCAKVTDQLDRDRVY  514

Query  1503  VIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPP  1324
             V+WNP S++ +CDC  A MG LCEHVFK IK   ++GS   SVS+FQY +ALI MLHCPP
Sbjct  515   VVWNPGSQYGICDCTWAEMGYLCEHVFKVIKVFHEKGSILPSVSLFQYNKALIDMLHCPP  574

Query  1323  YDSLIRDHALSVAVWVQKQLNSQI------GQESVQVVGPTTTYGGQCGDTVngskgnst  1162
             +DSLIRDHA+S+A++VQKQLNS +       ++S Q    T     Q    V+     + 
Sbjct  575   HDSLIRDHAVSLAIYVQKQLNSLVDPIQKQAKDSSQDASATVVSAKQNRGLVDEGPCVNG  634

Query  1161  sscngsgsNKLHHSGF----------TKNQLCHSVDHIVARNGICTNSSHNIAVEIPCLE  1012
                +       H +G+            +    SVD +V  NGIC  ++      I   E
Sbjct  635   IISSN------HENGYADCSEAPVSIASDLGSESVDGLVGINGICGKAA---GEGISGSE  685

Query  1011  IGASPYSMCRSEPQLFSIDEVTSTDMLAENGRV-LIDTGPDITENLPCTDMSFSNLNDF-  838
             +   P S C S P+L S++EV + ++ +E+G   LI+  P++   +P  D +  + +   
Sbjct  686   MDVDPPS-CISPPELPSLNEVVAGNVFSEHGDSDLINNVPNMKSKVPPKDNALRDESGCE  744

Query  837   DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQNG  718
             +++ NKN   + M AE Q   I   T + L   + + Q+G
Sbjct  745   EDIFNKNCHESVMAAELQPDEIP-QTRQLLKPCTATHQDG  783



>ref|XP_002301246.2| hypothetical protein POPTR_0002s14170g [Populus trichocarpa]
 gb|EEE80519.2| hypothetical protein POPTR_0002s14170g [Populus trichocarpa]
Length=873

 Score =   981 bits (2535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/616 (75%), Positives = 523/616 (85%), Gaps = 31/616 (5%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILS+PVQNPPTLEFS+SDIVWSKV GWRDN+DR+ALIP+ARVDDFVRGE ANK+
Sbjct  1     MARWDEILSIPVQNPPTLEFSASDIVWSKVGGWRDNLDRLALIPFARVDDFVRGEPANKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR  QTSYK KVDGILEYILYWCSFGPDDHRKGG+VRPSRTTYVPKKK+
Sbjct  61    CPTRFHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRG TCHFIVKRLI+EPSVALIIYNQDKHVDKKGLPCHGPQDKKA GT AM+AP
Sbjct  121   AGRPNTKRGYTCHFIVKRLISEPSVALIIYNQDKHVDKKGLPCHGPQDKKAEGTHAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQE+SIR ST
Sbjct  181   YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQEKSIRCST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DDA+SI++WVESH N +FF++DFSDS+PF LGIQTEWQLQQMIRFGNR L+ASD+
Sbjct  241   FELDTDDAVSINMWVESHLNQVFFFEDFSDSEPFTLGIQTEWQLQQMIRFGNRSLVASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             RFGTNKLKYP+HSLVVFNSDNKAIPVAWII PRFA+ D  R MRALYNRV TKDP+WKLA
Sbjct  301   RFGTNKLKYPVHSLVVFNSDNKAIPVAWIITPRFANADAHRRMRALYNRVRTKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFIVD PLTDI  IR+VFQCSVL SFWRVRHAW KN +KRC E E+RV I+K LG+ ++ 
Sbjct  361   GFIVDHPLTDILTIRDVFQCSVLTSFWRVRHAWLKNRIKRCMETELRVQISKWLGQTVYD  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G                        +AT    +G W+ A++ LPLASQ TCAA+EFY
Sbjct  421   ICRG------------------------QAT----VGSWTTAIKTLPLASQGTCAAMEFY  452

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             HNQLK+RLLNE+   VY+RADWLVDKLGT VHSYFWLDEYS KDDFARYWKDEW+SGLT+
Sbjct  453   HNQLKVRLLNEKKPGVYQRADWLVDKLGTKVHSYFWLDEYSEKDDFARYWKDEWVSGLTS  512

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC---EHV  1426
             WRK+L+IPD DV +DG  AKV DQ  ++ V+V+WNP S+FA+CDC  A MGNLC      
Sbjct  513   WRKALKIPDSDVVMDGRCAKVTDQLYRDRVYVVWNPGSQFAICDCRWAEMGNLCTTWRKA  572

Query  1425  FKSIKYLRDRGSATSS  1378
               S++ L  RG+ +S+
Sbjct  573   VNSLEQLVVRGTNSSN  588



>ref|XP_003566605.1| PREDICTED: uncharacterized protein LOC100828484 [Brachypodium 
distachyon]
Length=896

 Score =   964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/656 (66%), Positives = 529/656 (81%), Gaps = 0/656 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M RWDEIL+LPVQNP TLEFS+++I WS VEGW+D++DR+ALIP++RV+DFVRGES NK 
Sbjct  1     MTRWDEILTLPVQNPTTLEFSAAEITWSMVEGWKDSMDRLALIPFSRVNDFVRGESNNKV  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR    + KPKVDGILEYILYWCSFGPDD+RK G VRPSR++   +K  
Sbjct  61    CPTRFHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKNGAVRPSRSSCGKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPS+AL+IYN +KHVDKKG PCHGP DK A GT+AM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIAEPSLALVIYNHNKHVDKKGTPCHGPMDKMAIGTKAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++L L V+SLL+VG+ VETIMQRHNE VERQGGP NRDDLLTHRYVRR ER IRRS 
Sbjct  181   YISDELHLEVMSLLHVGIPVETIMQRHNEMVERQGGPSNRDDLLTHRYVRRLERKIRRSV  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+SI++W+E+HQ + FFY+DFSD D FVLGIQT+WQLQQMI++GNR LLASD+
Sbjct  241   YELDDDDAVSINMWIENHQEYTFFYEDFSDKDAFVLGIQTDWQLQQMIQYGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HS++VF+    AIPVAWII P F   +  RWM ALY+RV +KDPTW+L 
Sbjct  301   KFGTNKLKYPVHSILVFDQQKNAIPVAWIITPSFTHGEIYRWMGALYDRVRSKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDPLTD+  IREVFQC VLI+ WRVRHAWHKNLM +CS+ E R  +AKRLGE+I S
Sbjct  361   GFIIDDPLTDVRTIREVFQCPVLITLWRVRHAWHKNLMNKCSDFEKRSMLAKRLGEVISS  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC G      F+AF+EDFVD   F+DYFKA W+PRLG W+  L+A PLA+ E  +A+E Y
Sbjct  421   ICGGNGDMELFQAFLEDFVDCSGFLDYFKAIWFPRLGAWTTVLKATPLATAEVASAIESY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
              + LKLRLLNE D S+Y+RADWLV KLGTTVHSY+WLDE+SGKD F+RYW+ EW +G   
Sbjct  481   RHLLKLRLLNEADESIYQRADWLVHKLGTTVHSYYWLDEFSGKDSFSRYWRSEWKNGPNQ  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W++ +QIPD D+ I+G  A+V+ Q DK   H I NP SE ALCDC+ +  GNLC+H  KS
Sbjct  541   WQQGMQIPDSDIVIEGNCARVICQKDKEKSHAILNPGSELALCDCSWSRKGNLCKHAMKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIG  1249
              K  RDRG A  S+++ +Y QAL  ++HCPP DS++ DHA++VAV V+ QL++  G
Sbjct  601   AKVCRDRGLAPPSLALLRYYQALANVVHCPPSDSVVSDHAIAVAVSVRTQLDALFG  656



>ref|NP_001059218.1| Os07g0227700 [Oryza sativa Japonica Group]
 dbj|BAF21132.1| Os07g0227700 [Oryza sativa Japonica Group]
 gb|EEE66828.1| hypothetical protein OsJ_23599 [Oryza sativa Japonica Group]
Length=835

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/653 (67%), Positives = 531/653 (81%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEIL+LPVQNPPT EFS+SDI+WS+VEGW+D++DR+ALIP++RV+DFVRGES NKE
Sbjct  1     MARWDEILTLPVQNPPTPEFSASDIMWSRVEGWKDSMDRLALIPFSRVNDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR    + KPKVDGILEYILYWCSFGPDD+RKGG VRPSR +   +K  
Sbjct  61    CPTRFHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGSVRPSRNSSTKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRP+TKRGC CHFIVKRLIAEPSVAL+IYN DKHVDK G PCHGP D  A GT+AM+AP
Sbjct  121   AGRPHTKRGCICHFIVKRLIAEPSVALVIYNHDKHVDKIGKPCHGPMDNMAIGTKAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+++SLL VG+ VETIMQRH E +E+QGGP NRD LLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQIMSLLCVGIPVETIMQRHTEMIEKQGGPSNRDGLLTHRYVRRLERKIRRSV  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDAISI++WVE+HQNHIF Y+DFSD D F++GIQT+WQLQQMI++GNR LLASD+
Sbjct  241   YELDDDDAISINIWVENHQNHIFLYEDFSDKDTFIVGIQTDWQLQQMIQYGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HSL+VF+    AIPVAWII P F+  +  RWM ALY+RV TKDPTW+L 
Sbjct  301   KFGTNKLKYPVHSLLVFDKQKNAIPVAWIITPNFSHGEAYRWMGALYDRVRTKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDP  D+  IREVFQC VLIS WR+RHAWHKNLMK+C ++E R  +AKRLGE+I +
Sbjct  361   GFIIDDPFADVRTIREVFQCPVLISPWRIRHAWHKNLMKKCPDIEKRPMMAKRLGELICN  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G      FEAF+EDFVD   F+DYF+A W+PRLG W   LR  PLA+ E  +A+E Y
Sbjct  421   ICRGNGGMELFEAFLEDFVDCAGFLDYFRALWFPRLGSWITMLRTTPLATTEVASAIESY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE +  VY+RADWLV KLGT VHSY+WLDEYSGKD+F+RYW+ EW SG   
Sbjct  481   HHLLKLRLLNEANERVYQRADWLVHKLGTKVHSYYWLDEYSGKDNFSRYWRSEWKSGPNP  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W++ LQIPD DV ++G  A+VV Q +K   HVI NP S+ ALCDC+ +  GN+C+H  KS
Sbjct  541   WQQGLQIPDSDVVVEGNCARVVCQKNKERSHVIVNPGSDLALCDCSWSRKGNICKHAIKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              K  R RG A  S+++F+Y QAL  ++HCPP D+LI DHA++VA++V+ QL+S
Sbjct  601   TKVFRQRGLAPPSLALFRYYQALANVVHCPPSDTLISDHAVAVAIFVRTQLDS  653



>ref|XP_008670947.1| PREDICTED: uncharacterized protein LOC103648233 [Zea mays]
Length=828

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/653 (67%), Positives = 527/653 (81%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M RWDEIL+LPVQNPP+LEFS++DI WS VEGWRD++DR+ALIPY+RV+DFVRGES NK+
Sbjct  1     MTRWDEILTLPVQNPPSLEFSAADISWSMVEGWRDSMDRLALIPYSRVNDFVRGESNNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP++FHVEARRRR    + KPKVDGILEYILYWCSFGPDD+RKGG VRPSR     +K  
Sbjct  61    CPSRFHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGNVRPSRPIAEKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLI EPSVAL+IYN +KHVDKKG+PCHG  DK A GT+AM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIVEPSVALVIYNHNKHVDKKGMPCHGSMDKMAVGTKAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+V+SLLYVG+ VETIMQRH E VE+QGGP NRDDLLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQVMSLLYVGIPVETIMQRHTEMVEKQGGPSNRDDLLTHRYVRRLERKIRRSV  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDAISI LWVE++Q+ +FFY+DFSD+D FVLGIQT+WQLQQMI+FG+  L+ASD+
Sbjct  241   YELDDDDAISIGLWVENNQDCVFFYEDFSDTDTFVLGIQTDWQLQQMIQFGSHSLMASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HS++VF+    AIPVAWII P FA  +  +W+ ALY+R HTKDPTW+L 
Sbjct  301   KFGTNKLKYPVHSILVFDQHKNAIPVAWIITPNFAHGEIYKWVGALYDRAHTKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+D PLTD+  IREVF C VLIS WR+RHAWHKNL+ +CS++E R T+AKRLG+ I  
Sbjct  361   GFIIDGPLTDVRTIREVFHCPVLISLWRIRHAWHKNLVNKCSDIEKRSTMAKRLGDAISI  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G      FEAF++DFV+   F+DYFKA W PRLG W   L+A  LAS +  +A+E Y
Sbjct  421   ICRGTGDVELFEAFLQDFVECAGFLDYFKAVWLPRLGAWITVLKATALASAQVASAIESY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE D SVY RADWLVDKLGT VHSY+WLDE+SGK+ F+RYW+ EW SG   
Sbjct  481   HHLLKLRLLNEADESVYWRADWLVDKLGTKVHSYYWLDEFSGKNSFSRYWRSEWSSGPNP  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W + +QIPD DV I+G  A VV Q +K   HV+ NP SEFALCDC+ +  GNLC+HV KS
Sbjct  541   WCQGMQIPDSDVVIEGNYASVVSQKNKEKSHVVLNPGSEFALCDCSWSMKGNLCKHVIKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              K  RDRG A  S++MF Y QAL  ++HCPP D+LI DHA+++AV V+ QL++
Sbjct  601   AKVCRDRGLALPSLAMFHYYQALANLVHCPPSDTLISDHAMALAVSVKTQLDA  653



>ref|XP_002461610.1| hypothetical protein SORBIDRAFT_02g005340 [Sorghum bicolor]
 gb|EER98131.1| hypothetical protein SORBIDRAFT_02g005340 [Sorghum bicolor]
Length=831

 Score =   956 bits (2470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/653 (66%), Positives = 525/653 (80%), Gaps = 0/653 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M RWDEIL+LPVQNPP+LEFS++DI WS VEGW+D++DR+ALIPY+RV+DFVRGES NK+
Sbjct  1     MTRWDEILTLPVQNPPSLEFSAADISWSMVEGWKDSMDRLALIPYSRVNDFVRGESNNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR    + KPKVDGILEYILYWCSFGPDD+RKGG VRPSR     +K  
Sbjct  61    CPTRFHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGNVRPSRPISEKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLI EPSVAL+IYN +KHVDKKG+PCHG  DK A GT+AM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIVEPSVALVIYNHNKHVDKKGMPCHGSMDKMAVGTKAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+V+SLLYVG+ VETIMQRH E VE+QGGP NRDDLLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQVMSLLYVGIPVETIMQRHTEMVEKQGGPSNRDDLLTHRYVRRLERKIRRSV  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD ISI LWVE++Q+H+FFY+DFSD+D FVLGIQT+WQLQQMI+FG+  L+ASD+
Sbjct  241   YELDDDDTISIDLWVENNQDHVFFYEDFSDTDTFVLGIQTDWQLQQMIQFGSHSLMASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HS++VF+    AIPVAWI+ P FA  +  +WM ALY+R HTKDPTW+L 
Sbjct  301   KFGTNKLKYPVHSILVFDQHKNAIPVAWIMTPNFAHGEIHKWMGALYDRAHTKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDPL D+  IREVF C VLIS WR+RHAWHKNL+ +CS++E R  +AKRLG+ I S
Sbjct  361   GFIIDDPLADVRTIREVFHCPVLISLWRIRHAWHKNLVNKCSDIEKRSAMAKRLGDAISS  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G      FE F++DFVD   F+DYF+A W PRLG W   L+ + LA+ +  +A+E Y
Sbjct  421   ICRGNGDVELFEGFLQDFVDCAGFLDYFEARWLPRLGAWITVLKTISLATAQVASAIESY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE D SVY RADWLV KLGT VHSY+WLDE+SGK+ F+RYWK EW SG   
Sbjct  481   HHLLKLRLLNEADKSVYWRADWLVHKLGTKVHSYYWLDEFSGKNSFSRYWKSEWSSGPNP  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W + +QIPD DV I+G  A VV Q +K   HV+ NP SEFALCDC+ +  GN+C+HV KS
Sbjct  541   WCQGMQIPDSDVVIEGNYASVVSQKNKENSHVVLNPGSEFALCDCSWSRKGNICKHVVKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              K  RDRG A  S++MF Y QAL  ++HCPP D+LI DHA++VAV V+ QL++
Sbjct  601   AKVCRDRGLALPSLAMFHYYQALANLVHCPPSDTLISDHAMAVAVSVKTQLDA  653



>dbj|BAK03605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/674 (64%), Positives = 534/674 (79%), Gaps = 6/674 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M RWDEIL+LPVQNP  LEFS++DI WS VEGW+D++DR+ALIP++RV DFVRGES +KE
Sbjct  1     MTRWDEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNSKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+   + KPKVDGILEYILYWCSFGPDD+R GG VRPSR++Y  +K  
Sbjct  61    CPTRFHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRMGGAVRPSRSSYGKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPS+AL+IYN +KH+DKKG PCHGP DK A GT+AM+AP
Sbjct  121   AGRPNTKRGCVCHFIVKRLIAEPSLALVIYNHNKHIDKKGTPCHGPMDKMAVGTKAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++L L V+SLLYVG+ VETIMQRH E VE+QGGP NRDDLLTHRYVRR ER +RRS 
Sbjct  181   YISDELLLEVMSLLYVGIPVETIMQRHTEMVEKQGGPSNRDDLLTHRYVRRLERKMRRSV  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+S++ WVE++Q+ +F ++DFSD+D FVLGIQT+WQLQQMI++GNR LLASD+
Sbjct  241   YELDDDDAVSMNRWVENNQDCVFLFEDFSDNDTFVLGIQTDWQLQQMIQYGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HS++VF+    AIPVAWII+P F   +  RWM ALY+RV TKDPTW+L 
Sbjct  301   KFGTNKLKYPVHSILVFDQQKNAIPVAWIISPNFTHGEIHRWMGALYDRVRTKDPTWQLG  360

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDPLTD+  IREVF C VLIS WRVRHAWHK LM +CS+ E R  ++KRLGE I S
Sbjct  361   GFIIDDPLTDVRTIREVFLCPVLISLWRVRHAWHKKLMNKCSDFERRSVMSKRLGEAISS  420

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G      F+AF+EDF+D   FVDYFKA W+PRLG W++ L+  PLA+ E  +A+E Y
Sbjct  421   ICRGNGDIELFQAFLEDFIDCSGFVDYFKALWFPRLGAWTSVLKTNPLATAEVASAIERY  480

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE D S+Y+RADWLV KLGT VHSY+WLDE+SGKD F+RYWK EW +G   
Sbjct  481   HHLLKLRLLNEADESIYQRADWLVHKLGTKVHSYYWLDEFSGKDSFSRYWKSEWKTGPNP  540

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W++ LQIPD D+ I+G  A+VV Q  K   H + NP SE ALCDC+ +  GNLC+H  KS
Sbjct  541   WQQGLQIPDSDIVIEGNCARVVCQKHKEKSHAVLNPGSELALCDCSWSRKGNLCKHAMKS  600

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ---  1246
              K  RDRG A  S+++ +Y QAL  ++HCPP DS+I DHA++VAV  + QL++ +     
Sbjct  601   AKVCRDRGLAPPSLALLRYYQALANVVHCPPSDSVICDHAIAVAVSTRTQLDALLAAPNG  660

Query  1245  ---ESVQVVGPTTT  1213
                +++ + GP +T
Sbjct  661   SSPDTLLLKGPQST  674



>gb|EMS58193.1| hypothetical protein TRIUR3_12822 [Triticum urartu]
Length=869

 Score =   938 bits (2425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/674 (64%), Positives = 526/674 (78%), Gaps = 19/674 (3%)
 Frame = -3

Query  3222  IQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESAN  3043
             +QM RWDEIL+LPVQNP  LEFS++DI WS VEGW+D++DR+ALIP++RV DFVRGES N
Sbjct  5     LQMTRWDEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNN  64

Query  3042  KECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKK  2863
             K CPT+FHVEARRRR+   + KPKVDGILEYILYWCSFGPDD+RKGG VRPSR++   +K
Sbjct  65    KACPTRFHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRKGGAVRPSRSSCGKRK  124

Query  2862  KSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMY  2683
               AGRPNTKRGC CHFIVKRLIAEPS+AL+IYN +KHVDKKG PCHGP DK A GT+AM+
Sbjct  125   TPAGRPNTKRGCVCHFIVKRLIAEPSLALVIYNHNKHVDKKGTPCHGPMDKMAVGTKAMF  184

Query  2682  APYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRR  2503
             APYIS++L L V+SLLYVG+ VETIMQRH + VE+QGGP NRDDLLTHRYVRR ER +RR
Sbjct  185   APYISDELLLEVMSLLYVGIPVETIMQRHTKMVEKQGGPSNRDDLLTHRYVRRLERKMRR  244

Query  2502  STYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLAS  2323
             S YELD DDA+S++ WVE++Q+ +FFY+DFSD+D FVLGIQT+WQLQQMI++GNR LLAS
Sbjct  245   SVYELDDDDAVSMNKWVENNQDCVFFYEDFSDNDTFVLGIQTDWQLQQMIQYGNRSLLAS  304

Query  2322  DARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWK  2143
             D++FGTNKLKYP+HS++VF+    AIPVAWII P F   +  RWM ALY+RV TKDP W+
Sbjct  305   DSKFGTNKLKYPVHSILVFDQQKNAIPVAWIITPNFTHGEIHRWMGALYDRVRTKDPMWQ  364

Query  2142  LAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMI  1963
             L GFI+DDPLTD+  IREVFQC VLIS WRVRHAWHKNLM +CS+ E R  +AKRLGE I
Sbjct  365   LGGFIIDDPLTDMRTIREVFQCPVLISLWRVRHAWHKNLMSKCSDFERRSMMAKRLGEAI  424

Query  1962  HSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRL-------------------GLW  1840
              SIC+G      F+AF+EDF+D   FVDYFKA W PRL                   G W
Sbjct  425   SSICRGNGDIELFQAFLEDFIDCSGFVDYFKALWLPRLGWSMYLAFLAKISGFYLLQGAW  484

Query  1839  SNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDE  1660
             ++ L+  PLA+ E  +A+E YH+ LKLRLLNE D S+Y+RADWLV KLGT VHSY WLDE
Sbjct  485   TDILKTNPLATAEVASAIERYHHLLKLRLLNEADESIYQRADWLVHKLGTKVHSYCWLDE  544

Query  1659  YSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSE  1480
             +SGKD F+RYW+ EW +G   W++ LQIPD D+ I+G  A+VV Q  K   H I NP SE
Sbjct  545   FSGKDSFSRYWRSEWKTGPNPWQQGLQIPDSDIVIEGNCARVVCQKHKEKSHAILNPGSE  604

Query  1479  FALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDH  1300
              ALCDC+ +  GNLC+H  KS K  RDRG A  S+++ +Y QAL  ++HCPP DS+I DH
Sbjct  605   LALCDCSWSRKGNLCKHAMKSAKVCRDRGLAPPSLALLRYYQALANVVHCPPSDSVICDH  664

Query  1299  ALSVAVWVQKQLNS  1258
             A++VAV V+ QL++
Sbjct  665   AIAVAVSVRTQLDA  678



>ref|XP_006858725.1| hypothetical protein AMTR_s00066p00115970 [Amborella trichopoda]
 gb|ERN20192.1| hypothetical protein AMTR_s00066p00115970 [Amborella trichopoda]
Length=1173

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/651 (64%), Positives = 525/651 (81%), Gaps = 1/651 (0%)
 Frame = -3

Query  3213  ARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKEC  3034
             ARWD+IL++PVQ P T+EFSS+D+ WSKVEGWR  +D+VALIP++RVDDFVRGESAN EC
Sbjct  3     ARWDQILTMPVQQPSTIEFSSADLTWSKVEGWRQVMDKVALIPFSRVDDFVRGESANPEC  62

Query  3033  PTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSA  2854
             PT+FHVEARRR+     YKP+VDG +EYILYWCSFGPDDHR GG+ RPSR+   PKK  A
Sbjct  63    PTRFHVEARRRKPKGMGYKPRVDGYIEYILYWCSFGPDDHRVGGISRPSRSFKPPKKSPA  122

Query  2853  GRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPY  2674
             GRP  KRGCTCHFIVKRL+AEPSVALIIYN  +H+DK GLPCHGPQD +A GT AM+APY
Sbjct  123   GRPGQKRGCTCHFIVKRLMAEPSVALIIYNHREHIDKSGLPCHGPQDGQALGTGAMFAPY  182

Query  2673  ISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTY  2494
             IS++LR +V+SLLYVGV VE+IMQR NE V+RQGGP NRDDLL+HRYVRR ERSIRRSTY
Sbjct  183   ISDELRQQVISLLYVGVPVESIMQRRNEEVKRQGGPRNRDDLLSHRYVRRTERSIRRSTY  242

Query  2493  ELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDAR  2314
             + D DD +SI LW+ESH+NH+FFY+DFSD+DPFVLGIQTEWQLQQMI+FGNR L+A D+R
Sbjct  243   KRDPDDGVSIELWIESHRNHVFFYEDFSDNDPFVLGIQTEWQLQQMIQFGNRSLIACDSR  302

Query  2313  FGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAG  2134
              GT KL YP+ +L+VF+S   AIPVAWI++P FA +   +WM+ALY+RV  KD TW+LAG
Sbjct  303   LGTRKLTYPVCTLLVFDSKRNAIPVAWILSPWFAKDIAHKWMKALYDRVRQKDHTWQLAG  362

Query  2133  FIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSI  1954
             F++DDP TD+  IREVF+CS+LI FWRVRHAWHKN++K+CS   + V + +RLG+ +  I
Sbjct  363   FVIDDPGTDVLTIREVFRCSILICFWRVRHAWHKNVIKKCSATNMCVEMFRRLGQAVCGI  422

Query  1953  CKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYH  1774
             C+G    ++FE FM DFVD  +F++YFKATW PRLG+W +AL++ P AS ETCA++E YH
Sbjct  423   CRGNGDVDSFEEFMVDFVDNPDFLEYFKATWIPRLGIWVSALKSFPFASLETCASMESYH  482

Query  1773  NQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS-GLTA  1597
             ++LK+RLLNE++ SVY RADWL+DKL T VHSYFWLDE+  ++ F+RY KDEW+  G+T+
Sbjct  483   HKLKVRLLNEKEPSVYHRADWLIDKLETKVHSYFWLDEFQERNKFSRYRKDEWVEMGITS  542

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W ++ +IPD ++T++G  A V+ Q D   VH++ NP  EFA+CDC  + +G LC+HV K+
Sbjct  543   WSRASEIPDSNITLEGRDALVMSQSDPEHVHIVRNPGFEFAICDCEWSALGYLCKHVIKA  602

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
                 R+RG    S+S+FQY + L + L+CPPYDSL+ DHA S+A+ VQ QL
Sbjct  603   SWVCRNRGLVGPSISLFQYNRTLGQTLNCPPYDSLVLDHATSMAIEVQGQL  653



>ref|XP_008445306.1| PREDICTED: uncharacterized protein LOC103488340 isoform X3 [Cucumis 
melo]
Length=801

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/721 (62%), Positives = 542/721 (75%), Gaps = 25/721 (3%)
 Frame = -3

Query  2943  YWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYN  2764
             YWCSFGPDDHRKGGV RPSR+TYVPKKK+AGRPNTKRGCTCHFIVKRLIAEPS+ALIIYN
Sbjct  38    YWCSFGPDDHRKGGVRRPSRSTYVPKKKNAGRPNTKRGCTCHFIVKRLIAEPSIALIIYN  97

Query  2763  QDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESV  2584
             +DKHVDKKGLPCHGPQDKKA GTRAM+APYISEDLRLR+LSLLYVGVSVETIMQRHNE+V
Sbjct  98    EDKHVDKKGLPCHGPQDKKAEGTRAMFAPYISEDLRLRILSLLYVGVSVETIMQRHNETV  157

Query  2583  ERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDS  2404
             E+QGGPCNRDDLLTHRYVR QERSIRRST+ELD DDA+S+S+WVE H++++FFY+DF+D+
Sbjct  158   EKQGGPCNRDDLLTHRYVRIQERSIRRSTHELDEDDAVSLSIWVEGHRSNVFFYEDFTDT  217

Query  2403  DPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIA  2224
             D F LGIQTEWQLQQMIRFGNRGLLASD+RFGTNKLKYP+HSLV FNSD  AIPVAWI++
Sbjct  218   DTFTLGIQTEWQLQQMIRFGNRGLLASDSRFGTNKLKYPVHSLVAFNSDYNAIPVAWIVS  277

Query  2223  PRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRH  2044
             PRFAS D  RWMRAL++RV TKDP+WKLAGF+VDDPL D+  IRE+FQCSVL+SFWRVRH
Sbjct  278   PRFASGDAHRWMRALHSRVQTKDPSWKLAGFVVDDPLADVQTIREIFQCSVLLSFWRVRH  337

Query  2043  AWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKAT  1864
             AWHKN++K+C E E R  I ++L + +  +C+G E  ++FE  ++D  D  EFVDYFKAT
Sbjct  338   AWHKNILKKCVENEKRAEILRQLEKTVDGVCRGDENVDSFELMIKDQADDPEFVDYFKAT  397

Query  1863  WYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTV  1684
             W  RLG+W+ AL +LPLAS ETCAA+EFYH+QLKLRLLNE+D +VY+R DWLVDKLGT V
Sbjct  398   WCSRLGMWTTALTSLPLASLETCAAMEFYHSQLKLRLLNEKDSAVYQRTDWLVDKLGTKV  457

Query  1683  HSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVH  1504
             HSYFWLDEY  K++F RYWKDEW+SGLT WR++L IPD DV I+G  AKV +Q  ++   
Sbjct  458   HSYFWLDEYPEKNNFCRYWKDEWMSGLTYWRRALGIPDSDVIIEGGIAKVTNQITRDRKF  517

Query  1503  VIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPP  1324
             V+WNP S+F +CDC  A MGNLCEH+ K I   R +G+   SVS+ QY++ LI MLH PP
Sbjct  518   VVWNPGSQFGICDCQWAEMGNLCEHMCKVINICRKKGTTRPSVSLLQYQKTLIDMLHRPP  577

Query  1323  YDSLIRDHALSVAVWVQKQLNSQIGQES-VQVVGP-----TTTYGGQCGDTVngskgnst  1162
             +DSLIRDHA+S A+ VQKQLN+ I   S +++ GP       T   Q    V+     S 
Sbjct  578   HDSLIRDHAVSFAMSVQKQLNALISMGSDLELRGPFQDRVIKTLENQIDREVSTGDTESF  637

Query  1161  sscngsgsNKLHH------------SGFTKNQLCHSVDHIVARNGICTNSSHNIAVEIPC  1018
                     +KL+             +  T N     VD  V  N  C + +     E PC
Sbjct  638   RDNVLRNKSKLNQNESECASGQEASNNITDNSSSELVDLTVTGN--CVDGA-TAGEECPC  694

Query  1017  LEIGASPYSMCRSEPQLFSIDEVTSTDMLAEN-GRVLIDTGPDITENLPCTDMSFSNLND  841
              ++     S+C   P+L S++EV   + L +N   V ID   D   +LP +  +  NLN 
Sbjct  695   TQMDIDTTSICILPPRLSSVEEVVGGNSLLQNKNAVQIDMEYD---SLPSSYNAVCNLNK  751

Query  840   F  838
             F
Sbjct  752   F  752



>dbj|BAC84431.1| hypothetical protein [Oryza sativa Japonica Group]
Length=814

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/661 (63%), Positives = 507/661 (77%), Gaps = 37/661 (6%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEIL+LPVQNPPT EFS+SDI+WS+VEGW+D++DR+ALIP++RV+DFVRGES NKE
Sbjct  1     MARWDEILTLPVQNPPTPEFSASDIMWSRVEGWKDSMDRLALIPFSRVNDFVRGESNNKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR    + KPKVDGILEYILYWCSFGPDD+RKGG VRPSR +   +K  
Sbjct  61    CPTRFHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGSVRPSRNSSTKRKTP  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRP+TKRGC CHFIVKRLIAEPSVAL+IYN DKHVDK G PCHGP D  A GT+AM+AP
Sbjct  121   AGRPHTKRGCICHFIVKRLIAEPSVALVIYNHDKHVDKIGKPCHGPMDNMAIGTKAMFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+++SLL VG+ VETIMQRH E +E+QGGP NRD LLTHRYVRR ER IRRS 
Sbjct  181   YISDELRLQIMSLLCVGIPVETIMQRHTEMIEKQGGPSNRDGLLTHRYVRRLERKIRRSV  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDAISI++WVE+HQNHIF Y+DFSD D F++GIQT+WQLQQMI++GNR LLASD+
Sbjct  241   YELDDDDAISINIWVENHQNHIFLYEDFSDKDTFIVGIQTDWQLQQMIQYGNRSLLASDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HSL+VF+    AIPVAWII P F+    V    ++ N            
Sbjct  301   KFGTNKLKYPVHSLLVFDKQKNAIPVAWIITPNFSH---VPECNSMLN------------  345

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
                           REVFQC VLIS WR+RHAWHKNLMK+C ++E R  +AKRLGE+I +
Sbjct  346   --------------REVFQCPVLISPWRIRHAWHKNLMKKCPDIEKRPMMAKRLGELICN  391

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRL--------GLWSNALRALPLASQE  1801
             IC+G      FEAF+EDFVD   F+DYF+A W+PRL        G W   LR  PLA+ E
Sbjct  392   ICRGNGGMELFEAFLEDFVDCAGFLDYFRALWFPRLVLTAECIPGSWITMLRTTPLATTE  451

Query  1800  TCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKD  1621
               +A+E YH+ LKLRLLNE +  VY+RADWLV KLGT VHSY+WLDEYSGKD+F+RYW+ 
Sbjct  452   VASAIESYHHLLKLRLLNEANERVYQRADWLVHKLGTKVHSYYWLDEYSGKDNFSRYWRS  511

Query  1620  EWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGN  1441
             EW SG   W++ LQIPD DV ++G  A+VV Q +K   HVI NP S+ ALCDC+ +  GN
Sbjct  512   EWKSGPNPWQQGLQIPDSDVVVEGNCARVVCQKNKERSHVIVNPGSDLALCDCSWSRKGN  571

Query  1440  LCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
             +C+H  KS K  R RG A  S+++F+Y QAL  ++HCPP D+LI DHA++VA++V+ QL+
Sbjct  572   ICKHAIKSTKVFRQRGLAPPSLALFRYYQALANVVHCPPSDTLISDHAVAVAIFVRTQLD  631

Query  1260  S  1258
             S
Sbjct  632   S  632



>gb|EEC81754.1| hypothetical protein OsI_25420 [Oryza sativa Indica Group]
Length=900

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/653 (61%), Positives = 488/653 (75%), Gaps = 44/653 (7%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEIL+LPVQNPPT EFS+SDI+WS+VEGW+D++DR+ALIP++RV+DFVRGES NKE
Sbjct  114   MARWDEILTLPVQNPPTPEFSASDIMWSRVEGWKDSMDRLALIPFSRVNDFVRGESNNKE  173

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+   R   +  +                          G ++P R T       
Sbjct  174   CPTRFHMIIERAALSALA--------------------------GTLQPKRKT------P  201

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRP+TKRGC CHFIVKRLIAEPSVAL+IYN DKHVDK G PCHGP D  A GT+AM+AP
Sbjct  202   AGRPHTKRGCICHFIVKRLIAEPSVALVIYNHDKHVDKIGKPCHGPMDNMAIGTKAMFAP  261

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++LRL+++SLL VG+ VETIMQRH E +E+QGGP NRD LLTHRYVRR ER IRRS 
Sbjct  262   YISDELRLQIMSLLCVGIPVETIMQRHTEMIEKQGGPSNRDGLLTHRYVRRLERKIRRSV  321

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDAISI++WVE+HQNHIF Y+DFSD D F++GIQT+WQLQQMI++GNR LLASD+
Sbjct  322   YELDDDDAISINIWVENHQNHIFLYEDFSDKDTFIVGIQTDWQLQQMIQYGNRSLLASDS  381

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLK              AIPVAWII P F+  +  RWM ALY+RV TKDPTW+L 
Sbjct  382   KFGTNKLK------------KNAIPVAWIITPNFSHGEAYRWMGALYDRVRTKDPTWQLG  429

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDP  D+  IREVFQC VLIS WR+RHAWHKNLMK+C ++E R  +AKRLGE+I +
Sbjct  430   GFIIDDPFADVRTIREVFQCPVLISPWRIRHAWHKNLMKKCPDIEKRSMMAKRLGELICN  489

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             IC+G      FEAF+EDFVD   F+DYF+A W+PRLG W   LR  PLA+ E  +A+E Y
Sbjct  490   ICRGNGGMELFEAFLEDFVDCAGFLDYFRALWFPRLGSWITMLRTTPLATTEVASAIESY  549

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE +  VY+RADWLV KLG  VHSY+WLDEYSGKD+F+RYW+ EW SG   
Sbjct  550   HHLLKLRLLNEANERVYQRADWLVHKLGMKVHSYYWLDEYSGKDNFSRYWRSEWKSGPNP  609

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W++ LQIPD DV ++G  A+VV Q +K   HVI NP S+ ALCDC+ +  GN+C+H  KS
Sbjct  610   WQQGLQIPDSDVVVEGNCARVVCQKNKERSHVIVNPGSDLALCDCSWSRKGNICKHAIKS  669

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              K  R RG A  S+++F+Y QAL  ++HCPP D+LI DHA++VA++V+ QL+S
Sbjct  670   TKVFRQRGLAPPSLALFRYYQALANVVHCPPSDTLISDHAVAVAIFVRTQLDS  722



>gb|EMT07282.1| hypothetical protein F775_09518 [Aegilops tauschii]
Length=947

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/653 (59%), Positives = 471/653 (72%), Gaps = 57/653 (9%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M RWDEIL+LPVQNP  LEFS++DI WS VEGW+D++DR+ALIP++RV DFVRGES NK 
Sbjct  190   MTRWDEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNNKA  249

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+   + KPKVDGILEYILYWCSFGPDD+RKGG VRPSR++   +K  
Sbjct  250   CPTRFHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRKGGAVRPSRSSCGKRKTP  309

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGC CHFIVKRLIAEPS+AL+IYN +KHVDKKG PCHGP DK A GT+AM+AP
Sbjct  310   AGRPNTKRGCVCHFIVKRLIAEPSLALVIYNHNKHVDKKGTPCHGPMDKMAVGTKAMFAP  369

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YIS++L L V+SLLYVG+ VETIMQRH E VE+QGGP NRDDLLTHRYVRR ER +RRS 
Sbjct  370   YISDELLLEVMSLLYVGIPVETIMQRHTEMVEKQGGPSNRDDLLTHRYVRRLERKMRRSV  429

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DDA+S++ WVE++Q+ +FFY+DFSD+D FVLGIQT+WQLQQMI++G+R LLASD+
Sbjct  430   YELDDDDAVSMNKWVENNQDCVFFYEDFSDNDTFVLGIQTDWQLQQMIQYGSRSLLASDS  489

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HS++VF+    AIPVAWII P F   +  RWM ALY+RV TKDPTW+L 
Sbjct  490   KFGTNKLKYPVHSILVFDQQKNAIPVAWIITPNFTHGEIHRWMGALYDRVRTKDPTWQLG  549

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GFI+DDPLTD+  I  +   + L+      H W                           
Sbjct  550   GFIIDDPLTDVRTISSMVSKTWLVHI--PGHIW---------------------------  580

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
                                  +  V  F   W       +  L+  PLA+ E  +A+E Y
Sbjct  581   ---------------------ILLVTGFFGAW-------TGVLKTNPLATAEVASAIERY  612

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H+ LKLRLLNE D S+Y+RADWLV KLGT VHSY WLDE+SGKD F+RYW+ EW +G   
Sbjct  613   HHLLKLRLLNEADESIYQRADWLVHKLGTKVHSYCWLDEFSGKDSFSRYWRSEWKTGPNP  672

Query  1596  WRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKS  1417
             W++ LQIPD D+ I+G  A+VV Q  K+  H I NP SE ALCDC+ +  GNLC+H  KS
Sbjct  673   WQQGLQIPDSDIVIEGNCARVVCQKHKDKSHAILNPGSELALCDCSWSRKGNLCKHAMKS  732

Query  1416  IKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              K  RDRG A  S+++ +Y QAL  ++HCPP DS+I DHA++VAV V+ QL++
Sbjct  733   AKVCRDRGLAPPSLALLRYYQALANVVHCPPNDSVICDHAIAVAVSVRTQLDA  785



>emb|CAB10176.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78439.1| hypothetical protein [Arabidopsis thaliana]
Length=675

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/464 (71%), Positives = 383/464 (83%), Gaps = 12/464 (3%)
 Frame = -3

Query  2799  IAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVS  2620
             I     AL+IYN DKHVD+KG PCHGPQDKKAAGTRAM+APYISEDLRLRV SLLYVGVS
Sbjct  72    ILREGAALVIYNNDKHVDEKGFPCHGPQDKKAAGTRAMFAPYISEDLRLRVSSLLYVGVS  131

Query  2619  VETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQ  2440
             VETIMQRHNESVE+QGGP NRDDLLTHRYVRR ERSIRRSTYELD DD +SIS+WVESHQ
Sbjct  132   VETIMQRHNESVEKQGGPSNRDDLLTHRYVRRLERSIRRSTYELDEDDDVSISMWVESHQ  191

Query  2439  NHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLK-----------  2293
             +H+FF++ FSD+DPF LGIQTEWQLQQMIRFGN  LLASD+RFGTN LK           
Sbjct  192   SHVFFFEGFSDTDPFSLGIQTEWQLQQMIRFGNCRLLASDSRFGTNTLKDDSQVYVLVYF  251

Query  2292  -YPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDP  2116
              YPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL NRVH KDP+WK+AGFIVDDP
Sbjct  252   QYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALCNRVHAKDPSWKVAGFIVDDP  311

Query  2115  LTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEP  1936
               DI AIR+VFQC VL SFWR+RHAWHKN++KRC E + RV I++ LG+ +  I +    
Sbjct  312   FADIIAIRDVFQCPVLFSFWRLRHAWHKNIIKRCRETKTRVEISRHLGQAVDKISRRQGT  371

Query  1935  ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLR  1756
             A  F++F+EDFV + EFV+YF++ W PR+G W++AL++LPLASQETCAA+E YH QLK R
Sbjct  372   ATLFDSFVEDFVGSPEFVEYFRSVWSPRIGAWTSALQSLPLASQETCAAMELYHYQLKCR  431

Query  1755  LLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQI  1576
             LLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FARYWK+EW+SGLT++RK+L I
Sbjct  432   LLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFARYWKEEWVSGLTSFRKALSI  491

Query  1575  PDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMG  1444
             PD DV I G SAK+ D+ D N +HV+WNP S+F +C C+ A  G
Sbjct  492   PDSDVVISGMSAKITDECDGNEIHVVWNPGSQFGVCSCSWAEKG  535



>ref|XP_010108922.1| hypothetical protein L484_027117 [Morus notabilis]
 gb|EXC20562.1| hypothetical protein L484_027117 [Morus notabilis]
Length=375

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/375 (87%), Positives = 354/375 (94%), Gaps = 0/375 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MARWDEILSLPVQNPP LEFS+ DIVWSKVEGWRDNIDRVALIP+ARVDDF+RGES+NK+
Sbjct  1     MARWDEILSLPVQNPPILEFSAGDIVWSKVEGWRDNIDRVALIPFARVDDFIRGESSNKD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPTKFHVEARRRR   T YKPKVDG+LEYILYWCSFGPDDHRKGG+VRPSRTTYV KKK+
Sbjct  61    CPTKFHVEARRRRRPTTPYKPKVDGVLEYILYWCSFGPDDHRKGGIVRPSRTTYVAKKKN  120

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             AGRPNTKRGCTCHFIVKRLIAEPSVALIIYN+DKHVDKKGLPCHGPQDKKAAGTRA++AP
Sbjct  121   AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNEDKHVDKKGLPCHGPQDKKAAGTRAVFAP  180

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
              IS+DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST
Sbjct  181   DISDDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  240

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             YELD DD++S+S WVESHQ+++FFY+DFSDSDPF +GIQTEWQLQQMIRFGNR LL SD+
Sbjct  241   YELDTDDSVSVSTWVESHQSNVFFYEDFSDSDPFTVGIQTEWQLQQMIRFGNRNLLVSDS  300

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
             +FGTNKLKYP+HSL+VFN DNKAIPVAWII+PRFAS D  +WMRAL NRV TKDP+WKLA
Sbjct  301   KFGTNKLKYPVHSLLVFNPDNKAIPVAWIISPRFASSDCYKWMRALCNRVQTKDPSWKLA  360

Query  2136  GFIVDDPLTDIPAIR  2092
             GFIVDDPL D+ AIR
Sbjct  361   GFIVDDPLADVYAIR  375



>ref|XP_011019704.1| PREDICTED: uncharacterized protein LOC105122342 isoform X1 [Populus 
euphratica]
Length=697

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/653 (49%), Positives = 441/653 (68%), Gaps = 7/653 (1%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ +M R ++ILSLPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARVDDFV+G
Sbjct  2     KGHEPKMPRMEDILSLPVQDPPCAEFSAAHIKWVKVEGGRQGGDDIALIPFARVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTY  2875
             ES+N ECP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         +  
Sbjct  62    ESSNAECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESTMGDGSHT  121

Query  2874  VPKKKSAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
              P      RP  +   RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D  A
Sbjct  122   KPATGKGSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+SLLY+G+S++ I+Q H E V+  GGP NRDDLLT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSLLYIGISLDNIIQHHAEVVQGHGGPLNRDDLLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER++R S+Y+L ADD  S+ +WV+ HQ H+FF++D S ++PF+LGIQT+WQLQQMIR+G
Sbjct  242   MERNVRNSSYKLHADDESSVKMWVQRHQKHVFFFQDMSSTEPFILGIQTDWQLQQMIRYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             + G +AS + FG  KLKYP+ +L+VF+S   AIPVAWI+   F ++D  +W+ +L  R+ 
Sbjct  302   HSGSIASHSTFGLKKLKYPLCTLLVFDSSQNAIPVAWIVTSSFVTQDIHKWIGSLAERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             +KDP W+   F+VDDP  DI  IRE FQC +L+  W VR AW ++L+K+C  ++V+  + 
Sbjct  362   SKDPRWRPNAFLVDDPSFDISFIREAFQCRLLLCAWHVRRAWMRSLLKKCCNIDVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++S   G    N  E FM+ +VD   F+DYFK  W P + LW N++R+LP+AS 
Sbjct  422   KHLGWILYSTRSGPNADNAVEEFMQVYVDQCIFMDYFKRRWLPYIELWINSIRSLPVAST  481

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AA+E YH +LK +L +++  + Y R DWL+  L T  HS +WLD+YS +  +  Y +
Sbjct  482   EPLAAIESYHLRLKSKLFDQQYANSYTRIDWLIHTLTTEFHSLYWLDQYSAETGYFTYAR  541

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             D+  S   AW ++L IPD DV +D ++   AKV+ Q D+++ + IWNP SEFALCDC  +
Sbjct  542   DKSFST-NAWYQALHIPDVDVILDEQNLQLAKVISQTDRSLAYTIWNPGSEFALCDCPWS  600

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHAL  1294
               GNLC+HV K     ++R  A   ++   YRQAL+ +L  PP D L+ +HA+
Sbjct  601   RQGNLCKHVIKVAILCKNRQVARPLLASQVYRQALLTLLQNPPDDPLVLEHAI  653



>ref|XP_011019705.1| PREDICTED: uncharacterized protein LOC105122342 isoform X2 [Populus 
euphratica]
Length=690

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/647 (49%), Positives = 437/647 (68%), Gaps = 7/647 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++ILSLPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARVDDFV+GES+N E
Sbjct  1     MPRMEDILSLPVQDPPCAEFSAAHIKWVKVEGGRQGGDDIALIPFARVDDFVKGESSNAE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         +   P    
Sbjct  61    CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESTMGDGSHTKPATGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D  A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+LR +V+SLLY+G+S++ I+Q H E V+  GGP NRDDLLT   VR  ER++R
Sbjct  181   YAPRISEELRQKVMSLLYIGISLDNIIQHHAEVVQGHGGPLNRDDLLTRNDVRNMERNVR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S+Y+L ADD  S+ +WV+ HQ H+FF++D S ++PF+LGIQT+WQLQQMIR+G+ G +A
Sbjct  241   NSSYKLHADDESSVKMWVQRHQKHVFFFQDMSSTEPFILGIQTDWQLQQMIRYGHSGSIA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S + FG  KLKYP+ +L+VF+S   AIPVAWI+   F ++D  +W+ +L  R+ +KDP W
Sbjct  301   SHSTFGLKKLKYPLCTLLVFDSSQNAIPVAWIVTSSFVTQDIHKWIGSLAERIRSKDPRW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +   F+VDDP  DI  IRE FQC +L+  W VR AW ++L+K+C  ++V+  + K LG +
Sbjct  361   RPNAFLVDDPSFDISFIREAFQCRLLLCAWHVRRAWMRSLLKKCCNIDVQREMFKHLGWI  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++S   G    N  E FM+ +VD   F+DYFK  W P + LW N++R+LP+AS E  AA+
Sbjct  421   LYSTRSGPNADNAVEEFMQVYVDQCIFMDYFKRRWLPYIELWINSIRSLPVASTEPLAAI  480

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L +++  + Y R DWL+  L T  HS +WLD+YS +  +  Y +D+  S 
Sbjct  481   ESYHLRLKSKLFDQQYANSYTRIDWLIHTLTTEFHSLYWLDQYSAETGYFTYARDKSFST  540

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW ++L IPD DV +D ++   AKV+ Q D+++ + IWNP SEFALCDC  +  GNLC
Sbjct  541   -NAWYQALHIPDVDVILDEQNLQLAKVISQTDRSLAYTIWNPGSEFALCDCPWSRQGNLC  599

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHAL  1294
             +HV K     ++R  A   ++   YRQAL+ +L  PP D L+ +HA+
Sbjct  600   KHVIKVAILCKNRQVARPLLASQVYRQALLTLLQNPPDDPLVLEHAI  646



>ref|XP_006450581.1| hypothetical protein CICLE_v10010703mg [Citrus clementina]
 gb|ESR63821.1| hypothetical protein CICLE_v10010703mg [Citrus clementina]
Length=697

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/667 (47%), Positives = 448/667 (67%), Gaps = 15/667 (2%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             ++H+ +M R ++IL+LPVQ+PP +EFS++++ W KVEG R   D +ALIP+ARV++FV+G
Sbjct  2     KSHESKMPRMEDILNLPVQDPPCVEFSAANLKWVKVEGGRQGGDDIALIPFARVEEFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK-------GGVV  2896
             ES+N ECP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R        G  V
Sbjct  62    ESSNAECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGNGDGSNV  121

Query  2895  RPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQ  2716
             +P+      K    GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  
Sbjct  122   KPA----TGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGIL  177

Query  2715  DKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHR  2536
             D+ A GTRAMYAP ISEDLR +V+S+LYVG+S++ I+Q H E V+  GGP NRDD LT  
Sbjct  178   DRDAVGTRAMYAPRISEDLRQKVMSMLYVGISLDNIIQHHIEVVQGHGGPHNRDDFLTRN  237

Query  2535  YVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQM  2356
              VR  ER IR S++EL  DD  S+ +WV+ H  H+FF++D+S S+PF+L IQT+WQLQQM
Sbjct  238   DVRNMERVIRNSSHELHVDDECSVKMWVQRHHKHVFFFQDYSVSEPFILVIQTDWQLQQM  297

Query  2355  IRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALY  2176
             + +GN GL++  + FG+ KLKYP+ +L+VF+S + AIPVAWII   F  +   +W+  L 
Sbjct  298   LHYGNNGLMSFHSTFGSKKLKYPLSTLLVFDSSHNAIPVAWIITSSFVGQFVHKWIGLLA  357

Query  2175  NRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVR  1996
              R+ TKDP W+L+ F+VD+P  DI  IRE FQC +L+  W VR AW KNL+K+C  +EV+
Sbjct  358   ERIRTKDPRWRLSAFLVDNPSFDISTIRENFQCRILLCVWHVRRAWIKNLLKKCYNVEVQ  417

Query  1995  VTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALP  1816
               + K+L  +++S        +T E FM+ FVD   F+DYFK+ W P + LW   +R+LP
Sbjct  418   QEMFKQLSWILYSSRSSPNSVDTIEEFMQVFVDQCAFMDYFKSQWLPHIELWVTGIRSLP  477

Query  1815  LASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFA  1636
             + + E  AA+E YH +LK +L +E++++ + R DWL+  L T  HS +WLD+YS +  + 
Sbjct  478   VTTPEPLAAIETYHLRLKSKLFHEQNVNFWPRVDWLIHTLTTEFHSLYWLDQYSMETGYF  537

Query  1635  RYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCD  1465
                +D+  S   AW ++L IPD +V +D ++   AK++ Q D+ + + IWNP SEF+LCD
Sbjct  538   ENLRDDSFST-NAWSQALHIPDVNVMLDEQNLQLAKIISQADRTLAYTIWNPGSEFSLCD  596

Query  1464  CNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVA  1285
             C  + +GN+CEHV K     + R  A   ++   YRQAL+ +L  PP D L+ ++A+  A
Sbjct  597   CPWSRLGNVCEHVIKLAMVCKSRQVARPLLAAQVYRQALLSLLQNPPDDPLVLEYAIVHA  656

Query  1284  VWVQKQL  1264
               +Q+ +
Sbjct  657   TRLQQDI  663



>ref|XP_006476176.1| PREDICTED: uncharacterized protein LOC102625159 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/667 (47%), Positives = 448/667 (67%), Gaps = 15/667 (2%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             ++H+ +M R ++IL+LPVQ+PP +EFS++++ W KVEG R   D +ALIP+ARV++FV+G
Sbjct  2     KSHESKMPRMEDILNLPVQDPPCVEFSAANLKWVKVEGGRQGGDDIALIPFARVEEFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK-------GGVV  2896
             ES+N ECP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R        G  V
Sbjct  62    ESSNAECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGNGDGSNV  121

Query  2895  RPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQ  2716
             +P+      K    GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  
Sbjct  122   KPA----TGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGIL  177

Query  2715  DKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHR  2536
             D+ A GTRAMYAP ISEDLR +V+S+LYVG+S++ I+Q H E+V+  GGP NRDD LT  
Sbjct  178   DRDAVGTRAMYAPRISEDLRQKVMSMLYVGISLDNIIQHHIEAVQGHGGPHNRDDFLTRN  237

Query  2535  YVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQM  2356
              VR  ER IR S++EL  DD  S+ +WV+ H  H+FF++D+S S+PF+L IQT+WQLQQM
Sbjct  238   DVRNMERVIRNSSHELHVDDECSVKMWVQRHHKHVFFFQDYSVSEPFILVIQTDWQLQQM  297

Query  2355  IRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALY  2176
             + +GN GL++  + FG+ KLKYP+ +L+VF+S + AIPVAWII   F  +   +W+  L 
Sbjct  298   LHYGNNGLMSFHSTFGSKKLKYPLSTLLVFDSSHNAIPVAWIITSSFVGQFVHKWIGLLA  357

Query  2175  NRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVR  1996
              R+ TKDP W+L+ F+VD+P  DI  IRE FQC +L+  W VR AW KNL+K+C  +EV+
Sbjct  358   ERIRTKDPRWRLSAFLVDNPSFDISTIRENFQCRILLCVWHVRRAWIKNLLKKCYNVEVQ  417

Query  1995  VTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALP  1816
               + K+L  +++S        +T E FM+ FVD   F+DYFK+ W P + LW   +R+LP
Sbjct  418   QEMFKQLSWILYSSRSSPNSVDTIEEFMQVFVDQCAFMDYFKSQWLPHIELWVTGIRSLP  477

Query  1815  LASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFA  1636
             + + E  AA+E YH +LK +L +E+++  + R DWL+  L T  HS +WLD+YS +  + 
Sbjct  478   VTTPEPLAAIETYHLRLKSKLFHEQNVIFWPRVDWLIHTLTTEFHSLYWLDQYSMETGYF  537

Query  1635  RYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCD  1465
                +D+  S   AW ++L IPD +V +D ++   AK++ Q D+ + + IWNP SEF+LCD
Sbjct  538   ENLRDDSFST-NAWSQALHIPDVNVMLDEQNLQLAKIISQADRTLAYTIWNPGSEFSLCD  596

Query  1464  CNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVA  1285
             C  + +GN+CEHV K     + R  A   ++   YRQAL+ +L  PP D L+ ++A+  A
Sbjct  597   CPWSRLGNVCEHVIKLAMVCKSRQVARPLLAAQVYRQALLSLLQNPPDDPLVLEYAIVHA  656

Query  1284  VWVQKQL  1264
               +Q+ +
Sbjct  657   TRLQQDI  663



>gb|KDO79654.1| hypothetical protein CISIN_1g039513mg [Citrus sinensis]
Length=690

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/661 (47%), Positives = 444/661 (67%), Gaps = 15/661 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL+LPVQ+PP +EFS++++ W KVEG R   D +ALIP+ARV++FV+GES+N E
Sbjct  1     MPRMEDILNLPVQDPPCVEFSAANLKWVKVEGGRQGGDDIALIPFARVEEFVKGESSNAE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK-------GGVVRPSRTT  2878
             CP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R        G  V+P+   
Sbjct  61    CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGNGDGSNVKPA---  117

Query  2877  YVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAG  2698
                K    GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D+ A G
Sbjct  118   -TGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDRDAVG  176

Query  2697  TRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQE  2518
             TRAMYAP ISEDLR +V+S+LYVG+S++ I+Q H E+V+  GGP NRDD LT   VR  E
Sbjct  177   TRAMYAPRISEDLRQKVMSMLYVGISLDNIIQHHIEAVQGHGGPHNRDDFLTRNDVRNME  236

Query  2517  RSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNR  2338
             R IR S++EL  DD  S+ +WV+ H  H+FF++D+S S+PF+L IQT+WQLQQM+ +GN 
Sbjct  237   RVIRNSSHELHVDDECSVKMWVQRHHKHVFFFQDYSVSEPFILVIQTDWQLQQMLHYGNN  296

Query  2337  GLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTK  2158
             GL++  + FG+ KLKYP+ +L+VF+S + AIPVAWII   F  +   +W+  L  R+ TK
Sbjct  297   GLMSFHSTFGSKKLKYPLSTLLVFDSSHNAIPVAWIITSSFVGQFVHKWIGLLAERIRTK  356

Query  2157  DPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKR  1978
             DP W+L+ F+VD+P  DI  IRE FQC +L+  W VR AW KNL+K+C  +EV+  + K+
Sbjct  357   DPRWRLSAFLVDNPSFDISTIRENFQCRILLCVWHVRRAWIKNLLKKCYNVEVQQEMFKQ  416

Query  1977  LGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQET  1798
             L  +++S        +T E FM+ FVD   F+DYFK+ W P + LW   +R+LP+ + E 
Sbjct  417   LSWILYSSRSSPNSVDTIEEFMQVFVDQCAFMDYFKSQWLPHIELWVTGIRSLPVTTPEP  476

Query  1797  CAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDE  1618
              AA+E YH +LK +L +E++++ + R DWL+  L T  HS +WLD+YS +  +    +D+
Sbjct  477   LAAIETYHLRLKSKLFHEQNVNFWPRVDWLIHTLTTEFHSLYWLDQYSMETGYFENLRDD  536

Query  1617  WISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANM  1447
               S   AW ++L IPD +V +D ++   AK++ Q D+ + + IWNP SEF+LCDC  + +
Sbjct  537   SFST-NAWSQALHIPDVNVMLDEQNLQLAKIISQADRTLAYTIWNPGSEFSLCDCPWSRL  595

Query  1446  GNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQ  1267
             GN+CEHV K     + R  A   ++   YRQAL+ +L  PP D L+ ++A+  A  +Q+ 
Sbjct  596   GNVCEHVIKLAMVCKSRQVARPLLAAQVYRQALLSLLQNPPDDPLVLEYAIVHATRLQQD  655

Query  1266  L  1264
             +
Sbjct  656   I  656



>ref|XP_007013718.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 ref|XP_007013720.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY31337.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY31339.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
Length=697

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/663 (46%), Positives = 439/663 (66%), Gaps = 7/663 (1%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ ++ R ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARVDDFV+G
Sbjct  2     KGHESKIPRMEDILNLPVQDPPCSEFSAAHIKWVKVEGGRHGGDDIALIPFARVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTY  2875
             ES+N ECP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         +  
Sbjct  62    ESSNAECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGLGDVSNM  121

Query  2874  VPKKKSAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
              P      RP  +   RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D+ A
Sbjct  122   KPATGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDQDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+S+LYVG+S++ I Q H + V+R GGP NRDD LT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVISMLYVGISLDNIFQHHMDVVQRHGGPHNRDDFLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER IR +++EL  DD  S+ +WV+ HQ H+F+++D S S+P +LGIQT+WQLQQM+ +G
Sbjct  242   IERVIRNTSHELHIDDECSVKVWVQRHQKHVFYFQDASGSEPLILGIQTDWQLQQMLHYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             + G +AS + FG+ KLKYP+ +L+VF+S   AIPVAW+I      +D  +W+  L  R+ 
Sbjct  302   HNGSIASHSTFGSKKLKYPLSTLLVFDSSQNAIPVAWVITSALVGQDVHKWIGFLSERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
              KDP W++  F++DDP   I  IR+ FQC VL+  W VR AW ++L+K+C  ++V+  + 
Sbjct  362   AKDPRWRVNAFLIDDPSFGISVIRDAFQCRVLLCVWHVRRAWIRSLLKKCCNIDVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++S   G    +  E F+E FVD   F+DYFK+ W P +  W + +R+LP+   
Sbjct  422   KHLGWILYSSRSGPNAMDAVEEFLEIFVDQSAFIDYFKSRWSPYIESWVSGIRSLPVLGP  481

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AA+E YH +LK +L NE+  + + R DWL+  L T  HS +WL++Y+ +  +   ++
Sbjct  482   EPHAAIESYHRRLKYKLFNEQHANFWSRIDWLIHALTTEFHSLYWLEQYTRETGYFPNFR  541

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             DE  S   AW ++L IP+ DV +D ++   AKV+ Q D+N+ + IWNP SEF+LCDC+ +
Sbjct  542   DESFS-TNAWYQALHIPNVDVILDEQNLQLAKVISQTDRNLAYAIWNPGSEFSLCDCDWS  600

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
             ++GNLC+HV K     ++R  A   +S   YRQ L+ +LH PP D +I DHA+  A  +Q
Sbjct  601   SLGNLCKHVIKVAMICKNRQVARPLLSAQIYRQTLLSLLHNPPDDPVILDHAILCATRLQ  660

Query  1272  KQL  1264
             + +
Sbjct  661   QDI  663



>gb|KHG17737.1| Arrestin-C [Gossypium arboreum]
Length=690

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/657 (47%), Positives = 436/657 (66%), Gaps = 7/657 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MAR ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP++RVDDFV+GES+N E
Sbjct  1     MARMEDILNLPVQDPPCAEFSAAHITWVKVEGGRQGGDDIALIPFSRVDDFVKGESSNAE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         + + P    
Sbjct  61    CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDCESGLGDGSNFKPTTGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGSPCHGILDQDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+LR +V+S+LYVG+S++ I+Q H E V+  GGP NRDD LT   VR  ER IR
Sbjct  181   YAPRISEELRQKVMSMLYVGISLDNIIQHHMEVVQGHGGPHNRDDFLTRNDVRNIERVIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              +++EL  DDA S+ +WV+ HQ H+F+++D S S+PF+LGIQT+WQLQQM+R G  G +A
Sbjct  241   NTSHELHIDDACSVKIWVQRHQKHVFYFQDASASEPFILGIQTDWQLQQMLRHGQNGSVA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S + FG+ KLKYP+ +L+VF+S   AIPVAW+I      +D  +W+ +L  R+ TKD  W
Sbjct  301   SHSTFGSKKLKYPLSTLLVFDSSRNAIPVAWVITSSLTGQDIHKWVGSLAERLRTKDSRW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +L  F+VDDP     AIR+ FQC VL+  W VR AW ++L+K CS ++V+  + K LG +
Sbjct  361   RLNAFLVDDPSFGFSAIRDAFQCRVLLCVWHVRRAWIRSLLKTCSNIDVQREMFKHLGWI  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++S        +  + FME FVD   F+DYFK+ W P +  W + +R+LP+A  E  AA+
Sbjct  421   LYSSRSVPNAMDAVQEFMEVFVDQSAFMDYFKSQWSPYIESWVSCIRSLPVAGPEPHAAI  480

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L N++  + + R DWL+  L T  HS +WLD+Y+ +  +    +DE  S 
Sbjct  481   ESYHRRLKYKLFNDQYANFWPRIDWLIHTLTTEFHSLYWLDQYTVETGYFSNLRDESFS-  539

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW ++L IPD DV +D ++   AKV+ Q D+N+ + IWNP SEF+LCDC+ +N+GNLC
Sbjct  540   TNAWYQALHIPDIDVILDEQNLQVAKVISQTDRNLAYTIWNPGSEFSLCDCHWSNLGNLC  599

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             +HV K     ++R  A   ++   YRQ L+ +LH PP D ++ DHA+     +Q+ +
Sbjct  600   KHVIKVAMMCKNRQVARPLLAAQIYRQTLLSLLHNPPDDPVVLDHAILCTTRLQQDI  656



>ref|XP_007013717.1| SWIM zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOY31336.1| SWIM zinc finger family protein isoform 1 [Theobroma cacao]
Length=701

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/658 (47%), Positives = 436/658 (66%), Gaps = 7/658 (1%)
 Frame = -3

Query  3219  QMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANK  3040
             ++ R ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARVDDFV+GES+N 
Sbjct  11    KIPRMEDILNLPVQDPPCSEFSAAHIKWVKVEGGRHGGDDIALIPFARVDDFVKGESSNA  70

Query  3039  ECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKK  2860
             ECP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         +   P   
Sbjct  71    ECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGLGDVSNMKPATG  130

Query  2859  SAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
                RP  +   RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D+ A GTRA
Sbjct  131   KGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDQDAVGTRA  190

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MYAP ISE+LR +V+S+LYVG+S++ I Q H + V+R GGP NRDD LT   VR  ER I
Sbjct  191   MYAPRISEELRQKVISMLYVGISLDNIFQHHMDVVQRHGGPHNRDDFLTRNDVRNIERVI  250

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             R +++EL  DD  S+ +WV+ HQ H+F+++D S S+P +LGIQT+WQLQQM+ +G+ G +
Sbjct  251   RNTSHELHIDDECSVKVWVQRHQKHVFYFQDASGSEPLILGIQTDWQLQQMLHYGHNGSI  310

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             AS + FG+ KLKYP+ +L+VF+S   AIPVAW+I      +D  +W+  L  R+  KDP 
Sbjct  311   ASHSTFGSKKLKYPLSTLLVFDSSQNAIPVAWVITSALVGQDVHKWIGFLSERIRAKDPR  370

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             W++  F++DDP   I  IR+ FQC VL+  W VR AW ++L+K+C  ++V+  + K LG 
Sbjct  371   WRVNAFLIDDPSFGISVIRDAFQCRVLLCVWHVRRAWIRSLLKKCCNIDVQREMFKHLGW  430

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             +++S   G    +  E F+E FVD   F+DYFK+ W P +  W + +R+LP+   E  AA
Sbjct  431   ILYSSRSGPNAMDAVEEFLEIFVDQSAFIDYFKSRWSPYIESWVSGIRSLPVLGPEPHAA  490

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LK +L NE+  + + R DWL+  L T  HS +WL++Y+ +  +   ++DE  S
Sbjct  491   IESYHRRLKYKLFNEQHANFWSRIDWLIHALTTEFHSLYWLEQYTRETGYFPNFRDESFS  550

Query  1608  GLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
                AW ++L IP+ DV +D ++   AKV+ Q D+N+ + IWNP SEF+LCDC+ +++GNL
Sbjct  551   -TNAWYQALHIPNVDVILDEQNLQLAKVISQTDRNLAYAIWNPGSEFSLCDCDWSSLGNL  609

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             C+HV K     ++R  A   +S   YRQ L+ +LH PP D +I DHA+  A  +Q+ +
Sbjct  610   CKHVIKVAMICKNRQVARPLLSAQIYRQTLLSLLHNPPDDPVILDHAILCATRLQQDI  667



>ref|XP_006842250.1| hypothetical protein AMTR_s00078p00196690 [Amborella trichopoda]
 gb|ERN03925.1| hypothetical protein AMTR_s00078p00196690 [Amborella trichopoda]
Length=786

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/658 (47%), Positives = 437/658 (66%), Gaps = 7/658 (1%)
 Frame = -3

Query  3219  QMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANK  3040
             +M R ++IL+LPVQ+PP  EFS++ + W KV+G R   D +ALIP++RVDDFV+GES   
Sbjct  22    KMPRMEDILNLPVQDPPYAEFSAAHLNWVKVDGGRQGGDDIALIPFSRVDDFVKGESNKV  81

Query  3039  ECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHR---KGGVVRPSRTTYVP  2869
             ECP  F +E+RR+R+  +  KP+VDG LEY +YWCS+GP+D+R    G    P+      
Sbjct  82    ECPASFRIESRRKRSEGSVSKPRVDGYLEYTIYWCSYGPEDYRDCDSGIGDFPNNKPTSG  141

Query  2868  KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
             K    GR +  RGC CHF VKRL   P +ALII+NQ  HVDK G PCHG  D+ A GTRA
Sbjct  142   KGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIFNQKNHVDKTGAPCHGSLDRDAIGTRA  201

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MYAP ISE+LR R++SLLY+GV ++ I+Q H E VER GGPCNRDD LT   VR  ER I
Sbjct  202   MYAPRISEELRQRIMSLLYIGVPLDNIIQHHTEEVERHGGPCNRDDFLTRNDVRNMERVI  261

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             ++STYEL  +DA+S+ +WV+ HQ  +FF++D  D++ F+LGIQTEWQLQQM+R+G+   +
Sbjct  262   KQSTYELHLNDAVSVRIWVQRHQKCVFFFQDSPDTESFILGIQTEWQLQQMLRYGHNSSI  321

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             A+++ FG NKLK P+ +L+VF++    IPVAW+I+  +AS+D   WM +L  RV  +D  
Sbjct  322   AANSMFGLNKLKCPLCTLLVFDAYQNGIPVAWVISSSYASQDIHMWMGSLVERVRARDLN  381

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             W+   F++DDP  +I  IR++FQC +L+  WRVR  W +NL+K+C   +V+  + K LG 
Sbjct  382   WRPTAFLIDDPSFEISVIRDIFQCRILLCLWRVRRVWIRNLLKKCCNFDVQREMFKHLGR  441

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             +++    G    +  E FM+ FVD   F++YFKA W PR+ +W +A+R LPLA+QE  AA
Sbjct  442   ILYCSRSGPNATDVVEEFMQVFVDQTAFLEYFKAFWLPRIDMWVSAMRTLPLANQEVLAA  501

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH++LK +LL++     + R DWLV  L T  HS  W D+Y+ +  F R  +++  S
Sbjct  502   IESYHSRLKSKLLSDPPSRSWHRVDWLVHVLTTEFHSLCWFDQYAEESAFFRNMREQSFS  561

Query  1608  GLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
              + +WR++L I D DV +D E     KV+ Q D++  + IWNP SEF+LCDC  +  GN+
Sbjct  562   -MNSWRRALHISDDDVILDEEDLLFVKVISQSDRSHAYTIWNPGSEFSLCDCPWSRHGNV  620

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             C+H+ K     R R  A  S+++  YR+ L+ +L  PP D ++ DHA+  A  +Q+ L
Sbjct  621   CKHIIKVGVLCRHRQVARPSLALQAYREILLSLLQNPPDDPIVLDHAMVHATRMQQDL  678



>ref|XP_008378289.1| PREDICTED: uncharacterized protein LOC103441391 [Malus domestica]
Length=696

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/680 (47%), Positives = 443/680 (65%), Gaps = 7/680 (1%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ +MAR ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARV DFV+G
Sbjct  2     KGHEHKMARMEDILNLPVQDPPCAEFSATHIKWVKVEGGRQGGDDIALIPFARVGDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK--GGVVRPSRT  2881
             ES+N ECP  F VE+RR+R   +  KP+VDG LEY LYWCS+GP+D+R+   G++  S T
Sbjct  62    ESSNAECPASFRVESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGLMDGSST  121

Query  2880  TYVPKKKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
                  K S  GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A
Sbjct  122   KPASGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGILDQDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+ R +V+S+LYVG+ ++ I+Q H E VE  GGP NRDD L+   VR 
Sbjct  182   MGTRAMYAPRISEEQRQKVMSMLYVGIPLDNIIQHHMELVEGHGGPHNRDDFLSRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER IR S+ +L  +D  SI +WV+ H+ H+F+++D S S+PFVLGIQT+WQLQQM+++G
Sbjct  242   MERGIRNSSPQLHPNDGCSIKMWVQRHRKHVFYFQDXSVSEPFVLGIQTDWQLQQMLQYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             +   +A  + FG  KLKYP+ +L+VFN    AIPVAWII   F S+D  +W+  L  RV 
Sbjct  302   HNNYIAVHSTFGLKKLKYPLCTLLVFNPSRNAIPVAWIITSSFISQDIHKWIGPLAERVR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             TKDP W+   F+VDDP  +I  +RE FQC VL+  W  RH+W + ++K C   +V+  + 
Sbjct  362   TKDPGWRPDSFLVDDPSFEISILREAFQCRVLLCXWHARHSWIRRILKTCCNFDVQREVF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K+LG +++S   G    +  E FM+ FVD   F+DYFK  W P L LW N +R+LP+AS 
Sbjct  422   KQLGWLLYSTRSGSNAMDAVEEFMQVFVDQCAFMDYFKRRWLPNLELWVNCIRSLPVASP  481

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AA+E YH +LK +L NE+  + + R DWL+  L T  HS +WLD+YS +  +    +
Sbjct  482   EPNAAIESYHARLKSKLFNEQYANSWLRVDWLIHTLTTEFHSSYWLDQYSMETGYFENLR  541

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             D+  S   AW ++LQI D DV +D ++   AKV+ Q D+++ + IWNP SEF+ CDC S+
Sbjct  542   DKSFST-NAWYQALQILDVDVILDEQNLQYAKVISQTDRSLAYTIWNPGSEFSFCDCPSS  600

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
              +GNLC+HV K     +DR  A   ++   YRQ L+ +L   P D L+ DHA+  A  +Q
Sbjct  601   RLGNLCKHVIKVAISCKDRQVARPLLAAQVYRQTLLTLLQNIPDDPLVLDHAILHATRLQ  660

Query  1272  KQLNSQIGQESVQVVGPTTT  1213
             + + +     +  ++ P T+
Sbjct  661   QDIKALEVLSNSGLLQPLTS  680



>gb|EPS74375.1| hypothetical protein M569_00380, partial [Genlisea aurea]
Length=374

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/377 (77%), Positives = 337/377 (89%), Gaps = 4/377 (1%)
 Frame = -3

Query  3219  QMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANK  3040
             QMARWDEI SLPVQNP T+EFSS D+VWSK+EGWRD IDR+ALIP++RVDDFVRGES + 
Sbjct  1     QMARWDEIFSLPVQNPSTMEFSSVDLVWSKIEGWRDKIDRLALIPFSRVDDFVRGESNSM  60

Query  3039  ECPTKFHVEARRRRTA-QTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKK  2863
             ECPT+FHVEARR+RTA  TS+KPK+DG+LEYILYWCSFGPDDHRKGG++RPSR TYVPK 
Sbjct  61    ECPTRFHVEARRKRTATHTSFKPKIDGVLEYILYWCSFGPDDHRKGGLIRPSRNTYVPKN  120

Query  2862  KSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMY  2683
             K +GRPNTKRGCTCHFIVKRL AEPSVAL+IYNQDKH+DKKGLPCHGP D+KAAGTRAMY
Sbjct  121   KPSGRPNTKRGCTCHFIVKRLNAEPSVALVIYNQDKHIDKKGLPCHGPHDRKAAGTRAMY  180

Query  2682  APYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRR  2503
             APYISE+LRLR++SLL+ GVSVE+IMQ+HNE+VE+QGGP  RDDLLTHRYVR QERSIRR
Sbjct  181   APYISEELRLRIVSLLHSGVSVESIMQKHNETVEKQGGPSKRDDLLTHRYVRGQERSIRR  240

Query  2502  STYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLAS  2323
             STYELD DDA+S+ +WV SH N +F++   +DSDPFV GIQTEWQLQQMIRFGNR LLA 
Sbjct  241   STYELDEDDAVSVGMWVRSHPNSVFYH---ADSDPFVFGIQTEWQLQQMIRFGNRRLLAY  297

Query  2322  DARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWK  2143
              +R G+NK KYP+HSLV FNS+NKA+PVAWIIAP FAS D  RW++ALYNR++ +DP+WK
Sbjct  298   GSRIGSNKFKYPVHSLVAFNSENKAVPVAWIIAPSFASRDIHRWIQALYNRINGRDPSWK  357

Query  2142  LAGFIVDDPLTDIPAIR  2092
             LAGF++D+P  DIP IR
Sbjct  358   LAGFVLDEPSADIPTIR  374



>ref|XP_009377375.1| PREDICTED: uncharacterized protein LOC103965988 [Pyrus x bretschneideri]
Length=696

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/680 (47%), Positives = 443/680 (65%), Gaps = 7/680 (1%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ +MAR ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARV DFV+G
Sbjct  2     KGHEHKMARMEDILNLPVQDPPCAEFSATHIKWVKVEGGRQGGDDIALIPFARVGDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK--GGVVRPSRT  2881
             ES+N ECP  F VE+RR+R   +  KP+VDG LEY LYWCS+GP+D+R+   G+V  S T
Sbjct  62    ESSNAECPASFRVESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGLVDGSST  121

Query  2880  TYVPKKKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
                  K S  GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A
Sbjct  122   KPASGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGILDQDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+ R +V+S+LYVG+ ++ I+Q H E V+  GGP NRDD L+   VR 
Sbjct  182   MGTRAMYAPRISEEQRQKVMSMLYVGIPLDNIIQHHMELVQGHGGPHNRDDFLSRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER IR S+ +L  DD  SI +WV+ H+ H+F+++D S S+PFVLGIQT+WQ QQM+++G
Sbjct  242   MERGIRNSSPQLHPDDGCSIKMWVQRHRKHVFYFQDSSGSEPFVLGIQTDWQQQQMLQYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             +   +A  + FG  KLKYP+ +L+VFN    AIPVAWII   F S+D  +W+  L  R+ 
Sbjct  302   HNNYIAVHSTFGLKKLKYPLCTLLVFNPSRNAIPVAWIITSSFISQDIHKWIGPLAERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             TKDP W+   F+VDDP  +I  +R+ FQC VL+  W  RH+W + ++K C   +V+  + 
Sbjct  362   TKDPGWRPDSFLVDDPSFEISILRDAFQCRVLLCIWHARHSWIRRILKTCCNFDVQREVF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K+LG +++S   G    +  E F++ FVD   F+DYFK  W P L LW N +R+LP+AS 
Sbjct  422   KQLGWLLYSTRSGSNAMDAVEEFVQVFVDQCAFMDYFKRRWLPNLELWVNCIRSLPVASP  481

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AA+E YH +LK +L NE+  + + R DWL+  L T  HS +WLD+YS +  +    +
Sbjct  482   EPNAAIESYHARLKSKLFNEQYANSWLRVDWLIHTLTTEFHSSYWLDQYSTETGYFENLR  541

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             D+  S   AW ++LQI D DV +D ++   AKV+ Q D+++ + IWNP SEF+ CDC S+
Sbjct  542   DKSFS-TNAWYQALQILDVDVILDEQNLQYAKVISQTDRSLAYTIWNPGSEFSFCDCPSS  600

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
              +GNLC+HV K     +DR  A   ++   YRQAL+ +L   P D L+ DHA+  A  +Q
Sbjct  601   RLGNLCKHVIKVAISCKDRQVARPLLAAQVYRQALLTLLQNIPDDPLVLDHAILHATRLQ  660

Query  1272  KQLNSQIGQESVQVVGPTTT  1213
             + + +     +  ++ P T+
Sbjct  661   QDIKALEVLSNSGLLQPLTS  680



>ref|XP_002516601.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45942.1| conserved hypothetical protein [Ricinus communis]
Length=686

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/657 (47%), Positives = 442/657 (67%), Gaps = 15/657 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             ++IL+LPVQ+PP  EFS+++I W KVEG R   D +AL+P++RV+DFV+GES+N ECP  
Sbjct  2     EDILNLPVQDPPCAEFSAANIKWVKVEGGRQGGDDIALVPFSRVEDFVKGESSNAECPAS  61

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK-------GGVVRPSRTTYVPK  2866
             F VE+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R        G  V+P+      K
Sbjct  62    FRVESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGIGDGSNVKPA----TGK  117

Query  2865  KKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
                 GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D  A GTRAM
Sbjct  118   GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDLDAVGTRAM  177

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+LR +V+++LYVG+S++ I+Q H E V+  GGP NRDD LT   VR  ER +R
Sbjct  178   YAPRISEELRQKVMAMLYVGMSLDNIIQHHAEVVQGHGGPHNRDDFLTRNDVRNMERVVR  237

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S+++L A+D  S  +WV+ HQ H+FF++D S SDPF+LGIQT+WQLQQM+R+G+ G +A
Sbjct  238   NSSHKLHANDDSSFKIWVQRHQKHVFFFQDNSGSDPFILGIQTDWQLQQMLRYGHTGSIA  297

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S ++FG+ KLKYP+ +L+VF+S   AIPVAWII   F S++  +W  +L  ++ TKDP W
Sbjct  298   SHSKFGSKKLKYPLCTLLVFDSSQNAIPVAWIITSSFLSQEIHKWFSSLAEKIRTKDPRW  357

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             + + F+VDDP  DI  IRE F C VL+  W VR +W ++L+K+C  ++V+  + K LG +
Sbjct  358   RPSAFLVDDPSLDISIIREAFHCRVLLCTWHVRRSWIRSLLKKCCNIDVQREMFKHLGWV  417

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++S       A+  E FM+ +VD   F+DYFK  W P + LW N +R+LPLA  E  AA+
Sbjct  418   LYSTRSAANAADAIEEFMQVYVDQSIFIDYFKRRWLPYIELWVNGIRSLPLAGTEPLAAI  477

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +LL+E+  + ++R DWLV  L T  HS +WLD+YS +  +    +D+  S 
Sbjct  478   ESYHIRLKSKLLDEQYANFWKRIDWLVHTLTTAFHSSYWLDQYSVETGYFADVRDK-SSL  536

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW ++L I D DV +D ++   AKV+ Q D+++ ++IWNP +EF+LCDC  + +GNLC
Sbjct  537   ENAWYQALHISDVDVMLDEQNLQLAKVISQTDRSLAYIIWNPGTEFSLCDCPWSRLGNLC  596

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             +H+ K     ++R  A   +    YRQAL+ +L  PP + L+ +HA+  A  +Q+ +
Sbjct  597   KHIVKVAILCKNRQVARPLLVAQVYRQALLALLQDPPDNPLVLEHAIFHATRLQQDI  653



>ref|XP_002309581.2| hypothetical protein POPTR_0006s26200g [Populus trichocarpa]
 gb|EEE93104.2| hypothetical protein POPTR_0006s26200g [Populus trichocarpa]
Length=667

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/650 (48%), Positives = 424/650 (65%), Gaps = 31/650 (5%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ +M R ++ILSLPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARVDDFV+G
Sbjct  2     KGHEPKMPRMEDILSLPVQDPPCAEFSAAHIKWEKVEGGRQGGDDIALIPFARVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTY  2875
             ES+N ECP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         +  
Sbjct  62    ESSNAECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESTMGDGSHT  121

Query  2874  VPKKKSAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
              P      RP  +   RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D  A
Sbjct  122   KPATGKGSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+SLLY+G+S++ I+Q H E V+  GGP NRDDLLT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSLLYIGISLDNIIQHHAEVVQGHGGPLNRDDLLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER +R S+Y+L ADD  S+ +WV+ HQ H+FF++D S ++PF+LGIQT+WQLQQMIR+G
Sbjct  242   MERIVRNSSYKLHADDEFSVKMWVQRHQKHVFFFQDMSSTEPFILGIQTDWQLQQMIRYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             + G +AS + FG  KLKYP+ +L+VF+S   AIPVAWI+A  F ++D  +W+ +L  R+ 
Sbjct  302   HSGSVASHSTFGLKKLKYPLCTLLVFDSSQNAIPVAWIVASSFVTQDIHKWIGSLAERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             +KDP W+   F+VDDP  DI  IRE FQC  L+  W VR AW ++L+K+C  ++V+  + 
Sbjct  362   SKDPRWRPNAFLVDDPSFDISFIREAFQCRFLLCAWHVRRAWMRSLLKKCCNIDVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++S   G    N  E FM+ +VD   F+DYFK  W P + LW N++R+LP+AS 
Sbjct  422   KHLGWILYSTRSGPNADNAVEEFMQVYVDQCIFMDYFKRRWLPFIELWINSIRSLPVAST  481

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AA+E YH +LK +L +++  + Y R DWL+  L T  HS +WLD+YS +        
Sbjct  482   EPLAAIESYHLRLKSKLFDQQYANSYTRIDWLIHTLTTEFHSLYWLDQYSAE--------  533

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMG  1444
                    T +  +L             AKV+ Q ++++ + IWNP SEFALCDC  +  G
Sbjct  534   -------TGYFTNL-------------AKVISQTNRSLAYTIWNPGSEFALCDCPWSRQG  573

Query  1443  NLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHAL  1294
             NLC+HV K     ++R  A   ++   YRQAL+ +L  PP D L+ +HA+
Sbjct  574   NLCKHVIKVAILCKNRQVARPLLASQVYRQALLTLLQNPPDDPLVLEHAI  623



>ref|XP_002281999.2| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648575.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648576.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648577.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 emb|CBI20949.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/665 (47%), Positives = 434/665 (65%), Gaps = 11/665 (2%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ +M R ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP++RVDDFV+G
Sbjct  2     KGHESKMPRMEDILNLPVQDPPCAEFSAAHINWKKVEGGRQGGDDIALIPFSRVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHR--KGGVVRPSRT  2881
             ES N ECP  F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R  + G+   S  
Sbjct  62    ESTNAECPASFRIESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGLGDSSNN  121

Query  2880  TYVPKKKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
                  K S  GR +  RGC CHF VKRL   PS+ALIIYNQ KHVDK G PCHG  D+ A
Sbjct  122   KPASGKGSRPGRRHMMRGCLCHFTVKRLYTRPSLALIIYNQRKHVDKTGAPCHGILDRDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+S+LYVG+S++ I+Q H E V+  GGP NRDD LT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHMEVVQNHGGPHNRDDFLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER IR S++ L  +D  S+  W++ HQ H+FF++  S S+PF+LGIQT+WQLQQM+ +G
Sbjct  242   MERVIRNSSHMLLDNDECSVKAWMQRHQKHVFFFQANSGSEPFILGIQTDWQLQQMLHYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             + G +AS + FG+ KLKYP+ SL+VF+S   AIPVAW+I      +   +WM     R+ 
Sbjct  302   HNGSIASHSTFGSKKLKYPLCSLLVFDSSRNAIPVAWVITSSSIGQGIHKWMGIFVERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             TKDP W+   F+VDDP  +I  IREVFQC VL+  W VR AW ++L+K+C  ++V+  + 
Sbjct  362   TKDPRWRPNAFLVDDPSIEIGVIREVFQCRVLLCLWHVRRAWMRSLLKKCCNLDVQQEMF  421

Query  1983  KRLGEMIHSICKGCEP--ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLA  1810
             K LG++++  C    P   +  + FM+ FVD   F++YF+  W PR+ LW N ++ LP+A
Sbjct  422   KHLGQILY--CTKNRPIIVDAIQEFMQIFVDQCAFMNYFRRRWLPRIELWVNGIKTLPVA  479

Query  1809  SQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARY  1630
             SQE  AA+E YH  LK +L NE   + + R DWL+  L T +HS++WL++Y  +  +   
Sbjct  480   SQEPNAAIESYHLSLKTKLFNELYANHWPRVDWLIHILTTEIHSFYWLEQYIIETGYFEN  539

Query  1629  WKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCN  1459
              +D   +   +W ++L IPD DV +D ++   AKV+ Q D+ + + IWNP SEF +CDC 
Sbjct  540   LRDVSFTT-NSWYRALHIPDADVLLDEQNLQLAKVISQTDRTLAYTIWNPGSEFCICDCP  598

Query  1458  SANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVW  1279
              + +GNLC+H  K     + R  A   +S   YRQAL+ +L  PP D L+ DHA+     
Sbjct  599   WSRLGNLCKHAIKVAILCKSRQVARPLLSAQVYRQALLTLLQNPPDDPLVLDHAILHVTR  658

Query  1278  VQKQL  1264
             +Q+ +
Sbjct  659   LQQDI  663



>ref|XP_006840321.1| hypothetical protein AMTR_s00045p00084300 [Amborella trichopoda]
 gb|ERN01996.1| hypothetical protein AMTR_s00045p00084300 [Amborella trichopoda]
Length=719

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/663 (46%), Positives = 433/663 (65%), Gaps = 4/663 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             D IL L VQNPP  EFSS+DI WSK++  +D  D VALIPY RV++F++GE +  ECPT+
Sbjct  5     DSILDLVVQNPPNEEFSSADITWSKIQKDKDQTDDVALIPYKRVEEFIKGECSKVECPTR  64

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +    + D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65    FHIERGRKRPKGSLKSYQSDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  124

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTC+F+VKRL A PSVALIIYNQ  HV+K G  CHGP D  A G RA   PYI  
Sbjct  125   QSMRGCTCNFVVKRLYARPSVALIIYNQRSHVNKSGFICHGPLDGDAIGPRAKTVPYICN  184

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             + + + +S++Y+G+  E I+++H E V R  G          +YV++ E  I+R+T+ELD
Sbjct  185   ETQQQTMSMIYLGIPEENILEKHIEGVARYCGSNKEVKSFASQYVQKLEMIIKRTTHELD  244

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWV+ ++  +FFY+D SD+D FVLGIQTEWQLQQMIRFG++GLLA+D+ FG 
Sbjct  245   RDDQSSIRLWVDRNKKSVFFYQDSSDTDSFVLGIQTEWQLQQMIRFGHQGLLAADSIFGI  304

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
             +KLKYP+++L+VF+S+   +PVAW+I   F+  D  +WMRALY+R+H+ D +WK++GF++
Sbjct  305   SKLKYPLYTLLVFDSNQHGLPVAWVITRSFSKHDVYKWMRALYDRIHSMDSSWKISGFVI  364

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IR+VF C VL   WRVR AWH+N++K+C  +EV+  + KRLG++++S+  G
Sbjct  365   DDAAAEIDPIRDVFCCPVLFCAWRVRRAWHRNIIKKCCNIEVQREMFKRLGQIMYSVWSG  424

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +  +  E F++DFVD   F+ YFKA W P++ +W  A+++LPLASQE C  +E YH +L
Sbjct  425   ADSVDAMEEFVQDFVDQTAFMKYFKACWVPKIEMWLAAMKSLPLASQEACGVIEGYHMRL  484

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             KL+L ++  L   +R DWLV  L T +HS +WLD Y+      +  K+E++   T+W ++
Sbjct  485   KLKLFDDSQLGALQRVDWLVHILTTELHSIYWLDRYADDSGLFQTVKEEYMLS-TSWHRA  543

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L IPD  V  D +    AKVV Q D    HV+WNP SEFALCDC  +  GNLC+HV K  
Sbjct  544   LLIPDNAVNFDEKDHLFAKVVSQKDSTRSHVVWNPGSEFALCDCEWSMKGNLCKHVIKVN  603

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQ  1234
                R+       +S   +RQ L  +   P  DS   D +++    + +++   +  +S  
Sbjct  604   MVCRNSSKNELPMSFQSFRQILNTLWKKPQDDSFELDQSMAWCTQLHEKIQGLVELDSSN  663

Query  1233  VVG  1225
              +G
Sbjct  664   GIG  666



>gb|KDP43797.1| hypothetical protein JCGZ_23005 [Jatropha curcas]
Length=694

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/659 (47%), Positives = 441/659 (67%), Gaps = 9/659 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL+LPVQ+PP  EFS+S I W K+EG R   D +AL+P++RVDDFV+GES+N E
Sbjct  1     MPRMEDILNLPVQDPPCAEFSASHIKWVKIEGGRQGGDDIALVPFSRVDDFVKGESSNVE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHR--KGGVVRPSRTTYVPKK  2863
             CP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R  + G+   S       K
Sbjct  61    CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDNESGIGDGSNAKPATGK  120

Query  2862  KS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
              S  GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D  A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGMLDLDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+LR +V+S+LYVG+S++ I+Q H + V+  GGP NRDD LT   VR  ER +R
Sbjct  181   YAPRISEELRQKVMSMLYVGISLDNIIQHHTDVVQGHGGPHNRDDFLTRNDVRNMERVVR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++++ A+D  S+ LWV+ HQ H+FF+++ S ++PF+LGIQT+WQLQ M+R+G+ G +A
Sbjct  241   NSSHKMHANDDCSVKLWVQRHQKHVFFFQENSGTNPFILGIQTDWQLQHMLRYGHNGSVA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S + FG  KLKYP+ +L+VF+S   AIPVAW+IA  F S+DT +W  +L  ++ TKDP W
Sbjct  301   SHSTFGLKKLKYPLCTLLVFDSSRNAIPVAWVIASSFVSQDTHKWFGSLAEKIRTKDPGW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +   F+VDDP  DI  IRE F C VL+  WRVR AW ++L+K+C  ++V+  + K L  +
Sbjct  361   RPNAFLVDDPSLDISIIREAFHCRVLLCTWRVRRAWIRSLLKKCCNIDVQREMFKHLSWI  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++S   G    +  E FM+ +VD   F+DYFK  W P + LW+N +R+LP+A  E  AA+
Sbjct  421   LYSTRSGPSAVDAVEEFMQVYVDQSIFMDYFKRRWLPYIELWNNGIRSLPVAGTEPVAAI  480

Query  1785  EFYHNQLKLRLLNER--DLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWI  1612
             E YH +LK +L +E+  + + + R DWL+  L T  HS +WLD+YS +  +    +DE  
Sbjct  481   ESYHIRLKSKLFDEQHANSNSWARIDWLIHTLTTAFHSLYWLDQYSLESGYFASLRDESF  540

Query  1611  SGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGN  1441
                 AW ++L I D DV +D ++   AKV+ Q D+++ + IWNP +EF+LCDC  + +GN
Sbjct  541   LS-NAWYQALHISDVDVMLDEQNLQLAKVISQTDRSLAYTIWNPGTEFSLCDCPWSRLGN  599

Query  1440  LCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             LC+HV K     ++R  A   ++   YRQAL+ +L  P  D ++ +HA+ +A  +Q+ +
Sbjct  600   LCKHVIKVAVICKNRQVARPLLATQVYRQALLTLLQNPTDDPVVLEHAILLATRLQQDI  658



>ref|XP_007224640.1| hypothetical protein PRUPE_ppa026389mg, partial [Prunus persica]
 gb|EMJ25839.1| hypothetical protein PRUPE_ppa026389mg, partial [Prunus persica]
Length=688

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/657 (48%), Positives = 438/657 (67%), Gaps = 8/657 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             + R ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARV DFV+GES+N E
Sbjct  1     IPRMEDILNLPVQDPPCAEFSAAHIKWVKVEGGRQGGDDIALIPFARVGDFVKGESSNAE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK--GGVVRPSRTTYVPKK  2863
             CP  F +E+RRRR   +  KP+VDG LEY LYWCS+GP+D+R+   G+V  S T     K
Sbjct  61    CPASFRIESRRRRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGLVDGSSTKPASGK  120

Query  2862  KS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
              S  GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCICHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGILDQDAMGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+ R +V+S+LYVG+ +++I+Q H E VE  GGP NRDD L+   VR  ER IR
Sbjct  181   YAPRISEEQRQKVMSMLYVGIPLDSIVQHHMEMVEGHGGPHNRDDFLSRNDVRNMERVIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++EL  DD  SI +WV+ H+ ++F+++D S S+PFVLG+QT+WQLQQ++++G+ G +A
Sbjct  241   NSSHELHEDDECSIRMWVQRHRKNVFYFQDSSGSEPFVLGMQTDWQLQQLVQYGHNGYIA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
               + FG  KLKYP+ +L+VFN+   AIPVAW+I   F S+D  +W+  L  R+ TKDP W
Sbjct  301   FHSTFGLKKLKYPLCTLLVFNASRDAIPVAWVITSSFVSQDIHKWIGLLAERIQTKDPRW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +L  F+VDDP  +I  IRE FQC VL+  WR RH+W + L+K C   +V+  + K LG +
Sbjct  361   RLDAFLVDDPSFEISIIREAFQCRVLLCIWRARHSWIRRLLKTCCNFDVQREMFKHLGWL  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++   +     ++ E FM+ FVD   F+DYFK+ W P + LW+N +R+LP+A  E  AA+
Sbjct  421   LYCT-RRPNTLDSVEEFMQVFVDQCAFMDYFKSRWLPNIELWANGIRSLPVAGPEPSAAI  479

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L NE+ ++ + R DWL+  L T   S +WLD+YS +  +    +D+  S 
Sbjct  480   ESYHLRLKSKLFNEQYVNSWSRVDWLIHTLTTEFQSSYWLDQYSIETGYFENLRDKSFST  539

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW ++LQI + DV +D ++   AKV+ Q D+++ + IWNP SEF+LCDC  + +GNLC
Sbjct  540   -NAWYQALQILNVDVILDEQNLQYAKVISQTDRSLAYTIWNPGSEFSLCDCPWSRLGNLC  598

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             +HV K     + R  A   +S   YRQAL+ +L  PP D ++ DHA+  A  +Q+ +
Sbjct  599   KHVIKVAITCKSRQVARPLLSAQVYRQALLTLLQNPPDDPVVLDHAILHATRLQQDI  655



>ref|XP_008219841.1| PREDICTED: uncharacterized protein LOC103320013 [Prunus mume]
Length=695

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/663 (47%), Positives = 440/663 (66%), Gaps = 8/663 (1%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ ++ R ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP+ARV DFV+G
Sbjct  2     KGHEHKIPRMEDILNLPVQDPPCAEFSAAHIKWVKVEGGRQGGDNIALIPFARVGDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK--GGVVRPSRT  2881
             ES+N ECP  F +E+RRRR   +  KP+VDG LEY LYWCS+GP+D+R+   GV+  S T
Sbjct  62    ESSNAECPASFRIESRRRRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGVLDGSST  121

Query  2880  TYVPKKKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
                  K S  GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A
Sbjct  122   KPASGKGSRPGRRHMMRGCICHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGIHDQDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+ R +V+S+LYVG+ +++I+Q H E VE  GGP NRDD L+   VR 
Sbjct  182   MGTRAMYAPRISEEQRQKVMSMLYVGIPLDSIVQHHMEMVEGHGGPHNRDDFLSRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER IR S++EL  DD  SI +WV+ H+ ++F+++D S S+PFVLG+QT+WQLQQ++++G
Sbjct  242   MERVIRNSSHELHEDDECSIRMWVQRHRKNVFYFQDSSGSEPFVLGMQTDWQLQQLVQYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             + G +A  + FG   LKYP+ +L+VFN+   AIPVAW+I   F S+D  +W+  L  R+ 
Sbjct  302   HNGYIAFHSTFGLKILKYPLCTLLVFNASRDAIPVAWVITSSFVSQDIHKWIGLLAERIQ  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             TKDP W+L  F+VDDP  +I  IRE FQC VL+  WR R +W + L+K C   +V+  + 
Sbjct  362   TKDPRWRLDAFLVDDPSFEISIIREAFQCRVLLCIWRARRSWIRRLLKTCCNFDVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++   +     ++ E FM+ FVD   F+DYFK+ W P + LW+N +R+LP+A  
Sbjct  422   KHLGWLLYCT-RRPNTMDSVEEFMQVFVDQCAFMDYFKSRWLPNIELWANGIRSLPVAGP  480

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AA+E YH +LK +L NE+ ++ + R DWL+  L T   S +WLD+YS +  +    +
Sbjct  481   EPNAAIESYHLRLKSKLFNEQYVNSWSRVDWLIHTLTTEFQSSYWLDQYSIETGYFENLR  540

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             D+  S   AW ++LQI + DV +D ++   AKV+ Q D+++ + IWNP SEF+LCDC  +
Sbjct  541   DKSFST-NAWYQALQILNVDVILDEQNLQYAKVISQTDRSLAYTIWNPGSEFSLCDCPWS  599

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
              +GNLC+HV K     + +  A   +S   YRQAL+ +L  PP D L+ DHA+  A  +Q
Sbjct  600   RLGNLCKHVIKVAITCKSQQVARPLLSAQVYRQALLTLLQNPPDDPLVLDHAILHATRLQ  659

Query  1272  KQL  1264
             + +
Sbjct  660   QDI  662



>ref|XP_010249820.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249821.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249822.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249823.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249824.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
Length=694

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/679 (46%), Positives = 437/679 (64%), Gaps = 11/679 (2%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + ++ +M R ++ILSLPVQ+PP  EFS++ I W KVEG R   D +ALIP++RVDDFV+G
Sbjct  2     KGNEPKMPRMEDILSLPVQDPPCAEFSAAHINWVKVEGGRQGGDDIALIPFSRVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHR--KGGVVRPSRT  2881
             ES N ECP  F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R  + GV   S +
Sbjct  62    ESTNAECPANFRIESRRKRPEGSVSKPRVDGYLEYTLYWCSYGPEDYRDSESGVGDGSNS  121

Query  2880  TYVPKKKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
                  K S  GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A
Sbjct  122   KPTSGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDRDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+S+LYVG+S++ I+Q H E VER GGPCNRDD LT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHIEEVERHGGPCNRDDFLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              +R IR STY+L A+D  SI +WV+ HQ ++FF++D S ++ F+LGIQTEWQLQQM+R+G
Sbjct  242   MDRVIRHSTYQLHANDICSIRMWVQRHQKNVFFFQDSSPTESFILGIQTEWQLQQMLRYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             +   +AS + FG  KL+YP+ +L+VF+S   AIPVAW+I      +D  +WM +L  R+ 
Sbjct  302   HDSSVASHSNFGLKKLRYPLCTLLVFDSCQNAIPVAWVITSNSDGQDVHKWMGSLVERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
              KDP W+   F++DDP      +RE FQC VL+  W VR +W ++L+K+C   +V+  + 
Sbjct  362   AKDPRWRPNAFLLDDPSFKALTVREAFQCRVLLCLWHVRRSWIRSLLKKCYNFDVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++ +       +  E FM+ FVD   F+DYF+A W P L LW N +R LP+++Q
Sbjct  422   KYLGRVLYCM----RTMDAIEEFMQIFVDQCAFMDYFRARWLPSLELWVNGMRTLPVSNQ  477

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AALE YH +LK +L NE   + + R DWLV  L T  HS +W ++Y+ +  + R  +
Sbjct  478   EPHAALESYHLRLKSKLFNELQAASWLRVDWLVHTLTTEFHSLYWFEQYTEETGYFRNLR  537

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             +   S   +W ++L IPD DV +D E     KV    D+ + + IWNP SEFALCDC  +
Sbjct  538   EGSFSN-NSWYRALLIPDDDVIMDEEDLRIVKVFSLSDRGLAYTIWNPGSEFALCDCPWS  596

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
              +GNLC+HV K     R+R  A  S++   YRQAL+ +L   P D ++ DHA+     +Q
Sbjct  597   RLGNLCKHVIKVGILCRNRHVARPSLAAQTYRQALLSLLQNLPDDPIVLDHAILHVTRMQ  656

Query  1272  KQLNSQIGQESVQVVGPTT  1216
             + +       +  ++ P T
Sbjct  657   QDIKGLEDLSNSGLLQPLT  675



>ref|XP_010095498.1| hypothetical protein L484_014926 [Morus notabilis]
 gb|EXB60472.1| hypothetical protein L484_014926 [Morus notabilis]
Length=690

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/657 (47%), Positives = 431/657 (66%), Gaps = 15/657 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             ++IL+LPVQ+PP  EFS+  + W KVEG R   D VALIP+ARVDDFV+GES+N ECP  
Sbjct  2     EDILNLPVQDPPCAEFSADHLKWVKVEGGRQGGDDVALIPFARVDDFVKGESSNAECPAS  61

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRK-------GGVVRPSRTTYVPK  2866
             F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R+       G  ++P+      K
Sbjct  62    FRIESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRESHSGLEDGSNIKPASG----K  117

Query  2865  KKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
                 GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D+ + GTRAM
Sbjct  118   GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKSGAPCHGILDRDSLGTRAM  177

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISEDLR +V+S+LY+GV +++I+Q H E V+  GGP NRDD LT   VR  ER IR
Sbjct  178   YAPRISEDLRQKVMSMLYIGVPLDSIIQHHAEVVQGHGGPHNRDDFLTRNDVRNMERLIR  237

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
               ++E  A D  S+ +WV+ H  H+F+ + +S  +PFVLGIQT+WQLQQM+R+GN G +A
Sbjct  238   NYSHEFHASDECSVQMWVQRHHKHVFYLQSYSGVEPFVLGIQTDWQLQQMLRYGNNGSMA  297

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
               + F   KLKYP+ +L+VF+    AIPVAW+I+  F ++D  +WM  L  RV TKDP W
Sbjct  298   FHSMFSLKKLKYPLCTLLVFDLSRNAIPVAWVISSSFVNQDVQKWMGILAERVRTKDPRW  357

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +L  F+VDDP  ++  IRE FQC VL+  W+VR A  ++L+K+C  ++V+  I K LG +
Sbjct  358   RLNSFLVDDPSFNVSIIREAFQCRVLLCVWQVRRACIRSLLKKCCNIDVQREIFKHLGWI  417

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++         +  E FM+ FVD   F+DYFK  W P + LW + +++LP++S E  AA+
Sbjct  418   LYCTRSEQHAMDALEEFMQVFVDQCAFMDYFKRRWLPSIELWISGIKSLPVSSPEPNAAI  477

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LKL+L NE++ + + R DWL+  L T  HS +WLD+YS +  +    +D+  S 
Sbjct  478   ESYHLRLKLKLFNEQNANSWSRVDWLIHTLTTEFHSLYWLDQYSSETGYFDNLRDKAFST  537

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW ++LQIPD DV +D  +   AKV+ Q D+++ + I NP SEF+LCDC  + +GNLC
Sbjct  538   -NAWCQALQIPDVDVILDEHNLQLAKVISQTDRSLAYTILNPGSEFSLCDCPWSGVGNLC  596

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             +HV K     + R  A   ++   YRQ L+ ++  PP D L+ DHA+  A  +Q+++
Sbjct  597   KHVIKVAMLCKSRQVARPLLAAQVYRQTLLALMQNPPDDPLVLDHAILHATRLQQEI  653



>gb|KHN10289.1| hypothetical protein glysoja_017893 [Glycine soja]
Length=723

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/670 (46%), Positives = 435/670 (65%), Gaps = 11/670 (2%)
 Frame = -3

Query  3243  PNSRNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDF  3064
             P + ++  +M R ++IL+LPVQ+P   EFS++ I W K+EG R   D +ALIP+ARVDDF
Sbjct  25    PFAESNATKMPRMEDILNLPVQDPLYPEFSAAHINWVKLEGGRQGGDDIALIPFARVDDF  84

Query  3063  VRGESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSR  2884
             V+GES+N ECP  F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R+        
Sbjct  85    VKGESSNPECPASFRIESRRKRPVGSIAKPRVDGYLEYTLYWCSYGPEDYRESDSGVGDG  144

Query  2883  TTYVPKKKSAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQD  2713
             T+  P      RP  +   RGC CHF VKRL   P +ALIIYNQ +HVDK G PCHG  D
Sbjct  145   TSTKPASGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRRHVDKSGAPCHGLLD  204

Query  2712  KKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRY  2533
             + A GTRAMYAP IS++LR +V+S+LYVG+S++ I+Q H E +++QGGP NRDD LT   
Sbjct  205   RDAVGTRAMYAPRISDELRQKVMSMLYVGISLDKIIQHHAEGMQKQGGPQNRDDFLTRND  264

Query  2532  VRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMI  2353
             VR  ER++R S++EL  +D  S+ +WV+ HQ H+F+++D S S+PFVLGIQT+WQLQQM+
Sbjct  265   VRNMERTVRNSSHELHENDECSVKIWVQRHQKHVFYFQDNSGSEPFVLGIQTDWQLQQML  324

Query  2352  RFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYN  2173
             R+GN   ++  + FG  KLKYPI SL+VFNS   AIPVAWII      +   +W+  L  
Sbjct  325   RYGNNSFISFHSSFGLKKLKYPICSLLVFNSSQNAIPVAWIITSSSVGKAIHKWIVLLCE  384

Query  2172  RVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRV  1993
             R+ TKDP W+    ++DDP  D   IRE FQC +L+  W VR  W K L+K+C  +EV+ 
Sbjct  385   RLRTKDPRWRPNAILLDDPSLDYSIIREAFQCRILLCAWHVRRTWIKKLLKKCCNIEVQR  444

Query  1992  TIAKRLGEMIHSICKGCEP--ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRAL  1819
              + K+LG +++  C  C P   +  E  M+ FVD   F+DYFK+ W   + +W NA+++L
Sbjct  445   EMFKQLGWILY--CTKCGPNAMDAVEELMQIFVDQCAFMDYFKSHWLASIDMWINAIKSL  502

Query  1818  PLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDF  1639
              + + E  AA+E YH +LK  LL E   + + R DWL+  L T  HS +WLD+YS +  +
Sbjct  503   SVTTPEPHAAIESYHLKLKSMLLKENYANFWPRVDWLIHALTTEFHSLYWLDQYSLETGY  562

Query  1638  ARYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALC  1468
                 +D   S   AW  +L IPD DV +D ++   AKV+ Q D+++V+ + NP SEF+LC
Sbjct  563   FENLRDNSFSS-NAWYHALHIPDVDVILDEQNLHLAKVLSQTDRSLVYTVSNPGSEFSLC  621

Query  1467  DCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSV  1288
             DC+ + +GNLC+HV K   + R R  A  S+S   Y+QAL+ +LH PP D L+ DH +  
Sbjct  622   DCSWSRLGNLCKHVIKVATFCRSRQVARPSLSAQVYKQALLTLLHNPPDDPLVLDHTILH  681

Query  1287  AVWVQKQLNS  1258
                +Q+ + +
Sbjct  682   VAHLQQDIKA  691



>ref|XP_006578182.1| PREDICTED: uncharacterized protein LOC100779025 [Glycine max]
Length=690

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/661 (47%), Positives = 430/661 (65%), Gaps = 11/661 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL+LPVQ+P   EFS++ I W K+EG R   D +ALIP+ARVDDFV+GES+N E
Sbjct  1     MPRMEDILNLPVQDPLYPEFSAAHINWVKLEGGRQGGDDIALIPFARVDDFVKGESSNPE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP  F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R+        T+  P    
Sbjct  61    CPASFRIESRRKRPVGSIAKPRVDGYLEYTLYWCSYGPEDYRESDSGVGDGTSTKPASGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL   P +ALIIYNQ +HVDK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRRHVDKSGAPCHGLLDRDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP IS++LR +V+S+LYVG+S++ I+Q H E +++QGGP NRDD LT   VR  ER++R
Sbjct  181   YAPRISDELRQKVMSMLYVGISLDKIIQHHAEGMQKQGGPQNRDDFLTRNDVRNMERTVR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++EL  +D  S+ +WV+ HQ H+F+++D S S+PFVLGIQT+WQLQQM+R+GN   ++
Sbjct  241   NSSHELHENDECSVKIWVQRHQKHVFYFQDNSGSEPFVLGIQTDWQLQQMLRYGNNSFIS  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
               + FG  KLKYPI SL+VFNS   AIPVAWII      +   +W+  L  R+ TKDP W
Sbjct  301   FHSSFGLKKLKYPICSLLVFNSSQNAIPVAWIITSSSVGKAIHKWIVLLCERLRTKDPRW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +    ++DDP  D   IRE FQC +L+  W VR  W K L+K+C  +EV+  + K+LG +
Sbjct  361   RPNAILLDDPSLDYSIIREAFQCRILLCAWHVRRTWIKKLLKKCCNIEVQREMFKQLGWI  420

Query  1965  IHSICKGCEP--ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCA  1792
             ++  C  C P   +  E  M+ FVD   F+DYFK+ W   + +W NA+++L + + E  A
Sbjct  421   LY--CTKCGPNAMDAVEELMQIFVDQCAFMDYFKSHWLASIDMWINAIKSLSVTTPEPHA  478

Query  1791  ALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWI  1612
             A+E YH +LK  LL E   + + R DWL+  L T  HS +WLD+YS +  +    +D   
Sbjct  479   AIESYHLKLKSMLLKENYANFWPRVDWLIHALTTEFHSLYWLDQYSLETGYFENLRDNSF  538

Query  1611  SGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGN  1441
             S   AW  +L IPD DV +D ++   AKV+ Q D+++V+ + NP SEF+LCDC+ + +GN
Sbjct  539   SS-NAWYHALHIPDVDVILDEQNLHLAKVLSQTDRSLVYTVSNPGSEFSLCDCSWSRLGN  597

Query  1440  LCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
             LC+HV K   + R R  A  S+S   Y+QAL+ +LH PP D L+ DH +     +Q+ + 
Sbjct  598   LCKHVIKVATFCRSRQVARPSLSAQVYKQALLTLLHNPPDDPLVLDHTILHVAHLQQDIK  657

Query  1260  S  1258
             +
Sbjct  658   A  658



>ref|XP_008787735.1| PREDICTED: uncharacterized protein LOC103705694 [Phoenix dactylifera]
Length=725

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/654 (46%), Positives = 432/654 (66%), Gaps = 4/654 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             D I  +PVQ+PP  EFS++D+ W+K      ++D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     DSIDDIPVQDPPDEEFSAADLTWTKFGTTEHHVDDVALIPYARVDAFISGECSNAECPTR  64

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  L+Y LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65    FHIERGRKREKGSLKEYKSDEYLQYRLYWCSFGPENYGEGGSILPSRRYRLNTRNRAARP  124

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF VKRL A PS+ALIIY++ +H++K G  CHGP D+ A G  A   PYI  
Sbjct  125   QSMRGCTCHFAVKRLYARPSIALIIYHERRHINKAGFICHGPLDRDAIGPGAKKIPYICS  184

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +SL+Y+G+  E ++Q+H E V+R  G   + + L  +YV++    I+RST+ELD
Sbjct  185   EIQQQTMSLIYLGIPEENVLQKHIEGVQRYCGSNAKVNSLASQYVQKLGMIIKRSTHELD  244

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  +FFY+D +++DPF+LGIQTEWQLQQMIRFG++ LLASD+ FG 
Sbjct  245   LDDQASIRMWVEKNRKSVFFYQDSTETDPFILGIQTEWQLQQMIRFGHQSLLASDSSFGI  304

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
             +KLKYP+++L+ F+S   A+PVAW+I    A +D VRWM+AL +RV   D  +K+ GFI+
Sbjct  305   SKLKYPLYTLLAFDSRQHALPVAWVITRTIAKQDVVRWMKALADRVRAVDSGFKIGGFII  364

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DDP ++I  IR+VF C VL S WR+R +WHKN++K+C  MEV+  + KRLG+++ S+   
Sbjct  365   DDPASEIDPIRDVFCCPVLFSLWRIRRSWHKNVVKKCGNMEVQQELFKRLGKIMDSVWSK  424

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +  +  E   +DFVD   F+ YFKA W P++ +W   +R+LPLA QE+C A E YH +L
Sbjct  425   VDYMDALEELFQDFVDQTTFMQYFKACWVPKIEMWLATIRSLPLAGQESCGATEGYHVKL  484

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             KL++ ++  L   +R DWLV KL T +HS +WLD Y+ +       K+E+IS  T+W ++
Sbjct  485   KLKIYDDSHLGALQRVDWLVHKLTTELHSGYWLDLYADESGSFPAVKEEYISS-TSWHRA  543

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  V  D E    AKVV Q D +  H++WNP SEFALCDC+ +  GNLC+H+ K  
Sbjct  544   LQIPDDAVVFDDEEHLFAKVVSQEDGSHTHMVWNPGSEFALCDCSWSMQGNLCKHIIKVN  603

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
                R R     ++S   +   L+ +   P  DSL  D +++ A  +Q ++   +
Sbjct  604   MMCRHRKEYQPTLSYQSFEHVLLNLWRKPMDDSLSLDQSMAWARQMQDKIQGLV  657



>ref|XP_007040728.1| SWIM zinc finger family protein [Theobroma cacao]
 gb|EOY25229.1| SWIM zinc finger family protein [Theobroma cacao]
Length=718

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/656 (45%), Positives = 439/656 (67%), Gaps = 9/656 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL +PVQ+PP  EFSS+D+ W+K  G  ++ D VALIPYARVD+F+ GE +N ECPT+
Sbjct  5     ESILDIPVQDPPEEEFSSADLTWTKF-GAAEHHDDVALIPYARVDEFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGILPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGC CHF+VKRL A+PS+ALIIYN+ +H++K G  CHGP DK A G  A   PYIS 
Sbjct  124   QSMRGCMCHFVVKRLYAQPSLALIIYNERRHINKSGFVCHGPLDKDAIGPGAKKIPYISN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   R   L  +YVR+    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIECIQRYCGSDARVSTLASQYVRKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S++DPF+LGIQTEWQLQQM+RFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDTSETDPFILGIQTEWQLQQMVRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PV+W+I    A  D  +WM+AL +R  + +P WK+ GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVSWVITRSVAKSDVAKWMKALLDRARSIEPGWKINGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IR+ F C +L S WRVR +W +N++K+CS +EV+  I KRLGE+++SI  G
Sbjct  364   DDAAMEIDPIRDTFYCPILFSLWRVRRSWLRNVVKKCSNIEVQREIFKRLGEIVYSIWGG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
                +   E  ++DFVD   FV+YFK++W P++ +W + ++ +PLASQE   A+E YH +L
Sbjct  424   INTSVALEELIQDFVDQNAFVEYFKSSWVPKIEMWLSTMKTIPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D     K+E+I+  T+W ++
Sbjct  484   KTKLFDDSHLGALQRVDWLVHKLTTELHSTYWLDRYADESDSFLNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+  ++   AKV  Q D ++ H++WNP S+FA CDC  +  GN C+HV K  
Sbjct  543   LQIPDSFVTLGDKANLFAKVASQKDISITHLVWNPGSDFAFCDCAWSMQGNFCKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +R     S+S   +R+ L+ +L  P  DS+  D +++   W  + L+ QI Q
Sbjct  603   MMCENREGYKPSMSFQSFREILMDLLKKPMDDSIALDESVA---WTHQMLD-QIKQ  654



>gb|KDP32636.1| hypothetical protein JCGZ_13186 [Jatropha curcas]
Length=721

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/656 (46%), Positives = 436/656 (66%), Gaps = 9/656 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL +PVQNP   EF+S+D+ W+K  G  +  D VALIPY RVD F+ GE +N ECPT+
Sbjct  5     ENILDIPVQNPSEEEFASADLTWTKY-GTAERYDDVALIPYERVDTFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKNDEYLEYKLYWCSFGPENYGEGGSILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PSVALIIYN+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSVALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   R D L  +YV++    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNARVDSLASQYVQKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S+ +PF+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQSSIRMWVERNKKSIFFYQDTSEDNPFILGIQTEWQLQQMIRFGHRSLVAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+P+AW+I   FA  D  +WM+AL +R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPIAWVITRSFAKPDVSKWMKALLSRASSVEPGWKISGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IR++F C +L SFWRVR +W +N++K+C  +EV+  I KRLG++++ I +G
Sbjct  364   DDAAAEIDPIRDIFGCPILFSFWRVRRSWLRNIVKKCGNIEVQREIFKRLGKIVYGIWEG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E    DFVD   F+ Y KA+W P++ +W + +R LPLASQE   A+E YH +L
Sbjct  424   VDTLAALEELTRDFVDQTAFIQYLKASWVPKIEMWLSTIRGLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+++  T+W ++
Sbjct  484   KAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYVAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D +    AKV  Q D N++H++WNP SEFA CDC+ +  GNLC+HV K  
Sbjct  543   LQIPDSAVTLDDKDQLFAKVSSQKDSNLMHIVWNPGSEFAFCDCSWSLQGNLCKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +R     S+S   +++ L  +      DS+  D  LS+A W Q+ LN QI Q
Sbjct  603   MICENRQGYQCSMSFRSFKEILTNIWKKHSDDSVNLD--LSMA-WTQQMLN-QIKQ  654



>dbj|BAF01455.1| hypothetical protein [Arabidopsis thaliana]
Length=551

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/426 (66%), Positives = 346/426 (81%), Gaps = 0/426 (0%)
 Frame = -3

Query  2535  YVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQM  2356
             YVRR ERSIRRSTYELD DD +SIS+WVESHQ+H+FF++ FSD+DPF LGIQTEWQLQQM
Sbjct  1     YVRRLERSIRRSTYELDEDDDVSISMWVESHQSHVFFFEGFSDTDPFSLGIQTEWQLQQM  60

Query  2355  IRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALY  2176
             IRFGN  LLASD+RFGTN LKYPIHSLVVF+S+NKAIPVAWIIAPRF+S D  RWMRAL 
Sbjct  61    IRFGNCRLLASDSRFGTNTLKYPIHSLVVFDSENKAIPVAWIIAPRFSSGDAYRWMRALC  120

Query  2175  NRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVR  1996
             NRVH KDP+WK+AGFIVDDP  DI AIR+VFQC VL SFWR+RHAWHKN++KRC E + R
Sbjct  121   NRVHAKDPSWKVAGFIVDDPFADIIAIRDVFQCPVLFSFWRLRHAWHKNIIKRCRETKTR  180

Query  1995  VTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALP  1816
             V I++ LG+ +  I +    A  F++F+EDFV + EFV+YF++ W PR+G W++AL++LP
Sbjct  181   VEISRHLGQAVDKISRRQGTATLFDSFVEDFVGSPEFVEYFRSVWSPRIGAWTSALQSLP  240

Query  1815  LASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFA  1636
             LASQETCAA+E YH QLK RLLNERD   Y+RADWLVDKLGT VHSYFWLDEYSGKD+FA
Sbjct  241   LASQETCAAMELYHYQLKCRLLNERDSEAYQRADWLVDKLGTKVHSYFWLDEYSGKDNFA  300

Query  1635  RYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNS  1456
             RYWK+EW+SGLT++RK+L IPD DV I G SAK+ D+ D N +HV+WNP S+F +C C+ 
Sbjct  301   RYWKEEWVSGLTSFRKALSIPDSDVVISGMSAKITDECDGNEIHVVWNPGSQFGVCSCSW  360

Query  1455  ANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWV  1276
             A  G +C+H+ K  +      +A  S S+ QY Q LI +L CPP+DSL RD+A+S+AV V
Sbjct  361   AEKGYICKHMIKLTQLCLGNRAARQSASLLQYYQTLIDLLRCPPHDSLFRDYAVSLAVSV  420

Query  1275  QKQLNS  1258
             +KQ+N+
Sbjct  421   EKQINA  426



>ref|XP_010255617.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255624.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255633.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255642.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
Length=718

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/641 (46%), Positives = 429/641 (67%), Gaps = 5/641 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL++PVQ+PP  +FSS+D+ W+K  G  ++ D VALIPY RVD F+ GE +N ECPT+
Sbjct  5     ESILNIPVQDPPEEDFSSADLNWTKF-GTAEHHDDVALIPYDRVDAFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +    K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKTYKSDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+ALIIYN+ +H++K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALIIYNERRHINKSGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++Q+H E V+R  G   +   L  +YVR+    I+RSTYELD
Sbjct  184   EIQQQTMSMIYLGLPEENVLQKHIEGVQRYCGSNAKVTTLASQYVRKLGMIIKRSTYELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  +FFY+D S++DPF+LGIQTEWQLQQMIRFG  GL+A D+ FG 
Sbjct  244   LDDQASIRLWVERNKKSVFFYQDSSETDPFILGIQTEWQLQQMIRFGYHGLMACDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAW+I    A +D  +WM++L +R  T D  WK+ GF++
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWVITRTAAKQDVSKWMKSLLDRARTIDSAWKINGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   ++  IR++F C VL   WRVR +W +N++K+C+ +EV+  I KRLG+++++I  G
Sbjct  364   DDAAAEVDPIRDIFCCPVLFCLWRVRRSWLRNIIKKCNNIEVQREIFKRLGKIVYAIWGG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              + A+    F++DFVD   F+ YFKA W P++ +W   ++A PLASQE   A+E YH +L
Sbjct  424   MDSADAMGEFIQDFVDQTAFMQYFKACWVPKIEMWLATMKAFPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             KL+L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KLKLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D +    AKVV Q D +  H+IWNP SEF+ CDC  +  GNLC+HV K  
Sbjct  543   LQIPDAAVTLDDKEHLFAKVVSQKDSSQSHLIWNPGSEFSFCDCEWSMQGNLCKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALS  1291
                ++  +   S+S   +R+ L+ +   P  DS+  D +++
Sbjct  603   MICQNCKNYQPSMSFQSFREILLNLWKKPIDDSIALDQSIA  643



>ref|XP_008441058.1| PREDICTED: uncharacterized protein LOC103485285 [Cucumis melo]
Length=718

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/645 (46%), Positives = 432/645 (67%), Gaps = 5/645 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + IL L VQ+PP  EF S+D+ W+K  G  ++ D VALIPYARVD F+ GE  N E
Sbjct  1     MAIVESILDLQVQDPPEEEFYSADLTWTKF-GTVEHHDEVALIPYARVDAFIIGECTNIE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+R+  +  + K D  LEY  YWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRSRGSLKEFKDDEYLEYRQYWCSFGPENYGEGGSILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A PS+ALIIYN+ +HV+K G  CHGP D++A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPFDREAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S+LY+G+    I+++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMLYLGIPEANIVEKHLECLQRYCGSNAKANSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SIS+WVE ++  IF ++D S+ + F+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDQASISMWVERNKKSIFIHQDTSEDNSFILGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAWII   FA  D  +WM+AL +R H+ +P WK++
Sbjct  300   TFGIRRLKYPLCTLLVFDSRQHALPVAWIITRSFAKSDVSKWMKALLDRAHSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD  T+I  I ++F C VL S WR+R +W KN++++CS +EV+  I KRLG++++S
Sbjct  360   GFLIDDAATEINPIMDIFCCPVLFSLWRIRRSWLKNVVRKCSSIEVQREIFKRLGKLVYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G + +   E F  DFVD   F++YFK  W P++ +W +A+R  PLASQE   A+E Y
Sbjct  420   IWDGIDTSVVLEEFTRDFVDQTAFMEYFKGCWVPKIEMWLSAMRTFPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L  ++R DWLV KL T +HS +WLD Y+ + D  +  K+E+IS  T+
Sbjct  480   HMKLKAKLFDDSHLGAFQRVDWLVHKLTTELHSTYWLDRYADESDSFQNVKEEYISS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  VT+D E+   AKV+ Q D ++ HV+WNP SEF+ CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDSSVTLDEENHLFAKVLSQKDTSISHVVWNPGSEFSFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALS  1291
              K      +  S   S+S   + + L+ M   P  DS+  D +++
Sbjct  599   IKVNMVCENCPSYKPSMSFQSFEEILMNMWKLPMDDSVALDVSMA  643



>ref|XP_002274170.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 ref|XP_010649364.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 ref|XP_010649365.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 emb|CBI37532.3| unnamed protein product [Vitis vinifera]
Length=720

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/651 (45%), Positives = 436/651 (67%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL +PVQ+P   EFSS+D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     ESILDIPVQDPKEEEFSSADLNWTKF-GNPEHHDDVALIPYARVDAFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKEYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+ALIIYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICS  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R ++A D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDSSEADPFILGIQTEWQLQQMIRFGHRSIMAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII   FA  D  +WM+AL +R    D  WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWIITRSFAKPDVSKWMKALLDRARGIDIGWKVSGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I +IR+VF C VL S WRVR +W +N++K+ S +EV+  + KRLG++++SI  G
Sbjct  364   DDAAAEIDSIRDVFCCPVLFSLWRVRRSWLRNIIKKSSNVEVQREMFKRLGKIVYSIWSG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E F +DFVD   F++YFKA W P++ +W + ++ LPLASQE   A+E YH +L
Sbjct  424   VDSLVALEEFTQDFVDQTSFIEYFKALWMPKIEMWIDMMKTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KVKLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L+IPD  V ++ ++   AKV+ Q D N+ H++WNP SEFA CDC  A  GNLC+H+ K  
Sbjct  543   LRIPDTSVILEDKNQLFAKVLSQKDSNLTHLVWNPGSEFAFCDCEWAMQGNLCKHIIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                ++  +  SS+S   +R+ L+ +   P  DS+  D A++   W  + L+
Sbjct  603   MICKNHQAYQSSMSFQSFREILMNLWRKPMDDSVALDQAVA---WTHQMLD  650



>ref|XP_010921228.1| PREDICTED: uncharacterized protein LOC105044872 [Elaeis guineensis]
Length=725

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/669 (44%), Positives = 435/669 (65%), Gaps = 13/669 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             D I  +PVQ+PP  EFS++D+ W+K      +ID VALIPYARVD F+ GE  N ECPT+
Sbjct  5     DSIDDIPVQDPPGEEFSAADLSWTKFGTTEHHIDDVALIPYARVDAFISGECLNAECPTR  64

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  L+Y LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65    FHIERGRKREKGSLKEYKSDEYLQYRLYWCSFGPENYGEGGSILPSRRYRLNTRNRAARP  124

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF VKRL A PS+ALI+Y++ +H++K G  CHGP D+ A G  A   PYI  
Sbjct  125   QSMRGCTCHFAVKRLYARPSIALIVYHERRHINKSGFICHGPLDRDAIGPGAKKIPYICS  184

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +SL+Y+G+  E ++Q H E V+R  G   + + L  +YV++    I+RST+ELD
Sbjct  185   EIQQQTMSLIYLGIPEENVLQTHIEGVQRYCGSNAKVNSLASQYVQKLGMIIKRSTHELD  244

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  +FFY+D +++DPF+LGIQTEWQLQQMIRFG++ LLASD+ FG 
Sbjct  245   LDDQASIRMWVEKNRKSVFFYQDSTETDPFILGIQTEWQLQQMIRFGHQSLLASDSSFGI  304

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
             +KLKYP+++L+VF+S   A+PVAW+I    A +D ++WM+AL +RV   D  +K+ GFI+
Sbjct  305   SKLKYPLYTLLVFDSRQHALPVAWVITRTIAKQDVIKWMKALADRVRAVDSGFKIGGFII  364

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DDP ++I   R+VF C VL S WR+R +WHKN++K+CS +EV+  + KRLG+++ S+   
Sbjct  365   DDPASEIDPFRDVFCCPVLFSLWRIRRSWHKNVVKKCSNIEVQQELFKRLGKIMDSVWSK  424

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +  +  E   +DFVD   F+ YFKA W P++ +W   +R+ PLA QE+C A+E YH +L
Sbjct  425   VDYMDALEELFQDFVDQTTFMQYFKACWVPKIEMWLATIRSFPLAGQESCGAIEGYHVKL  484

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             KL++ ++  L   +R DWLV KL T +HS +WLD Y+ +       K+E+IS  T+W ++
Sbjct  485   KLKIYDDLHLGALQRVDWLVHKLTTELHSGYWLDLYADESGSFPAVKEEYISS-TSWHRA  543

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  V  D +    AKVV Q D +   ++WNP SEFALCDC+ +  GNLC+H+ K  
Sbjct  544   LQIPDDAVVFDDKEHLFAKVVSQKDSSHTRIVWNPGSEFALCDCSWSMQGNLCKHIIKVN  603

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQ  1234
                R R     ++S   +   L+ +   P  DS   D +++   WV++       Q+ +Q
Sbjct  604   MMCRHRREYRPTLSYQSFEHVLLNLWRKPMDDSFSLDQSMA---WVRQM------QDKIQ  654

Query  1233  VVGPTTTYG  1207
              +   TT G
Sbjct  655   RLVEITTSG  663



>ref|XP_004148660.1| PREDICTED: uncharacterized protein LOC101204643 [Cucumis sativus]
 gb|KGN48347.1| hypothetical protein Csa_6G483290 [Cucumis sativus]
Length=718

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/645 (46%), Positives = 432/645 (67%), Gaps = 5/645 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + IL L VQ+PP  EF S+D+ W+K  G  ++ D VALIPYARVD F+ GE  N E
Sbjct  1     MAIVESILDLQVQDPPEEEFYSADLTWTKF-GTVEHHDEVALIPYARVDAFIIGECTNIE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+R+  +  + K D  LEY  YWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRSRGSLKEFKDDEYLEYRQYWCSFGPENYGEGGSILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A PS+ALIIYN+ +HV+K G  CHGP D++A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPFDREAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S+LY+G+    I+++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMLYLGIPEANIVEKHLECLQRYCGSNAKANSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SIS+WVE ++  IF ++D S+ + F+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDRASISMWVERNKKSIFIHQDTSEDNSFILGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAWII   FA  D  +WM+AL +R  + +P WK++
Sbjct  300   TFGIRRLKYPLCTLLVFDSRQHALPVAWIITRSFAKSDVSKWMKALLDRAQSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD  T+I  I ++F C VL S WR+R +W KN++++CS +EV+  I KRLG++++S
Sbjct  360   GFLIDDAATEIDPIMDIFCCPVLFSLWRIRRSWLKNVVRKCSSIEVQREIFKRLGKLVYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G + +   E F  DFVD   F++YFK  W P++ +W +A+RA PLASQE   A+E Y
Sbjct  420   IWDGVDASVVLEEFTRDFVDQTAFMEYFKGCWVPKIEMWLSAMRAFPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L  ++R DWLV KL T +HS +WLD Y+ + D  +  K+E+IS  T+
Sbjct  480   HMKLKAKLFDDSHLGAFQRVDWLVHKLTTELHSTYWLDRYADESDSFQNVKEEYISS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  VT+D E+   AKV+ Q D ++ HV+WNP SEF+ CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDSSVTLDDENHLFAKVLSQKDTSISHVVWNPGSEFSFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALS  1291
              K      +  S   S+S   + + L+ M   P  DS+  D +++
Sbjct  599   IKVNMVCENCPSYKPSMSFQSFEEILMNMWKLPMDDSVALDVSMA  643



>ref|XP_007137090.1| hypothetical protein PHAVU_009G098900g [Phaseolus vulgaris]
 gb|ESW09084.1| hypothetical protein PHAVU_009G098900g [Phaseolus vulgaris]
Length=744

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/662 (46%), Positives = 425/662 (64%), Gaps = 11/662 (2%)
 Frame = -3

Query  3219  QMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANK  3040
             +M R ++IL+LPVQ+P   E S++ I W K+EG R   D +ALIP+ARVDDFV+GES+N 
Sbjct  54    KMPRMEDILNLPVQDPLCTELSAAYINWVKLEGGRQGGDDIALIPFARVDDFVKGESSNP  113

Query  3039  ECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKG--GVVRPSRTTYVPK  2866
             ECP  F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R+   GV     T  V  
Sbjct  114   ECPASFRIESRRKRAEGSIAKPRVDGYLEYTLYWCSYGPEDYRESDSGVGDGMSTKPVSG  173

Query  2865  KKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
             K S  GR +  RGC CHF +KRL   P +ALIIYNQ +HVDK G PCHG  D+ A GTRA
Sbjct  174   KGSRPGRRHMMRGCLCHFTIKRLYTRPLLALIIYNQRRHVDKSGAPCHGLLDRDAVGTRA  233

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MYAP IS+DLR +V+S+LY G+S++ I+Q H E +++QGGP NRDD LT   VR  ER+I
Sbjct  234   MYAPRISDDLRQKVMSMLYAGMSLDKIIQHHTEEMQKQGGPQNRDDFLTRNDVRNMERTI  293

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             R S++EL  +D  S+ +WV+ HQ H+F+++D S S+PFVLGIQT+WQLQQM+R+GN  L+
Sbjct  294   RNSSHELHENDGCSVKMWVQRHQKHVFYFQDNSASEPFVLGIQTDWQLQQMLRYGNNSLI  353

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             +  + FG  KLKYP+ SL+VFNS   AIPVAWIIA  F  +   +WM  L  R+ TKDP 
Sbjct  354   SFHSGFGLKKLKYPVCSLLVFNSSQNAIPVAWIIASSFVGKSFHKWMVLLSERLRTKDPR  413

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             W+    ++DDP      IRE FQC +L   W VR    K L+K+C   EV+  +   LG 
Sbjct  414   WRPGAILLDDPSLHFSIIREAFQCRILSCAWHVRRTLIKKLLKKCRNFEVQREMFMHLGW  473

Query  1968  MIHSICKGCEP--ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETC  1795
             +++  C  C P   ++ E FM+ FVD   F+DYFK  W   + +W NA+++ P  + E  
Sbjct  474   ILY--CTKCGPNAMDSVEEFMQIFVDQCSFMDYFKNHWQASIDMWINAIKSFPATTPEPH  531

Query  1794  AALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEW  1615
             AA+E YH +LK  LL E   + + R DWL+  L T   S +WLD+YS +  +    +   
Sbjct  532   AAIESYHLKLKSVLLKENYGNSWPRVDWLIHALTTEFLSLYWLDQYSLETGYFENLQGNS  591

Query  1614  ISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMG  1444
              +   AW  +L IPD DV +D ++   AKV+ Q D+++V+ +WNP SEF+LCDC+ + +G
Sbjct  592   YTS-NAWHHALHIPDVDVMLDEQNLHLAKVLSQTDRSLVYTVWNPGSEFSLCDCSWSRLG  650

Query  1443  NLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             NLC+HV K   + R R     S+S   Y+QAL+ +   PP D L+ DH +     +Q+ +
Sbjct  651   NLCKHVIKVANFCRHRQVVKPSLSAQVYKQALLTLFENPPNDPLVLDHTMLHVARLQQDI  710

Query  1263  NS  1258
              +
Sbjct  711   KA  712



>ref|XP_004163046.1| PREDICTED: uncharacterized LOC101204643 [Cucumis sativus]
Length=718

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/645 (46%), Positives = 432/645 (67%), Gaps = 5/645 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + IL L VQ+PP  EF S+D+ W+K  G  ++ D VALIPYARVD F+ GE  N E
Sbjct  1     MAIVESILDLQVQDPPEEEFYSADLTWTKF-GTVEHHDEVALIPYARVDAFIIGECTNIE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+R+  +  + K D  LEY  YWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRSRGSLKEFKDDEYLEYRQYWCSFGPENYGEGGSILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A PS+ALIIYN+ +HV+K G  CHGP D++A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPFDREAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S+LY+G+    I+++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMLYLGIPEANIVEKHLECLQRYCGSNAKANSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SIS+WVE ++  IF ++D S+ + F+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDRASISMWVERNKKSIFIHQDTSEDNSFILGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAWII   FA  D  +WM+AL +R  + +P WK++
Sbjct  300   TFGIRRLKYPLCTLLVFDSRQHALPVAWIITRSFAKSDVSKWMKALLDRAQSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD  T+I  I ++F C VL S WR+R +W KN++++CS +EV+  I KRLG++++S
Sbjct  360   GFLIDDAATEIDPIMDIFCCPVLFSLWRIRRSWLKNVVRKCSSIEVQREIFKRLGKLVYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G + +   E F  DFVD   F++YFK  W P++ +W +A+RA PLASQE   A+E Y
Sbjct  420   IWDGVDASVVLEEFTRDFVDQTAFMEYFKGCWVPKIEMWLSAMRAFPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L  ++R DWLV KL T +HS +WLD Y+ + D  +  K+E+IS  T+
Sbjct  480   HMKLKAKLFDDSHLGAFQRVDWLVHKLTTELHSTYWLDRYADESDSFQNVKEEYISS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  VT+D E+   AKV+ Q D ++ HV+WNP SEF+ CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDSSVTLDNENHLFAKVLSQKDTSISHVVWNPGSEFSFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALS  1291
              K      +  S   S+S   + + L+ +   P  DS+  D +++
Sbjct  599   IKVNMVCENCPSYKPSMSFQSFEKILMNIWKLPMDDSVALDVSMA  643



>ref|XP_006432214.1| hypothetical protein CICLE_v10000430mg [Citrus clementina]
 ref|XP_006464992.1| PREDICTED: uncharacterized protein LOC102609999 isoform X1 [Citrus 
sinensis]
 ref|XP_006464993.1| PREDICTED: uncharacterized protein LOC102609999 isoform X2 [Citrus 
sinensis]
 ref|XP_006464994.1| PREDICTED: uncharacterized protein LOC102609999 isoform X3 [Citrus 
sinensis]
 ref|XP_006464995.1| PREDICTED: uncharacterized protein LOC102609999 isoform X4 [Citrus 
sinensis]
 ref|XP_006464996.1| PREDICTED: uncharacterized protein LOC102609999 isoform X5 [Citrus 
sinensis]
 gb|ESR45454.1| hypothetical protein CICLE_v10000430mg [Citrus clementina]
Length=716

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/656 (45%), Positives = 437/656 (67%), Gaps = 9/656 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +  + VQ+PP  +FSS D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     ESLFDIQVQDPPEEDFSSIDLTWTKF-GTAEHHDEVALIPYARVDSFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E+++++H E ++R  G   + + L  +YV++    IRRST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEESVLEKHIEGIQRYCGSDAKVNSLASQYVQKLGMIIRRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWV+ ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRLWVDRNKKSIFFYQDSSETDPFILGIQTEWQLQQMIRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAW++    A  D  +WM++L +R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWVVTRSSAKPDVTKWMKSLLDRGRSIEPGWKISGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C VL S WRVR +W +N++K+C+ ++++  I KRLG +++SI  G
Sbjct  364   DDAAAEIDPIREIFCCPVLFSLWRVRRSWLRNIVKKCTNIKIQREIFKRLGNILYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E  ++DFVD   F++YFKA+W P+L +W + +RALPLASQE   A+E YH +L
Sbjct  424   ADPFVNLEVLIQDFVDQTAFIEYFKASWMPKLAMWLSTMRALPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  KDE+I+  T+W ++
Sbjct  484   KTKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKDEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             +QIP+  VT+D +    A+V  Q D ++ H++WNP SEFA CDC  +  GN+C+HV K  
Sbjct  543   MQIPNSAVTLDDKEHLFARVSSQKDSSLTHLVWNPGSEFAFCDCAWSMQGNICKHVVKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +      S+S    R+ L+ +   P  DS+  D  LSVA W    L+ QI Q
Sbjct  603   MICGNNEGYQPSMSFQSLREVLMNLWRKPMDDSVELD--LSVA-WTHNMLD-QIKQ  654



>ref|XP_002518981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43514.1| conserved hypothetical protein [Ricinus communis]
Length=719

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/656 (45%), Positives = 431/656 (66%), Gaps = 10/656 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  +PVQNPP  EFSS+D+ W+K  G  D  D VALIPY RVD F+ GE +N ECPT+
Sbjct  5     ESIFDIPVQNPPDEEFSSADLTWTKF-GTADRHDDVALIPYDRVDTFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E +R+R+  +  + K D  LEY LYWCSFGP+++ +GG   PSR   +  +  A RP
Sbjct  64    FHIERQRKRSRGSLKEYKNDEYLEYKLYWCSFGPENYGEGGDTLPSRRYRLNTRNRAPRP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL   PS+ALIIYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYTRPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV++    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVQKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S++D F+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDTSEADSFILGIQTEWQLQQMIRFGHRSLVAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+P+AW+I   FA  D  +WM+AL +R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPIAWVITRSFAKPDVAKWMKALLDRASSVEPGWKISGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IR+++ C VL S WR+R +W +N++K+C+ +EV+  I KRLG++++ I  G
Sbjct  364   DDAAAEIDPIRDIYGCPVLFSLWRIRRSWLRNIVKKCNNIEVQREIFKRLGKIVYGIWNG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E    DFVD   F+ YF A+W P++ +W +A+R LPLASQE   A+E YH +L
Sbjct  424   GDTLAALEELTTDFVDQTTFIQYFNASWVPKIDMWLSAMRTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+++  T+W ++
Sbjct  484   KAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYVAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIP+  VT+D +    AKV  Q D N+ H++WNP SEFA CDC  +  GNLC+HV K +
Sbjct  543   LQIPNSAVTLDDKDKLFAKVSSQKDSNLTHIVWNPGSEFAFCDCAWSLQGNLCKHVIK-V  601

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
               L       SS+S    ++ L  +   P  DS+  D  LS+A W  + L  QI Q
Sbjct  602   NMLCKNSEGQSSMSFQSLKEILTGLWRKPMDDSVALD--LSMA-WTHQMLG-QIKQ  653



>ref|XP_010249825.1| PREDICTED: uncharacterized protein LOC104592258 isoform X2 [Nelumbo 
nucifera]
Length=681

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/679 (46%), Positives = 427/679 (63%), Gaps = 24/679 (4%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + ++ +M R ++ILSLPVQ+PP  EFS++ I W KVEG R   D +ALIP++RVDDFV+G
Sbjct  2     KGNEPKMPRMEDILSLPVQDPPCAEFSAAHINWVKVEGGRQGGDDIALIPFSRVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHR--KGGVVRPSRT  2881
             ES N ECP  F +E+RR+R   +  KP+VDG LEY LYWCS+GP+D+R  + GV   S +
Sbjct  62    ESTNAECPANFRIESRRKRPEGSVSKPRVDGYLEYTLYWCSYGPEDYRDSESGVGDGSNS  121

Query  2880  TYVPKKKS-AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
                  K S  GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A
Sbjct  122   KPTSGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDRDA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+S+LYVG+S++ I+Q H E VER GGPCNRDD LT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHIEEVERHGGPCNRDDFLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              +R IR STY+L A+D  SI +WV+ HQ ++FF++D S ++ F+LGIQTEWQLQQM+R+G
Sbjct  242   MDRVIRHSTYQLHANDICSIRMWVQRHQKNVFFFQDSSPTESFILGIQTEWQLQQMLRYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             +   +AS + FG  KL+              AIPVAW+I      +D  +WM +L  R+ 
Sbjct  302   HDSSVASHSNFGLKKLR-------------NAIPVAWVITSNSDGQDVHKWMGSLVERIR  348

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
              KDP W+   F++DDP      +RE FQC VL+  W VR +W ++L+K+C   +V+  + 
Sbjct  349   AKDPRWRPNAFLLDDPSFKALTVREAFQCRVLLCLWHVRRSWIRSLLKKCYNFDVQREMF  408

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++ +       +  E FM+ FVD   F+DYF+A W P L LW N +R LP+++Q
Sbjct  409   KYLGRVLYCM----RTMDAIEEFMQIFVDQCAFMDYFRARWLPSLELWVNGMRTLPVSNQ  464

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  AALE YH +LK +L NE   + + R DWLV  L T  HS +W ++Y+ +  + R  +
Sbjct  465   EPHAALESYHLRLKSKLFNELQAASWLRVDWLVHTLTTEFHSLYWFEQYTEETGYFRNLR  524

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             +   S   +W ++L IPD DV +D E     KV    D+ + + IWNP SEFALCDC  +
Sbjct  525   EGSFSN-NSWYRALLIPDDDVIMDEEDLRIVKVFSLSDRGLAYTIWNPGSEFALCDCPWS  583

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
              +GNLC+HV K     R+R  A  S++   YRQAL+ +L   P D ++ DHA+     +Q
Sbjct  584   RLGNLCKHVIKVGILCRNRHVARPSLAAQTYRQALLSLLQNLPDDPIVLDHAILHVTRMQ  643

Query  1272  KQLNSQIGQESVQVVGPTT  1216
             + +       +  ++ P T
Sbjct  644   QDIKGLEDLSNSGLLQPLT  662



>gb|KDO50309.1| hypothetical protein CISIN_1g005059mg [Citrus sinensis]
Length=716

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/656 (45%), Positives = 436/656 (66%), Gaps = 9/656 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +  + VQ+PP  +FSS D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     ESLFDIQVQDPPEEDFSSIDLTWTKF-GTAEHHDEVALIPYARVDSFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E+++++H E ++R  G   + + L  +YV++    IRRST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEESVLEKHIEGIQRYCGSDAKVNSLASQYVQKLGMIIRRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWV+ ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRLWVDRNKKSIFFYQDSSETDPFILGIQTEWQLQQMIRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAW++    A  D  +WM++L +R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWVVTRSSAKPDVTKWMKSLLDRARSIEPGWKISGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C +L S WRVR +W +N++K+C+ ++++  I KRLG +++SI  G
Sbjct  364   DDAAAEIDPIREIFCCPLLFSLWRVRRSWLRNIVKKCTNIKIQREIFKRLGNILYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E  ++DFVD   F++YFKA+W P+L +W + +RALPLASQE   A+E YH +L
Sbjct  424   ADPFVNLEVLIQDFVDQTAFIEYFKASWMPKLAMWLSTMRALPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  KDE+I+  T+W ++
Sbjct  484   KTKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKDEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             +QIP+  VT+  +    A+V  Q D ++ H++WNP SEFA CDC  +  GN+C+HV K  
Sbjct  543   MQIPNSAVTLGDKEHLFARVSSQKDSSLTHLVWNPGSEFAFCDCAWSMQGNICKHVVKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +      S+S    R+ L+ +   P  DS+  D  LSVA W    L+ QI Q
Sbjct  603   MICANNEGYQPSMSFQSLREVLMNLWTKPMDDSVELD--LSVA-WTHNMLD-QIKQ  654



>ref|XP_011022940.1| PREDICTED: uncharacterized protein LOC105124571 [Populus euphratica]
Length=720

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/663 (44%), Positives = 429/663 (65%), Gaps = 5/663 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + + +L VQNP   +FS++D+ W+K  G  ++ D VALIPY RVD F+ GE +N ECPT+
Sbjct  5     ESVHNLAVQNPAEEDFSAADLTWTKF-GTAEHHDEVALIPYDRVDAFIIGECSNPECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   T    K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRARGTLKDYKTDEYLEYKLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A  S ALIIYN+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARSSQALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNPKVNSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S+SD F+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDSSESDAFILGIQTEWQLQQMIRFGHRSLIAADSAFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII    A  D  +WM+AL  R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWIITRSSAKPDVAKWMKALLGRASSVEPGWKISGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IR+VF C VL S WRVR  W +N++K+CS +EV+  I KRLGE+++SI  G
Sbjct  364   DDAAAEIDPIRDVFGCPVLFSLWRVRRTWLRNIVKKCSNIEVQREIFKRLGEIVYSIWGG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +  +  E    D VD   F+ YFKA+W P++ +W + +RALPLASQE   A+E YH +L
Sbjct  424   VDTLSALEELTHDLVDQTAFIQYFKASWVPKIEMWLSTMRALPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIP+  VT+D +    A+V  Q D N+ H++WNP SEFA CDC  +  GNLC+HV K  
Sbjct  543   LQIPNSSVTVDDKDHLFARVSSQKDNNVTHIVWNPGSEFAFCDCAWSLQGNLCKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQ  1234
                 +      S+S   +++ L  +   P  DS+  D +++ A  +  Q+   +  +S +
Sbjct  603   MICENGEGYQPSMSFRAFKELLTSLWKKPMDDSVGLDLSIAWAHQMLDQIKQLVELDSSK  662

Query  1233  VVG  1225
              +G
Sbjct  663   TIG  665



>ref|XP_010027651.1| PREDICTED: uncharacterized protein LOC104418118 [Eucalyptus grandis]
 gb|KCW54219.1| hypothetical protein EUGRSUZ_I00201 [Eucalyptus grandis]
Length=720

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/661 (44%), Positives = 433/661 (66%), Gaps = 5/661 (1%)
 Frame = -3

Query  3198  ILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFH  3019
             I+ +PVQ+P   +FS++D+ W+K  G  ++ D VALIPY RVD F+ GE +N ECPT+FH
Sbjct  7     IVDIPVQDPQDEDFSAADLTWTKF-GTPEHHDDVALIPYPRVDAFIIGECSNVECPTRFH  65

Query  3018  VEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNT  2839
             +E  R+R+  +  + K D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP +
Sbjct  66    IERGRKRSKGSLKEYKSDEYLEYKMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQS  125

Query  2838  KRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDL  2659
              RGCTCHF+VKRL A PS+AL+IYN  +H++K G  CHGP D+ A G  A   PYI  ++
Sbjct  126   MRGCTCHFVVKRLYARPSLALLIYNDRRHINKAGFVCHGPLDRDAIGPGAKNIPYICSEI  185

Query  2658  RLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDAD  2479
             + + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    IRRST+ELD D
Sbjct  186   QQQTMSMIYLGIPEENVLEKHIEGIQRYCGSDAKVNSLASQYVHKLGMIIRRSTHELDLD  245

Query  2478  DAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNK  2299
             D  SI +WVE ++  IFFY+D S++D F+LGIQTEWQLQQMIRFG+R L+A+D+ FG  +
Sbjct  246   DQASIRMWVERNKKSIFFYQDTSETDAFILGIQTEWQLQQMIRFGHRSLIAADSTFGIKR  305

Query  2298  LKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDD  2119
             LKYP+ +L+VF+S   A+PVAW+I   F+  D  +WM+AL +R  + +P WK++GF++DD
Sbjct  306   LKYPLCTLLVFDSRQHALPVAWVITRSFSKPDVSKWMKALLDRARSVEPGWKVSGFLIDD  365

Query  2118  PLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCE  1939
                +I  IR++F C VL S WR+R  W +N++K+CS  EV+  + KRLG++++SI  G E
Sbjct  366   AAAEIDPIRDIFSCPVLFSLWRIRRTWLRNVVKKCSNPEVQRELFKRLGQIVYSIWDGSE  425

Query  1938  PANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKL  1759
                  E  + DF D   F++YFKA W P++ +W + ++ALPLASQE  +A+E YH +LK 
Sbjct  426   TLAALEELVLDFADQTVFMEYFKAFWVPKIEMWLSTMKALPLASQEASSAIEAYHAKLKT  485

Query  1758  RLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQ  1579
             +L ++  L+   R DWLV KL T +HS +WLD Y+ + D  +  ++E+I+  T+W ++LQ
Sbjct  486   KLFDDSHLNALWRVDWLVHKLTTELHSSYWLDRYADESDSFQNVREEYITS-TSWHRALQ  544

Query  1578  IPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKY  1408
             IPD  +T D +    AKV  Q D ++ H++WNP SEFA CDC  +   NLC+HV K    
Sbjct  545   IPDSAITFDEKDHLYAKVQGQKDSSVTHLVWNPGSEFAFCDCPWSMQANLCKHVLKVNMI  604

Query  1407  LRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVV  1228
               +R    SS+SM  +R+ L+ +   P  DSL  D +++    +  Q+   +   S   +
Sbjct  605   CENRRGCQSSMSMHSFREVLLNIWRMPLDDSLALDQSMAWTYQMVDQIQKLVELNSTNDI  664

Query  1227  G  1225
             G
Sbjct  665   G  665



>ref|XP_008391981.1| PREDICTED: uncharacterized protein LOC103454170 [Malus domestica]
Length=719

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/655 (45%), Positives = 431/655 (66%), Gaps = 8/655 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + I  LPVQ+PP  +FSS+D+ W+K  G  +N D  ALIPY RVD+F+ GES+N E
Sbjct  1     MAIVESINDLPVQDPPEEDFSSADLTWTKF-GTTENHDDAALIPYDRVDEFIIGESSNLE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  RRR      + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANXIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +WVE ++  IF Y+D S+ DPF+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDQASIRMWVERNKKSIFIYQDTSEKDPFLLGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +WM+AL +R  + +P WK+ 
Sbjct  300   TFGIKRLKYPLCTLLVFDSRQHALPVAWVITRSFAKPDVSKWMKALLDRARSVEPXWKIN  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  IR++F C VL S WRVR +W +N++K+C+ +EV+  I KRLG + +S
Sbjct  360   GFLIDDAAAEIDPIRDIFCCPVLFSLWRVRRSWLRNIVKKCNNIEVQREIFKRLGNIAYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G +     E   +DFVD   F++YFK +W P++ +W + +R+LPLASQE   A+E Y
Sbjct  420   IWDGSDTLVALEELTQDFVDQTAFMEYFKQSWVPKIEMWLSTMRSLPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H ++K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+
Sbjct  480   HVKMKVKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADECDAFQNVKEEYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKV+ Q D   +H++WNP SEF+ CDC  +  GNLC+HV
Sbjct  539   WHRALQIPDSVVSLDDKDHLFAKVLSQKDSXTMHLVWNPGSEFSFCDCAWSXQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
              K       R     S+S   ++  L+ +L  P  DS+  D +++   W  + L+
Sbjct  599   IKVNMICESRQGYQPSMSSQSFKDVLMNLLKKPMDDSIALDRSMA---WTMQMLD  650



>ref|XP_008351508.1| PREDICTED: uncharacterized protein LOC103414930 [Malus domestica]
Length=719

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/655 (45%), Positives = 431/655 (66%), Gaps = 8/655 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + I  LPVQ+PP  +FSS+D+ W+K  G  +N D  ALIPY RVD+F+ GES+N E
Sbjct  1     MAIVESINDLPVQDPPEEDFSSADLTWTKF-GTTENHDDAALIPYDRVDEFIIGESSNLE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  RRR      + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANXIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +WVE ++  IF Y+D S+ DPF+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDQASIRMWVERNKKSIFIYQDTSEKDPFLLGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +WM+AL +R  + +P WK+ 
Sbjct  300   TFGIKRLKYPLCTLLVFDSRQHALPVAWVITRSFAKPDVSKWMKALLDRARSVEPEWKIN  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  IR++F C VL S WRVR +W +N++K+C+ +EV+  I KRLG + +S
Sbjct  360   GFLIDDAAAEIDPIRDIFCCPVLFSLWRVRRSWLRNIVKKCNNIEVQREIFKRLGNIAYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G +     E   +DFVD   F++YFK +W P++ +W + +R+LPLASQE   A+E Y
Sbjct  420   IWDGSDTLVALEELTQDFVDQTAFMEYFKQSWVPKIEMWLSTMRSLPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H ++K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+
Sbjct  480   HVKMKVKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADECDAFQNVKEEYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKV+ Q D   +H++WNP SEF+ CDC  +  GNLC+HV
Sbjct  539   WHRALQIPDSVVSLDDKDHLFAKVLSQKDSXTMHLVWNPGSEFSFCDCAWSXQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
              K       R     S+S   ++  L+ +L  P  DS+  D +++   W  + L+
Sbjct  599   IKVNMICESRQGYQPSMSSQSFKDVLMNLLKKPMDDSIALDRSMA---WTMQMLD  650



>ref|XP_009348880.1| PREDICTED: uncharacterized protein LOC103940490 [Pyrus x bretschneideri]
Length=719

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/655 (45%), Positives = 430/655 (66%), Gaps = 8/655 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + I  LPVQ+PP  +FSS+D+ W+K  G  +N D  ALIPY RVDDF+ GE +N E
Sbjct  1     MAIVESINDLPVQDPPEEDFSSADLTWTKF-GTTENHDDAALIPYDRVDDFIIGEGSNLE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  RRR      + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGLPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +WVE ++  IF Y+D S+ DPF+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDQASIRMWVERNKKSIFIYQDTSEKDPFLLGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +WM+AL +R  + +P WK+ 
Sbjct  300   TFGIKRLKYPLCTLLVFDSRQHALPVAWVITRSFAKPDVSKWMKALLDRARSVEPGWKIN  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  IR++F C VL S WRVR +W +N++K+C+ +EV+  I KRLG + +S
Sbjct  360   GFLIDDAAAEIDPIRDIFCCPVLFSLWRVRRSWLRNIVKKCNNIEVQREIFKRLGNIAYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G +     E   +DFVD   F++YFK +W P++ +W + +R+LPLASQE   A+E Y
Sbjct  420   IWDGSDTLVALEELTQDFVDQTAFMEYFKQSWVPKIEMWLSTMRSLPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H ++K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+
Sbjct  480   HIKMKVKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADECDAFQNVKEEYIAS-TS  538

Query  1596  WRKSLQIPDGDVTI---DGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++   D   AKV+ Q D   +H++WNP SEF+ CDC  +  GNLC+HV
Sbjct  539   WHRALQIPDSAVSLGDKDHLFAKVLSQKDSGTMHLVWNPGSEFSFCDCAWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
              K       R     S+S   ++  L+ +L  P  DS+  DH+++   W  + L+
Sbjct  599   IKVNMICESRQGYKPSMSSQSFKDVLMNLLKKPMDDSIALDHSMA---WTMQMLD  650



>ref|XP_008360601.1| PREDICTED: uncharacterized protein LOC103424292 [Malus domestica]
Length=719

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/655 (45%), Positives = 431/655 (66%), Gaps = 8/655 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + I  LPVQ+PP  +FSS+D+ W+K  G  +N D  ALIPY RVD+F+ GES+N E
Sbjct  1     MAIVESINDLPVQDPPEEDFSSADLTWTKF-GTTENHDDAALIPYDRVDEFIIGESSNLE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  RRR      + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANXIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +WVE ++  IF Y+D S+ DPF+LGIQTEWQLQQMIRFG+R L+A+D+
Sbjct  240   HELDLDDQASIRMWVERNKKSIFIYQDTSEKDPFLLGIQTEWQLQQMIRFGHRSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +WM+AL +R  + +P WK+ 
Sbjct  300   TFGIKRLKYPLCTLLVFDSRQHALPVAWVITRSFAKPDVSKWMKALLDRARSVEPXWKIN  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  IR++F C VL S WRVR +W +N++K+C+ +EV+  I KRLG + +S
Sbjct  360   GFLIDDAAAEIDPIRDIFCCPVLFSLWRVRRSWLRNIVKKCNNIEVQREIFKRLGNIAYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G +     E   +DFVD   F++YFK +W P++ +W + +R+LPLASQE   A+E Y
Sbjct  420   IWDGSDTLVALEELTQDFVDQTAFMEYFKQSWVPKIEMWLSTMRSLPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H ++K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+
Sbjct  480   HVKMKVKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADECDAFQNVKEEYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKV+ Q D   +H++WNP SEF+ CDC  +  GNLC+HV
Sbjct  539   WHRALQIPDSVVSLDDKDHLFAKVLSQKDSXTMHLVWNPGSEFSFCDCAWSXQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
              K       R     S+S   ++  L+ +L  P  DS+  D +++   W  + L+
Sbjct  599   IKVNMICESRQGYQPSMSSQSFKDVLMNLLKKPMDDSIALDRSMA---WTMQMLD  650



>ref|XP_009613006.1| PREDICTED: uncharacterized protein LOC104106214 [Nicotiana tomentosiformis]
Length=718

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/651 (46%), Positives = 428/651 (66%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL+LP+Q+PP  +FS+SD+ W+KV G  +  D VALI Y RVD F+ GE  N E PT+
Sbjct  5     ESILNLPLQDPPGEDFSASDLSWTKV-GNVERYDDVALILYDRVDAFIIGECCNVEFPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKHDDYLEYRLYWCSFGPENYGEGGDILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHFIVKRL   PS+ALIIYN  +HV+K G  CHGP D+ A G  A   PY+  
Sbjct  124   QSMRGCTCHFIVKRLYTRPSLALIIYNNRRHVNKSGSLCHGPLDRDAIGPGAKKIPYVCN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  + ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEKNVLEKHIEGIQRYCGSDAKVNSLAAQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  IFFY+D S++DPF+LGIQT+WQLQQMIRFG+R L+A D+ FG 
Sbjct  244   LDDQASIRLWVERNKKSIFFYQDTSENDPFILGIQTDWQLQQMIRFGHRSLIAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAW++    A  D  +WM+AL++RV   DPTWK+ GF++
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWVVTRTIAKPDVSKWMKALHDRVRAVDPTWKVNGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C VL S WR+R +W +N++K+CS +EV+  I KRLG+ ++SI  G
Sbjct  364   DDAAAEIDPIREIFSCPVLFSLWRIRRSWLRNIIKKCSNVEVQREIFKRLGDTVYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E   +DFVD + F+ YFKATW P+  +W    R LPLASQE   A+E YH +L
Sbjct  424   SDPFVALEELSQDFVDQMAFLQYFKATWVPKFEMWLTTTRTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K+RL ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KVRLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAT-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D +    AKV+ Q D +  H++WNP SEFA CDC  +  GN+C+H+ K  
Sbjct  543   LQIPDDAVTLDSKDNSFAKVLSQKDSSKTHLVWNPGSEFAHCDCEWSMQGNMCKHIIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                 +  S   S+S   + + L+ +   P  DS+  D  LS A W  + L+
Sbjct  603   MICGNLQSCRPSMSFQSFNEVLVSLTRKPVDDSMALD--LSTA-WTHQMLD  650



>ref|XP_004501270.1| PREDICTED: uncharacterized protein LOC101505233 isoform X1 [Cicer 
arietinum]
 ref|XP_004501271.1| PREDICTED: uncharacterized protein LOC101505233 isoform X2 [Cicer 
arietinum]
 ref|XP_004501272.1| PREDICTED: uncharacterized protein LOC101505233 isoform X3 [Cicer 
arietinum]
Length=690

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/646 (45%), Positives = 417/646 (65%), Gaps = 7/646 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL+LPVQ+ P  EFS+ ++ W K+EG R   D +ALIP+ RVDDFV+GES+N  
Sbjct  1     MPRMEDILNLPVQDLPCSEFSAENMNWVKLEGGRQGGDDIALIPFVRVDDFVKGESSNPA  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP  F VE++R+R   +  KP+VDG LEY LYWCS+GP+D+R+   V    T+  P    
Sbjct  61    CPASFRVESKRKRPVGSVAKPRVDGYLEYTLYWCSYGPEDYRESESVIVDATSAKPASGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL   P +ALIIYNQ +HVDK G+PCHG  D  A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYTRPHLALIIYNQRRHVDKSGMPCHGIIDIDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP IS++LR +V+S+LY GVS++ I+Q H E++++QGG  NRD+ LT   VR  ER+IR
Sbjct  181   YAPRISDELRQKVMSMLYAGVSLDNILQNHAEAMQKQGGSLNRDNFLTRNDVRNMERTIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S+ EL  +D  S+ +W++ HQ  +F+++D + S+ F+LGIQT+WQLQQM+R+GN   ++
Sbjct  241   NSSLELLGNDECSVKIWIQRHQKDVFYFQDNAGSESFILGIQTDWQLQQMLRYGNNSFIS  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
               + FG+ KLKYP+ SL+VF+S   AIPV WII   F  +D  +W+  L  R+ TKDP W
Sbjct  301   FHSTFGSKKLKYPVCSLLVFDSSQNAIPVVWIITSSFVGKDIHKWIVLLSERLRTKDPGW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +     +DDP  +   IRE F+C +L+  W VR  W K L K+C   EV+  + ++LG +
Sbjct  361   RPNAIFLDDPSFNYSIIREAFRCRILLCTWHVRRTWIKKLFKKCCNFEVQREMFRQLGWI  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++S   G    +  E  M+ FVD   F+DYFK+     + +W N + +LP+ + E  AA+
Sbjct  421   LYSTRCGPNAMDAIEELMQIFVDQCAFIDYFKSHSLAIIDVWINGINSLPVTTLEPHAAI  480

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK  LL E+  + + R DWL+  L T  HS +WLD+YS +  +    +D   S 
Sbjct  481   ESYHLKLKSTLLKEKYANFWSRVDWLIHTLTTEFHSLYWLDQYSSQTGYFENLRDNSFST  540

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW  +L+IPD DV +D ++   AKV  Q D+++V+ IWNP SEF+LCDC+ + +GNLC
Sbjct  541   -NAWYCALRIPDVDVVLDEQNLHLAKVSSQTDRDLVYTIWNPGSEFSLCDCSCSRLGNLC  599

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHA  1297
             +HV K   + R+R  A   +S   Y+QAL+ +L+ PP D L+ DH 
Sbjct  600   KHVVKMATFCRNRQVARPLLSSQIYKQALLTLLNNPPDDPLVLDHT  645



>gb|KGN60133.1| hypothetical protein Csa_3G879510 [Cucumis sativus]
Length=685

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/655 (46%), Positives = 422/655 (64%), Gaps = 11/655 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL L VQ+PP LEFS++ + W KVEG R     +A++P++RV+DFV+GES+N E
Sbjct  1     MPRTEDILKLQVQDPPCLEFSAAHVKWEKVEGGRQGGADIAVVPFSRVEDFVKGESSNPE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
              P +F +E+RR+RTA +  KP+VDG LEYILYWCS+GP+D+R       S +   P    
Sbjct  61    SPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL A+P +ALIIYNQ KH+DK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYAQPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             Y   ISE+LR +++S+LYVG+ +E I+Q H+E V+R GGP NRDD L+   VR  ER IR
Sbjct  181   YTQRISEELRQKIMSMLYVGIPIENIVQHHSEVVQRHGGPPNRDDFLSRIDVRNMERVIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++EL  +D  S+ +WV+ H+  IFF+++ SD + FVLGIQT+WQLQQM+R+G+ G +A
Sbjct  241   NSSHELHTNDDCSVKIWVQRHRKVIFFFQESSDCERFVLGIQTDWQLQQMLRYGHNGSVA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S +  G+ KL++P+ SL+VF+S    IPVAWIIA  F  +D  +W+  L  R+H KDPTW
Sbjct  301   SHSTLGSKKLRFPLCSLLVFDSSQNTIPVAWIIASSFVDQDIRKWLGLLVERLHAKDPTW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             K+  F++D+P  ++  IREVFQC VL+  W VR +W +N++K+C  ++V+  + K+LG++
Sbjct  361   KIDTFLLDNPSFEVSTIREVFQCQVLLCIWHVRRSWIRNILKKCPNLDVQREMFKQLGKV  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++    G   A   E F   F D   FVDY   TW P + LW N+LR+ P+++ E  AA+
Sbjct  421   LYCTRIGLGFAYAVEQFKRRFSDQCVFVDYLTRTWLPDIELWVNSLRSHPVSTLEANAAI  480

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L  E+  S   R DWL+  L T  HS +WLD+YS    +   ++D+ I  
Sbjct  481   EAYHIRLKSKLFKEQSNSSSSRVDWLIHILTTQFHSSYWLDQYSLDTGYFGSFRDKSILT  540

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW K+L IPD DV +D  +   AKV+ Q  +N+ + IW+P SEF+LCDC  + MGNLC
Sbjct  541   -NAWNKALHIPDVDVIVDESNLQFAKVISQSKRNLEYTIWDPGSEFSLCDCPWSRMGNLC  599

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQK  1270
             EHV K +  L  R  A   +   Q  Q  +      P   +  DH + +   VQ+
Sbjct  600   EHVIK-VSLLCKRQQAARPLVAAQVYQDRVPNFQLNP---VTFDHGMPLVNCVQR  650



>ref|XP_009781835.1| PREDICTED: uncharacterized protein LOC104230671 [Nicotiana sylvestris]
Length=718

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/651 (46%), Positives = 424/651 (65%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL+LPVQ+PP  +FS+SD+ W+KV G  +  D VALI Y RVD F+ GE  N E PT+
Sbjct  5     ESILNLPVQDPPGEDFSASDLSWTKV-GNVERYDDVALILYDRVDAFIIGECCNVEFPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +    K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKDYKHDDYLEYRLYWCSFGPENYGEGGDILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHFIVKRL   PS+ALIIYN  +HV+K G  CHGP D+ A G  A   PY+  
Sbjct  124   QSMRGCTCHFIVKRLYNRPSLALIIYNNRRHVNKSGSLCHGPLDRDAIGPGAKKIPYVCN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  + ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEKNVLEKHIEGIQRYCGSDAKVNSLAAQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  IFFY+D S+ DPF+LGIQT+WQLQQMIRFG+R L+A D+ FG 
Sbjct  244   LDDQASIRLWVERNKKSIFFYQDTSEHDPFILGIQTDWQLQQMIRFGHRSLIAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAW++    A  D  +WM+AL++RV   DPTWK+ G ++
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWVVTRTIAKPDVSKWMKALHDRVRAVDPTWKVNGVLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C VL S WR+R +W +N++K+CS +EV+  I KRLGE ++SI  G
Sbjct  364   DDAAAEIDPIREIFSCPVLFSLWRIRRSWLRNIIKKCSNVEVQREIFKRLGETVYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E   +DFVD   F+ YFKATW P+  +W   +R LPLASQE   A+E YH +L
Sbjct  424   SDPFVALEELSQDFVDQTAFLQYFKATWVPKFEMWLTTMRTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K+RL ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KVRLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAT-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D +    AKV+ Q D +  H++WNP SEFA CDC  +  GN+C+H+ K  
Sbjct  543   LQIPDDSVTLDNKDNSFAKVLSQKDNSKTHLVWNPGSEFAHCDCEWSMQGNMCKHIIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                    S   S+S   + + L+ +   P  DS+  D  LS A W  + L+
Sbjct  603   MISGKLQSCRPSMSFQSFNEVLVSLTRKPVDDSMALD--LSTA-WTHQMLD  650



>ref|XP_002309914.2| SWIM zinc finger family protein [Populus trichocarpa]
 gb|EEE90364.2| SWIM zinc finger family protein [Populus trichocarpa]
Length=727

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/670 (44%), Positives = 431/670 (64%), Gaps = 12/670 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +L+L VQNP   +FS++D+ W+K  G  ++ D VALIPY RVD F+ GE +N ECPT+
Sbjct  5     ESVLNLAVQNPAEEDFSAADLTWTKF-GTAEHHDEVALIPYDRVDAFIIGECSNPECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   T    K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRARGTLKDYKTDEYLEYKLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS ALIIYN+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSQALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNPKVNSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D  +SD F+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDSLESDAFILGIQTEWQLQQMIRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII    A  D  +WM+AL  R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWIITRSSAKPDVAKWMKALLGRASSVEPGWKISGFLI  363

Query  2124  DDPLT-------DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             DD          DI AI+++F C VL S WRVR +W +N++K+C  +EV+  I KRLGE+
Sbjct  364   DDAAAEIDPIRQDIFAIQDIFGCPVLFSLWRVRRSWLRNIVKKCGNIEVQREIFKRLGEI  423

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++SI  G +  +  E    D VD   F+ YFKA+W P++ +W + +RALPLASQE   A+
Sbjct  424   VYSIWGGVDTLSALEELTHDLVDQTAFIQYFKASWVPKIEMWLSTMRALPLASQEASGAI  483

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+ 
Sbjct  484   EAYHVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS  543

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
              T+W ++LQIP+  VT+D +    AKV  Q D N+  ++WNP SEFA CDC  +  GNLC
Sbjct  544   -TSWHRALQIPNSSVTVDDKDHLFAKVSSQKDNNVTRIVWNPGSEFAFCDCAWSLQGNLC  602

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQ  1255
             +HV K      +R     S+S   +++ L  +   P  DS+  D +++ A  +  Q+   
Sbjct  603   KHVIKVNMICENREGYQPSMSFRAFKELLTSLWKKPMDDSVGLDLSIAWAHQMLDQIKHL  662

Query  1254  IGQESVQVVG  1225
             +  +S + +G
Sbjct  663   VELDSSKTIG  672



>gb|KHN17186.1| hypothetical protein glysoja_010645 [Glycine soja]
Length=720

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/658 (43%), Positives = 431/658 (66%), Gaps = 5/658 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EF ++D+ W+K  G  ++ D VALIPY RVD F+ GE  N E
Sbjct  1     MAIVESVGKIPLQDPPEEEFCAADLTWTKF-GNAEHHDEVALIPYDRVDAFIIGECTNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+RT  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A+PS+ALI+YN+ +H++K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   +   L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSDAKVSSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +W+E ++  +FF++D S+SDPF+LGIQTEWQLQQMIRFG+R ++A+D+
Sbjct  240   HELDLDDQASIRMWIERNRKSVFFHQDTSESDPFILGIQTEWQLQQMIRFGHRSVVAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   F   D  +W++AL +R  + +P WK++
Sbjct  300   TFGVKRLKYPLFTLLVFDSRQHALPVAWVITRSFTKPDVSKWLKALIDRARSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  +R++F C VL S WRVR +W +N++K+CS +E++  I KRLG ++++
Sbjct  360   GFLIDDAAAEIDLLRDIFCCPVLFSLWRVRRSWLRNIVKKCSNIEIQREIFKRLGRIVYN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G   +   E F+ DFVD   F++YFK  W P+L +W + +R  PLASQE   ALE Y
Sbjct  420   IWGGINASLALEQFLLDFVDQTAFMEYFKVMWLPKLEMWLSTMRNFPLASQEASGALEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+++I+  T+
Sbjct  480   HVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEKYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKVV Q D ++ H++WNP SEFA CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDYAVSLDDKDHLFAKVVSQKDSSLTHIVWNPGSEFAFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
              K      +      S+S   + + L+ +   P  DS   D +L+    +  Q+  Q+
Sbjct  599   VKVNMICENLKGYQPSMSFRSFEEVLMDLWKKPVDDSFALDLSLAWTHQMLDQIQKQV  656



>ref|XP_004511186.1| PREDICTED: uncharacterized protein LOC101498464 [Cicer arietinum]
Length=790

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/651 (44%), Positives = 430/651 (66%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  +P+Q+PP  EFSS+D+ W+K  G  ++ D VALIPY RVD F+ GE  N  CPT+
Sbjct  77    ESIEKIPLQDPPEEEFSSADLTWTKF-GNAEHHDEVALIPYDRVDAFIIGECCNVLCPTR  135

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+RT  T  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  136   FHIERGRKRTIGTLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  195

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+ALIIYN+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  196   QSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  255

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E I+++H E +ER  G   + + L  +YV +    I+RST+ELD
Sbjct  256   EIQQQTMSMIYLGIPEENILEKHIEGIERYCGSNAKVNSLASQYVHKLGMIIKRSTHELD  315

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  +FF++D S+SDPF+LGIQTEWQLQQM+RFG+R ++A+D+ FG 
Sbjct  316   LDDQASIRMWVERNRKSVFFHQDTSESDPFILGIQTEWQLQQMVRFGHRNVVAADSSFGV  375

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII   FA  D  +W+ AL +R  + +P WK++GF++
Sbjct  376   KRLKYPLFTLLVFDSRQHALPVAWIITRSFAKPDVSKWLNALIDRARSVEPGWKVSGFLI  435

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   DI  +R++F C VL S WR+R +W +N++++C+ +EV+  I KRLG +++SI  G
Sbjct  436   DDAAADIDLLRDIFGCPVLFSLWRIRRSWLRNIVRKCNNIEVQREIFKRLGTIVYSIWGG  495

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
                +   E FM DFVD  +F++YFK +W P++ +W + +R  PLASQE   ALE YH +L
Sbjct  496   TNTSVALEQFMLDFVDQTDFMEYFKVSWVPKIEMWLSMMRNFPLASQEASGALEAYHVKL  555

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD ++ + D  +  K+ +I+  T+W ++
Sbjct  556   KAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRFADESDSFQNVKEGYIAS-TSWHRA  614

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  V++D +    AKV  Q D++++H++WNP SEF+ CDC+ +  GNLC+HV K  
Sbjct  615   LQIPDSAVSLDDKDRLFAKVASQKDRSLIHIVWNPGSEFSFCDCSWSLQGNLCKHVLKVN  674

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                 +      S+S   + + L+ +   P  DS   D +L+   W  + L+
Sbjct  675   MICDNLQGCQRSMSFRSFEEVLMDLWRKPVDDSFALDVSLA---WTHQMLD  722



>gb|KHN13990.1| hypothetical protein glysoja_025007 [Glycine soja]
Length=719

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/658 (43%), Positives = 431/658 (66%), Gaps = 5/658 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EF ++D+ W+K  G  ++ D VALIPY RVD F+ GE  N E
Sbjct  1     MAIVESVGKIPLQDPPEEEFCAADLTWTKF-GNAEHHDEVALIPYDRVDAFIIGECTNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+RT  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A+PS+ALI+YN+ +H++K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   +   L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSDAKVSSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +W+E ++  +FF++D S+SDPF+LGIQTEWQLQQMIRFG+R ++A+D+
Sbjct  240   HELDLDDQASIRMWIERNRKSVFFHQDTSESDPFILGIQTEWQLQQMIRFGHRSVVAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   F   D  +W++AL +R  + +P WK++
Sbjct  300   TFGVKRLKYPLFTLLVFDSRQHALPVAWVITRSFTKPDVSKWLKALIDRARSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  +R++F C VL S WRVR +W +N++K+CS +E++  I KRLG ++++
Sbjct  360   GFLIDDAAAEIDLLRDIFCCPVLFSLWRVRRSWLRNIVKKCSNIEIQREIFKRLGRIVYN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G   +   E F+ DFVD   F++YFK  W P+L +W + +R  PLASQE   ALE Y
Sbjct  420   IWGGINASLALEQFLLDFVDQTAFMEYFKVMWLPKLEMWLSTMRNFPLASQEASGALEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+++I+  T+
Sbjct  480   HVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEKYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKVV Q D ++ H++WNP SEFA CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDYAVSLDDKDHLFAKVVSQKDSSLTHIVWNPGSEFAFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
              K      +      S+S   + + L+ +   P  DS   D +L+    +  Q+  Q+
Sbjct  599   VKVNMICENLKGYQPSMSFRSFEEVLMDLWKKPVDDSFALDLSLAWTHQMLDQIQKQV  656



>ref|XP_011099737.1| PREDICTED: uncharacterized protein LOC105178078 [Sesamum indicum]
Length=716

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/651 (45%), Positives = 427/651 (66%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I +L VQ+PP  +FS++D+ W K+ G  D  D VALIPY RVD F+ GE +N ECPT+
Sbjct  5     ESIDNLSVQDPPGEDFSAADLDWVKL-GSEDRYDDVALIPYDRVDAFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRAKGSLKQYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PY+  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYVCS  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   +   L  +YV++    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSDAKVKSLASQYVQKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R ++A+D+ FG 
Sbjct  244   LDDQASIRLWVERNKKSIFFYRDTSETDPFILGIQTEWQLQQMIRFGHRNIIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAWII    A  D  +WM+AL +RVH+ DP WK +GF++
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWIITRSIAKPDVAKWMKALLDRVHSVDPGWKASGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IREVF C +L S WRVR +W ++++K+C+ +EV+  + KRLG++++SI  G
Sbjct  364   DDAAAEIEPIREVFSCPILFSLWRVRRSWLRHIVKKCTNIEVQREMFKRLGQIMYSIWGG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              + A   E F  DFVD   F+ YFK +W P++ +W  +++ LPLASQE   A+E YH +L
Sbjct  424   VDLAVALEEFSLDFVDQTSFMQYFKDSWVPKIEMWLTSMKTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D     K+E+I+  T+W ++
Sbjct  484   KTKLYDDSHLGSLQRVDWLVHKLTTELHSSYWLDRYADESDSFVNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  +++D      AKVV Q D  +  V+WNP SEFA CDC  +  GNLC+H+ K  
Sbjct  543   LQIPDNAISLDDRDHLFAKVVSQKDSKVTRVVWNPGSEFAHCDCEWSLQGNLCKHIIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                 +     SS+S    +  LI +   P  DS+  D  +S A W  + L+
Sbjct  603   MVCENLQCYQSSLSFQSLKNILIDLWEKPMDDSVALD--ISTA-WTHQMLD  650



>ref|XP_003552176.1| PREDICTED: uncharacterized protein LOC100776331 [Glycine max]
Length=719

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/658 (43%), Positives = 431/658 (66%), Gaps = 5/658 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EF ++D+ W+K  G  ++ D VALIPY RVD F+ GE  N E
Sbjct  1     MAIVESVGKIPLQDPPEEEFCAADLTWTKF-GNAEHHDEVALIPYDRVDAFIIGECTNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+RT     + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRTIGNLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A+PS+ALI+YN+ +H++K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   +   L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSDAKVSSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +W+E ++  +FF++D S+SDPF+LGIQTEWQLQQMIRFG+R ++A+D+
Sbjct  240   HELDLDDQASIRMWIERNRKSVFFHQDTSESDPFILGIQTEWQLQQMIRFGHRSVVAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   F   D  +W++AL +R  + +P WK++
Sbjct  300   TFGVKRLKYPLFTLLVFDSRQHALPVAWVITRSFTKPDVSKWLKALIDRARSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  +R++F C VL S WRVR +W +N++K+CS +E++  I KRLG ++++
Sbjct  360   GFLIDDAAAEIDLLRDIFCCPVLFSLWRVRRSWLRNIVKKCSNIEIQREIFKRLGRIVYN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G   +   E F+ DFVD   F++YFK  W P+L +W + +R  PLASQE   ALE Y
Sbjct  420   IWGGINASLALEQFLLDFVDQTAFMEYFKVMWLPKLEMWLSTMRNFPLASQEASGALEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+++I+  T+
Sbjct  480   HVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEKYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKVV Q D ++ H++WNP SEFA CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDYAVSLDDKDHLFAKVVSQKDSSLTHIVWNPGSEFAFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
              K      +      S+S   +++ L+ +   P  DS   D +L+    +  Q+  Q+
Sbjct  599   VKVNMICENLKGYQPSMSFRSFQEVLMDLWKKPVDDSFALDLSLAWTHQMLDQIQKQV  656



>ref|XP_006361419.1| PREDICTED: uncharacterized protein LOC102587868 [Solanum tuberosum]
Length=719

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/651 (46%), Positives = 424/651 (65%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  L VQ+PP  +FS+SD+ W+K  G  +  D VALI Y RVD F+ GE  N E PT+
Sbjct  5     ESIPDLAVQDPPGEDFSASDLSWTKF-GTEERHDDVALIHYDRVDAFIIGECCNVEFPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKEYKPDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHFIVKRL A PS+AL+IYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFIVKRLYARPSLALLIYNNRRHVNKSGFVCHGPLDRDAIGPGAKNIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++ +H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLAKHIEGIQRYCGSDAKVNSLAAQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  +FFY+D S++DPF+LG+QTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRLWVERNKKSVFFYQDASENDPFILGVQTEWQLQQMIRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAWII    A  D  +WM+AL++RV   DPTWK+ GF+V
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWIITRTIAKPDVSKWMKALHDRVLAVDPTWKVNGFLV  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C+VL S WR+R +W +N++K+CS +EV+  I KRLG +++SI  G
Sbjct  364   DDAAAEIDPIREIFSCTVLFSLWRIRRSWLRNIIKKCSNIEVQREIFKRLGNIVYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E   +DFVD + F+ YFKATW P+  +W   ++ LPLASQE   A+E YH +L
Sbjct  424   TDPFVALEELSQDFVDQMAFLQYFKATWVPKFEMWLTTMKTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K+RL ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K E+I+  T+W ++
Sbjct  484   KVRLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKAEYIAT-TSWNRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D +    AKV+ Q D  +  ++WNP SEFA CDC  +  GNLC+HV K  
Sbjct  543   LQIPDASVTLDCKDSSFAKVLSQKDSTIARLVWNPGSEFAHCDCEWSMQGNLCKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                 +  S   S+S   + + L  +   P  DS+  D  LS A W  + L+
Sbjct  603   MICGNLQSYQPSMSFQSFNEILDSLSKKPADDSIALD--LSTA-WTHQMLD  650



>ref|XP_010049049.1| PREDICTED: uncharacterized protein LOC104437738 isoform X1 [Eucalyptus 
grandis]
 gb|KCW81512.1| hypothetical protein EUGRSUZ_C02873 [Eucalyptus grandis]
Length=693

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/666 (45%), Positives = 429/666 (64%), Gaps = 15/666 (2%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             +  + + AR ++IL+LPVQ+PP  EFS+S + W K+ G R   D VALIP+ARV+DFV+G
Sbjct  2     KGREAKAARMEDILNLPVQDPPRAEFSASQLKWVKIVGGRQGGDDVALIPFARVEDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTY  2875
             ES+N +CP  F VE+RRRR   ++ KP+VDG +EY LYWCS+GP+D+R    V       
Sbjct  62    ESSNADCPASFRVESRRRRREGSTSKPRVDGYIEYTLYWCSYGPEDYRDNESVVGDSLGM  121

Query  2874  VP---KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
              P   K    GR +  RGC CHF VKRL   PS+ALIIYNQ KHVDK G PCHG  D+ A
Sbjct  122   KPLSGKGSRPGRHHMMRGCLCHFTVKRLYIRPSIALIIYNQQKHVDKTGAPCHGLLDRHA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+S+LY  + ++ IMQ H E V+R GGP NRDD L+   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSMLYAAIPIDDIMQHHMELVQRHGGPLNRDDFLSRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER +  S++EL+ +D  S+ +WV  HQ ++FFY++ +D++PF++GIQT+WQL+QM+ +G
Sbjct  242   MERLVHNSSHELNENDECSVKIWVRRHQKYVFFYQERTDTEPFIMGIQTKWQLEQMLHYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
               G +A  + FG NKLKYP+ +L+ FN+ + AIPVAWII+     +   +W+  L  R++
Sbjct  302   RNGSIAMHSSFGRNKLKYPLCTLLAFNTSHSAIPVAWIISSSLICQGIHKWIGPLAERIY  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
             TKDPTW+L+ F+VDD    +  IRE F+C VL+  WRVR AW +NL+KR     V+  + 
Sbjct  362   TKDPTWQLSSFLVDDCSFKVSLIREAFRCRVLLCLWRVRRAWIRNLIKRSCHSGVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             + LG +++     C  +N  E FM+ FVD   F++YF+  W PR+    N +++LP A  
Sbjct  422   RLLGSILY-----CTRSNAVEEFMQVFVDQCAFMEYFRERWLPRIDALINGMKSLPTAGP  476

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYS-GKDDFARYW  1627
             E  AA+E YH + K +LL+ +  +++ R DWL+  L T  HS FWLD+YS G   F    
Sbjct  477   EPQAAIESYHLRSKFKLLDIQYCNLWLRVDWLIHMLATEYHSSFWLDQYSLGTGCFENVR  536

Query  1626  KDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNS  1456
                + S   AW ++L I D +V ++ ++   AKV+ + D+N V+ +WNP SEF+LCDC  
Sbjct  537   DPSFTS--NAWHRALNILDVNVILEEQNLLLAKVLSE-DRNSVYTVWNPGSEFSLCDCAW  593

Query  1455  ANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWV  1276
             +  GNLCEHV K     R R  A +S+    YRQA++ +L  PP D ++ DHA   A  +
Sbjct  594   SKCGNLCEHVIKVAFLCRTRQVAGTSLGSQGYRQAMLSLLQKPPGDPIVLDHANLRATQL  653

Query  1275  QKQLNS  1258
              + +NS
Sbjct  654   HEDVNS  659



>ref|XP_006596000.1| PREDICTED: uncharacterized protein LOC100809744 isoform X1 [Glycine 
max]
 ref|XP_006596001.1| PREDICTED: uncharacterized protein LOC100809744 isoform X2 [Glycine 
max]
 ref|XP_006596002.1| PREDICTED: uncharacterized protein LOC100809744 isoform X3 [Glycine 
max]
Length=720

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/658 (43%), Positives = 431/658 (66%), Gaps = 5/658 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EF ++D+ W+K  G  ++ D VALIPY RVD F+ GE  N E
Sbjct  1     MAIVESVGKIPLQDPPEEEFCAADLTWTKF-GNAEHHDEVALIPYDRVDAFIIGECTNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+RT  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A+PS+ALI+YN+ +H++K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   +   L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSDAKVSSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +W+E ++  +FF++D S+SDPF+LGIQTEWQLQQMIRFG+R ++A+D+
Sbjct  240   HELDLDDQASIRMWIERNRKSVFFHQDTSESDPFILGIQTEWQLQQMIRFGHRSVVAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   F   D  +W++AL +R  + +P WK++
Sbjct  300   TFGVKRLKYPLFTLLVFDSRQHALPVAWVITRSFTKPDVSKWLKALIDRARSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  +R++F C VL S WRVR +W +N++K+CS +E++  I KRLG ++++
Sbjct  360   GFLIDDAAAEIDLLRDIFCCPVLFSLWRVRRSWLRNIVKKCSNIEIQREIFKRLGRIVYN  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G   +   E F+ DFVD   F++YFK  W P+L +W + +R  PLAS E   ALE Y
Sbjct  420   IWGGINASLALEQFLLDFVDQTAFMEYFKVMWLPKLEMWLSTMRNFPLASLEASGALEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+++I+  T+
Sbjct  480   HVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEKYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKVV Q D ++ H++WNP SEFA CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDYAVSLDDKDHLFAKVVSQKDSSLTHIVWNPGSEFAFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
              K      +      S+S + + + L+ +   P  DS   D +L+    +  Q+  Q+
Sbjct  599   VKVNMICENLKGYQPSMSFWSFEEVLMDLWKKPVDDSFALDLSLAWTHQMLDQIQKQV  656



>gb|AET02590.2| SWIM zinc finger protein [Medicago truncatula]
Length=721

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/657 (43%), Positives = 434/657 (66%), Gaps = 8/657 (1%)
 Frame = -3

Query  3222  IQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESAN  3043
             ++MA  + + ++P+Q+P   EFS++D+ W+K  G  ++ D VALIPY RVD F+ GE +N
Sbjct  1     MEMAIVESVRNIPLQDPSEEEFSAADLTWTKF-GSAEHYDEVALIPYDRVDAFIIGECSN  59

Query  3042  KECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKK  2863
               CPT+FH+E  R+RT  T  + K D  LEY  YWCSFGP+++ +GG + PSR   +  +
Sbjct  60    VLCPTRFHIERGRKRTIGTLKEYKDDEYLEYRQYWCSFGPENYGEGGEILPSRRYRLNTR  119

Query  2862  KSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMY  2683
               A RP + RGCTCHF+VKRL A PS+ALIIYN+ +HV+  G  CHGP D+ A G  A  
Sbjct  120   NRAARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNTSGFICHGPLDRDAIGPGAKK  179

Query  2682  APYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRR  2503
              PYI  +++ + +S++Y+G+  E I+++H E +ER  GP  + + L  +YV +    I+R
Sbjct  180   IPYICNEIQQQTMSMIYLGIPEENILEKHIEGIERYCGPNAQVNSLASQYVHKLGMIIKR  239

Query  2502  STYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLAS  2323
             ST+ELD DD  SI +WVE ++  +FF++D S+SDPF+LGIQTEWQLQQM+RFG+R ++A+
Sbjct  240   STHELDLDDQASIRMWVERNRKSVFFHQDTSESDPFILGIQTEWQLQQMVRFGHRSIVAA  299

Query  2322  DARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWK  2143
             D+ FG  +LKYP+ +L+VF+S   A+PVAWII   FA  D  +W++AL +R  + +P WK
Sbjct  300   DSSFGVKRLKYPLFTLLVFDSRQHALPVAWIITRSFAKPDVSKWLKALIDRARSVEPGWK  359

Query  2142  LAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMI  1963
             ++GF++DD   DI  + ++F C VL S WR+R +W +N++++C+ +EV+  I KRLG ++
Sbjct  360   VSGFLIDDAAADIDLLSDIFDCPVLFSLWRIRRSWLRNIVRKCNNIEVQREIFKRLGTIV  419

Query  1962  HSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALE  1783
             +SI  G   +   E  M DFVD  +F++YF+ +W P++ +W + +R +PLASQE   ALE
Sbjct  420   YSIWGGTNTSLALEQLMLDFVDQTDFLEYFRVSWLPKIEMWLSTMRNVPLASQEASGALE  479

Query  1782  FYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGL  1603
              YH +LK +L ++  L   +R DWLV KL T +HS +WLD ++ + D  +  K+ +I+  
Sbjct  480   AYHVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRFADESDSFQNVKEGYIAS-  538

Query  1602  TAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCE  1432
             T+W ++L+IPD  VT+D ++   AKV  + D ++ H++WNP SEF+ CDC+ +  GNLC+
Sbjct  539   TSWHRALEIPDSAVTLDDKNRLFAKVASKKDSSLTHIVWNPGSEFSFCDCSWSLHGNLCK  598

Query  1431  HVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
             HV K      +     SS+S   + + L+ +   P  DS   D +L+   W  + L+
Sbjct  599   HVIKVNMICENLQGCQSSMSFRSFEEVLMDLWRKPVDDSFALDLSLA---WTHQMLD  652



>ref|XP_004287787.1| PREDICTED: uncharacterized protein LOC101292541 [Fragaria vesca 
subsp. vesca]
Length=715

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/663 (43%), Positives = 430/663 (65%), Gaps = 5/663 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  LPVQ+PP  EFSS+D+ W+K  G  +N D  ALIPY RVD+F+ GE +N E PT+
Sbjct  5     ESIHDLPVQDPPVEEFSSADLTWTKF-GTYENHDDAALIPYDRVDEFIIGECSNLEYPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  +   D  LEY LYWCSFGP+++ +GG   PSR   +  +  A RP
Sbjct  64    FHIERGRKRKKGSLREYSDDDFLEYKLYWCSFGPENYGEGGGTLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTC+F+VKRL A PS+AL+IYNQ +HV+K G  CHGP D  A G  A   PYI  
Sbjct  124   QSMRGCTCNFVVKRLYARPSLALLIYNQRRHVNKSGFVCHGPLDGDAIGPAAKTVPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+GV  E I+++H E +ER      + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGVPEENILEKHIEGIERYCPSNAKVNSLASQYVHKLGMIIQRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IF ++D S++DPF+LGIQTEWQLQQ++RFG+R L+A D+ FG 
Sbjct  244   LDDQASIRMWVERNRKSIFIHQDASETDPFILGIQTEWQLQQLLRFGHRSLIAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII   F+  D  +WM AL  R H+ +P WK +GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWIITRSFSKPDVSKWMTALLGRAHSVEPGWKASGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +   IR++F C VL S WRVR +W +N++K+C+ +EV+  + KRLG ++H I  G
Sbjct  364   DDAAAETDPIRDIFGCPVLFSLWRVRRSWLRNIVKKCNNIEVQRELFKRLGNIVHGIWGG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              + A   E   +DFVD   FV+YFK+ W P++ +W + +R LPLASQE   A+E YH +L
Sbjct  424   SDTAVALEQLTQDFVDQTAFVEYFKSYWVPKIEMWLSTMRTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KVKLFDDSHLGALQRVDWLVHKLTTELHSAYWLDRYADECDSFQNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D ++   AKV  Q D ++VH++WNP SEF+ CDC  +  GN+C+HV K  
Sbjct  543   LQIPDSAVTLDDKNRLFAKVSSQKDSSIVHLVWNPGSEFSFCDCMWSMQGNICKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQ  1234
                        S+S   +++ L+ +   P  DS+ +D +++  + + +Q+ + +     +
Sbjct  603   MICESHKGYQPSMSFQSFKELLVSISKKPMEDSISQDLSMAWTMQMLEQVRNLVEVTRAE  662

Query  1233  VVG  1225
              +G
Sbjct  663   DIG  665



>ref|XP_008242047.1| PREDICTED: uncharacterized protein LOC103340404 [Prunus mume]
Length=720

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/667 (43%), Positives = 434/667 (65%), Gaps = 5/667 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + I  LPVQ+PP  EFS++D+ W+K  G  ++ D  ALIPY RVD+F+ GE +N E
Sbjct  1     MAIVEFIGDLPVQDPPEEEFSAADLTWTKF-GTAEHHDDAALIPYDRVDEFIIGEGSNLE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+R   +  + K D  LEY +YWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRKMGSLKEYKDDEYLEYRMYWCSFGPENYGEGGSILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGAKTVP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +WVE ++  IF Y+D S+ D F+LGIQTEWQLQQMIRFG+  L+ASD+
Sbjct  240   HELDLDDQASIRMWVERNKKSIFIYQDTSEKDSFILGIQTEWQLQQMIRFGHCSLIASDS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +WM+AL +R  + +P WK+ 
Sbjct  300   TFGIKRLKYPLCTLLVFDSRQHALPVAWVITRSFAKPDVSKWMKALLDRARSVEPGWKIN  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +   IR++F C +L S WRVR +W +N++K+C+ +EV+  I KRLG +++ 
Sbjct  360   GFLIDDAAAETDPIRDIFCCPILFSLWRVRRSWLRNIVKKCNNIEVQREIFKRLGNIVYG  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G       E   +DFVD   F++YFK++W P++ +W + +R+LPLASQE   A+E Y
Sbjct  420   IWGGNGTLGALEELTQDFVDQTAFMEYFKSSWVPKIEMWLSTMRSLPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H ++K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+
Sbjct  480   HVKMKVKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADECDSFQNVKEEYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  V++D +    AKV+ Q D + VH++WNP SEF+ CDC  +  GNLC+H+
Sbjct  539   WHRALQIPDSAVSLDDKDHLYAKVLSQKDSSTVHLVWNPGSEFSFCDCAWSMQGNLCKHI  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
              K       R     S+S   +++ L+ +L  P  DS+  D +++  + +  Q+   +  
Sbjct  599   IKVNMICESRQGYQPSMSFQSFKELLMSLLKKPMDDSVALDQSMAWTMQMFDQIRKLVEV  658

Query  1245  ESVQVVG  1225
              S   +G
Sbjct  659   TSSNDIG  665



>ref|XP_011081859.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
 ref|XP_011081860.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
 ref|XP_011081861.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
Length=697

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/665 (44%), Positives = 427/665 (64%), Gaps = 7/665 (1%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ ++AR ++ILSLPVQ+PP  EFS+++I W KVEG R   D +ALIP++RVDDFV+G
Sbjct  2     KGHESKVARMEDILSLPVQDPPYAEFSAANINWVKVEGGRQGGDDIALIPFSRVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTY  2875
             ES+N ECP  F VE+RR+R   +  KP+VDG LEY LYWCS+GP+D+R         ++ 
Sbjct  62    ESSNAECPASFRVESRRKRPEGSLNKPRVDGYLEYTLYWCSYGPEDYRDIEPHIGENSSA  121

Query  2874  VPKKKSAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
              P      RP  +   RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D++A
Sbjct  122   KPASGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDQEA  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+++L+VG+S++ I+Q H E V+R GGP NRDD LT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMAMLHVGISLDMIVQHHMEEVQRHGGPQNRDDFLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER IR S+ EL ++D  S+ +WV+ H  H+F++++   S+  +LGIQT+WQLQQM+R+G
Sbjct  242   MERLIRNSSLELHSNDHCSVKMWVQRHHKHVFYFQENCGSETLILGIQTDWQLQQMLRYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
             + G LAS    G  KLKY + SL+ F+S + AIPVAWII     S++  +WM +L  R+ 
Sbjct  302   HNGSLASHTASGPKKLKYTLCSLLAFDSSHNAIPVAWIITSSSLSQNIHKWMPSLVERIR  361

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIA  1984
              KD  W+    +VDDP  +   IRE FQC VL+S W VR  W K L+K C+   V+  + 
Sbjct  362   GKDTRWRPNAILVDDPSFEASVIREGFQCRVLLSIWHVRRCWLKGLLKYCNNFNVQREMF  421

Query  1983  KRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
             K LG +++    G   ++  + FM+ ++D   F++YF++ W P++ LW +++R+LP+A Q
Sbjct  422   KHLGRIVYCTRSGSSTSDAVDEFMQIYIDQSAFIEYFRSKWLPKIELWVSSVRSLPVAGQ  481

Query  1803  ETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWK  1624
             E  A++E YH +LK R+L+    + Y+R D L+  L T  HS++W D Y  +  +    +
Sbjct  482   EPYASVESYHLRLKSRVLSLLPANSYQRVDLLIHALTTQFHSFYWFDHYIAETGYFENLR  541

Query  1623  DEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSA  1453
             D + S    W +++ IPD DV +D E+   AKVV Q D ++ + +WNP SEF  CDC+ +
Sbjct  542   DRF-SLTNPWYQAMHIPDIDVLLDEENLHFAKVVSQADSSVAYTVWNPGSEFGFCDCSWS  600

Query  1452  NMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQ  1273
              +GN+C+H  K + + R R  A   +S   YRQ L+ +L   P D L+ +HA++    +Q
Sbjct  601   MLGNMCKHTIKVVIFCRCRQIARPLLSAQVYRQTLLNLLQNLPDDPLVLEHAIAHVTRLQ  660

Query  1272  KQLNS  1258
             + + S
Sbjct  661   QDIKS  665



>ref|XP_009383179.1| PREDICTED: uncharacterized protein LOC103970968 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383259.1| PREDICTED: uncharacterized protein LOC103970968 [Musa acuminata 
subsp. malaccensis]
Length=727

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/648 (45%), Positives = 423/648 (65%), Gaps = 6/648 (1%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PPT EF++SD+ W+K      ++D VAL+PY RVD F+ GE +N E PT+FH+E 
Sbjct  10    LPVQDPPTEEFTASDLTWTKYGSSEHHVDDVALVPYDRVDAFIGGECSNPEHPTRFHIER  69

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + K D  L Y LYWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  70    GRKRERGSLKECKSDEYLLYRLYWCSFGPENYGEGGSILPSRRYRLNTRNRAARPQSMRG  129

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  130   CTCHFAIKRLYARPSIALIIYHERRHVNKSGFICHGPLDRDAIGPGAKKVPYICSEIQQQ  189

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+G+  E ++Q H E V+R   P    + L  +YV++    I+RST+ELD DD  
Sbjct  190   TMSLIYLGIPEENVLQTHIEGVQRYCDPNASVNSLASQYVQKLGMIIKRSTHELDLDDQA  249

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WVE ++  +FFY+D S++DPF+LGIQTEWQLQQMIRF ++ +LA D+ FG +KLKY
Sbjct  250   SIRMWVEKNKKSVFFYQDSSETDPFILGIQTEWQLQQMIRFCHQSILACDSSFGISKLKY  309

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+++L+ F+S + A+PVAW+I      +D  +WM+AL +R+   D  W + GFI+DDP  
Sbjct  310   PLYTLLAFDSRHHALPVAWVITRTITKQDVSKWMKALVDRIRAVDSVWNIYGFIIDDPAL  369

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IRE+F C +L S WR+R +W KN++K+C  +EV+  I KRLG++++SI    +P +
Sbjct  370   EIDPIREIFCCPILFSLWRIRRSWLKNVIKKCGHIEVQREIYKRLGKIMYSIWTKEDPMD  429

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DF+D   F+ YFKA W P++ +W   +++LPLASQE+C A+E YH +LKL++ 
Sbjct  430   AMEELFQDFIDQTAFIQYFKAFWVPKIEMWLGTIKSLPLASQESCGAIEGYHVKLKLKVY  489

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ +       K+E+I   T+W ++LQIPD
Sbjct  490   DDSHLGALQRVDWLVHKLTTELHSGYWLDLYADESGSFPSVKEEYILS-TSWHRALQIPD  548

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT D +    AKV+ Q D     ++WNP SEFALCDC+ +  GNLC+H+ K     + 
Sbjct  549   DVVTFDDKEHLFAKVLSQKDGGQERMVWNPGSEFALCDCSWSMQGNLCKHIIKVNLLCQH  608

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQ  1255
             +     S+S   +++ L+ +   P  DSL  D  LS+A   Q Q N Q
Sbjct  609   KKEFLPSLSYLSFQEVLLDLWRKPMDDSLSLD--LSMAWVAQMQDNIQ  654



>ref|XP_004968166.1| PREDICTED: uncharacterized protein LOC101763681 [Setaria italica]
Length=727

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/665 (44%), Positives = 430/665 (65%), Gaps = 13/665 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQNPP  EFS++D+ W K      + D VALIPY R++ F+ GES N ECPT+FH+E 
Sbjct  16    LPVQNPPGEEFSAADLTWVKYASSEHHRDDVALIPYDRMEAFISGESNNPECPTRFHIER  75

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  76    GRKREMGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRRYRLNTRNRAARPQSMRG  135

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ LIIY++ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  136   CTCHFAIKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKVPYIGSEIQQQ  195

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R      + D L  +YV++    I+RST+ELD DD  
Sbjct  196   TMSLIYLGVPEENILQTHIEGIQRYCSSDAKVDSLASQYVQKLGMIIKRSTHELDLDDQA  255

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FF++D +++D F+LGIQTEWQLQQM+RFG++ LLAS + FG +KLKY
Sbjct  256   SIRMWVDRNKKSVFFHQDSTETDAFILGIQTEWQLQQMMRFGHQSLLASHSSFGVSKLKY  315

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+L+VF+S  +A+PVAWII    A +DT++WMRAL +R+H+ D TW++ GFI+DDP +
Sbjct  316   PLHTLLVFDSRQQALPVAWIITRSVAKKDTLKWMRALTDRIHSIDSTWRIGGFIIDDPAS  375

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IR+VF C VL S WR+R  W KN++K+CS +EV+  I  +LG++I++I     P +
Sbjct  376   ELDPIRDVFACPVLFSLWRIRRTWLKNVIKKCSNVEVQREIFIQLGKIIYNIWSEKNPMD  435

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
                   +DFVD   F+ YFK+ W P+L +W +++R LPLASQE+C A+E YH +LKL+  
Sbjct  436   ALGQLFQDFVDQTAFIKYFKSFWVPKLEMWIDSIRNLPLASQESCGAIEAYHLKLKLKAY  495

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +W++ +S +       K ++I+  T+W+++LQIPD
Sbjct  496   DDVQLDALQRVDWLVHKLTTELHSSYWINLFSDESGSFPEVKADYIAS-TSWQRALQIPD  554

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               V  D +    AKVV Q D + +  +WNP SEF+LC+C+ +  GNLC+HV K       
Sbjct  555   DAVIFDDKEPLLAKVVSQKDPSQMRTVWNPGSEFSLCNCSWSMQGNLCKHVLKVNMMCGT  614

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVGPT  1219
             R     S+S   ++  L+ +   P  DS   D  LSVA WV +       QE +Q +   
Sbjct  615   RKDFQPSLSFQSFQHVLLGLWQKPSDDSFSLD--LSVA-WVMQM------QERIQHIAEL  665

Query  1218  TTYGG  1204
              T  G
Sbjct  666   ATSDG  670



>ref|XP_004236786.1| PREDICTED: uncharacterized protein LOC101247514 [Solanum lycopersicum]
Length=719

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/651 (46%), Positives = 423/651 (65%), Gaps = 8/651 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  L VQ+PP  +FS+SD+ W+K  G  +  D VALI Y RVD F+ GE  N E PT+
Sbjct  5     ESIPDLAVQDPPGEDFSASDLSWTKF-GTEERHDDVALIHYDRVDAFIIGECCNVEFPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LE+ LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKEYKPDEYLEHRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHFIVKRL A PS+AL+IYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFIVKRLYARPSLALLIYNNRRHVNKSGFVCHGPLDRDAIGPGAKNIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++ +H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLAKHIEGIQRYCGSDAKVNSLAAQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  +FFY+D S++DPF+LG+QTEWQL QMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRLWVERNKKSVFFYQDASENDPFILGVQTEWQLLQMIRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAWII    A  D  +WM+AL++RV   DPTWK+ GF+V
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWIITRTIAKPDVSKWMKALHDRVLAVDPTWKVNGFLV  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C+VL S WR+R AW +N++K+CS +EV+  I KRLG +++ I  G
Sbjct  364   DDAAAEIDPIREIFSCAVLFSLWRIRRAWLRNIIKKCSNIEVQREIFKRLGNIVYRIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E   +DFVD + F+ YFKATW P+  +W   ++ LPLASQE   A+E YH +L
Sbjct  424   TDPFVALEELSQDFVDQIAFLQYFKATWVPKFEMWVTTMKTLPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K+RL ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K E+I+  T+W ++
Sbjct  484   KVRLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKAEYIAT-TSWNRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  VT+D ++   AKV+ Q D  +  ++WNP SEFA CDC  +  GNLC+HV K  
Sbjct  543   LQIPDAAVTLDCKNNSFAKVLSQKDSTIARLVWNPGSEFAHCDCEWSMQGNLCKHVIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                 +  S   S+S   + + L  +   P  DS+  D  LS A W  + L+
Sbjct  603   MICGNLQSYRPSMSFQSFNEILDSLSKKPVDDSIALD--LSTA-WTHQMLD  650



>ref|XP_007133525.1| hypothetical protein PHAVU_011G186500g [Phaseolus vulgaris]
 gb|ESW05519.1| hypothetical protein PHAVU_011G186500g [Phaseolus vulgaris]
Length=719

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/645 (44%), Positives = 423/645 (66%), Gaps = 5/645 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+P   EF ++D+ W+K  G  ++ D VALIPY RVD F+ GE +N E
Sbjct  1     MAIVESVGKIPLQDPSEEEFGAADLTWTKF-GTAEHHDVVALIPYDRVDAFIIGECSNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+RT  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTCHF+VKRL A PS+ALIIYN+ +H++K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHINKSGFICHGPLDRDAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   +   L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSDAKVSSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +W+E ++  +FF++D S+SD F+LGIQTEWQLQQMIRFG+R ++A+D+
Sbjct  240   HELDLDDQASIRMWIERNRKSVFFHQDTSESDAFILGIQTEWQLQQMIRFGHRSVIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +W++AL +R  + +P WK++
Sbjct  300   TFGVKRLKYPLFTLLVFDSRQHALPVAWVITRSFAKPDVSKWLKALIDRARSVEPGWKVS  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +I  +R++F C VL S WRVR +W +N++K+CS +EV+  I KRLG +++S
Sbjct  360   GFLIDDAAAEIDLLRDIFCCPVLFSLWRVRRSWLRNIVKKCSSIEVQREIFKRLGTIVYS  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G   A   E FM DFVD   F++YFK +W P+L +W + +R   L SQE   ALE Y
Sbjct  420   IWGGINTALALEQFMLDFVDQTAFMEYFKTSWLPKLEMWLSTMRNFQLGSQEASGALEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H +LK +L ++  L   +R DWLV +L T +HS +WLD Y+ + D  +  K+++I   T+
Sbjct  480   HVKLKAKLFDDSHLGALQRVDWLVHRLTTELHSSYWLDRYADESDSFQNVKEKYILS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  VT+D      AKVV Q D +++H++WNP SEFA CDC+ +  GNLC+HV
Sbjct  539   WHRALQIPDYAVTLDDRDHLFAKVVSQKDSSLLHLVWNPGSEFAFCDCSWSMQGNLCKHV  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALS  1291
              K      +      S+S   + + L+ +   P  DS   D +L+
Sbjct  599   VKVNMICENLKGYQPSMSFRSFEEVLMDLWRKPVDDSFALDLSLA  643



>ref|XP_008466356.1| PREDICTED: uncharacterized protein LOC103503790 isoform X1 [Cucumis 
melo]
 ref|XP_008466357.1| PREDICTED: uncharacterized protein LOC103503790 isoform X1 [Cucumis 
melo]
Length=678

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/655 (45%), Positives = 417/655 (64%), Gaps = 11/655 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL L VQ+PP LEFS++ I W K+EG R     +A++P++RV+DFV+GES+N E
Sbjct  2     MPRTEDILKLQVQDPPCLEFSAAHIKWEKIEGGRQGGADIAVVPFSRVEDFVKGESSNPE  61

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP +F +E+RR+RTA +  KP+VDG LEYILYWCS+GP+D+R       S +   P    
Sbjct  62    CPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  121

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL A P +ALIIYNQ KH+DK G PCHG  D+ A GTRAM
Sbjct  122   GSRPGRRHMMRGCLCHFTVKRLYARPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  181

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             Y   ISE+LR +++S+LYVG+ +E I+Q H+E V+  GGP NRDD L+   VR  ER IR
Sbjct  182   YTQRISEELRQKIMSMLYVGIPIENIVQHHSEVVQGHGGPQNRDDFLSRIDVRNMERVIR  241

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++EL  +D  S+ +WV+ H+  IFF+++ SD + FVLGIQT+WQLQQM+R+G+ G +A
Sbjct  242   NSSHELHINDDCSVKIWVQRHRKFIFFFQESSDCERFVLGIQTDWQLQQMLRYGHNGSVA  301

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S +  G+ KL++P+ SL+VF+S    IPVAWIIA  F  +D  +W+  L  R+H KDPTW
Sbjct  302   SHSTLGSKKLRFPLCSLLVFDSSQNTIPVAWIIASSFVDQDIRKWLGLLVERLHEKDPTW  361

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             K+  F++D+P  ++  IREVFQC VL+  W VR +W +NL+ +C  ++V+  I K+LG++
Sbjct  362   KIDTFLLDNPSFEVSTIREVFQCRVLLCIWHVRRSWVRNLLNKCPNLDVQREIFKQLGKV  421

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++    G       E F   F D   F DY   TW P +  W N++R  P+++ E  AA+
Sbjct  422   LYCSRIGLGFEYAVEQFKRRFADQCVFDDYLTRTWLPDIESWVNSIRLHPVSTLEANAAI  481

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L  E+  S   R DWL+  L T VHS +WLD+YS    +   ++D+ I  
Sbjct  482   EAYHIRLKSKLFKEQSNSSSSRVDWLIHTLTTQVHSSYWLDQYSLDTGYLGSFRDKSILT  541

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW K+L IPD DV +D  +   AKV+ Q  +N+ + IW+P SEF+LCDC  + MGNLC
Sbjct  542   -NAWNKALHIPDVDVMLDESNLQFAKVISQSKRNLEYTIWDPGSEFSLCDCPWSRMGNLC  600

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQK  1270
             +HV K +  L  R  A   +   Q  Q  +      P   +  DH + +   VQ+
Sbjct  601   KHVIK-VSLLCKRQQAARPLVAAQVYQDRVPNFQLNP---VTFDHGMPLVNCVQR  651



>ref|XP_002466103.1| hypothetical protein SORBIDRAFT_01g001310 [Sorghum bicolor]
 gb|EER93101.1| hypothetical protein SORBIDRAFT_01g001310 [Sorghum bicolor]
Length=728

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/665 (44%), Positives = 429/665 (65%), Gaps = 13/665 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R++ F+ GES N ECPT+FH+E 
Sbjct  19    LPVQDPPGEEFSAADLTWVKYASSEHHRDDVALIPYDRMEAFIGGESNNPECPTRFHIER  78

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  79    GRKRERGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARPQSMRG  138

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF VKRL A PS+ LIIY++ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  139   CTCHFTVKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKMPYIGSEIQQQ  198

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R      + D L  +YV++    I+RST+ELD DD  
Sbjct  199   TMSLIYLGVPEENILQTHIEGIQRYCSADAQVDNLASQYVQKLGMIIKRSTHELDLDDQA  258

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FFY+D +++D F+LGIQTEWQLQQM+RFG++ LLAS + FG +KLKY
Sbjct  259   SIRMWVDRNKKSVFFYQDSTEADAFILGIQTEWQLQQMMRFGHQSLLASHSSFGVSKLKY  318

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+L+VF+S   A+PVAW+I     ++DT++WMRAL +R+H+ D TW++ GFI+DDP +
Sbjct  319   PLHTLLVFDSRQHALPVAWVITRSVTNKDTLKWMRALTDRIHSIDSTWRIGGFIIDDPAS  378

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IREVF C VL S W +R  W KN++K+CS +EV+  I  +LG++I+SI     P +
Sbjct  379   ELGPIREVFACPVLFSVWHIRRTWLKNVIKKCSNVEVQREIFIQLGKIIYSIWSEKNPMD  438

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
                   +DFVD   F+ YFK+ W P+L +W +++R LPLASQE+C A+E YH +LK++  
Sbjct  439   ALGKLFQDFVDQTTFIKYFKSFWVPKLEMWIDSIRNLPLASQESCGAIEGYHLKLKVKAY  498

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +W++ ++ +       K ++I+  T+W+++LQIPD
Sbjct  499   DDVQLDALQRVDWLVHKLTTELHSSYWINLFADESGSFPEVKADYIAS-TSWQRALQIPD  557

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT D +    A+VV Q D +    +WNP SEF+LCDC+ +  GNLC+HV K       
Sbjct  558   AAVTFDDKEPLLARVVSQKDTSQTRTVWNPGSEFSLCDCSWSMQGNLCKHVLKVNMMCGA  617

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVGPT  1219
             R     S+S   Y+  L+ +   P  DS   D  LSVA WV +       QE ++ V   
Sbjct  618   RKDFQPSLSFQSYQHVLLDLWQKPLDDSFSLD--LSVA-WVMQM------QEKIKHVAEL  668

Query  1218  TTYGG  1204
              T GG
Sbjct  669   ATSGG  673



>ref|XP_008466358.1| PREDICTED: uncharacterized protein LOC103503790 isoform X2 [Cucumis 
melo]
Length=677

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/655 (45%), Positives = 417/655 (64%), Gaps = 11/655 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL L VQ+PP LEFS++ I W K+EG R     +A++P++RV+DFV+GES+N E
Sbjct  1     MPRTEDILKLQVQDPPCLEFSAAHIKWEKIEGGRQGGADIAVVPFSRVEDFVKGESSNPE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP +F +E+RR+RTA +  KP+VDG LEYILYWCS+GP+D+R       S +   P    
Sbjct  61    CPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL A P +ALIIYNQ KH+DK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYARPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             Y   ISE+LR +++S+LYVG+ +E I+Q H+E V+  GGP NRDD L+   VR  ER IR
Sbjct  181   YTQRISEELRQKIMSMLYVGIPIENIVQHHSEVVQGHGGPQNRDDFLSRIDVRNMERVIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++EL  +D  S+ +WV+ H+  IFF+++ SD + FVLGIQT+WQLQQM+R+G+ G +A
Sbjct  241   NSSHELHINDDCSVKIWVQRHRKFIFFFQESSDCERFVLGIQTDWQLQQMLRYGHNGSVA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S +  G+ KL++P+ SL+VF+S    IPVAWIIA  F  +D  +W+  L  R+H KDPTW
Sbjct  301   SHSTLGSKKLRFPLCSLLVFDSSQNTIPVAWIIASSFVDQDIRKWLGLLVERLHEKDPTW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             K+  F++D+P  ++  IREVFQC VL+  W VR +W +NL+ +C  ++V+  I K+LG++
Sbjct  361   KIDTFLLDNPSFEVSTIREVFQCRVLLCIWHVRRSWVRNLLNKCPNLDVQREIFKQLGKV  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++    G       E F   F D   F DY   TW P +  W N++R  P+++ E  AA+
Sbjct  421   LYCSRIGLGFEYAVEQFKRRFADQCVFDDYLTRTWLPDIESWVNSIRLHPVSTLEANAAI  480

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L  E+  S   R DWL+  L T VHS +WLD+YS    +   ++D+ I  
Sbjct  481   EAYHIRLKSKLFKEQSNSSSSRVDWLIHTLTTQVHSSYWLDQYSLDTGYLGSFRDKSILT  540

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW K+L IPD DV +D  +   AKV+ Q  +N+ + IW+P SEF+LCDC  + MGNLC
Sbjct  541   -NAWNKALHIPDVDVMLDESNLQFAKVISQSKRNLEYTIWDPGSEFSLCDCPWSRMGNLC  599

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQK  1270
             +HV K +  L  R  A   +   Q  Q  +      P   +  DH + +   VQ+
Sbjct  600   KHVIK-VSLLCKRQQAARPLVAAQVYQDRVPNFQLNP---VTFDHGMPLVNCVQR  650



>emb|CDP09645.1| unnamed protein product [Coffea canephora]
Length=728

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/662 (44%), Positives = 429/662 (65%), Gaps = 19/662 (3%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  +PVQ+PP  EFS++D+ W+K  G  +  D VALIPYARVD F+ GE  N ECPT+
Sbjct  5     ESIFDIPVQSPPAEEFSAADLDWTKF-GTIERHDDVALIPYARVDAFIIGECLNAECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRARGSLQEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNNRRHVNKSGSICHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGLIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  S+ LWVE ++  +FFY+D S++DPF+LGIQTEWQLQQMIRFG+R ++A+D+ FG 
Sbjct  244   LDDQASVKLWVERNKKSVFFYQDTSETDPFILGIQTEWQLQQMIRFGHRSIVAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAW+I       D  +WM+AL +RVHT D  WK+  F+V
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWVITRSVVKSDVAKWMKALVDRVHTVDLGWKVNAFLV  363

Query  2124  DDPLTDIPAIRE-----------VFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKR  1978
             DD   +I  IR+           +F C VL S WR+R +W +N++K+C+ +EV+  I KR
Sbjct  364   DDAAAEIDPIRQNSLLCLPFCFSIFSCPVLFSLWRIRRSWLRNILKKCNNIEVQREIFKR  423

Query  1977  LGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQET  1798
             LGE+++SI    +     E F +DFVD   F++YF+ATW P++ +W   +R LPLASQE+
Sbjct  424   LGEIVYSIWGEVDYMVPLEKFTQDFVDQTAFLNYFRATWLPKMEMWLTGMRTLPLASQES  483

Query  1797  CAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDE  1618
               A+E YH +LK++L ++  L  ++R DWLV KL T +HS +WLD ++ + D  +  K+E
Sbjct  484   SGAIEAYHVKLKVKLYDDSHLGAFQRVDWLVHKLTTELHSSYWLDRFADESDSFQNVKEE  543

Query  1617  WISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANM  1447
             +++  T+W ++LQIPD  VT+D +    AKV+ Q +     ++WNP SEF+LCDC  +  
Sbjct  544   YLAS-TSWHRALQIPDTAVTLDDKDHPFAKVLSQRESTRTRIVWNPGSEFSLCDCEWSMQ  602

Query  1446  GNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQ  1267
             GNLC+HV K      +  S   ++S   ++  L+ +   P  DS+  D  LS A W  + 
Sbjct  603   GNLCKHVIKVNMICENLRSYQPTLSFQSFQDILMSLQEKPLDDSIALD--LSTA-WAHQM  659

Query  1266  LN  1261
             L+
Sbjct  660   LD  661



>emb|CAN60858.1| hypothetical protein VITISV_039453 [Vitis vinifera]
Length=706

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/651 (45%), Positives = 427/651 (66%), Gaps = 22/651 (3%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL +PVQ+P   EFSS+D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     ESILDIPVQDPKEEEFSSADLNWTKF-GNPEHHDDVALIPYARVDAFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKEYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+ALIIYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICS  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R ++A D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDSSEADPFILGIQTEWQLQQMIRFGHRSIMAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII   FA  D  +WM+AL +R H  D  WK++G   
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWIITRSFAKPDVSKWMKALLDRAHGIDIGWKVSG---  360

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
                        +VF C VL S WRVR +W +N++K+ S +EV+  + KRLG++++SI  G
Sbjct  361   -----------DVFCCPVLFSLWRVRRSWLRNIIKKSSNVEVQREMFKRLGKIVYSIWSG  409

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E F +DFVD   F++YFKA W P++ +W + ++ LPLASQE   A+E YH +L
Sbjct  410   VDSLVALEEFTQDFVDQTSFIEYFKALWMPKIEMWIDMMKTLPLASQEASGAIEAYHVKL  469

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  470   KVKLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  528

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L+IPD  V ++ ++   AKV+ Q D N+ H++WNP SEFA CDC  A  GNLC+H+ K  
Sbjct  529   LRIPDTSVILEDKNQLFAKVLSQKDSNLTHLVWNPGSEFAFCDCEWAMQGNLCKHIIKVN  588

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                ++  +  SS+S   +R+ L+ +   P  DS+  D A++   W  + L+
Sbjct  589   MICKNHQAYQSSMSFQSFREILMNLWRKPMDDSVALDQAVA---WTHQMLD  636



>ref|XP_007204630.1| hypothetical protein PRUPE_ppa002073mg [Prunus persica]
 gb|EMJ05829.1| hypothetical protein PRUPE_ppa002073mg [Prunus persica]
Length=720

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/667 (42%), Positives = 434/667 (65%), Gaps = 5/667 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + I  LPVQ+PP  EFS++D+ W+K  G  ++ D  ALIPY RVD+F+ GE +N E
Sbjct  1     MAIVECIGDLPVQDPPEEEFSAADLTWTKF-GTAEHHDDAALIPYDRVDEFIIGEGSNLE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+R   +  + K D  LEY +YWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRKMGSLKEYKDDEYLEYRMYWCSFGPENYGEGGSILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGAKTVP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E I+++H E ++R  G   + + L  +YV +    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENILEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI +WVE ++  IF Y+D S+ D F+LGIQTEWQLQQMIRFG+  L+A+D+
Sbjct  240   HELDLDDQASIRMWVERNKKSIFIYQDTSEKDSFILGIQTEWQLQQMIRFGHCSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +WM+AL +R  + +P WK+ 
Sbjct  300   TFGIKRLKYPLCTLLVFDSRQHALPVAWVITRSFAKPDVSKWMKALLDRARSVEPGWKIN  359

Query  2136  GFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             GF++DD   +   IR++F C +L S WRVR +W +N++K+C+ +EV+  I KRLG +++ 
Sbjct  360   GFLIDDAAAETDPIRDIFCCPILFSLWRVRRSWLRNIVKKCNNIEVQREIFKRLGNIVYG  419

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             I  G       E   ++FVD   F++YFK++W P++ +W + +R+LPLASQE   A+E Y
Sbjct  420   IWGGNGTLGALEELTQEFVDQTAFMEYFKSSWVPKIEMWLSTMRSLPLASQEASGAIEAY  479

Query  1776  HNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTA  1597
             H ++K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+
Sbjct  480   HVKMKVKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADECDSFQNVKEEYIAS-TS  538

Query  1596  WRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             W ++LQIPD  +++D +    AKV+ Q D + VH++WNP SEF+ CDC  +  GNLC+H+
Sbjct  539   WHRALQIPDSAISLDDKDHLYAKVLSQKDSSTVHLVWNPGSEFSFCDCAWSMQGNLCKHI  598

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
              K       R     S+S   +++ L+ +L  P  DS+  D +++  + +  Q+   +  
Sbjct  599   IKVNMICESRQGYQPSMSFQSFKELLMSLLKKPMDDSVALDQSMAWTMQMFDQIRKLVEV  658

Query  1245  ESVQVVG  1225
              S   +G
Sbjct  659   TSSNDIG  665



>ref|XP_002886608.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62867.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/656 (43%), Positives = 430/656 (66%), Gaps = 9/656 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  +PVQNP   +FS +D+ W+K  G  ++ D VALIPY+RVD+F+ GE +N ECPT+
Sbjct  5     ESIEEIPVQNPQIEDFSWADLTWTKF-GTSEHHDEVALIPYSRVDEFIIGECSNAECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ++RFG+  L+A+D  FG 
Sbjct  244   LDDQASIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQLVRFGHCSLVAADLTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + DP +K+ GFI+
Sbjct  304   KRLKYPLCTLLVFDSRHHALPVAWIISRSYLKSDVTKWMKILLQRAQSIDPGFKINGFII  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD  T+I  IR+ F C +L S WRVR +W +N++K+C  +EV+  + K LGE+++SI  G
Sbjct  364   DDAATEIDPIRDTFCCPILFSLWRVRRSWLRNVVKKCDSLEVQRDLFKCLGELVYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E   +DFVD   F+ YF +TW P++G+W +A+++LPLASQE C A+E YH +L
Sbjct  424   VDTKKALERLTQDFVDQTAFMQYFTSTWLPKIGMWLSAMKSLPLASQEACGAIEAYHIKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  484   KVKLFDDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
              +IP+  VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K  
Sbjct  543   SEIPESAVTLDESNVLVAKVQSQRDSDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +R     S+S+  +++ L  +   P  DS+  D ++++ +    Q+  QI Q
Sbjct  603   TMCENRKGYGDSMSLRSFKEKLRNIKMKPMDDSIALDLSMALTL----QMFDQIKQ  654



>ref|XP_010674758.1| PREDICTED: uncharacterized protein LOC104890846 [Beta vulgaris 
subsp. vulgaris]
Length=719

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/655 (45%), Positives = 429/655 (65%), Gaps = 17/655 (3%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I  L +Q+PP  EFSS+D+ W+K  G  ++ D VA IPY RVDDF+ GE +N E PT+
Sbjct  5     ESIDDLSLQDPPEAEFSSADLKWTKF-GTAEHHDDVAKIPYDRVDDFIIGECSNVEFPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRRRGSLKEYKSDDYLEYKLYWCSFGPENYGEGGDILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A P++ALIIYN+ +HV+K G PCHG  D+ A G  A   PY+  
Sbjct  124   QSMRGCTCHFVVKRLYACPTLALIIYNERRHVNKSGFPCHGALDRDAIGPGAKKIPYVGT  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTH---RYVRRQERSIRRSTY  2494
             +++ + +S++Y+G+  E ++Q+H E ++R    CN D  L+    +YV++    I+RST+
Sbjct  184   EMQQQAMSMIYLGIPEENVVQKHLEGIQRY---CNADAKLSKMASQYVQKLGMVIKRSTH  240

Query  2493  ELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDAR  2314
             ELD DD  S+ LWVE ++  +FFY+D SD DP +LGIQTEWQ+QQMIRFG+R ++A+D+ 
Sbjct  241   ELDLDDQASVRLWVERNKKSVFFYQDSSDGDPLILGIQTEWQVQQMIRFGHRSIIAADST  300

Query  2313  FGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAG  2134
             FG  KL+YP+ +L+VF+S   A+PVAWII   FA  DT +WM+AL +R+   D  WK++G
Sbjct  301   FGLKKLRYPLCTLLVFDSRQHALPVAWIITRSFAKPDTSKWMKALVDRIRAVDTGWKVSG  360

Query  2133  FIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSI  1954
             +++DD   ++  IR++F C VL S WRVR AW +N++K+CSE+EV+  I K LG+++ SI
Sbjct  361   YVIDDAAAELEPIRDMFCCPVLFSLWRVRRAWLRNIVKKCSELEVQRKIFKHLGDVVSSI  420

Query  1953  CKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYH  1774
              KG + A   E FM+DF D   F+ YFK  W P++ +W + +R +PLASQE   A+E YH
Sbjct  421   WKGLDSAVAIEKFMQDFSDQTAFMQYFKDCWLPKIEMWLSIMRTVPLASQEAAGAIEAYH  480

Query  1773  NQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAW  1594
              +LK ++ ++  L  ++R DWLV KL   +HS +WLD YS + D  +  K+ +++  T+W
Sbjct  481   IKLKTKVFDDSHLGAFQRVDWLVHKLTAELHSSYWLDRYSDEHDTFKDVKEMYLAS-TSW  539

Query  1593  RKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVF  1423
              ++LQI D  V         A++  Q D  + H++WNP SEFA C+C  A  GNLC+HV 
Sbjct  540   HRALQISDTAVYFHENHDFFAEIQSQKDNTVSHIVWNPGSEFAFCNCAWALQGNLCKHVI  599

Query  1422  K-SIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
             K ++ Y   +GSA  S+S   +R+ L  +L  P  DS+  D A++   W  + LN
Sbjct  600   KVNMMYETRQGSA--SMSFHSFRELLTSLLRKPMDDSIELDKAMA---WTHQMLN  649



>ref|NP_176256.2| SWIM zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AAL91647.1| At1g60560/F8A5_10 [Arabidopsis thaliana]
 gb|AAO11540.1| At1g60560/F8A5_10 [Arabidopsis thaliana]
 gb|AEE33698.1| SWIM zinc finger-like protein [Arabidopsis thaliana]
Length=703

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/651 (43%), Positives = 429/651 (66%), Gaps = 9/651 (1%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS +D+ W+K  G  ++ D+VAL+PYARVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQVEDFSWADLTWTKF-GTSEHHDQVALVPYARVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDSLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ++RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQLVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +   IR+ F C +L S WRVR +W +N++K+C  +EV+  + K LGE+++SI  G +   
Sbjct  369   ETDPIRDTFCCPILFSLWRVRRSWLRNVVKKCDSIEVQRDLFKCLGELVYSIWDGVDTTK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  429   ALEKLTQDFVDQTAFMQYFTSTWLPKIGMWLSTMKSLPLASQEACGAIEAYHIKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++++IPD
Sbjct  489   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWYRAMEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  548   SAVTLDENNILLAKVQSQRDSDVTRVVWNPGSEFAFCDCTWSLQGNLCKHIIKVNTMCEN  607

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             R     S+S+  +++ L  +   P  DS+  D ++++ +    Q+  QI Q
Sbjct  608   REGYGDSMSLRSFKEKLRNIKMKPMDDSIALDLSMALTL----QMFDQIKQ  654



>ref|XP_003628114.1| hypothetical protein MTR_8g043760 [Medicago truncatula]
Length=732

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/668 (42%), Positives = 434/668 (65%), Gaps = 19/668 (3%)
 Frame = -3

Query  3222  IQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESAN  3043
             ++MA  + + ++P+Q+P   EFS++D+ W+K  G  ++ D VALIPY RVD F+ GE +N
Sbjct  1     MEMAIVESVRNIPLQDPSEEEFSAADLTWTKF-GSAEHYDEVALIPYDRVDAFIIGECSN  59

Query  3042  KECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKK  2863
               CPT+FH+E  R+RT  T  + K D  LEY  YWCSFGP+++ +GG + PSR   +  +
Sbjct  60    VLCPTRFHIERGRKRTIGTLKEYKDDEYLEYRQYWCSFGPENYGEGGEILPSRRYRLNTR  119

Query  2862  KSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMY  2683
               A RP + RGCTCHF+VKRL A PS+ALIIYN+ +HV+  G  CHGP D+ A G  A  
Sbjct  120   NRAARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNTSGFICHGPLDRDAIGPGAKK  179

Query  2682  APYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRR  2503
              PYI  +++ + +S++Y+G+  E I+++H E +ER  GP  + + L  +YV +    I+R
Sbjct  180   IPYICNEIQQQTMSMIYLGIPEENILEKHIEGIERYCGPNAQVNSLASQYVHKLGMIIKR  239

Query  2502  STYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLAS  2323
             ST+ELD DD  SI +WVE ++  +FF++D S+SDPF+LGIQTEWQLQQM+RFG+R ++A+
Sbjct  240   STHELDLDDQASIRMWVERNRKSVFFHQDTSESDPFILGIQTEWQLQQMVRFGHRSIVAA  299

Query  2322  DARFGTNKLK-----------YPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALY  2176
             D+ FG  +LK           YP+ +L+VF+S   A+PVAWII   FA  D  +W++AL 
Sbjct  300   DSSFGVKRLKVIIFHSRLLSYYPLFTLLVFDSRQHALPVAWIITRSFAKPDVSKWLKALI  359

Query  2175  NRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVR  1996
             +R  + +P WK++GF++DD   DI  + ++F C VL S WR+R +W +N++++C+ +EV+
Sbjct  360   DRARSVEPGWKVSGFLIDDAAADIDLLSDIFDCPVLFSLWRIRRSWLRNIVRKCNNIEVQ  419

Query  1995  VTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALP  1816
               I KRLG +++SI  G   +   E  M DFVD  +F++YF+ +W P++ +W + +R +P
Sbjct  420   REIFKRLGTIVYSIWGGTNTSLALEQLMLDFVDQTDFLEYFRVSWLPKIEMWLSTMRNVP  479

Query  1815  LASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFA  1636
             LASQE   ALE YH +LK +L ++  L   +R DWLV KL T +HS +WLD ++ + D  
Sbjct  480   LASQEASGALEAYHVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRFADESDSF  539

Query  1635  RYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCD  1465
             +  K+ +I+  T+W ++L+IPD  VT+D ++   AKV  + D ++ H++WNP SEF+ CD
Sbjct  540   QNVKEGYIAS-TSWHRALEIPDSAVTLDDKNRLFAKVASKKDSSLTHIVWNPGSEFSFCD  598

Query  1464  CNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVA  1285
             C+ +  GNLC+HV K      +     SS+S   + + L+ +   P  DS   D +L+  
Sbjct  599   CSWSLHGNLCKHVIKVNMICENLQGCQSSMSFRSFEEVLMDLWRKPVDDSFALDLSLA--  656

Query  1284  VWVQKQLN  1261
              W  + L+
Sbjct  657   -WTHQMLD  663



>emb|CAN76964.1| hypothetical protein VITISV_043960 [Vitis vinifera]
Length=706

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/651 (44%), Positives = 426/651 (65%), Gaps = 22/651 (3%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + IL +PVQ+P   EFSS+D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     ESILDIPVQDPKEEEFSSADLNWTKF-GNPEHHDDVALIPYARVDAFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHIERGRKRSKGSLKEYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+ALIIYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICS  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WVE ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R ++A D+ FG 
Sbjct  244   LDDQASIRMWVERNKKSIFFYQDSSEADPFILGIQTEWQLQQMIRFGHRSIMAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAWII   FA  D  +WM+AL +R    D  WK++G   
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWIITRSFAKPDVSKWMKALLDRARGIDIGWKVSG---  360

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
                        +VF C VL S WRVR +W +N++K+ S +EV+  + KRLG++++SI  G
Sbjct  361   -----------DVFCCPVLFSLWRVRRSWLRNIIKKSSNVEVQREMFKRLGKIVYSIWSG  409

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E F +DFVD   F++YFKA W P++ +W + ++ LPLASQE   A+E YH +L
Sbjct  410   VDSLVALEEFTQDFVDQTSFIEYFKALWMPKIEMWIDMMKTLPLASQEASGAIEAYHVKL  469

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  470   KVKLYDDSHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  528

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L+IPD  V ++ ++   AKV+ Q D N+ H++WNP SEFA CDC  A  GNLC+H+ K  
Sbjct  529   LRIPDTSVILEDKNQLFAKVLSQKDSNLTHLVWNPGSEFAFCDCEWAMQGNLCKHIIKVN  588

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                ++  +  SS+S   +R+ L+ +   P  DS+  D A++   W  + L+
Sbjct  589   MICKNHQAYQSSMSFQSFREILMNLWRKPMDDSVALDQAVA---WTHQMLD  636



>ref|XP_003576405.1| PREDICTED: uncharacterized protein LOC100828723 [Brachypodium 
distachyon]
Length=726

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/665 (44%), Positives = 421/665 (63%), Gaps = 13/665 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R + F+ GE  N E PT+FH+E 
Sbjct  14    LPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRTEAFISGECNNPEYPTRFHIER  73

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  74    GRKRERGSLKEFRSDEYLLYRMYWCSFGPENYGEGGAILPSRKYRLNTRNRAARPQSMRG  133

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   PY+  +++ +
Sbjct  134   CTCHFAIKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGARRVPYVGSEIQQQ  193

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R  G   + D L  +YV +    I+RST+ELD DD  
Sbjct  194   TMSLIYLGVPEENILQTHIEGIQRYCGSDAKVDSLASQYVHKLGMIIKRSTHELDLDDQA  253

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FF++D +++D FVLGIQTEWQLQQMIRFG++GLLAS + FG +KLKY
Sbjct  254   SIRMWVDRNKKSVFFHQDATETDAFVLGIQTEWQLQQMIRFGHQGLLASHSSFGISKLKY  313

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+L+VF+S   A+PVAW+I      +DT+RWM+AL +R+H  D TW++ GFI+DDP +
Sbjct  314   PLHTLLVFDSRQHALPVAWVITRSVTKQDTLRWMKALTDRIHYVDSTWRIGGFIIDDPTS  373

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IR VF C +L S W +R  W KN++K+CS  EV+  I   LG+ ++SI     P +
Sbjct  374   ELDPIRNVFSCPILFSLWHIRRTWLKNIIKKCSNSEVQCEIFTILGKFMYSIWSEKNPMD  433

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YFK+ W P+L +W + +R LPLASQE+C A+E YH +LKL+  
Sbjct  434   ALEKLFQDFVDQTTFIQYFKSFWVPKLDMWIDTIRNLPLASQESCGAIEGYHLKLKLKAY  493

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WL+ Y+ +       K E+I+  T+W++++QIPD
Sbjct  494   DDSQLDALQRVDWLVHKLTTELHSGYWLNLYADESGSFPQVKAEYIAS-TSWQRAVQIPD  552

Query  1569  GDVTIDGE---SAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               V  D +   SAKV  Q D + + ++WN  SEF+LCDC+ +  GNLC+H+ K       
Sbjct  553   DSVVFDDKEPLSAKVASQKDASQMRIVWNAGSEFSLCDCSWSMQGNLCKHIIKVNMICAP  612

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVGPT  1219
             R     S+S   ++  L+ +   P  DS   D  LSVA WV +       QE +Q V   
Sbjct  613   RKDFQPSLSFQSFQHVLLDLWQKPVDDSFSLD--LSVA-WVMQM------QERIQKVSEL  663

Query  1218  TTYGG  1204
              T  G
Sbjct  664   ATSDG  668



>gb|EYU21901.1| hypothetical protein MIMGU_mgv1a023458mg [Erythranthe guttata]
Length=679

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/659 (44%), Positives = 420/659 (64%), Gaps = 11/659 (2%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MAR ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP++RV+DFV+GES+N +
Sbjct  1     MARMEDILNLPVQDPPYTEFSAAHINWVKVEGGRQGGDDIALIPFSRVEDFVKGESSNAD  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP  F VE+RR+R   +  KP+VDG LEY LYWCS+GP+D+R         T+  P    
Sbjct  61    CPANFRVESRRKRPEGSLNKPRVDGYLEYTLYWCSYGPEDYRDIEPQIGENTSTKPSSGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+++ GTRAM
Sbjct  121   GSRPGRRHMMRGCICHFTVKRLYTRPQLALIIYNQRSHVDKSGAPCHGILDQESVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+LR +V+SLL+VG S++ I+Q H E V+R GGP +RDD LT   VR  ER IR
Sbjct  181   YAPRISEELRQKVMSLLHVGTSLDAIVQHHMEEVQRHGGPHSRDDFLTRNDVRNMERLIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S +EL  DD  S+ +WV+ H  H+F++++    + FVLG+QT+WQLQQM+R+G+ G +A
Sbjct  241   NSPHELHLDDRCSVKMWVQRHHKHVFYFQESCGCEDFVLGVQTDWQLQQMLRYGHGGFIA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S    G+ K K  + SL+ F+S   AIPVAWII+     ++  +W+ +L  R+  KD  W
Sbjct  301   SHLVSGSKKFK-QLCSLLAFDSSQNAIPVAWIISSSSIGQNIHKWIPSLVERIRGKDTRW  359

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +    +VDDP  +   +RE FQC VL+  W VR  W K L+K C+  +V+  + K+LG +
Sbjct  360   RPNAVLVDDPSFEASILREAFQCRVLLCLWHVRRGWLKGLLKYCNNFDVQREMFKQLGRI  419

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++    G   A+  E F++ FVD   F++YF++ W  ++ LW N +R LP+A QET A++
Sbjct  420   LYCTRNGSSVADAVEEFVQIFVDQYAFIEYFRSKWLSKIELWVNCVRTLPVAPQETIASI  479

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK ++L++      +R D+L+  L +  HS++W ++Y+ +  +    +D + S 
Sbjct  480   ESYHLRLKSKVLSQ---DSDQRVDFLIHALTSQFHSFYWFEQYTVETGYFENLRDRF-SI  535

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
                W ++  IPD DV +D E+   AKVV Q D N+ + IWNP SEFALCDC+ + +GN+C
Sbjct  536   TNPWNQATHIPDIDVLLDEENLQLAKVVSQADNNVAYTIWNPGSEFALCDCSWSMVGNMC  595

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
             +HV K   + R R  A   +S   YRQ L+ +L   P D L+ +HA+S    +++ + S
Sbjct  596   KHVIKVAIFCRSRQIARPLLSAQVYRQTLVNLLQNLPEDPLVLEHAISHVTRLEQDIKS  654



>ref|NP_001062830.1| Os09g0309100 [Oryza sativa Japonica Group]
 dbj|BAD36226.1| SWIM zinc finger family protein-like [Oryza sativa Japonica Group]
 dbj|BAD36475.1| SWIM zinc finger family protein-like [Oryza sativa Japonica Group]
 dbj|BAF24744.1| Os09g0309100 [Oryza sativa Japonica Group]
 gb|EAZ44181.1| hypothetical protein OsJ_28802 [Oryza sativa Japonica Group]
 dbj|BAG95598.1| unnamed protein product [Oryza sativa Japonica Group]
Length=729

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/670 (43%), Positives = 424/670 (63%), Gaps = 13/670 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +  L VQ+PP  EFS++D+ W K        D VALIPY R+D F+ GE +N ECPT+
Sbjct  12    ESVSDLAVQDPPGEEFSAADLRWVKYASSEHQRDDVALIPYERMDAFIAGECSNPECPTR  71

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   T  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  72    FHIERGRKRDRGTLREVRSDDYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARP  131

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF +KRL A PS+ LIIY++ +H++K G  CHGP D+ A G  A   PY+  
Sbjct  132   QSMRGCTCHFAIKRLYARPSLVLIIYHERRHINKSGFICHGPLDRDAIGPGARRVPYVGS  191

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +SL+Y+GV  E I+Q H E + R  G   + D L  +YV++    I+RST+ELD
Sbjct  192   EIQQQTMSLIYLGVPEENILQTHMEGIHRYCGSDAKVDSLASQYVQKLGMIIKRSTHELD  251

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WV+ ++  +F+Y+D +D+D FVLGIQTEWQLQQMIRFG++ LLAS + FG 
Sbjct  252   LDDQASIRMWVDRNKKSVFYYQDSTDTDAFVLGIQTEWQLQQMIRFGHQDLLASHSSFGV  311

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
             +KLKYP+H+L+VF+S   A+PVAWII      +DT+RWM+AL  R+++ D TW++ GF++
Sbjct  312   SKLKYPLHTLLVFDSRQHALPVAWIITRSVTKQDTLRWMKALTERIYSVDSTWRIGGFVI  371

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DDP +++  IR+VF C +L S W +R  W KN++K+CS  EV+  +  +LG++++SI   
Sbjct  372   DDPASELDPIRDVFSCPILFSLWHIRRTWLKNIIKKCSNSEVQREMFMQLGKVMYSIWSE  431

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
               P +  E   +DFVD   F+ YFK+ W P+L +W + +R+LPLASQE+   +E YH +L
Sbjct  432   KNPMDALEQLFQDFVDQTTFIQYFKSFWVPKLEMWIDTIRSLPLASQESSGTIEGYHLKL  491

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++  ++  L   +R DWLV KL T +HS +WL+ Y+ +       K E+I+  T+W ++
Sbjct  492   KVKAYDDSQLDALQRVDWLVHKLTTELHSSYWLNLYADESGSFPEVKAEYIAS-TSWHRA  550

Query  1584  LQIPDGDVTIDGE---SAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             LQIPD  V  D +   SAKV  Q D + +  +WNP SEF+LCDC+ +  GNLC+H+ K  
Sbjct  551   LQIPDDAVIFDDKEPFSAKVTSQKDTSQMWTVWNPGSEFSLCDCSWSMQGNLCKHIIKVN  610

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQ  1234
                  R     S+S   +++ L+ +   P  DS   D  LSVA WV +       QE +Q
Sbjct  611   MMCGPRKDFQPSLSFQSFQRVLLDLWQKPMDDSFSLD--LSVA-WVMQM------QERIQ  661

Query  1233  VVGPTTTYGG  1204
              V    T  G
Sbjct  662   KVTELATADG  671



>gb|EEC84321.1| hypothetical protein OsI_30820 [Oryza sativa Indica Group]
Length=733

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/665 (43%), Positives = 422/665 (63%), Gaps = 13/665 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             L VQ+PP  EFS++D+ W K        D VALIPY R+D F+ GE +N ECPT+FH+E 
Sbjct  21    LAVQDPPGEEFSAADLRWVKYASSEHQRDDVALIPYERMDAFIAGECSNPECPTRFHIER  80

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   T  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  81    GRKRDRGTLREVRSDDYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARPQSMRG  140

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ LIIY++ +H++K G  CHGP D+ A G  A   PY+  +++ +
Sbjct  141   CTCHFAIKRLYARPSLVLIIYHERRHINKSGFICHGPLDRDAIGPGARRVPYVGSEIQQQ  200

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E + R  G   + D L  +YV++    I+RST+ELD DD  
Sbjct  201   TMSLIYLGVPEENILQTHMEGIHRYCGSDAKVDSLASQYVQKLGMIIKRSTHELDLDDQA  260

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +F+Y+D +D+D FVLGIQTEWQLQQMIRFG++ LLAS + FG +KLKY
Sbjct  261   SIRMWVDRNKKSVFYYQDSTDTDAFVLGIQTEWQLQQMIRFGHQDLLASHSSFGVSKLKY  320

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+L+VF+S   A+PVAWII      +DT+RWM+AL  R+++ D TW++ GF++DDP +
Sbjct  321   PLHTLLVFDSRQHALPVAWIITRSVTKQDTLRWMKALTERIYSVDSTWRIGGFVIDDPAS  380

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IR+VF C +L S W +R  W KN++K+CS  EV+  +  +LG++++SI     P +
Sbjct  381   ELDPIRDVFSCPILFSLWHIRRTWLKNIIKKCSNSEVQREMFMQLGKVMYSIWSEKNPMD  440

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YFK+ W P+L +W + +R+LPLASQE+   +E YH +LK++  
Sbjct  441   ALEQLFQDFVDQTTFIQYFKSFWVPKLEMWIDTIRSLPLASQESSGTIEGYHLKLKVKAY  500

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WL+ Y+ +       K E+I+  T+W ++LQIPD
Sbjct  501   DDSQLDALQRVDWLVHKLTTELHSSYWLNLYADESGSFPEVKAEYIAS-TSWHRALQIPD  559

Query  1569  GDVTIDGE---SAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               V  D +   SAKV  Q D + +  +WNP SEF+LCDC+ +  GNLC+H+ K       
Sbjct  560   DAVIFDDKEPFSAKVTSQKDTSQMWTVWNPGSEFSLCDCSWSMQGNLCKHIIKVNMMCGP  619

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVGPT  1219
             R     S+S   +++ L+ +   P  DS   D  LSVA WV +       QE +Q V   
Sbjct  620   RKDFQPSLSFQSFQRVLLDLWQKPMDDSFSLD--LSVA-WVMQM------QERIQKVTEL  670

Query  1218  TTYGG  1204
              T  G
Sbjct  671   ATADG  675



>ref|XP_006300800.1| hypothetical protein CARUB_v10019879mg [Capsella rubella]
 gb|EOA33698.1| hypothetical protein CARUB_v10019879mg [Capsella rubella]
Length=703

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/658 (43%), Positives = 429/658 (65%), Gaps = 10/658 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS +D+ W+K  G  ++ D VAL+PYARVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPHVEDFSWADLTWTKF-GTSEHHDEVALVPYARVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     + L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDANVNSLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F C +L S WRVR +W +N++K+C  +E +  + K LGE+++SI    +   
Sbjct  369   EIDPIRDTFCCPILFSLWRVRRSWLRNVVKKCDGIEAQRKLFKCLGELVYSIWDEVDTPK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E F +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  429   ALERFTQDFVDQTAFMQYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHIKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  489   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRATEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D N+  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  548   SAVTLDENNILVAKVQSQKDSNVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICEN  607

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVG  1225
             R     S+S+   ++ +  +   P  DS+  D ++++ +    Q+  QI Q  VQ+ G
Sbjct  608   REGYGDSMSLRSLKEKIRTIKMTPMDDSIALDLSMALTL----QMLDQIKQ-LVQLSG  660



>ref|XP_010417988.1| PREDICTED: uncharacterized protein LOC104703643 isoform X1 [Camelina 
sativa]
 ref|XP_010417989.1| PREDICTED: uncharacterized protein LOC104703643 isoform X2 [Camelina 
sativa]
 ref|XP_010417991.1| PREDICTED: uncharacterized protein LOC104703643 isoform X3 [Camelina 
sativa]
Length=703

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/649 (43%), Positives = 424/649 (65%), Gaps = 5/649 (1%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS +D+ W+K  G  ++ D VAL+PYARVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQVEDFSWADLTWTKF-GTSEHHDEVALVPYARVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIKQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     + L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVNSLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQFLRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F C VL + WRVR +W +N++K+C  +EV+  + K LGE+++SI        
Sbjct  369   EIDPIRDTFCCPVLFALWRVRRSWLRNVVKKCDGIEVQRKLFKCLGELVYSIWDEVGTPK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  429   ALERLTQDFVDQTAFMQYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHIKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  489   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRATEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  548   SAVTLDENNILVAKVQSQRDSDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICEN  607

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQI  1252
             R     S+S+   ++ +  +   P  DS+  D ++++ + + +Q+   +
Sbjct  608   REGYGDSMSLRSLKEKIRNIKMTPMDDSIALDLSMALTLQMLEQMKQLV  656



>ref|XP_006660525.1| PREDICTED: uncharacterized protein LOC102707611 [Oryza brachyantha]
Length=728

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/670 (43%), Positives = 424/670 (63%), Gaps = 13/670 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +  LPVQ+PP  EFS++D+ W+K        D VALIPY R++ F+ GE  + ECPT+
Sbjct  11    ESVSDLPVQDPPAEEFSAADLRWAKYASSEHQRDDVALIPYERMEAFIAGECNSPECPTR  70

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   T  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  71    FHIERGRKRDRGTLREVRSDDYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARP  130

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF +KRL A PS+ LIIY++ +H++K G  CHGP D+ A G  A   PY+  
Sbjct  131   QSMRGCTCHFAIKRLYARPSLVLIIYHERRHINKSGFICHGPLDRDAIGPGARRVPYVGS  190

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +SL+Y+GV  E I+Q H E + R  G   + D L  +YV +    I+RST+ELD
Sbjct  191   EIQQQTMSLIYLGVPEENILQTHMEGIHRYCGSDAKVDSLASQYVHKLGMIIKRSTHELD  250

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +WV+ ++  +F+Y+D +D+D FVLGIQTEWQLQQMIRFG++ LLAS + FG 
Sbjct  251   LDDQASIRMWVDRNKKSVFYYQDSTDTDAFVLGIQTEWQLQQMIRFGHQDLLASHSSFGV  310

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
             +KLKYP+H+L+VF+S   A+PVAWII      +DT+RWM+AL  R+++ + TW++ GF++
Sbjct  311   SKLKYPLHTLLVFDSRQHALPVAWIITRSVTKQDTLRWMKALTERIYSVESTWRIGGFVI  370

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DDP +++  IR+VF C +L S W +R  W KN++K+CS  EV+  I  +LG++++SI   
Sbjct  371   DDPASELDPIRDVFSCPILFSLWHIRRTWLKNIIKKCSNSEVQREIFMQLGKVMYSIWSE  430

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
               P +  E   +DFVD   F+ YFK+ W P+L +W + +R+LP+ASQE+  A+E YH +L
Sbjct  431   KNPMDALEQLFQDFVDQTAFIQYFKSFWVPKLEMWIDTIRSLPVASQESSGAIEGYHLKL  490

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++  ++  L   +R DWLV KL T +HS +WL+ Y+ +       K E+++  T+W+++
Sbjct  491   KVKAYDDSQLDALQRVDWLVHKLTTELHSSYWLNLYADESGSFPEVKAEYVAS-TSWQRA  549

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L+IPD  V ID +    AKV  Q D N +  +WNP SEF+ C C+ +  GNLC+H+ K  
Sbjct  550   LKIPDDAVIIDDKEPFLAKVASQKDTNQMWNVWNPGSEFSFCGCSWSMQGNLCKHIIKVN  609

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQ  1234
                  R     S+S   +++ L+ +   P  DS   D  LSVA WV +       QE +Q
Sbjct  610   MMCGPRKDFQPSLSFQSFQRVLLDLWQKPMDDSFSLD--LSVA-WVMQM------QERIQ  660

Query  1233  VVGPTTTYGG  1204
              V    T  G
Sbjct  661   KVTELATSDG  670



>ref|XP_010542310.1| PREDICTED: uncharacterized protein LOC104815571 [Tarenaya hassleriana]
 ref|XP_010542311.1| PREDICTED: uncharacterized protein LOC104815571 [Tarenaya hassleriana]
Length=709

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/656 (44%), Positives = 430/656 (66%), Gaps = 12/656 (2%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             DEIL   VQNPP  +FSS+D+ W+K  G  ++ D VALIPYARVD+F+ GE +N ECPT+
Sbjct  8     DEIL---VQNPPLEDFSSADLTWTKF-GTAEHHDDVALIPYARVDEFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRPRGSLKEHKSDDYLEYRLYWCSFGPENYGEGGSVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL   PSVAL+IYN+ +H++K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYTRPSVALLIYNERRHINKSGFICHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G     + L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSDATVNSLATQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +W E ++  IFFY+D S++D F+LGIQTEWQLQQ+IRFG+  L+A+D+ FG 
Sbjct  244   LDDQASIKIWAERNKKSIFFYQDPSETDQFMLGIQTEWQLQQLIRFGHCSLIAADSTFGV  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+P+AWII+  F+  D  +WM++L  R  + +P + + GFI+
Sbjct  304   KRLKYPLCTLLVFDSRQHALPIAWIISRSFSKPDVEKWMKSLLQRARSVEPGFHINGFII  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IR+ F CS+L S WRVR +W +N++K+C  +EV+  + K LG++++S+  G
Sbjct  364   DDAAAEIDPIRDTFGCSILFSLWRVRRSWLRNVVKKCDNVEVQRELFKCLGKVVYSVWNG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              + +   E   +DFVD   F+ YFKA W P++G+W + +++LP+ASQE   A+E YH +L
Sbjct  424   DDTSKALEELTQDFVDQTAFMQYFKAIWMPKIGMWLSTIKSLPVASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + +     K+E+++  T+W ++
Sbjct  484   KAKLFDDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESNSFHNVKEEYLAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L+I D  VT D ++   AKV  + D +++HV+WNP SEFA CDC  +  GNLC+H+ K  
Sbjct  543   LEITDSAVTFDEKNRLFAKVQSKKDTDVLHVVWNPGSEFAFCDCLWSLQGNLCKHIIKVN  602

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +R   + S+S    R+ L  +   P  DS+  D  LS+A W  + L+ QI Q
Sbjct  603   SMCENREGYSPSMSFRSLREILTNLRKQPMDDSI--DLDLSMA-WTLQMLD-QIKQ  654



>ref|XP_010473234.1| PREDICTED: uncharacterized protein LOC104752724 [Camelina sativa]
Length=703

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/658 (43%), Positives = 428/658 (65%), Gaps = 10/658 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS +D+ W+K  G  ++ D VAL+PYARVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQVEDFSWADLTWTKF-GTSEHHDEVALVPYARVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     + L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVNSLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F C VL + WRVR +W +N++K+C  +EV+  + K LGE+++SI    +   
Sbjct  369   EIDPIRDTFCCPVLFALWRVRRSWLRNVVKKCDGIEVQRKLFKCLGELVYSIWDEVDTPK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E    DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  429   ALERLTHDFVDQTAFMQYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHIKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  489   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRATEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  548   SAVTLDENNILVAKVQSQRDSDVARVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICEN  607

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVG  1225
             R     S+S+   ++ +  +   P  DS+  D ++++ +    Q+  QI Q  VQ+ G
Sbjct  608   REGYGDSMSLRSLKEKIRNIKMTPMDDSIALDLSMALTL----QMLDQIKQ-LVQLSG  660



>ref|XP_006392152.1| hypothetical protein EUTSA_v10023307mg [Eutrema salsugineum]
 gb|ESQ29438.1| hypothetical protein EUTSA_v10023307mg [Eutrema salsugineum]
Length=710

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/658 (43%), Positives = 432/658 (66%), Gaps = 10/658 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS +D+ W+K  G  ++ D VALIPYARVD+F+ GE +N ECPT+FH+E 
Sbjct  17    IPVQNPQVEDFSWADLSWTKF-GTSEHHDVVALIPYARVDEFIIGECSNAECPTRFHIER  75

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  76    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  135

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  136   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFICHGPLDRDAIGPGAKKIPYICNEIQQQ  195

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     + L  +YV +    I+RST+ELD DD  
Sbjct  196   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVNSLASQYVHKLGMIIKRSTHELDLDDQA  255

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ +++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  256   SIKIWAERNKKSIFFYQESTETDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  315

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  316   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  375

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F C +L S WR+R +W +N++K+C  +EV+  + K LGE+++SI  G + + 
Sbjct  376   EIDPIRDTFCCPILFSLWRIRRSWLRNVVKKCDTIEVQRELFKCLGEVVYSIWDGVDTSK  435

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  436   AVERLTQDFVDQTAFMQYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHVKLKVKLF  495

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+++I+  T+W ++ +I D
Sbjct  496   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEDYIAS-TSWHRASEIQD  554

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D ++   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  555   SAVTLDSDNILFAKVQSQRDTDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCEN  614

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVG  1225
             R     S+S+  +++ L  +   P  DS+  D ++++ +    Q+  QI Q  VQ+ G
Sbjct  615   REGYGDSMSLRSFKEKLRNIKMKPMDDSISLDLSMALTL----QMFDQIKQ-LVQLSG  667



>gb|EYU23749.1| hypothetical protein MIMGU_mgv1a002058mg [Erythranthe guttata]
Length=720

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/650 (44%), Positives = 423/650 (65%), Gaps = 7/650 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I +L VQ+PP  +FSS+D+ W K  G  +  D VALIPY RVD F+ GE +  ECPT+
Sbjct  5     ESIDNLQVQDPPGEDFSSADLEWVKF-GTAERCDDVALIPYDRVDAFIIGECSCVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R   +  + K D  LEY +YWCSFGP+++ +GG + PSR   +  +  A  P
Sbjct  64    FHIERGRKRARGSLKQYKNDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAIP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN  +HV+K G  CHGP DK A G  A   PY+  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDKDAIGPGAKNIPYVCS  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E +ER GG   +   L  +YV++    I+RST+ELD
Sbjct  184   EVQQQTMSMIYLGIPEENVLEKHIEGIERYGGSDAKVKSLACQYVQKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  S+ LWVE ++  IFFY+D S+S+PF+LG+QTEWQLQQM RFG+R ++A D+ FG 
Sbjct  244   LDDQASVRLWVERNKKSIFFYRDSSESEPFILGVQTEWQLQQMTRFGHRSVVAVDSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ +L+VF+S   A+PVAWII    A  D  +WM++L +RVH+ DP WK  GF++
Sbjct  304   KKLKYPLCTLLVFDSRQHALPVAWIITRSVAKADVAKWMKSLLDRVHSVDPGWKANGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C VL S WRVR +W ++++K+C+ +EV+  + KRLG+++++I  G
Sbjct  364   DDAAAEIEPIREIFSCPVLFSLWRVRRSWLRHIVKKCTNVEVQREMFKRLGQIVYNIWGG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              + A + E    DFVD   F+ YF  +W P++ +W  ++R LPLASQE+  A+E YH +L
Sbjct  424   ADLAVSLEELSLDFVDQTSFMQYFMDSWVPKIEMWLTSMRTLPLASQESSGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K +L ++  L   +R DWLV KL T +HS +WLD Y+ + D     K+E+I+  T+W ++
Sbjct  484   KTKLYDDSHLGSLQRVDWLVHKLTTELHSSYWLDRYADESDSFLNVKEEYIAS-TSWHRA  542

Query  1584  LQIPDGDVTIDGES--AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIK  1411
             LQIP+  V+ + +   A+VV Q D+ +  V+WNP SEFA CDC  +  GNLC+HV K   
Sbjct  543   LQIPEDSVSFNRDPLFARVVSQKDRCLSRVVWNPGSEFAHCDCEWSLQGNLCKHVIKVNM  602

Query  1410  YLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                +  S  SS+S    +  L+ +   P  DS+  D +++   W  + L+
Sbjct  603   TCDNLDSHKSSMSFQSLKNILMDLWKKPVDDSVGLDISMA---WTHQMLD  649



>ref|XP_009103823.1| PREDICTED: uncharacterized protein LOC103829887 [Brassica rapa]
Length=703

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/651 (43%), Positives = 424/651 (65%), Gaps = 9/651 (1%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS SD+ W+K  G  ++ D VALIPYARV++F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQAEDFSYSDLTWTKF-GTTEHHDEVALIPYARVEEFIIGECSNPECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLREYKPDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL++YN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLVYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDTLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IF Y++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFSYQESSETDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+      D  +WM+ L  R  + +P +++ GFI+DD   
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSNLKSDVEKWMKILLQRAQSVEPGFRINGFIIDDAAM  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F+C +L S WR+R +W +N++K+C  +EV+  + K LGE+++SI  G + + 
Sbjct  369   EIDPIRDTFRCPILFSLWRIRRSWLRNVVKKCDTIEVQRELFKCLGEVVYSIWDGVDTSK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E    DF D   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  429   ALERLTLDFSDQTAFMHYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHVKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L+  +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  489   DDTHLNALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRASEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               V +D  +   AKV  Q D N+  V+WNP SEFA CDC  +  GNLC+HV K      +
Sbjct  548   SAVILDSNNTVVAKVRSQRDTNVARVVWNPGSEFAFCDCAWSLQGNLCKHVIKVNTMCEN  607

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             R     S+S+  +++ L  +   P  DS+    AL +++ +  Q+  QI Q
Sbjct  608   REGYGDSMSLRSFKEKLTSVKMKPMDDSI----ALDISMALTLQMFDQIKQ  654



>dbj|BAK04195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/665 (43%), Positives = 418/665 (63%), Gaps = 13/665 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R++ F+ GE  N E PT+FH+E 
Sbjct  17    LPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRMEAFISGECNNPEYPTRFHIER  76

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  77    GRKRERGSLKEFRSDEYLLYRMYWCSFGPENYGEGGTILPSRRYRLNTRNRAARPQSMRG  136

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   PY+  +++ +
Sbjct  137   CTCHFAIKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGARRVPYVGSEIQQQ  196

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R  G   + D L  +YV +    I+RST+ELD DD  
Sbjct  197   TMSLIYLGVPEENILQTHIEGIQRYCGSDAKVDSLASQYVHKLGMIIKRSTHELDLDDQA  256

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FF++D +++D FVLGIQTEWQLQQMIRFG++ +LAS + FG +KLKY
Sbjct  257   SIRMWVDRNKKSVFFHQDSTETDAFVLGIQTEWQLQQMIRFGHQNILASHSSFGVSKLKY  316

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+++VF+S  +A+PVAW+I       DT RWM+AL +R+H+ D  W++ GFI+DDP +
Sbjct  317   PLHTILVFDSRQQALPVAWVITRSVTKHDTSRWMKALTSRIHSVDSNWRIGGFIIDDPTS  376

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IR VF C +L S W +R  W KN++K+CS  EV+  +  +LG+ ++SI     P +
Sbjct  377   ELDPIRNVFSCPILFSLWHIRRTWLKNIIKKCSNTEVQREVFTQLGKFMYSIWSDANPMD  436

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
                   +DFVD   F+ YFK+ W P+L +W + +R LPLASQE+CAA+E YH +LKL+  
Sbjct  437   ALGQLFQDFVDQTTFIQYFKSFWVPKLEMWIDTIRNLPLASQESCAAIEGYHLKLKLKAY  496

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WL+ Y+ +       K E+I+  T+W+++L IPD
Sbjct  497   DDSQLDALQRVDWLVHKLTTELHSGYWLNLYADESGSFPEVKAEYIAS-TSWQRALHIPD  555

Query  1569  GDVTIDGE---SAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               V  D +   SAKV  Q D + +  +WN  SEF+LC C+ +  GNLC+HV K       
Sbjct  556   EAVLFDDKEPVSAKVASQKDASQMRTVWNAGSEFSLCSCSWSMQGNLCKHVIKVNMMYAP  615

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVGPT  1219
             R     S+S   +++ L+ +   P  DS   D  LSVA WV +       QE +Q V   
Sbjct  616   RKDVQPSLSFQSFQRVLLDLWQKPLDDSFSLD--LSVA-WVMQM------QERIQKVAEL  666

Query  1218  TTYGG  1204
                 G
Sbjct  667   AASDG  671



>gb|KFK40774.1| hypothetical protein AALP_AA2G039200 [Arabis alpina]
Length=703

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/653 (43%), Positives = 427/653 (65%), Gaps = 13/653 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS SD+ W+K  G  ++ D VALIPY+RVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQVEDFSWSDLTWTKF-GTSEHHDDVALIPYSRVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKTDEYLEYRLYWCSFGPENYGEGGDVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A P +AL+IYN+ +HV+K G  CHGP D+ A G  A   PY+S +++ +
Sbjct  129   CTCHFVVKRLYARPLLALLIYNKRRHVNKAGFICHGPLDRDAIGPGAKKIPYVSNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     + L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVNSLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  KLKY
Sbjct  249   SIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQFVRFGHGSLVAADSTFGIKKLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F C +L S WRVR  W +N++K+C+ +EV+  + K LGE+++SI    + + 
Sbjct  369   EIDPIRDTFCCPILFSLWRVRRTWLRNVVKKCNNIEVQRELFKCLGEVVYSIWDEVDTSK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YF +TW P++ +W + +++LPLASQE   A+E YH +LK++L 
Sbjct  429   ALERLTQDFVDETAFMQYFTSTWLPKIEMWLSTIKSLPLASQEVFGAIEAYHVKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  489   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRASEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  548   SAVTLDENNSLVAKVQSQKDIDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCEN  607

Query  1398  RGSATSSVSMFQYRQAL--IKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             R     S+S+  +++ L  IKM    P D+ I   AL +++ +  Q+  QI Q
Sbjct  608   RKGYGDSMSLLSFKEKLRNIKM---KPLDNSI---ALDLSMALTLQMVEQIKQ  654



>ref|XP_004136464.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
Length=678

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/655 (44%), Positives = 412/655 (63%), Gaps = 18/655 (3%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R ++IL L VQ+PP LEFS++ + W KVEG R     +A++P++RV+DFV+GES+N E
Sbjct  1     MPRTEDILKLQVQDPPCLEFSAAHVKWEKVEGGRQGGADIAVVPFSRVEDFVKGESSNPE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
              P +F +E+RR+RTA +  KP+VDG LEYILYWCS+GP+D+R       S +   P    
Sbjct  61    SPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL A+P +ALIIYNQ KH+DK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYAQPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             Y   ISE+LR +++S+LYVG+ +E I+Q H+E V+R GGP NRDD L+   VR  ER IR
Sbjct  181   YTQRISEELRQKIMSMLYVGIPIENIVQHHSEVVQRHGGPPNRDDFLSRIDVRNMERVIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              S++EL  +D  S+ +WV+ H+  IFF+++ SD + FVLGIQT+WQLQQM+R+G+ G +A
Sbjct  241   NSSHELHTNDDCSVKIWVQRHRKVIFFFQESSDCERFVLGIQTDWQLQQMLRYGHNGSVA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S +  G+ KL++P+ SL+VF+S    IPVAWIIA  F  +D  +W+  L  R+H KDPTW
Sbjct  301   SHSTLGSKKLRFPLCSLLVFDSSQNTIPVAWIIASSFVDQDIRKWLGLLVERLHAKDPTW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             K+  F++D+P  ++  IR +            R  W +N++K+C  ++V+  + K+LG++
Sbjct  361   KIDTFLLDNPSFEVSTIRLILDLP-------YRFNWIRNILKKCPNLDVQREMFKQLGKV  413

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++    G   A   E F   F D   FVDY   TW P + LW N+LR+ P+++ E  AA+
Sbjct  414   LYCTRIGLGFAYAVEQFKRRFSDQCVFVDYLTRTWLPDIELWVNSLRSHPVSTLEANAAI  473

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             E YH +LK +L  E+  S   R DWL+  L T  HS +WLD+YS    +   ++D+ I  
Sbjct  474   EAYHIRLKSKLFKEQSNSSSSRVDWLIHILTTQFHSSYWLDQYSLDTGYFGSFRDKSILT  533

Query  1605  LTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLC  1435
               AW K+L IPD DV +D  +   AKV+ Q  +N+ + IW+P SEF+LCDC  + MGNLC
Sbjct  534   -NAWNKALHIPDVDVIVDESNLQFAKVISQSKRNLEYTIWDPGSEFSLCDCPWSRMGNLC  592

Query  1434  EHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQK  1270
             EHV K +  L  R  A   +   Q  Q  +      P   +  DH + +   VQ+
Sbjct  593   EHVIK-VSLLCKRQQAARPLVAAQVYQDRVPNFQLNP---VTFDHGMPLVNCVQR  643



>ref|XP_010510937.1| PREDICTED: uncharacterized protein LOC104787116 isoform X1 [Camelina 
sativa]
 ref|XP_010510938.1| PREDICTED: uncharacterized protein LOC104787116 isoform X2 [Camelina 
sativa]
Length=703

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/658 (43%), Positives = 426/658 (65%), Gaps = 10/658 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             + VQNP   +FS +D+ W+K  G  ++ D VAL+PYARVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IQVQNPQVEDFSWADLTWTKF-GTSEHHDEVALVPYARVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G       L  +YV +    I+RS +ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGLQRYCGSDATVSSLASQYVHKLGMIIKRSIHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S+SD F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFFYQEASESDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+DD  T
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIIDDAAT  368

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             +I  IR+ F C VL + WRVR +W +N++K+C  +EV+  + K LG++++SI    +   
Sbjct  369   EIDPIRDTFCCPVLFALWRVRRSWLRNVVKKCDGIEVQRELFKCLGKLVYSIWDEVDTPK  428

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  429   ALERLTQDFVDQTAFMQYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHIKLKVKLF  488

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  489   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRATEIPD  547

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  548   SAVTLDENNILVAKVQSQRDSDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTICEN  607

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVG  1225
             R     S+S+   ++ +  +   P  DS+  D ++++ +    Q+  QI Q  VQ+ G
Sbjct  608   REGYGDSMSLRSLKEKIRNIKMTPMDDSIALDLSMALTL----QMLDQIKQ-LVQLSG  660



>emb|CDY24539.1| BnaA01g22430D [Brassica napus]
Length=708

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/656 (43%), Positives = 424/656 (65%), Gaps = 14/656 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS SD+ W+K  G  ++ D VALIPYARV++F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQAEDFSYSDLSWTKF-GTTEHHDEVALIPYARVEEFIIGECSNPECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLREYKPDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL++YN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLVYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDTLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IF Y++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFSYQESSETDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+      D  +WM+ L  R  + +P +++ GFI+DD   
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSNLISDVEKWMKILLQRAQSVEPGFRINGFIIDDAAM  368

Query  2109  DIPAIR-----EVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             +I  IR     + F+C +L S WR+R +W +N++K+C  +EV+  + K LGE+++SI  G
Sbjct  369   EIDPIRHASTLDTFRCPILFSLWRIRRSWLRNVVKKCDTIEVQRELFKCLGEVVYSIWDG  428

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              + +   E    DF D   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +L
Sbjct  429   VDTSKALERLTLDFSDQTAFMHYFTSTWLPKIGMWLSTIKSLPLASQEACGAIEAYHVKL  488

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K++L ++  L+  +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++
Sbjct  489   KVKLFDDTHLNALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRA  547

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
              +IPD  V +D  +   AKV  Q D N+  V+WNP SEFA CDC  +  GNLC+HV K  
Sbjct  548   SEIPDSAVILDSNNTVVAKVRSQRDTNVARVVWNPGSEFAFCDCAWSLQGNLCKHVIKVN  607

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                 +R     S+S+  +++ L  +   P  DS+    AL +++ +  Q+  QI Q
Sbjct  608   TMCENREGYGDSMSLRSFKEKLTSVKMKPMDDSI----ALDISMALTLQMFDQIKQ  659



>ref|XP_008644121.1| PREDICTED: uncharacterized protein LOC100383900 isoform X1 [Zea 
mays]
 gb|AFW66990.1| hypothetical protein ZEAMMB73_942101 [Zea mays]
Length=725

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/644 (43%), Positives = 413/644 (64%), Gaps = 6/644 (1%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R++ F+ GES N ECPT+FH+E 
Sbjct  14    LPVQDPPGEEFSAADLAWVKYATSEHHRDDVALIPYDRMEAFIAGESNNPECPTRFHIER  73

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  74    GRKRERGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARPQSMRG  133

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ LIIY++ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  134   CTCHFTIKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKMPYIGSEIQQQ  193

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R      + D L  +YV++    I+RST+ELD DD  
Sbjct  194   TMSLIYLGVPEENILQTHIEGIQRYCSKDAKVDNLASQYVQKLGMIIKRSTHELDLDDQA  253

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FFY+D +++D F+LGIQT+WQLQQM+RFG++ LLAS + FG +KLKY
Sbjct  254   SIRMWVDRNRKSVFFYQDSTEADAFILGIQTQWQLQQMMRFGHQSLLASHSSFGVSKLKY  313

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+L+ F+S   A+PVAW+I      +DT++WM  L +R+H+ D TW + GFI+DDP +
Sbjct  314   PLHTLLAFDSRQHALPVAWVITRSVTKKDTLKWMSTLTDRIHSIDSTWGIGGFIIDDPAS  373

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IREVF C VL S W +R  W KN++K+CS +EV+  I   LG+ I +I     P +
Sbjct  374   ELGPIREVFACPVLFSMWHIRRTWLKNVIKKCSNVEVQREIFILLGKTICNIWSEKNPMD  433

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
                   +DFVD   F+ YFK+ W P+L +W +++R LPLASQE+C A+E YH +LK++  
Sbjct  434   ALGQLFQDFVDQTAFIKYFKSFWVPKLEMWIDSIRNLPLASQESCGAIEGYHLKLKVKAY  493

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +W++ ++ +       K ++I+  T+W+++LQIPD
Sbjct  494   DDVQLDALQRVDWLVHKLTTELHSSYWINLFADESGSFPEVKADYIAS-TSWQRALQIPD  552

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT D +    A+VV Q + +    +W+P SEF+LC+C+ +  GNLC+HV K       
Sbjct  553   DAVTFDDKDPLVARVVSQKETSQTRTVWSPGSEFSLCNCSWSMQGNLCKHVLKVNMVCGA  612

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQ  1267
             R     S+S   ++  L+ +   P  DS   D  LSVA  +Q Q
Sbjct  613   RKDFQPSLSFQSFQHVLLDLWQKPLDDSFSLD--LSVARVMQMQ  654



>emb|CDY34123.1| BnaC01g28630D [Brassica napus]
Length=693

 Score =   559 bits (1441),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 271/651 (42%), Positives = 412/651 (63%), Gaps = 19/651 (3%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS SD+ W+K  G  ++ D VALIPYARV++F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQAEDFSYSDLSWTKF-GTTEHHDEVALIPYARVEEFIIGECSNPECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLREYKPDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL++YN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLVYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDTLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IF Y++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFSYQESSETDQFMLGIQTEWQLQQFVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+      D  +WM+ L  R          A   + +   
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSNLKSDVEKWMKILLQR----------AQGCLCNSFI  358

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
                  R+ F+C VL S WR+R +W +N++K+C  +EV+  + K LGE+++SI  G + + 
Sbjct  359   SFSLFRDTFRCPVLFSLWRIRRSWLRNVVKKCDTIEVQRELFKCLGEVVYSIWDGVDTSK  418

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E    DF D   F+ YF +TW P++G+W ++++ LPLASQE C A+E YH +LK++L 
Sbjct  419   VLERLTLDFSDQTAFMHYFTSTWLPKIGMWLSSIKILPLASQEACGAIEAYHVKLKVKLF  478

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L+  +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ +IPD
Sbjct  479   DDTHLNALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRASEIPD  537

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               V +D  +   AKV  Q D N+  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  538   SAVILDSNNTVVAKVRSQRDTNVARVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNTMCEN  597

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             R     S+S+  +++ L  +   P  DS+  D ++++ +    Q+  QI Q
Sbjct  598   REGYGDSMSLRSFKEKLTSIKMKPMDDSIALDLSMALTL----QMFDQIKQ  644



>gb|AES96430.2| zinc ion-binding protein [Medicago truncatula]
Length=676

 Score =   556 bits (1433),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 270/673 (40%), Positives = 418/673 (62%), Gaps = 27/673 (4%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EFSS+D+ W+K  G  D+ D                  +N  
Sbjct  1     MAIVESVSKIPLQDPPEEEFSSADLTWTKF-GNADHHDEAC---------------SNVL  44

Query  3036  CPTKFHVEARRR----RTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVP  2869
             CPT+FH+E   +    ++  T  K K D  +EY  Y CSFGP+++ +GG + PSR     
Sbjct  45    CPTQFHIEGGTKLPKGQSRDTLKKYKGDEHIEYKKYQCSFGPENYGEGGEILPSRRCRTN  104

Query  2868  KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
              +  A RP + RGCTCHF+VKRL A PS+ALI+YN+ +HV+K G  CHGP D+ A G RA
Sbjct  105   TRNRAARPQSMRGCTCHFVVKRLYARPSLALIVYNERRHVNKSGFICHGPLDRDAIGPRA  164

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
                PYIS +++ + +S++++G+  E I+++H E +ER  G   + + L  ++V +    I
Sbjct  165   TNIPYISNEIQQQTISMIHLGIPEENILEKHIEGIERYCGSNVKFNSLASQHVHKLSMII  224

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             +RST+ELD DD +SI +WVE ++  +FF++D S+SDPFVLGIQTEWQLQQM+RFG+  ++
Sbjct  225   KRSTHELDLDDEVSIRMWVERNRKSVFFHQDTSESDPFVLGIQTEWQLQQMVRFGHHSVV  284

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             A+D+ FG  +LKYP+ +L+VF+S   A+PVAWII   FA  D  +W++AL +R  + +P 
Sbjct  285   AADSSFGVKRLKYPLFTLLVFDSRQHALPVAWIITRSFAKPDVSKWLKALIDRARSVEPG  344

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             WK+ GF +DD   DI  +R++F C VL S WR+R +W +N++++C+ +E+   + KRLG 
Sbjct  345   WKVGGFFIDDAAADIDLLRDIFGCPVLFSLWRMRRSWLRNIVRKCNNIEIEREMFKRLGT  404

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             ++++I  G   +   E FM DFVD  +F++YF+ +W P++ +W +  R  PLASQE   A
Sbjct  405   IVYNIWGGTSTSVALEQFMLDFVDQTDFMEYFRVSWVPKIEMWLSTRRNFPLASQEASGA  464

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             LE YH +LK +L ++  L   +R DWLV KL T +HS +WLD ++ + D  +  K+ +I+
Sbjct  465   LEAYHVKLKAKLFDDSHLGALQRVDWLVHKLTTELHSSYWLDRFADESDSFQNVKEGYIA  524

Query  1608  GLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
               T+W ++ QIPD  VT+DG+    AKV  Q D ++  ++WNP SEF+ CDC+ +  GNL
Sbjct  525   S-TSWHRAFQIPDSAVTMDGKDRLFAKVASQKDSSVTRIVWNPGSEFSFCDCSWSLQGNL  583

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
             C+HV K      +      S+S   + + L+ +   P  DS   D +L+   W  ++  +
Sbjct  584   CKHVIKVNTICENLQGYQPSMSFRSFEEVLMDLWRKPVDDSFELDVSLA---WTHQKGRT  640

Query  1257  QIGQESVQVVGPT  1219
               G+ S+ +  P 
Sbjct  641   YNGKRSLILATPV  653



>gb|EMT08273.1| hypothetical protein F775_06016 [Aegilops tauschii]
Length=724

 Score =   551 bits (1419),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 280/678 (41%), Positives = 407/678 (60%), Gaps = 44/678 (6%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R++ F+ GE  N E PT+FH+E 
Sbjct  17    LPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRMEAFISGECNNPEYPTRFHIER  76

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   T  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  77    GRKRERGTLKEVRSDDYLLYRMYWCSFGPENYGEGGTILPSRRYRLNTRNRAARPQSMRG  136

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   PY+  +++ +
Sbjct  137   CTCHFAIKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGARKVPYVGSEIQQQ  196

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R  G   + D L  +YV +    I+RST+ELD DD  
Sbjct  197   TMSLIYLGVPEENILQTHIEGIQRYCGSDAKVDSLASQYVHKLGMIIKRSTHELDLDDQA  256

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FF++D +++D FVLGIQTEWQLQQMIRFG++ +LAS + FG +KLKY
Sbjct  257   SIRMWVDRNKKSVFFHQDSTETDAFVLGIQTEWQLQQMIRFGHQNILASHSSFGVSKLKY  316

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+++VF+S  +A+PVAW+I       DT RWM+AL +R+H+ D  W++ GFI+DDP +
Sbjct  317   PLHTILVFDSRQQALPVAWVITRSVTKHDTSRWMKALTSRIHSVDSNWRIGGFIIDDPTS  376

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IR VF C +L S W +R  W KN++K+CS  EV+  I  +LG+ ++SI     P +
Sbjct  377   ELDPIRNVFSCPILFSLWHIRRTWLKNIIKKCSNTEVQREIFTQLGKFMYSIWSEKNPMD  436

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLG-------------LWSNALRALPLASQETCAA  1789
               E   +DFVD   F+ YFK+ W P+L              +W +++R LPLASQE+C A
Sbjct  437   VLEQLFQDFVDQTTFIQYFKSFWVPKLDANNVSCVPLPHLEMWIDSIRNLPLASQESCGA  496

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LKL+  ++  L   +R DWLV KL T +HS +WL+ Y+ +       K E+I+
Sbjct  497   IEGYHLKLKLKAYDDSQLDALQRVDWLVHKLTTELHSGYWLNLYADESGSFPEVKAEYIA  556

Query  1608  GLTAWRKSLQIPDGDVTIDGE---SAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
               T+W+++L IPD  V  D +   SAKV  Q D + +                    GNL
Sbjct  557   S-TSWQRALHIPDEAVLFDHKEPLSAKVASQKDASQMRT------------------GNL  597

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
             C+HV K       R     S+S   +++ L+ +   P  DS   D  LSVA WV +    
Sbjct  598   CKHVIKVNMMYAPRKDVQPSLSFQSFQRVLLDLWQKPLDDSFSLD--LSVA-WVMQM---  651

Query  1257  QIGQESVQVVGPTTTYGG  1204
                QE +Q V       G
Sbjct  652   ---QERIQKVAELAASDG  666



>ref|XP_011019706.1| PREDICTED: uncharacterized protein LOC105122342 isoform X3 [Populus 
euphratica]
Length=583

 Score =   543 bits (1400),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 257/528 (49%), Positives = 356/528 (67%), Gaps = 4/528 (1%)
 Frame = -3

Query  2868  KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
             K    GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D  A GTRA
Sbjct  13    KGSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDAVGTRA  72

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MYAP ISE+LR +V+SLLY+G+S++ I+Q H E V+  GGP NRDDLLT   VR  ER++
Sbjct  73    MYAPRISEELRQKVMSLLYIGISLDNIIQHHAEVVQGHGGPLNRDDLLTRNDVRNMERNV  132

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             R S+Y+L ADD  S+ +WV+ HQ H+FF++D S ++PF+LGIQT+WQLQQMIR+G+ G +
Sbjct  133   RNSSYKLHADDESSVKMWVQRHQKHVFFFQDMSSTEPFILGIQTDWQLQQMIRYGHSGSI  192

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             AS + FG  KLKYP+ +L+VF+S   AIPVAWI+   F ++D  +W+ +L  R+ +KDP 
Sbjct  193   ASHSTFGLKKLKYPLCTLLVFDSSQNAIPVAWIVTSSFVTQDIHKWIGSLAERIRSKDPR  252

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             W+   F+VDDP  DI  IRE FQC +L+  W VR AW ++L+K+C  ++V+  + K LG 
Sbjct  253   WRPNAFLVDDPSFDISFIREAFQCRLLLCAWHVRRAWMRSLLKKCCNIDVQREMFKHLGW  312

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             +++S   G    N  E FM+ +VD   F+DYFK  W P + LW N++R+LP+AS E  AA
Sbjct  313   ILYSTRSGPNADNAVEEFMQVYVDQCIFMDYFKRRWLPYIELWINSIRSLPVASTEPLAA  372

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LK +L +++  + Y R DWL+  L T  HS +WLD+YS +  +  Y +D+  S
Sbjct  373   IESYHLRLKSKLFDQQYANSYTRIDWLIHTLTTEFHSLYWLDQYSAETGYFTYARDKSFS  432

Query  1608  GLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
                AW ++L IPD DV +D ++   AKV+ Q D+++ + IWNP SEFALCDC  +  GNL
Sbjct  433   T-NAWYQALHIPDVDVILDEQNLQLAKVISQTDRSLAYTIWNPGSEFALCDCPWSRQGNL  491

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHAL  1294
             C+HV K     ++R  A   ++   YRQAL+ +L  PP D L+ +HA+
Sbjct  492   CKHVIKVAILCKNRQVARPLLASQVYRQALLTLLQNPPDDPLVLEHAI  539



>gb|EPS61942.1| hypothetical protein M569_12851, partial [Genlisea aurea]
Length=691

 Score =   545 bits (1403),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 267/610 (44%), Positives = 391/610 (64%), Gaps = 17/610 (3%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I +L VQ+P   +F SSD+ W K+    +  + VALIPY RVD F+ GE +  E PT+
Sbjct  5     ESIDTLTVQDPGGEDFCSSDLEWFKLRN-AERCEDVALIPYDRVDAFIIGECSRVEFPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FHVE  R+R   +  +   D  L+Y LYWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  64    FHVERGRKRARGSLKQHTADEYLDYKLYWCSFGPENYGEGGTILPSRRYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHFIVKRL A PS+AL+IY++ +HV+K G+ CHGP D  A G  A   PY+  
Sbjct  124   QSMRGCTCHFIVKRLYARPSLALLIYSERRHVNKSGIICHGPLDGDAIGPGAKRVPYMCS  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
              ++ + +S++Y+G+  E ++++H E + R   P  + D +  +YV +    I+RS++ELD
Sbjct  184   GIQQQTMSMMYLGIPEENVLEKHIEGIHRYCDPNAKVDGIASQYVHKVGMIIKRSSHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWVE ++  +FF++D S +DP +LGIQTEWQLQQMIRFG+R ++A  + FG 
Sbjct  244   LDDEASIRLWVERNKKSVFFHRDASVADPLILGIQTEWQLQQMIRFGHRNIIALHSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              + KYP+ ++VVF+S N A+PVAW+I+   A +D   WM+AL +RVH  DP W    FI+
Sbjct  304   KRFKYPLCTVVVFDSRNHALPVAWVISRSVAKQDVTTWMKALLDRVHLTDPGWTAGSFII  363

Query  2124  DDPLTDIPAIR----EVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHS  1957
             DD   ++  IR    E F C +L S WR+R +W K+++++CS +EV+  + KRLGE+++ 
Sbjct  364   DDAALEVEPIRQNEMESFSCPILFSLWRIRRSWLKHIVEKCSNIEVQREMFKRLGEIVYC  423

Query  1956  ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFY  1777
             +  G + +   E F+ DF D   F++YFK +W P++ +W  A++ LPLASQET AA+E Y
Sbjct  424   VWNGRDVSAAVEEFLLDFADQASFMEYFKDSWVPKIEMWLMAMKNLPLASQETSAAVEAY  483

Query  1776  HNQLKLRLLNE----RDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             H +L+ +L ++      L   +R DWLV KL T +HS +WLD Y+ + D  R  KDE+I 
Sbjct  484   HIKLETKLSDDDAAASHLGSLQRVDWLVHKLITELHSGYWLDRYADETDSFRDVKDEYIR  543

Query  1608  GLTAWRKSLQI------PDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANM  1447
               T+W ++LQI      PD D+++   S K  D G     HV+WNP SEF+ C C S++ 
Sbjct  544   S-TSWHRALQIPDSCVLPDSDLSVRVTSQKEDDGGGPAKSHVVWNPGSEFSHCTCESSST  602

Query  1446  -GNLCEHVFK  1420
              GNLCEHV K
Sbjct  603   KGNLCEHVLK  612



>ref|XP_003613472.1| hypothetical protein MTR_5g037070 [Medicago truncatula]
Length=705

 Score =   541 bits (1395),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 270/702 (38%), Positives = 418/702 (60%), Gaps = 56/702 (8%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EFSS+D+ W+K  G  D+ D                  +N  
Sbjct  1     MAIVESVSKIPLQDPPEEEFSSADLTWTKF-GNADHHDEAC---------------SNVL  44

Query  3036  CPTKFHVEARRR----RTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVP  2869
             CPT+FH+E   +    ++  T  K K D  +EY  Y CSFGP+++ +GG + PSR     
Sbjct  45    CPTQFHIEGGTKLPKGQSRDTLKKYKGDEHIEYKKYQCSFGPENYGEGGEILPSRRCRTN  104

Query  2868  KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
              +  A RP + RGCTCHF+VKRL A PS+ALI+YN+ +HV+K G  CHGP D+ A G RA
Sbjct  105   TRNRAARPQSMRGCTCHFVVKRLYARPSLALIVYNERRHVNKSGFICHGPLDRDAIGPRA  164

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
                PYIS +++ + +S++++G+  E I+++H E +ER  G   + + L  ++V +    I
Sbjct  165   TNIPYISNEIQQQTISMIHLGIPEENILEKHIEGIERYCGSNVKFNSLASQHVHKLSMII  224

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             +RST+ELD DD +SI +WVE ++  +FF++D S+SDPFVLGIQTEWQLQQM+RFG+  ++
Sbjct  225   KRSTHELDLDDEVSIRMWVERNRKSVFFHQDTSESDPFVLGIQTEWQLQQMVRFGHHSVV  284

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             A+D+ FG  +LKYP+ +L+VF+S   A+PVAWII   FA  D  +W++AL +R  + +P 
Sbjct  285   AADSSFGVKRLKYPLFTLLVFDSRQHALPVAWIITRSFAKPDVSKWLKALIDRARSVEPG  344

Query  2148  WKLAGFIVDDPLTDIPAIRE-----------------------------VFQCSVLISFW  2056
             WK+ GF +DD   DI  +R+                             +F C VL S W
Sbjct  345   WKVGGFFIDDAAADIDLLRQDFIVFKTSLVQCSTVVFICLTSVVFFYRDIFGCPVLFSLW  404

Query  2055  RVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDY  1876
             R+R +W +N++++C+ +E+   + KRLG ++++I  G   +   E FM DFVD  +F++Y
Sbjct  405   RMRRSWLRNIVRKCNNIEIEREMFKRLGTIVYNIWGGTSTSVALEQFMLDFVDQTDFMEY  464

Query  1875  FKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKL  1696
             F+ +W P++ +W +  R  PLASQE   ALE YH +LK +L ++  L   +R DWLV KL
Sbjct  465   FRVSWVPKIEMWLSTRRNFPLASQEASGALEAYHVKLKAKLFDDSHLGALQRVDWLVHKL  524

Query  1695  GTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQ  1525
              T +HS +WLD ++ + D  +  K+ +I+  T+W ++ QIPD  VT+DG+    AKV  Q
Sbjct  525   TTELHSSYWLDRFADESDSFQNVKEGYIAS-TSWHRAFQIPDSAVTMDGKDRLFAKVASQ  583

Query  1524  GDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALI  1345
              D ++  ++WNP SEF+ CDC+ +  GNLC+HV K      +      S+S   + + L+
Sbjct  584   KDSSVTRIVWNPGSEFSFCDCSWSLQGNLCKHVIKVNTICENLQGYQPSMSFRSFEEVLM  643

Query  1344  KMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQESVQVVGPT  1219
              +   P  DS   D +L+   W  ++  +  G+ S+ +  P 
Sbjct  644   DLWRKPVDDSFELDVSLA---WTHQKGRTYNGKRSLILATPV  682



>gb|KHG17736.1| Sacsin [Gossypium arboreum]
Length=504

 Score =   528 bits (1360),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/504 (50%), Positives = 341/504 (68%), Gaps = 3/504 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MAR ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP++RVDDFV+GES+N E
Sbjct  1     MARMEDILNLPVQDPPCAEFSAAHITWVKVEGGRQGGDDIALIPFSRVDDFVKGESSNAE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CP  F +E+RR+R+  +  KP+VDG LEY LYWCS+GP+D+R         + + P    
Sbjct  61    CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDCESGLGDGSNFKPTTGK  120

Query  2856  AGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAM  2686
               RP  +   RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ A GTRAM
Sbjct  121   GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGSPCHGILDQDAVGTRAM  180

Query  2685  YAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR  2506
             YAP ISE+LR +V+S+LYVG+S++ I+Q H E V+  GGP NRDD LT   VR  ER IR
Sbjct  181   YAPRISEELRQKVMSMLYVGISLDNIIQHHMEVVQGHGGPHNRDDFLTRNDVRNIERVIR  240

Query  2505  RSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLA  2326
              +++EL  DDA S+ +WV+ HQ H+F+++D S S+PF+LGIQT+WQLQQM+R G  G +A
Sbjct  241   NTSHELHIDDACSVKIWVQRHQKHVFYFQDASASEPFILGIQTDWQLQQMLRHGQNGSVA  300

Query  2325  SDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTW  2146
             S + FG+ KLKYP+ +L+VF+S   AIPVAW+I      +D  +W+ +L  R+ TKD  W
Sbjct  301   SHSTFGSKKLKYPLSTLLVFDSSRNAIPVAWVITSSLTGQDIHKWVGSLAERLRTKDSRW  360

Query  2145  KLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEM  1966
             +L  F+VDDP     AIR+ FQC VL+  W VR AW ++L+K CS ++V+  + K LG +
Sbjct  361   RLNAFLVDDPSFGFSAIRDAFQCRVLLCVWHVRRAWIRSLLKTCSNIDVQREMFKHLGWI  420

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             ++S        +  + FME FVD   F+DYFK+ W P +  W + +R+LP+A  E  AA+
Sbjct  421   LYSSRSVPNAMDAVQEFMEVFVDQSAFMDYFKSQWSPYIESWVSCIRSLPVAGPEPHAAI  480

Query  1785  EFYHNQLKLRLLNERDLSVYERAD  1714
             E YH +LK +L N++  + + R D
Sbjct  481   ESYHRRLKYKLFNDQYANFWPRID  504



>gb|AAB71951.1| Hypothetical Protein [Arabidopsis thaliana]
Length=653

 Score =   529 bits (1363),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 260/651 (40%), Positives = 398/651 (61%), Gaps = 59/651 (9%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS +D+ W+K  G  ++ D+VAL+PYARVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQVEDFSWADLTWTKF-GTSEHHDQVALVPYARVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + RG
Sbjct  69    GRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARPQSMRG  128

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  129   CTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICNEIQQQ  188

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD DD  
Sbjct  189   TMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDSLASQYVHKLGMIIKRSTHELDLDDQA  248

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ++RFG+  L+A+D+ FG  +LKY
Sbjct  249   SIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQLVRFGHCSLVAADSTFGIKRLKY  308

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+ +L+VF+S + A+PVAWII+  +   D                               
Sbjct  309   PLCTLLVFDSRHHALPVAWIISRSYLKSD-------------------------------  337

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
                                V  +W +N++K+C  +EV+  + K LGE+++SI  G +   
Sbjct  338   -------------------VEKSWLRNVVKKCDSIEVQRDLFKCLGELVYSIWDGVDTTK  378

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
               E   +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +LK++L 
Sbjct  379   ALEKLTQDFVDQTAFMQYFTSTWLPKIGMWLSTMKSLPLASQEACGAIEAYHIKLKVKLF  438

Query  1749  NERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPD  1570
             ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++++IPD
Sbjct  439   DDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWYRAMEIPD  497

Query  1569  GDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRD  1399
               VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K      +
Sbjct  498   SAVTLDENNILLAKVQSQRDSDVTRVVWNPGSEFAFCDCTWSLQGNLCKHIIKVNTMCEN  557

Query  1398  RGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             R     S+S+  +++ L  +   P  DS+  D ++++ +    Q+  QI Q
Sbjct  558   REGYGDSMSLRSFKEKLRNIKMKPMDDSIALDLSMALTL----QMFDQIKQ  604



>ref|XP_007013719.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 ref|XP_007013721.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 ref|XP_007013722.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31338.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31340.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31341.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
Length=577

 Score =   526 bits (1354),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/538 (46%), Positives = 354/538 (66%), Gaps = 4/538 (1%)
 Frame = -3

Query  2868  KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
             K    GR +  RGC CHF VKRL   P +ALIIYNQ KHVDK G PCHG  D+ A GTRA
Sbjct  7     KGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDQDAVGTRA  66

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MYAP ISE+LR +V+S+LYVG+S++ I Q H + V+R GGP NRDD LT   VR  ER I
Sbjct  67    MYAPRISEELRQKVISMLYVGISLDNIFQHHMDVVQRHGGPHNRDDFLTRNDVRNIERVI  126

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             R +++EL  DD  S+ +WV+ HQ H+F+++D S S+P +LGIQT+WQLQQM+ +G+ G +
Sbjct  127   RNTSHELHIDDECSVKVWVQRHQKHVFYFQDASGSEPLILGIQTDWQLQQMLHYGHNGSI  186

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             AS + FG+ KLKYP+ +L+VF+S   AIPVAW+I      +D  +W+  L  R+  KDP 
Sbjct  187   ASHSTFGSKKLKYPLSTLLVFDSSQNAIPVAWVITSALVGQDVHKWIGFLSERIRAKDPR  246

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             W++  F++DDP   I  IR+ FQC VL+  W VR AW ++L+K+C  ++V+  + K LG 
Sbjct  247   WRVNAFLIDDPSFGISVIRDAFQCRVLLCVWHVRRAWIRSLLKKCCNIDVQREMFKHLGW  306

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             +++S   G    +  E F+E FVD   F+DYFK+ W P +  W + +R+LP+   E  AA
Sbjct  307   ILYSSRSGPNAMDAVEEFLEIFVDQSAFIDYFKSRWSPYIESWVSGIRSLPVLGPEPHAA  366

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LK +L NE+  + + R DWL+  L T  HS +WL++Y+ +  +   ++DE  S
Sbjct  367   IESYHRRLKYKLFNEQHANFWSRIDWLIHALTTEFHSLYWLEQYTRETGYFPNFRDESFS  426

Query  1608  GLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
                AW ++L IP+ DV +D ++   AKV+ Q D+N+ + IWNP SEF+LCDC+ +++GNL
Sbjct  427   T-NAWYQALHIPNVDVILDEQNLQLAKVISQTDRNLAYAIWNPGSEFSLCDCDWSSLGNL  485

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQL  1264
             C+HV K     ++R  A   +S   YRQ L+ +LH PP D +I DHA+  A  +Q+ +
Sbjct  486   CKHVIKVAMICKNRQVARPLLSAQIYRQTLLSLLHNPPDDPVILDHAILCATRLQQDI  543



>gb|KDO50310.1| hypothetical protein CISIN_1g005059mg [Citrus sinensis]
Length=656

 Score =   523 bits (1347),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 234/512 (46%), Positives = 352/512 (69%), Gaps = 1/512 (0%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +  + VQ+PP  +FSS D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+
Sbjct  5     ESLFDIQVQDPPEEDFSSIDLTWTKF-GTAEHHDEVALIPYARVDSFIIGECSNVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E+++++H E ++R  G   + + L  +YV++    IRRST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEESVLEKHIEGIQRYCGSDAKVNSLASQYVQKLGMIIRRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI LWV+ ++  IFFY+D S++DPF+LGIQTEWQLQQMIRFG+R L+A+D+ FG 
Sbjct  244   LDDQASIRLWVDRNKKSIFFYQDSSETDPFILGIQTEWQLQQMIRFGHRSLIAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S   A+PVAW++    A  D  +WM++L +R  + +P WK++GF++
Sbjct  304   KRLKYPLCTLLVFDSRQHALPVAWVVTRSSAKPDVTKWMKSLLDRARSIEPGWKISGFLI  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD   +I  IRE+F C +L S WRVR +W +N++K+C+ ++++  I KRLG +++SI  G
Sbjct  364   DDAAAEIDPIREIFCCPLLFSLWRVRRSWLRNIVKKCTNIKIQREIFKRLGNILYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +P    E  ++DFVD   F++YFKA+W P+L +W + +RALPLASQE   A+E YH +L
Sbjct  424   ADPFVNLEVLIQDFVDQTAFIEYFKASWMPKLAMWLSTMRALPLASQEASGAIEAYHVKL  483

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFW  1669
             K +L ++  L   +R DW+  +  +++    W
Sbjct  484   KTKLFDDSHLGALQRVDWVSSQKDSSLTHLVW  515


 Score = 61.2 bits (147),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 72/165 (44%), Gaps = 28/165 (17%)
 Frame = -3

Query  1668  LDEYSGKDDFARYWKDEWISGLTAWRKSLQ-IP----DGDVTIDGESAK-----------  1537
             + ++  +  F  Y+K  W+  L  W  +++ +P    +    I+    K           
Sbjct  434   IQDFVDQTAFIEYFKASWMPKLAMWLSTMRALPLASQEASGAIEAYHVKLKTKLFDDSHL  493

Query  1536  --------VVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATS  1381
                     V  Q D ++ H++WNP SEFA CDC  +  GN+C+HV K      +      
Sbjct  494   GALQRVDWVSSQKDSSLTHLVWNPGSEFAFCDCAWSMQGNICKHVVKVNMICANNEGYQP  553

Query  1380  SVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
             S+S    R+ L+ +   P  DS+  D  LSVA W    L+ QI Q
Sbjct  554   SMSFQSLREVLMNLWTKPMDDSVELD--LSVA-WTHNMLD-QIKQ  594



>ref|XP_003628100.1| hypothetical protein MTR_8g043530 [Medicago truncatula]
Length=792

 Score =   525 bits (1351),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 242/577 (42%), Positives = 374/577 (65%), Gaps = 18/577 (3%)
 Frame = -3

Query  2949  ILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALII  2770
             + YWCSFGP+++ +GG + PSR   +  +  A RP + RGCTCHF+VKRL A PS+ALII
Sbjct  151   LWYWCSFGPENYGEGGEILPSRRYRLNTRNRAARPQSMRGCTCHFVVKRLYARPSLALII  210

Query  2769  YNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNE  2590
             YN+ +HV+  G  CHGP D+ A G  A   PYI  +++ + +S++Y+G+  E I+++H E
Sbjct  211   YNERRHVNTSGFICHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENILEKHIE  270

Query  2589  SVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFS  2410
              +ER  GP  + + L  +YV +    I+RST+ELD DD  SI +WVE ++  +FF++D S
Sbjct  271   GIERYCGPNAQVNSLASQYVHKLGMIIKRSTHELDLDDQASIRMWVERNRKSVFFHQDTS  330

Query  2409  DSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLK-----------YPIHSLVVFN  2263
             +SDPF+LGIQTEWQLQQM+RFG+R ++A+D+ FG  +LK           YP+ +L+VF+
Sbjct  331   ESDPFILGIQTEWQLQQMVRFGHRSIVAADSSFGVKRLKVIIFHSRLLSYYPLFTLLVFD  390

Query  2262  SDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVF  2083
             S   A+PVAWII   FA  D  +W++AL +R  + +P WK++GF++DD   DI  + ++F
Sbjct  391   SRQHALPVAWIITRSFAKPDVSKWLKALIDRARSVEPGWKVSGFLIDDAAADIDLLSDIF  450

Query  2082  QCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDF  1903
              C VL S WR+R +W +N++++C+ +EV+  I KRLG +++SI  G   +   E  M DF
Sbjct  451   DCPVLFSLWRIRRSWLRNIVRKCNNIEVQREIFKRLGTIVYSIWGGTNTSLALEQLMLDF  510

Query  1902  VDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYE  1723
             VD  +F++YF+ +W P++ +W + +R +PLASQE   ALE YH +LK +L ++  L   +
Sbjct  511   VDQTDFLEYFRVSWLPKIEMWLSTMRNVPLASQEASGALEAYHVKLKAKLFDDSHLGALQ  570

Query  1722  RADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGES  1543
             R DWLV KL T +HS +WLD ++ + D  +  K+ +I+  T+W ++L+IPD  VT+D ++
Sbjct  571   RVDWLVHKLTTELHSSYWLDRFADESDSFQNVKEGYIAS-TSWHRALEIPDSAVTLDDKN  629

Query  1542  ---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVS  1372
                AKV  + D ++ H++WNP SEF+ CDC+ +  GNLC+HV K      +     SS+S
Sbjct  630   RLFAKVASKKDSSLTHIVWNPGSEFSFCDCSWSLHGNLCKHVIKVNMICENLQGCQSSMS  689

Query  1371  MFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
                + + L+ +   P  DS   D +L+   W  + L+
Sbjct  690   FRSFEEVLMDLWRKPVDDSFALDLSLA---WTHQMLD  723


 Score = 83.2 bits (204),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 2/126 (2%)
 Frame = -3

Query  3222  IQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESAN  3043
             ++MA  + + ++P+Q+P   EFS++D+ W+K  G  ++ D VALIPY RVD F+ GE +N
Sbjct  1     MEMAIVESVRNIPLQDPSEEEFSAADLTWTKF-GSAEHYDEVALIPYDRVDAFIIGECSN  59

Query  3042  KECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKK  2863
               CPT+FH+E  R+RT  T  + K D  LEY   W  +    H    V R  +       
Sbjct  60    VLCPTRFHIERGRKRTIGTLKEYKDDEYLEY-RQWFGYLERRHVGSLVSRVDQMGSSQIT  118

Query  2862  KSAGRP  2845
                GRP
Sbjct  119   SGRGRP  124



>ref|XP_010648578.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
 ref|XP_010648579.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
 ref|XP_010648580.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
Length=562

 Score =   510 bits (1313),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 341/520 (66%), Gaps = 10/520 (2%)
 Frame = -3

Query  2835  RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLR  2656
             RGC CHF VKRL   PS+ALIIYNQ KHVDK G PCHG  D+ A GTRAMYAP ISE+LR
Sbjct  3     RGCLCHFTVKRLYTRPSLALIIYNQRKHVDKTGAPCHGILDRDAVGTRAMYAPRISEELR  62

Query  2655  LRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADD  2476
              +V+S+LYVG+S++ I+Q H E V+  GGP NRDD LT   VR  ER IR S++ L  +D
Sbjct  63    QKVMSMLYVGISLDNIIQHHMEVVQNHGGPHNRDDFLTRNDVRNMERVIRNSSHMLLDND  122

Query  2475  AISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKL  2296
               S+  W++ HQ H+FF++  S S+PF+LGIQT+WQLQQM+ +G+ G +AS + FG+ KL
Sbjct  123   ECSVKAWMQRHQKHVFFFQANSGSEPFILGIQTDWQLQQMLHYGHNGSIASHSTFGSKKL  182

Query  2295  KYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDP  2116
             KYP+ SL+VF+S   AIPVAW+I      +   +WM     R+ TKDP W+   F+VDDP
Sbjct  183   KYPLCSLLVFDSSRNAIPVAWVITSSSIGQGIHKWMGIFVERIRTKDPRWRPNAFLVDDP  242

Query  2115  LTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEP  1936
               +I  IREVFQC VL+  W VR AW ++L+K+C  ++V+  + K LG++++  C    P
Sbjct  243   SIEIGVIREVFQCRVLLCLWHVRRAWMRSLLKKCCNLDVQQEMFKHLGQILY--CTKNRP  300

Query  1935  --ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
                +  + FM+ FVD   F++YF+  W PR+ LW N ++ LP+ASQE  AA+E YH  LK
Sbjct  301   IIVDAIQEFMQIFVDQCAFMNYFRRRWLPRIELWVNGIKTLPVASQEPNAAIESYHLSLK  360

Query  1761  LRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLT-AWRKS  1585
              +L NE   + + R DWL+  L T +HS++WL++Y  +  +    +D  +S  T +W ++
Sbjct  361   TKLFNELYANHWPRVDWLIHILTTEIHSFYWLEQYIIETGYFENLRD--VSFTTNSWYRA  418

Query  1584  LQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSI  1414
             L IPD DV +D ++   AKV+ Q D+ + + IWNP SEF +CDC  + +GNLC+H  K  
Sbjct  419   LHIPDADVLLDEQNLQLAKVISQTDRTLAYTIWNPGSEFCICDCPWSRLGNLCKHAIKVA  478

Query  1413  KYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHAL  1294
                + R  A   +S   YRQAL+ +L  PP D L+ DHA+
Sbjct  479   ILCKSRQVARPLLSAQVYRQALLTLLQNPPDDPLVLDHAI  518



>gb|EMS61136.1| hypothetical protein TRIUR3_35179 [Triticum urartu]
Length=654

 Score =   512 bits (1318),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 243/571 (43%), Positives = 361/571 (63%), Gaps = 16/571 (3%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R++ F+ GE  N E PT+FH+E 
Sbjct  17    LPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRMEAFISGECNNPEYPTRFHIER  76

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   T  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  77    GRKRERGTLKEVRSDDYLLYRMYWCSFGPENYGEGGTILPSRRYRLNTRNRAARPQSMRG  136

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +K+L A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   PY+  +++ +
Sbjct  137   CTCHFAIKQLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGARKVPYVGSEIQQQ  196

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAI  2470
              +SL+Y+GV  E I+Q H E ++R  G   + D L  +YV +    I+RST+ELD DD  
Sbjct  197   TMSLIYLGVPEENILQTHIEGIQRYCGSDAKVDNLASQYVHKLGMIIKRSTHELDLDDQA  256

Query  2469  SISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
             SI +WV+ ++  +FF++D +++D FVLGIQTEWQLQQMIRFG++ +LAS + FG +KLKY
Sbjct  257   SIRMWVDRNKKSVFFHQDSTETDAFVLGIQTEWQLQQMIRFGHQNILASHSSFGVSKLKY  316

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
             P+H+++VF+S  +A+PVAW+I       DT RWM+AL +R+H+ D  W++ GFI+DDP +
Sbjct  317   PLHTILVFDSRQQALPVAWVITRSVTKHDTSRWMQALTSRIHSVDSNWRIGGFIIDDPTS  376

Query  2109  DIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPAN  1930
             ++  IR +F C +L S W +R  W KN++K+CS  EV+  I  +LG+ ++SI     P +
Sbjct  377   ELDPIRNIFSCPILFSLWHIRRTWLKNIIKKCSNTEVQREIFTQLGKFMYSIWSEKNPMD  436

Query  1929  TFEAFMEDFVDAVEFVDYFKATWYPRLG-------------LWSNALRALPLASQETCAA  1789
               E   +DFVD   F+ YFK+ W P+L              +W + +R LPLASQE+C A
Sbjct  437   ILEQLFQDFVDQTTFIQYFKSFWVPKLDANNVSCVPLPHLEMWIDTIRNLPLASQESCGA  496

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LKL+  ++  L   +R DWLV KL T +HS +WL+ Y+ +       +  +  
Sbjct  497   IEGYHLKLKLKAYDDSQLDALQRVDWLVHKLTTELHSGYWLNLYADESVVRGQCRVTYRV  556

Query  1608  GLTAWRKSLQIPDGDVTIDGESAKVVDQGDK  1516
              L  W+K L   D   ++D   A V+   ++
Sbjct  557   LLDLWQKPL---DDSFSLDLSVAWVMQMQER  584



>ref|XP_010049050.1| PREDICTED: uncharacterized protein LOC104437738 isoform X2 [Eucalyptus 
grandis]
Length=640

 Score =   510 bits (1314),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 252/569 (44%), Positives = 358/569 (63%), Gaps = 15/569 (3%)
 Frame = -3

Query  2943  YWCSFGPDDHRKGGVVRPSRTTYVP---KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALI  2773
             YWCS+GP+D+R    V        P   K    GR +  RGC CHF VKRL   PS+ALI
Sbjct  46    YWCSYGPEDYRDNESVVGDSLGMKPLSGKGSRPGRHHMMRGCLCHFTVKRLYIRPSIALI  105

Query  2772  IYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHN  2593
             IYNQ KHVDK G PCHG  D+ A GTRAMYAP ISE+LR +V+S+LY  + ++ IMQ H 
Sbjct  106   IYNQQKHVDKTGAPCHGLLDRHAVGTRAMYAPRISEELRQKVMSMLYAAIPIDDIMQHHM  165

Query  2592  ESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDF  2413
             E V+R GGP NRDD L+   VR  ER +  S++EL+ +D  S+ +WV  HQ ++FFY++ 
Sbjct  166   ELVQRHGGPLNRDDFLSRNDVRNMERLVHNSSHELNENDECSVKIWVRRHQKYVFFYQER  225

Query  2412  SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAW  2233
             +D++PF++GIQT+WQL+QM+ +G  G +A  + FG NKLKYP+ +L+ FN+ + AIPVAW
Sbjct  226   TDTEPFIMGIQTKWQLEQMLHYGRNGSIAMHSSFGRNKLKYPLCTLLAFNTSHSAIPVAW  285

Query  2232  IIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWR  2053
             II+     +   +W+  L  R++TKDPTW+L+ F+VDD    +  IRE F+C VL+  WR
Sbjct  286   IISSSLICQGIHKWIGPLAERIYTKDPTWQLSSFLVDDCSFKVSLIREAFRCRVLLCLWR  345

Query  2052  VRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYF  1873
             VR AW +NL+KR     V+  + + LG +++     C  +N  E FM+ FVD   F++YF
Sbjct  346   VRRAWIRNLIKRSCHSGVQREMFRLLGSILY-----CTRSNAVEEFMQVFVDQCAFMEYF  400

Query  1872  KATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLG  1693
             +  W PR+    N +++LP A  E  AA+E YH + K +LL+ +  +++ R DWL+  L 
Sbjct  401   RERWLPRIDALINGMKSLPTAGPEPQAAIESYHLRSKFKLLDIQYCNLWLRVDWLIHMLA  460

Query  1692  TTVHSYFWLDEYS-GKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQ  1525
             T  HS FWLD+YS G   F       + S   AW ++L I D +V ++ ++   AKV+ +
Sbjct  461   TEYHSSFWLDQYSLGTGCFENVRDPSFTS--NAWHRALNILDVNVILEEQNLLLAKVLSE  518

Query  1524  GDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALI  1345
              D+N V+ +WNP SEF+LCDC  +  GNLCEHV K     R R  A +S+    YRQA++
Sbjct  519   -DRNSVYTVWNPGSEFSLCDCAWSKCGNLCEHVIKVAFLCRTRQVAGTSLGSQGYRQAML  577

Query  1344  KMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
              +L  PP D ++ DHA   A  + + +NS
Sbjct  578   SLLQKPPGDPIVLDHANLRATQLHEDVNS  606



>ref|XP_004292961.1| PREDICTED: uncharacterized protein LOC101313282 [Fragaria vesca 
subsp. vesca]
Length=583

 Score =   508 bits (1309),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 248/540 (46%), Positives = 350/540 (65%), Gaps = 6/540 (1%)
 Frame = -3

Query  2868  KKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRA  2689
             K    GR +  RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D+ + GTRA
Sbjct  14    KGSRPGRRHMMRGCLCHFTVKRLYTRPLIALIIYNQRTHVDKSGAPCHGILDRDSMGTRA  73

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MYAP ISE+ R +V+S+LYVG+ +++I+Q H E V+  GGP NRDD L+   VR  ER +
Sbjct  74    MYAPRISEEQRQKVMSMLYVGIPLDSIIQHHTEVVQEHGGPLNRDDFLSRSDVRNMERLV  133

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             R ST+EL ADD  S+ +WV+ H+ H+F++++ S S+ FVLGIQTEWQLQQM+++G+   +
Sbjct  134   RNSTHELHADDGCSVRIWVQRHRKHVFYFEESSSSESFVLGIQTEWQLQQMLQYGHNSYV  193

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             A  +RFG  K KYP+ +L+VF+    AIPVAWIIA  F+ +   +W+  L +R+ TKDP 
Sbjct  194   AFHSRFGLKKFKYPLSTLLVFDQSRNAIPVAWIIASSFSGQGIHKWIGLLVDRIRTKDPR  253

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             W+L  F VDDP  +I  IRE FQC VL+  W VR +W ++++KRC   +V+  + K LG 
Sbjct  254   WRLDAFFVDDPSFEISIIREAFQCRVLLCIWHVRRSWIRSILKRCRNFDVQREMFKHLGW  313

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             +++    G    +  E F++ FVD   F+DYFK  W P + +W N +R+LP+AS E  AA
Sbjct  314   LLYCTTSGPIAMDAVEEFLQVFVDQCAFMDYFKRRWLPNIEMWVNGVRSLPVASPEPSAA  373

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LK +L NE+  S + R DWL+  L T   S +WLD+YS +  +    +D   S
Sbjct  374   VESYHLRLKSKLFNEQYASSWSRVDWLIHTLTTEFQSSYWLDQYSVETGYFENLRDR--S  431

Query  1608  GLT-AWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGN  1441
              LT  W ++LQI D DV ID ++   AKV+ Q D+++V+ IWNP SEF+LCDC  + +GN
Sbjct  432   FLTNCWYQALQILDVDVIIDEQNLQYAKVISQSDRSVVYTIWNPGSEFSLCDCPWSMLGN  491

Query  1440  LCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLN  1261
             LC+H+ K     + R  A   ++   YRQAL+ +L  PP D ++ DHA+  A  +Q+ + 
Sbjct  492   LCKHIIKVAILCKSRQVARPLLAAQVYRQALLTLLQNPPDDPVVLDHAILHATRLQQDIK  551



>ref|NP_974054.1| SWIM zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AEE33697.1| SWIM zinc finger-like protein [Arabidopsis thaliana]
Length=500

 Score =   495 bits (1275),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 223/497 (45%), Positives = 338/497 (68%), Gaps = 1/497 (0%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + +  +PVQNP   +FS +D+ W+K  G  ++ D+VAL+PYARVD+F+ GE +N ECPT+
Sbjct  5     ESLEEIPVQNPQVEDFSWADLTWTKF-GTSEHHDQVALVPYARVDEFIIGECSNAECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP
Sbjct  64    FHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAARP  123

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
              + RGCTCHF+VKRL A PS+AL+IYN+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  124   QSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPYICN  183

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +++ + +S++Y+G+  E ++++H E ++R  G     D L  +YV +    I+RST+ELD
Sbjct  184   EIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSDATVDSLASQYVHKLGMIIKRSTHELD  243

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              DD  SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ++RFG+  L+A+D+ FG 
Sbjct  244   LDDQASIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQLVRFGHCSLVAADSTFGI  303

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              +LKYP+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+
Sbjct  304   KRLKYPLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFII  363

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DD  T+   IR+ F C +L S WRVR +W +N++K+C  +EV+  + K LGE+++SI  G
Sbjct  364   DDAATETDPIRDTFCCPILFSLWRVRRSWLRNVVKKCDSIEVQRDLFKCLGELVYSIWDG  423

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
              +     E   +DFVD   F+ YF +TW P++G+W + +++LPLASQE C A+E YH +L
Sbjct  424   VDTTKALEKLTQDFVDQTAFMQYFTSTWLPKIGMWLSTMKSLPLASQEACGAIEAYHIKL  483

Query  1764  KLRLLNERDLSVYERAD  1714
             K++L ++  L   +R D
Sbjct  484   KVKLFDDTHLGALQRVD  500



>ref|XP_011081862.1| PREDICTED: uncharacterized protein LOC105164788 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   471 bits (1213),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 228/529 (43%), Positives = 336/529 (64%), Gaps = 4/529 (1%)
 Frame = -3

Query  2835  RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLR  2656
             RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D++A GTRAMYAP ISE+LR
Sbjct  3     RGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDQEAVGTRAMYAPRISEELR  62

Query  2655  LRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADD  2476
              +V+++L+VG+S++ I+Q H E V+R GGP NRDD LT   VR  ER IR S+ EL ++D
Sbjct  63    QKVMAMLHVGISLDMIVQHHMEEVQRHGGPQNRDDFLTRNDVRNMERLIRNSSLELHSND  122

Query  2475  AISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKL  2296
               S+ +WV+ H  H+F++++   S+  +LGIQT+WQLQQM+R+G+ G LAS    G  KL
Sbjct  123   HCSVKMWVQRHHKHVFYFQENCGSETLILGIQTDWQLQQMLRYGHNGSLASHTASGPKKL  182

Query  2295  KYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDP  2116
             KY + SL+ F+S + AIPVAWII     S++  +WM +L  R+  KD  W+    +VDDP
Sbjct  183   KYTLCSLLAFDSSHNAIPVAWIITSSSLSQNIHKWMPSLVERIRGKDTRWRPNAILVDDP  242

Query  2115  LTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEP  1936
               +   IRE FQC VL+S W VR  W K L+K C+   V+  + K LG +++    G   
Sbjct  243   SFEASVIREGFQCRVLLSIWHVRRCWLKGLLKYCNNFNVQREMFKHLGRIVYCTRSGSST  302

Query  1935  ANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLR  1756
             ++  + FM+ ++D   F++YF++ W P++ LW +++R+LP+A QE  A++E YH +LK R
Sbjct  303   SDAVDEFMQIYIDQSAFIEYFRSKWLPKIELWVSSVRSLPVAGQEPYASVESYHLRLKSR  362

Query  1755  LLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQI  1576
             +L+    + Y+R D L+  L T  HS++W D Y  +  +    +D + S    W +++ I
Sbjct  363   VLSLLPANSYQRVDLLIHALTTQFHSFYWFDHYIAETGYFENLRDRF-SLTNPWYQAMHI  421

Query  1575  PDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYL  1405
             PD DV +D E+   AKVV Q D ++ + +WNP SEF  CDC+ + +GN+C+H  K + + 
Sbjct  422   PDIDVLLDEENLHFAKVVSQADSSVAYTVWNPGSEFGFCDCSWSMLGNMCKHTIKVVIFC  481

Query  1404  RDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
             R R  A   +S   YRQ L+ +L   P D L+ +HA++    +Q+ + S
Sbjct  482   RCRQIARPLLSAQVYRQTLLNLLQNLPDDPLVLEHAIAHVTRLQQDIKS  530



>gb|AES73739.2| zinc ion-binding protein [Medicago truncatula]
Length=540

 Score =   467 bits (1202),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 237/566 (42%), Positives = 341/566 (60%), Gaps = 40/566 (7%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             +EIL+LPVQ+PP  EFS+  I    +EG R   D +ALIP+ARVDDFV+ ES+N  CP  
Sbjct  2     EEILTLPVQDPPCAEFSAETINLLNLEGGRQGGDDIALIPFARVDDFVKEESSNPTCPAN  61

Query  3024  FHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  2845
             F VE+RR+R + +  KP+VDG LEY LYWCS+GP+D+R+        +  V +    GR 
Sbjct  62    FRVESRRKRASGSVAKPRVDGYLEYTLYWCSYGPEDYRE--------SERVNRGSRLGRR  113

Query  2844  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  2665
             +  RGC CHF VKRL   P +ALIIY+Q                      RAMYAP IS+
Sbjct  114   HMMRGCLCHFTVKRLYTRPHLALIIYDQ---------------------KRAMYAPRISD  152

Query  2664  DLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD  2485
             +LR +V+S+LYVG+S++ I+Q H E  ++QGGP NR D LT   VR  ER+I  S+ EL 
Sbjct  153   ELRQKVMSMLYVGISLDNILQHHAEVTQKQGGPLNRGDFLTRNDVRNMERTIHNSSRELL  212

Query  2484  ADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGT  2305
              ++  S+ +W++ HQ  IF+++D S S+ F++ IQT+WQLQQM+R+G+   ++  + FG 
Sbjct  213   GNEECSVKIWIQRHQKDIFYFQDNSGSESFIVAIQTDWQLQQMLRYGSNSFISFHSAFGL  272

Query  2304  NKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIV  2125
              KLKYP+ SL+VF+S   AIPVAWII+  F  +D  +W+  L  R+ TKDP WK     +
Sbjct  273   KKLKYPVCSLLVFDSSQNAIPVAWIISSSFVGKDIHKWIVLLSERLRTKDPRWKPNAIFL  332

Query  2124  DDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKG  1945
             DDP  +   IRE FQC +L+  W VR    K L K+C   EV+  + ++LG +++S   G
Sbjct  333   DDPSFNYYIIREAFQCRILLCTWHVRRTCIKMLFKKCCNFEVQQRMFRQLGSILYSARCG  392

Query  1944  CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQL  1765
                 +  +  M+ FVD  +F+DY K        +W N +++LP+ + +   A+E YH +L
Sbjct  393   PNAMDAIDELMQIFVDQCDFIDYLK-------NVWINGIKSLPVTTPKPHDAMESYHLKL  445

Query  1764  KLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKS  1585
             K  LL E   + + R DWL+  L T  HS +WLD+YS +  +    +D   S   AW  +
Sbjct  446   KSTLLKESHANFWSRVDWLIHTLTTEFHSLYWLDQYSLETGYFENLRDNSFST-NAWYHA  504

Query  1584  LQIPDGDVTIDGES---AKVVDQGDK  1516
             L IPD DV ++ ++   AK++ Q  K
Sbjct  505   LHIPDVDVVLNEQNLHLAKILSQLTK  530



>ref|XP_003603488.1| hypothetical protein MTR_3g108220 [Medicago truncatula]
Length=552

 Score =   455 bits (1170),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 234/571 (41%), Positives = 338/571 (59%), Gaps = 48/571 (8%)
 Frame = -3

Query  3219  QMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANK  3040
             ++ R +EIL+LPVQ+PP  EFS+  I    +EG R   D +ALIP+ARVDDFV+ ES+N 
Sbjct  17    RLPRMEEILTLPVQDPPCAEFSAETINLLNLEGGRQGGDDIALIPFARVDDFVKEESSNP  76

Query  3039  ECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKK  2860
              CP  F VE+RR+R + +  KP+VDG LEY LYWCS+GP+D+R+        +  V +  
Sbjct  77    TCPANFRVESRRKRASGSVAKPRVDGYLEYTLYWCSYGPEDYRE--------SERVNRGS  128

Query  2859  SAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYA  2680
               GR +  RGC CHF VKRL   P +ALIIY+Q                      RAMYA
Sbjct  129   RLGRRHMMRGCLCHFTVKRLYTRPHLALIIYDQ---------------------KRAMYA  167

Query  2679  PYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRS  2500
             P IS++LR +V+S+LYVG+S++ I+Q H E  ++QGGP NR D LT   VR  ER+I  S
Sbjct  168   PRISDELRQKVMSMLYVGISLDNILQHHAEVTQKQGGPLNRGDFLTRNDVRNMERTIHNS  227

Query  2499  TYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASD  2320
             + EL  ++  S+ +W++ HQ  IF+++D S S+ F++ IQT+WQLQQM+R+G+   ++  
Sbjct  228   SRELLGNEECSVKIWIQRHQKDIFYFQDNSGSESFIVAIQTDWQLQQMLRYGSNSFISFH  287

Query  2319  ARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKL  2140
             + FG  KLKYP+ SL+VF+S   AIPVAWII+  F  +D  +W+  L  R+ TKDP WK 
Sbjct  288   SAFGLKKLKYPVCSLLVFDSSQNAIPVAWIISSSFVGKDIHKWIVLLSERLRTKDPRWKP  347

Query  2139  AGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIH  1960
                 +DDP  +   IRE FQC +L+  W VR    K L K+C   EV+  + ++LG +++
Sbjct  348   NAIFLDDPSFNYYIIREAFQCRILLCTWHVRRTCIKMLFKKCCNFEVQQRMFRQLGSILY  407

Query  1959  SICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEF  1780
             S   G    +  +  M+ FVD                 +W N +++LP+ + +   A+E 
Sbjct  408   SARCGPNAMDAIDELMQIFVDQY---------------VWINGIKSLPVTTPKPHDAMES  452

Query  1779  YHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLT  1600
             YH +LK  LL E   + + R DWL+  L T  HS +WLD+YS +  +    +D   S   
Sbjct  453   YHLKLKSTLLKESHANFWSRVDWLIHTLTTEFHSLYWLDQYSLETGYFENLRDNSFST-N  511

Query  1599  AWRKSLQIPDGDVTIDGES---AKVVDQGDK  1516
             AW  +L IPD DV ++ ++   AK++ Q  K
Sbjct  512   AWYHALHIPDVDVVLNEQNLHLAKILSQLTK  542



>gb|KFK40773.1| hypothetical protein AALP_AA2G039200 [Arabis alpina]
Length=642

 Score =   451 bits (1160),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 246/657 (37%), Positives = 371/657 (56%), Gaps = 82/657 (12%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             +PVQNP   +FS SD+ W+K  G  ++ D VALIPY+RVD+F+ GE +N ECPT+FH+E 
Sbjct  10    IPVQNPQVEDFSWSDLTWTKF-GTSEHHDDVALIPYSRVDEFIIGECSNAECPTRFHIER  68

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R+  +  + K D  LEY LYWCSFGP+++ +GG V PSR   +  +  A RP + R 
Sbjct  69    GRKRSRGSLKEYKTDEYLEYRLYWCSFGPENYGEGGDVLPSRKYRLNTRNRAARPQSMR-  127

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
                                           G  CH                         
Sbjct  128   ------------------------------GCTCHF------------------------  133

Query  2649  VLSLLYVGVSVETIMQRHNESVERQG----GPCNRDDLLTHRYVRRQERSIRRSTYELDA  2482
             V+  LY    +  ++      V + G    GP +RD +             ++  Y    
Sbjct  134   VVKRLYARPLLALLIYNKRRHVNKAGFICHGPLDRDAI---------GPGAKKIPYGF-R  183

Query  2481  DDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTN  2302
             DD  SI +W E ++  IFFY++ S++D F+LGIQTEWQLQQ +RFG+  L+A+D+ FG  
Sbjct  184   DDQASIKIWAERNKKSIFFYQESSETDQFMLGIQTEWQLQQFVRFGHGSLVAADSTFGIK  243

Query  2301  KLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVD  2122
             KLKYP+ +L+VF+S + A+PVAWII+  +   D  +WM+ L  R  + +P +K+ GFI+D
Sbjct  244   KLKYPLCTLLVFDSRHHALPVAWIISRSYLKSDVEKWMKILLQRAQSVEPGFKINGFIID  303

Query  2121  DPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGC  1942
             D  T+I  IR+ F C +L S WRVR  W +N++K+C+ +EV+  + K LGE+++SI    
Sbjct  304   DAATEIDPIRDTFCCPILFSLWRVRRTWLRNVVKKCNNIEVQRELFKCLGEVVYSIWDEV  363

Query  1941  EPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
             + +   E   +DFVD   F+ YF +TW P++ +W + +++LPLASQE   A+E YH +LK
Sbjct  364   DTSKALERLTQDFVDETAFMQYFTSTWLPKIEMWLSTIKSLPLASQEVFGAIEAYHVKLK  423

Query  1761  LRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSL  1582
             ++L ++  L   +R DWLV KL T +HS +WLD Y+ + D  +  K+E+I+  T+W ++ 
Sbjct  424   VKLFDDTHLGALQRVDWLVHKLTTELHSSYWLDRYADESDSFQNVKEEYIAS-TSWHRAS  482

Query  1581  QIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIK  1411
             +IPD  VT+D  +   AKV  Q D ++  V+WNP SEFA CDC  +  GNLC+H+ K   
Sbjct  483   EIPDSAVTLDENNSLVAKVQSQKDIDVTRVVWNPGSEFAFCDCAWSLQGNLCKHIIKVNT  542

Query  1410  YLRDRGSATSSVSMFQYRQAL--IKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
                +R     S+S+  +++ L  IKM    P D+ I   AL +++ +  Q+  QI Q
Sbjct  543   MCENRKGYGDSMSLLSFKEKLRNIKM---KPLDNSI---ALDLSMALTLQMVEQIKQ  593



>ref|XP_010090844.1| hypothetical protein L484_020703 [Morus notabilis]
 gb|EXB40969.1| hypothetical protein L484_020703 [Morus notabilis]
Length=382

 Score =   383 bits (983),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/376 (47%), Positives = 262/376 (70%), Gaps = 1/376 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + IL +PVQ+P   EFSS+D+ W+K  G  D+ D VALIPY RVD+F+ GE +N E
Sbjct  1     MAIVESILDIPVQDPSEEEFSSADLTWTKF-GTSDHHDDVALIPYERVDEFIIGECSNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FH+E  R+R+  +  + K D  LEY LYWCSFGP+++ +GG + PSR   +  +  
Sbjct  60    CPTRFHIERGRKRSIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  119

Query  2856  AGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAP  2677
             A RP + RGCTC+F+VKRL A PS+ALIIY++ +HV+K G  CHGP D+ A G  A   P
Sbjct  120   AARPQSMRGCTCNFVVKRLFARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGAKKIP  179

Query  2676  YISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRST  2497
             YI  +++ + +S++Y+G+  E ++++H E ++R  G   + + L  +YV++    I+RST
Sbjct  180   YICNEIQQQTMSMIYLGIPEENVLEKHIEGIQRYCGSNAKVNSLASQYVQKLGMIIKRST  239

Query  2496  YELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDA  2317
             +ELD DD  SI LWVE ++  IFF++D S++D F+LGIQT+WQLQQMIRF +  L+A+D+
Sbjct  240   HELDLDDQASIRLWVERNRKSIFFFQDSSETDSFILGIQTDWQLQQMIRFSHHSLIAADS  299

Query  2316  RFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLA  2137
              FG  +LKYP+ +L+ F+S   A+PVAWII   +A  D  +W++AL +RV + +P WK++
Sbjct  300   TFGIKRLKYPLCTLLAFDSRQHALPVAWIITRSYAKPDVSKWIKALLDRVRSVEPGWKIS  359

Query  2136  GFIVDDPLTDIPAIRE  2089
             GF+VDD   +I  IR+
Sbjct  360   GFLVDDAAAEIDPIRQ  375



>ref|XP_010108923.1| hypothetical protein L484_027118 [Morus notabilis]
 gb|EXC20563.1| hypothetical protein L484_027118 [Morus notabilis]
Length=464

 Score =   381 bits (978),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 211/470 (45%), Positives = 292/470 (62%), Gaps = 24/470 (5%)
 Frame = -3

Query  1965  IHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAAL  1786
             + SIC+G    + FE F+EDF+D  +F+DYFKATWYPR+G W  A++ LP+ASQETC+A+
Sbjct  1     MDSICQGQGTISLFEGFLEDFLDESDFMDYFKATWYPRMGKWITAVQTLPIASQETCSAI  60

Query  1785  EFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISG  1606
             EFYHNQ+K+RLLNE++  VY+R DWLVDKL T +HSYFWLDEYSGKDDFARY K+EW+SG
Sbjct  61    EFYHNQMKVRLLNEKNPIVYQRTDWLVDKLNTKIHSYFWLDEYSGKDDFARYRKEEWVSG  120

Query  1605  LTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHV  1426
             LT+WRK+L+I D DV ++G SAKV DQ D++ +HV+WN  S+F +C+CN A MGNLCEH+
Sbjct  121   LTSWRKALEISDTDVVMEGGSAKVTDQLDRDRLHVVWNSGSQFGICECNWAEMGNLCEHM  180

Query  1425  FKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQKQLNSQIGQ  1246
              K I   R + SAT S+S+ QY++  + ML C P+DSLIRDHA+S+AV+VQKQ+N  + +
Sbjct  181   LKVISVWRKKKSATPSISLLQYQKVFMDMLQCAPHDSLIRDHAVSLAVFVQKQINGLVSE  240

Query  1245  ESVQVVG-PTTTYGGQCGDTVngskgnstsscngsgsNKLHH--SGFTKNQLCHSVDHIV  1075
                   G P++    Q   +                 +  H   +G    Q   S D   
Sbjct  241   SRNSSKGQPSSGNHDQELASGRSEDILYDKENGSLDRHGTHGRVTGIVGGQTNDSGD---  297

Query  1074  ARNGICTNSSHNIAVEIPCLEIGASPYSMCRSEPQLFSIDEVTSTDMLAENGRVLIDTGP  895
              RN IC +    +A EI C E+   P S+C S P L S+DEV S+ +L+EN    +++  
Sbjct  298   GRNSICGD---GLAEEISCAEMDVDPSSICISPPGLHSVDEVVSSGVLSENTEKGLNSE-  353

Query  894   DITENLPC--TDMSFSNLNDF-DNVLNKNDSTAKMDAESQSLHIVLSTAESLNQNSGSQQ  724
               +E+LP    D + +N N F  + LNK    ++MD ES S+ I  ST E + Q + + Q
Sbjct  354   --SEHLPSKDADATLANTNCFTTHALNKGGPESEMDMESISMDIPPSTMEFVEQCTVAHQ  411

Query  723   NGVCGNRKDTWVGPCIVSVGGKTDKDSSETSEP----VDSCLVNVGESSN  586
             N          + P ++S     D  S +TS P    V+S  V + E+SN
Sbjct  412   NDAYSQD----LKP-VISNTVDADTLSIKTSPPITVHVESQAVEIAETSN  456



>ref|XP_004162497.1| PREDICTED: uncharacterized LOC101215653 [Cucumis sativus]
Length=499

 Score =   381 bits (979),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 196/476 (41%), Positives = 288/476 (61%), Gaps = 15/476 (3%)
 Frame = -3

Query  2688  MYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSI  2509
             MY   ISE+LR +++S+LYVG+ +E I+Q H+E V+R GGP NRDD L+   VR  ER I
Sbjct  1     MYTQRISEELRQKIMSMLYVGIPIENIVQHHSEVVQRHGGPPNRDDFLSRIDVRNMERVI  60

Query  2508  RRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLL  2329
             R S++EL  +D  S+ +WV+ H+  IFF+++ SD + FVLGIQT+WQLQQM+R+G+ G +
Sbjct  61    RNSSHELHTNDDCSVKIWVQRHRKVIFFFQESSDCERFVLGIQTDWQLQQMLRYGHNGSV  120

Query  2328  ASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPT  2149
             AS +  G+ KL++P+ SL+VF+S    IPVAWIIA  F  +D  +W+  L  R+H KDPT
Sbjct  121   ASHSTLGSKKLRFPLCSLLVFDSSQNTIPVAWIIASSFVDQDIRKWLGLLVERLHAKDPT  180

Query  2148  WKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
             WK+  F++D+P  ++  IR +            R  W +N++K+C  ++V+  + K+LG+
Sbjct  181   WKIDTFLLDNPSFEVSTIRLILDLP-------YRFNWIRNILKKCPNLDVQREMFKQLGK  233

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
             +++    G   A   E F   F D   FVDY   TW P + LW N+LR+ P+++ E  AA
Sbjct  234   VLYCTRIGLGFAYAVEQFKRRFSDQCVFVDYLTRTWLPDIELWVNSLRSHPVSTLEANAA  293

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWIS  1609
             +E YH +LK +L  E+  S   R DWL+  L T  HS +WLD+YS    +   ++D+ I 
Sbjct  294   IEAYHIRLKSKLFKEQSNSSSSRVDWLIHILTTQFHSSYWLDQYSLDTGYFGSFRDKSIL  353

Query  1608  GLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNL  1438
                AW K+L IPD DV +D  +   AKV+ Q  +N+ + IW+P SEF+LCDC  + MGNL
Sbjct  354   T-NAWNKALHIPDVDVIVDESNLQFAKVISQSKRNLEYTIWDPGSEFSLCDCPWSRMGNL  412

Query  1437  CEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWVQK  1270
             CEHV K +  L  R  A   +   Q  Q  +      P   +  DH + +   VQ+
Sbjct  413   CEHVIK-VSLLCKRQQAARPLVAAQVYQDRVPNFQLNP---VTFDHGMPLVNCVQR  464



>ref|XP_006827055.1| hypothetical protein AMTR_s00010p00231990 [Amborella trichopoda]
 gb|ERM94292.1| hypothetical protein AMTR_s00010p00231990 [Amborella trichopoda]
Length=797

 Score =   382 bits (980),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 227/660 (34%), Positives = 341/660 (52%), Gaps = 44/660 (7%)
 Frame = -3

Query  3255  EVQNPNSRNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYAR  3076
             EV NP+ ++          ILSLPVQN P   F+SS + W  +   +  +D VA+IPY R
Sbjct  2     EVSNPSRKDTNKSF-----ILSLPVQNLPEGYFNSSQLTWYTMNRGKSPVD-VAVIPYDR  55

Query  3075  VDDFVRGESANKECPTKFHVEARRRRTAQTSYKPKVDGILEY-----ILYWCSFGPDDHR  2911
             +DDFV GES+  +C T F   AR + + Q  +   V   LE+       YWCS+G  D+R
Sbjct  56    MDDFVCGESSLSQCSTSF---ARTKSSKQPLHTASV--TLEHRSLVSCTYWCSYGGADYR  110

Query  2910  KGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLP  2731
                ++ P    + P      R   KRGCTCHFI K+L A PS  LI Y + +HVDK GLP
Sbjct  111   DQ-MIHPEHNKHRP-----NRERKKRGCTCHFICKQLAARPSDVLITYVERRHVDKNGLP  164

Query  2730  CHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGG-----P  2566
             CHGP+D  + G R ++A ++S + +  V SLLY+G+S +TI  +H   + ++ G      
Sbjct  165   CHGPEDISSGGKRPLHAMHLSSEKKHWVYSLLYMGLSYKTIYDKHIHYINQENGRDPNRE  224

Query  2565  CNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLG  2386
               RDD L  R V+   R      Y+L  +   S+  WV  + + +F ++   +   F+LG
Sbjct  225   ATRDDFLKLRDVQNLARRSNGIGYQLHPNGNGSVGKWVAKNPSDVFIFRK-DEQFSFILG  283

Query  2385  IQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASE  2206
             +QT WQL+Q++RFGNR  L  D+       KY +++++ F+S    IPVAW+I      E
Sbjct  284   LQTHWQLEQLVRFGNRSELFLDSTCDLTCSKYFVYTVLAFDSQQTGIPVAWVIVEEVTQE  343

Query  2205  DTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNL  2026
                 W+ AL  R+  KD TW +A F++D+ +     I ++F C + +S WRVR +W + L
Sbjct  344   VMFTWLTALKKRILEKDATWSVASFLIDESVQCRETISDIFGCRLPLSLWRVRRSWLERL  403

Query  2025  MKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLG  1846
              K   ++ +R  +   LG+++           +F  F   F   + F+ YF+  W P++ 
Sbjct  404   SKDVYDVALRAEMYCALGKILRLSTSEEHAMESFAKFKVIFAMEMTFLSYFEEYWIPQIC  463

Query  1845  LWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWL  1666
              W +  R     S E   AL +YH+ L  +    R++S   R DWL+++L   VHSY+W 
Sbjct  464   RWFSEKREFAHPSHEVNGALPYYHSGLNEQRPEARNISE-TRLDWLINRLMKEVHSYYWY  522

Query  1665  DEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDG---ESAKVVDQ-GDKNMVHVI  1498
              +Y+ K+   R    E +    AW+ +L+IPDGDV  D      AKV +Q G       +
Sbjct  523   GQYAKKNGLCRTVATEHLQN-NAWQNALKIPDGDVVWDSLCFHIAKVHNQLGGHPEYFTL  581

Query  1497  WNPSSEFALCDCNSANMGNLCEHV----------FKSIKYLRDRGSATSSVSMFQYRQAL  1348
             WNP SE++LCDC      + CEH+           K+ KYL      TS+ S      +L
Sbjct  582   WNPGSEYSLCDCGVPICASTCEHIAKLYMVWNVHLKTPKYLCLESPPTSTTSQINSTSSL  641



>gb|EYU33119.1| hypothetical protein MIMGU_mgv1a009920mg [Erythranthe guttata]
Length=327

 Score =   349 bits (895),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 223/327 (68%), Gaps = 5/327 (2%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H+ +MAR ++IL+LPVQ+PP  EFS++ I W KVEG R   D +ALIP++RV+DFV+G
Sbjct  2     KGHESKMARMEDILNLPVQDPPYTEFSAAHINWVKVEGGRQGGDDIALIPFSRVEDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTY  2875
             ES N +CP  F VE+RR+R   +  KP+VDG LEY LYWCS+GP+D+R        +T+ 
Sbjct  62    ESGNADCPANFRVESRRKRPEGSLNKPRVDGYLEYTLYWCSYGPEDYRDIEPQIGEKTST  121

Query  2874  VPKKKSAGRPNTK---RGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKA  2704
              P      RP  +   RGC CHF VKRL   P +ALIIYNQ  HVDK G PCHG  D ++
Sbjct  122   KPSSGKGSRPGRRHMMRGCICHFTVKRLYTRPQLALIIYNQRSHVDKSGAPCHGILDHES  181

Query  2703  AGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRR  2524
              GTRAMYAP ISE+LR +V+SLL+VG+S++ I+Q H E V+R GGP +RDD LT   VR 
Sbjct  182   VGTRAMYAPRISEELRQKVMSLLHVGISLDAIVQHHMEEVQRHGGPHSRDDFLTRNDVRN  241

Query  2523  QERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFG  2344
              ER I+ S +EL  DD  S+ +WV+ H  H+F++++    + FVLG+QT+WQLQQM+R+G
Sbjct  242   MERLIKNSPHELHLDDRCSVKMWVQRHHKHVFYFQESCGCEGFVLGVQTDWQLQQMLRYG  301

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFN  2263
             + G + S    G+ K K  +  ++VF 
Sbjct  302   HGGFIVSHLVSGSKKFKVEL--VIVFG  326



>gb|AFK48408.1| unknown [Medicago truncatula]
Length=204

 Score =   325 bits (832),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 177/205 (86%), Gaps = 1/205 (0%)
 Frame = -3

Query  2460  LWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +WVES Q+++FFY+DFSDSDPF+LGIQTEWQLQQMI+FGNRGLLASD+RFGTN LKYP+H
Sbjct  1     MWVESRQSNVFFYQDFSDSDPFILGIQTEWQLQQMIKFGNRGLLASDSRFGTNTLKYPVH  60

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIP  2101
             SL+VFNSD KAIPVAWII P+F+  D  RWMRAL+NRVH KDPTWKLAGFIVDDP  D+P
Sbjct  61    SLLVFNSDKKAIPVAWIITPKFSCLDAHRWMRALHNRVHNKDPTWKLAGFIVDDPQYDVP  120

Query  2100  AIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFE  1921
             AIR+VFQCSVLISFWRVRH WHKN+MK C E ++++ I++RLG ++ SIC+     + FE
Sbjct  121   AIRDVFQCSVLISFWRVRHLWHKNIMK-CLETDMQIKISQRLGWIMDSICRRQGTMSLFE  179

Query  1920  AFMEDFVDAVEFVDYFKATWYPRLG  1846
              F+EDF+D   F+DYFKATWYPR+G
Sbjct  180   DFVEDFIDEFNFMDYFKATWYPRMG  204



>tpg|DAA42489.1| TPA: hypothetical protein ZEAMMB73_890904 [Zea mays]
Length=237

 Score =   314 bits (805),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 178/218 (82%), Gaps = 3/218 (1%)
 Frame = -3

Query  2736  LPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNR  2557
             +PCHG  DK A GT+AM+APYIS+ LRL+V+S+LYVG+ VETIMQRH   VE+QGGP NR
Sbjct  1     MPCHGSMDKMAVGTKAMFAPYISDVLRLQVMSVLYVGIPVETIMQRHTGMVEKQGGPSNR  60

Query  2556  DDLLTHRYVR-RQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQ  2380
             DDLLTHRYVR   ER IRRS YELD DDAISI LWVE++Q+ +FFY+DFSD+D FVLGIQ
Sbjct  61    DDLLTHRYVRILMERKIRRSVYELDDDDAISIDLWVENNQDCVFFYEDFSDTDTFVLGIQ  120

Query  2379  TEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDT  2200
             T+WQLQQMI+FG+  L+ASD++FGTNKLKYP+HS++VF+    AIPVAWII P FA  + 
Sbjct  121   TDWQLQQMIQFGSHTLMASDSKFGTNKLKYPVHSILVFDQHKNAIPVAWIITPSFAHGEI  180

Query  2199  VRWMRALYNRVHTKDPTWKLAGFI--VDDPLTDIPAIR  2092
              +WM ALY+R HTKDPTW+L GFI  +DDPL  +  IR
Sbjct  181   YKWMGALYDRAHTKDPTWQLDGFIIVIDDPLAKVRTIR  218



>gb|AFW66989.1| hypothetical protein ZEAMMB73_942101 [Zea mays]
Length=355

 Score =   309 bits (791),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 211/312 (68%), Gaps = 6/312 (2%)
 Frame = -3

Query  3189  LPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFHVEA  3010
             LPVQ+PP  EFS++D+ W K      + D VALIPY R++ F+ GES N ECPT+FH+E 
Sbjct  14    LPVQDPPGEEFSAADLAWVKYATSEHHRDDVALIPYDRMEAFIAGESNNPECPTRFHIER  73

Query  3009  RRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRG  2830
              R+R   +  + + D  L Y +YWCSFGP+++ +GG + PSR   +  +  A RP + RG
Sbjct  74    GRKRERGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARPQSMRG  133

Query  2829  CTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLR  2650
             CTCHF +KRL A PS+ LIIY++ +HV+K G  CHGP D+ A G  A   PYI  +++ +
Sbjct  134   CTCHFTIKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKMPYIGSEIQQQ  193

Query  2649  VLSLLYVGVSVETIMQRHNESVERQGGPCNRD---DLLTHRYVRRQERSIRRSTYELDAD  2479
              +SL+Y+GV  E I+Q H E ++R    C++D   D L  +YV++    I+RST+ELD D
Sbjct  194   TMSLIYLGVPEENILQTHIEGIQRY---CSKDAKVDNLASQYVQKLGMIIKRSTHELDLD  250

Query  2478  DAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNK  2299
             D  SI +WV+ ++  +FFY+D +++D F+LGIQT+WQLQQM+RFG++ LLAS + FG +K
Sbjct  251   DQASIRMWVDRNRKSVFFYQDSTEADAFILGIQTQWQLQQMMRFGHQSLLASHSSFGVSK  310

Query  2298  LKYPIHSLVVFN  2263
             LK P   LVV +
Sbjct  311   LKIPHGELVVLS  322



>gb|KHN16480.1| hypothetical protein glysoja_036582 [Glycine soja]
Length=430

 Score =   260 bits (665),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 216/448 (48%), Gaps = 98/448 (22%)
 Frame = -3

Query  2595  NESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKD  2416
             NE +++QGGP NRDD LT   VR  ER++R S+ EL  +D  S+ +WV+ HQ H+F+++D
Sbjct  58    NEDMQKQGGPQNRDDFLTRNDVRNMERTVRNSSNELHENDECSVKIWVQQHQKHVFYFQD  117

Query  2415  FSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVA  2236
              S S+PFVLGIQT+WQLQQM+RFGN   ++  + FG  KLK                   
Sbjct  118   NSSSEPFVLGIQTDWQLQQMLRFGNNSFISFHSSFGLKKLK-------------------  158

Query  2235  WIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFW  2056
                                       DP W+    ++DDP  D   IRE F+C +L+  W
Sbjct  159   --------------------------DPRWRPNAILLDDPSLDYSIIREAFRCRILLCAW  192

Query  2055  RVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEP--ANTFEAFMEDFVDAVEFV  1882
              VR  W K L K+C  +EV+  + + LG +++  C  C P   +  E  M+ FVD   F+
Sbjct  193   HVRRTWIKKLFKKCCNIEVQREMFRHLGWILY--CTKCGPNAMDAVEELMQIFVDQCAFM  250

Query  1881  DYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVD  1702
             DYFK+ W   + +W NA+++L + + E  AA+E YH +LK  LL E   S + R DWL+ 
Sbjct  251   DYFKSHWLASIDMWINAIKSLSVTTPEPHAAIESYHLKLKSMLLKENYASFWPRVDWLIH  310

Query  1701  KLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQG  1522
              L T  HS +WLD+YS +  +    +D   S    W                        
Sbjct  311   TLTTEFHSLYWLDQYSLETGYFENLRDNSFSS-NVW------------------------  345

Query  1521  DKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIK  1342
                                     +GNLC+HV K   + R +  A  S+S   Y+QAL+ 
Sbjct  346   ------------------------LGNLCKHVIKVATFCRSQQVARPSLSTQGYKQALLT  381

Query  1341  MLHCPPYDSLIRDHALSVAVWVQKQLNS  1258
             +LH PP D L+ D  +     +Q+ + +
Sbjct  382   LLHNPPDDPLVLDLTILHVTHLQQDIKA  409


 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M R + IL+LPVQ+P   EFS++ I W K+EG R   D +ALIP+ARVDDFV+GES+N++
Sbjct  1     MPRMEGILNLPVQDPLCPEFSAAHINWVKLEGGRQCGDNIALIPFARVDDFVKGESSNED  60



>tpg|DAA42494.1| TPA: hypothetical protein ZEAMMB73_619750 [Zea mays]
Length=172

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 140/176 (80%), Gaps = 5/176 (3%)
 Frame = -3

Query  2736  LPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNR  2557
             +PCHG  DK A GT+AM+APYIS++LRL+V+SLLYVG+ VETIMQRH E VE+QGGP NR
Sbjct  1     MPCHGSMDKMAVGTKAMFAPYISDELRLQVMSLLYVGIPVETIMQRHTEMVEKQGGPSNR  60

Query  2556  DDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQT  2377
             DDLLTHRYVRR ER IRRS YELD DDAISI LWVE++Q+ +FFY+DFSD+D FVLGIQT
Sbjct  61    DDLLTHRYVRRLERKIRRSVYELDDDDAISIGLWVENNQDCVFFYEDFSDTDTFVLGIQT  120

Query  2376  EWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFAS  2209
             +WQLQQMI+FG+  L+ASD++FGTNKLK+P      F S  K         P+F +
Sbjct  121   DWQLQQMIQFGSHSLMASDSKFGTNKLKHP-----CFRSAQKCNSCCVDYNPQFCT  171



>gb|EYU24925.1| hypothetical protein MIMGU_mgv1a022371mg, partial [Erythranthe 
guttata]
Length=337

 Score =   249 bits (636),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 194/330 (59%), Gaps = 7/330 (2%)
 Frame = -3

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIP  2101
             SL+ F+S   AIPVAWII+     ++  +W+ +L  R+  KD  W+    +VDDP  +  
Sbjct  5     SLLAFDSSQNAIPVAWIISSSSIGQNIHKWIPSLVERIRGKDTRWRPNAVLVDDPSFEAS  64

Query  2100  AIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFE  1921
              +RE FQC VL+  W VR  W K L+K C+  +V+  + K+LG +++    G   A+  E
Sbjct  65    ILREAFQCRVLLCLWHVRRGWLKGLLKYCNNFDVQREMFKQLGRILYCTRNGSSVADAVE  124

Query  1920  AFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNER  1741
              F++ FVD   F++YF++ W  ++ LW N +R LP+A QET A++E YH +LK ++L++ 
Sbjct  125   EFVQIFVDQYAFIEYFRSKWLSKIELWVNCVRTLPVAPQETIASIESYHLRLKSKVLSQD  184

Query  1740  DLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDV  1561
                  +R D+L+  L +  HS++W ++Y+ +  +    +D   S    W ++  IPD DV
Sbjct  185   S---DQRVDFLIHALTSQFHSFYWFEQYTVETGYFENLRDR-FSITNPWNQATHIPDIDV  240

Query  1560  TIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGS  1390
              +D E+   AKVV Q D ++ + IWNP SEFALCDC+ + +GN+C+HV K   + R R  
Sbjct  241   LLDEENLQLAKVVSQADNSVAYTIWNPGSEFALCDCSWSMVGNMCKHVIKVAIFCRSRQI  300

Query  1389  ATSSVSMFQYRQALIKMLHCPPYDSLIRDH  1300
             A   +S   YRQ L+ +L   P D L+ + 
Sbjct  301   ARPLLSAQVYRQTLVNLLQNLPEDPLVLEQ  330



>gb|AGZ89234.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89235.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89236.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89237.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89238.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89239.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89240.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89241.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89242.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89243.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89244.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89245.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89246.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89247.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89248.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89249.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89250.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89251.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89252.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89253.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89254.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89255.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89256.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89257.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89258.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89259.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89260.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89261.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89262.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89263.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89264.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89265.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89266.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89267.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89268.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89269.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89270.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89271.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89272.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89273.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89274.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89275.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89276.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89277.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89278.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89279.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89280.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89281.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89282.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89283.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89284.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
Length=135

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             M RWDEIL+LPVQNP  LEFS++DI WS VEGW+D++DR+ALIP++RV DFVRGES +KE
Sbjct  1     MTRWDEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNSKE  60

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKS  2857
             CPT+FHVEARRRR+   + KPKVDGILEYILYWCSFGPDD+R GG VRPSR++Y  +K  
Sbjct  61    CPTRFHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRMGGAVRPSRSSYGKRKTP  120

Query  2856  AGRPNTKRGCTCHFI  2812
             AGRPNTKRGC CHFI
Sbjct  121   AGRPNTKRGCVCHFI  135



>ref|NP_001169995.1| uncharacterized protein LOC100383900 [Zea mays]
 gb|ACN35472.1| unknown [Zea mays]
Length=395

 Score =   231 bits (590),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 180/303 (59%), Gaps = 6/303 (2%)
 Frame = -3

Query  2166  HTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTI  1987
               KD TW + GFI+DDP +++  IREVF C VL S W +R  W KN++K+CS +EV+  I
Sbjct  25    QAKDSTWGIGGFIIDDPASELGPIREVFACPVLFSMWHIRRTWLKNVIKKCSNVEVQREI  84

Query  1986  AKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLAS  1807
                LG+ I +I     P +      +DFVD   F+ YFK+ W P+L +W +++R LPLAS
Sbjct  85    FILLGKTICNIWSEKNPMDALGQLFQDFVDQTAFIKYFKSFWVPKLEMWIDSIRNLPLAS  144

Query  1806  QETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYW  1627
             QE+C A+E YH +LK++  ++  L   +R DWLV KL T +HS +W++ ++ +       
Sbjct  145   QESCGAIEGYHLKLKVKAYDDVQLDALQRVDWLVHKLTTELHSSYWINLFADESGSFPEV  204

Query  1626  KDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFALCDCNS  1456
             K ++I+  T+W+++LQIPD  VT D +    A+VV Q + +    +W+P SEF+LC+C+ 
Sbjct  205   KADYIAS-TSWQRALQIPDDAVTFDDKDPLVARVVSQKETSQTRTVWSPGSEFSLCNCSW  263

Query  1455  ANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDSLIRDHALSVAVWV  1276
             +  GNLC+HV K       R     S+S   ++  L+ +   P  DS   D  LSVA  +
Sbjct  264   SMQGNLCKHVLKVNMVCGARKDFQPSLSFQSFQHVLLDLWQKPLDDSFSLD--LSVARVM  321

Query  1275  QKQ  1267
             Q Q
Sbjct  322   QMQ  324



>gb|KHN38118.1| hypothetical protein glysoja_007160 [Glycine soja]
Length=299

 Score =   159 bits (401),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 128/234 (55%), Gaps = 43/234 (18%)
 Frame = -3

Query  2166  HTKDPTWKLAGFIVDDPLTDIPAIREVFQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTI  1987
             ++ +P WK+ GF++DD   +I  + +VF C VL S WRV  +W +N++K+CS +E++  I
Sbjct  100   YSVEPGWKVGGFLIDDTAAEIDLLSDVFCCPVLFSLWRVCRSWLRNIVKKCSNIEIQWEI  159

Query  1986  AKRLGEMIHSICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLAS  1807
              KRLG +++SI      +   E FM DFVD   F++YFK  W P L L            
Sbjct  160   FKRLGTIVYSIWGAINASLALEQFMLDFVDQTAFMEYFKVAWLPNLAL------------  207

Query  1806  QETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFARYW  1627
                                        +R DWLV KL T +HS  WLD Y+ + D  +  
Sbjct  208   ---------------------------QRVDWLVPKLTTELHSSCWLDWYADESDSFQNV  240

Query  1626  KDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIWNPSSEFA  1474
             K+++I+  T+W ++LQIPD  V++D ++   AKVV Q D ++ H++WNP SEFA
Sbjct  241   KEKYIAS-TSWHRALQIPDYAVSLDDKAHLFAKVVSQKDSSLTHIVWNPGSEFA  293


 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = -3

Query  3216  MARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKE  3037
             MA  + +  +P+Q+PP  EF ++D+ W+K  G  ++ D V  IPY RVD F+ GE +N E
Sbjct  1     MAIVESVGKIPLQDPPEEEFCAADLTWTKF-GNSEHHDEVPFIPYDRVDAFIIGECSNVE  59

Query  3036  CPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGPDDH  2914
             C T+FH+E  ++ T  +    K D  LEY LYWCSFGP+++
Sbjct  60    CTTRFHIERGKKPTIGSLKDYKDDEYLEYRLYWCSFGPENY  100



>ref|XP_003624419.1| hypothetical protein MTR_7g082990 [Medicago truncatula]
 gb|AES80637.1| zinc ion-binding protein [Medicago truncatula]
Length=113

 Score =   145 bits (365),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 61/77 (79%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  2448  SHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVV  2269
             + Q+++FFY+DFSDSDPF+LGIQTEWQLQQMI+FGN GLLASD+RFGTNKLKYP+HSL+V
Sbjct  32    NRQSNVFFYQDFSDSDPFILGIQTEWQLQQMIKFGNHGLLASDSRFGTNKLKYPVHSLLV  91

Query  2268  FNSDNKAIPVAWIIAPR  2218
             FNSD KAI VAWII P+
Sbjct  92    FNSDKKAILVAWIITPK  108



>ref|XP_010090843.1| hypothetical protein L484_020702 [Morus notabilis]
 gb|EXB40968.1| hypothetical protein L484_020702 [Morus notabilis]
Length=263

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 128/210 (61%), Gaps = 9/210 (4%)
 Frame = -3

Query  1845  LWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWL  1666
             +W + ++  PLASQE   A+E YH +LK++L ++  L   +R DWLV KL T +HS +WL
Sbjct  1     MWLSTMKTFPLASQEASGAIEAYHVKLKMKLFDDTHLRSLQRVDWLVHKLTTELHSSYWL  60

Query  1665  DEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIW  1495
             D Y+ + D  +  K+E+++  T+W ++LQIPD  VT+D  +   AKV+ Q D  +  ++W
Sbjct  61    DRYADESDSFQNIKEEYVAS-TSWHRALQIPDSAVTLDENARLFAKVLSQKDSGITRLVW  119

Query  1494  NPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDS  1315
             NP SEFA CDC  +  GNLC+HV K     +++  +  S+S   +++ L+ +   P  DS
Sbjct  120   NPGSEFAFCDCAWSLQGNLCKHVIKVNMICQNKQDSQPSMSFQSFKEILMNLWRKPMEDS  179

Query  1314  LIRDHALSVAVWVQKQLNSQIGQESVQVVG  1225
             +  D  LS+A W   Q+  QI Q+ V++ G
Sbjct  180   VGMD--LSMA-WTH-QMVDQI-QKLVELNG  204



>ref|XP_004291410.1| PREDICTED: uncharacterized protein LOC101296739 [Fragaria vesca 
subsp. vesca]
Length=120

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  3234  RNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRG  3055
             + H  +MAR ++IL+LPVQ+PP  EFS++ I W KV+G R   D +ALIPYARVDDFV+G
Sbjct  2     KGHDHKMARMEDILNLPVQDPPCAEFSAAHIKWVKVDGGRHGGDDIALIPYARVDDFVKG  61

Query  3054  ESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSFGP  2923
             ES N +CP  F +E++R+R   +  KP+VDG LEY LY C + P
Sbjct  62    ESLNADCPASFRIESKRKRAEGSVSKPRVDGYLEYTLYVCFYTP  105



>gb|KHN10140.1| hypothetical protein glysoja_023721 [Glycine soja]
Length=165

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -3

Query  2358  MIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRAL  2179
             MIR+G+R ++A+D+ FG  +LKYP+ +L+VF+S   A+PVAW+I   FA  D  +W++AL
Sbjct  1     MIRYGHRNVVAADSTFGAKRLKYPLFTLLVFDSRQHALPVAWVITRSFAKPDVSKWLKAL  60

Query  2178  YNRVHTKDPTWKLAGFIVDDPLTDI  2104
              ++  + +P WKL GF++DD   +I
Sbjct  61    IDQARSVEPGWKLNGFLIDDATAEI  85



>ref|XP_006855942.1| hypothetical protein AMTR_s00037p00218460 [Amborella trichopoda]
 gb|ERN17409.1| hypothetical protein AMTR_s00037p00218460 [Amborella trichopoda]
Length=210

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 96/202 (48%), Gaps = 21/202 (10%)
 Frame = -3

Query  3288  TPLPVRLN*HSEVQNPNSRNHQIQMARWDEILSLPVQNPPTLEFSSSDIVWSKVEGWRDN  3109
             T + V L+  S    PN  N    +     I SLPVQN     F SS + WS++   R  
Sbjct  11    TLIQVDLSIGSPFHRPNMEN---AVTNKSIIYSLPVQNNGEGYFDSSKLSWSQISE-RGK  66

Query  3108  IDRVALIPYARVDDFVRGESANKECPTKFHVEARRRRTAQTSYKPKVDGILEYILYWCSF  2929
             +  VA+IP+ RVDDFV GES +K+CPT F   + R++   T     +D     I Y CS+
Sbjct  67    VVDVAVIPFDRVDDFVNGESRHKKCPTNFFRRSTRKK--NTKMGKGID-----ITYMCSY  119

Query  2928  GPDDHRKGGVVRP--SRTTYVPKKKSAGRPNTKRG--------CTCHFIVKRLIAEPSVA  2779
             G  D+R     +   + +    +K      N ++         C C F + +L      A
Sbjct  120   GRKDYRPQSTEQELDAHSDAQVQKNVRSESNVRKRRRLGRKRGCLCTFTISQLPDSHMNA  179

Query  2778  LIIYNQDKHVDKKGLPCHGPQD  2713
             +I Y + +HVDK G PCHGP D
Sbjct  180   VIKYRERRHVDKNGWPCHGPDD  201



>ref|XP_003628102.1| Cellulose synthase [Medicago truncatula]
 gb|AET02578.1| cellulose synthase [Medicago truncatula]
Length=422

 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 92/180 (51%), Gaps = 31/180 (17%)
 Frame = -3

Query  1845  LWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTVHSYFWL  1666
             +W + +R +P+ASQE   ALE YH +LK +L +                           
Sbjct  71    MWLSTMRNVPVASQEASGALEAYHVKLKAKLFD---------------------------  103

Query  1665  DEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGES---AKVVDQGDKNMVHVIW  1495
             D + G  D  +  K+ +I+  T+W ++L+IPD  VT+D ++   AKV  + D ++ H++W
Sbjct  104   DSHLGALDSFQNVKEGYIAS-TSWHRALEIPDSAVTLDNKNRLFAKVASKKDSSLTHIVW  162

Query  1494  NPSSEFALCDCNSANMGNLCEHVFKSIKYLRDRGSATSSVSMFQYRQALIKMLHCPPYDS  1315
             NP SE + CDC+ +  GN+C+HV K      +     SS+S   + + L+ +L  P  DS
Sbjct  163   NPGSECSFCDCSWSLHGNVCKHVIKVNMICENLQGCQSSMSFRSFEEVLMDLLRKPVDDS  222



>gb|KDO36953.1| hypothetical protein CISIN_1g034580mg [Citrus sinensis]
Length=90

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = -3

Query  3198  ILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFH  3019
             +  + VQ+PP  +FSS D+ W+K  G  ++ D VALIPYARVD F+ GE +N ECPT+FH
Sbjct  7     LFDIQVQDPPEEDFSSIDLTWTKF-GTAEHHDEVALIPYARVDSFIIGECSNVECPTRFH  65

Query  3018  VEARRRRTAQTSYKPKVDGILEYIL  2944
             +E  R+R+  +  + K D  LEY L
Sbjct  66    IERGRKRSRGSLKEYKDDEYLEYRL  90



>gb|KFM22548.1| hypothetical protein F751_0052 [Auxenochlorella protothecoides]
Length=728

 Score = 86.7 bits (213),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 127/555 (23%), Positives = 212/555 (38%), Gaps = 56/555 (10%)
 Frame = -3

Query  3015  EARRRRTAQTSYK-PKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNT  2839
             EAR   TA T  K       +E   Y C +GP      GV      T  P +        
Sbjct  15    EARAHATAFTGNKLGPTKKFIEQTQYRCVYGPRTTSDKGVGCKREGTCHPDRGD----GL  70

Query  2838  KRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDL  2659
             K+GC   FIVK L  EPS   + +    H  ++  P     D+   G      P++S+  
Sbjct  71    KQGCKAWFIVKVLRQEPSTVEVHFLDAPHTGRRVYP---ELDRHVEG-----CPWVSKRA  122

Query  2658  RLRVLSLLYVGVSVET---IMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYEL  2488
             R  VL  L      +T   +     +S+ + G P     L         +       Y +
Sbjct  123   RQVVLDHLAKDPLTQTSSLVGLVQQDSLRQAGLPPGPRLLGVEANRLEMDYPDLFRDYHI  182

Query  2487  DADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFG  2308
              A D IS+ L +++     F +         +L  QT  QL+ ++++G++  +  D+  G
Sbjct  183   TAKD-ISLQLRIDAAPADYFGHLS-EGGRRTLLCWQTPRQLEILLKYGHKRAVFLDSTHG  240

Query  2307  TNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFI  2128
             TN+ ++ + SL+V +  +    V+  IA +        W+  +  R     P W+ +   
Sbjct  241   TNENRFELFSLMVLDDHHVTHTVSVAIAAQSTHGLIHHWLAGVVERA---GPAWRPSCVF  297

Query  2127  VDDPLTDIPAIREVFQCSVLISF--WRVRHAW--HKNLMKRCSEMEVRVTIAKRLGEMIH  1960
              D       AIR+ +   V I+   W + H W  H  L       E+R  + +     + 
Sbjct  298   TDQSRPQYMAIRDAWNDRVPIALCHWHLLHDWDRHHRLCTGIDYPELRRALVR-----VR  352

Query  1959  SICKGCEPANTFEAFM-------EDFVDAVEFVDYFKATW---YPRLGLWSNALRALPLA  1810
              +C   +PA    A                 FVDYF+  W   YP +  W    R    +
Sbjct  353   DLCLPWDPALARRAAEEALARVWRSHFPGQAFVDYFEQKWKTAYP-METWVAGFRTYNTS  411

Query  1809  SQETCAALEFYHNQLKLRLLNERDLSVYERADWL---VDKLGTTVHSYFWLDEYSGKDDF  1639
              Q +    E ++  LK RL      +   R D+L   ++ L    H+   L+    + + 
Sbjct  412   GQSSICCCEGWNATLKRRLGATHSTATGRRVDYLLQVLEDLCAEAHTKLQLNLRGKRHNK  471

Query  1638  ARYWKDEWISGLTAWRKSLQIP-DGDVTIDGESAKV----VDQGDKNMVHVIWNPSSEFA  1474
             AR      ++   A R++  +P D  V +  E   V       GD ++ H +   +S+  
Sbjct  472   ARK-----LAVRGACREARGVPRDAVVRLADEPGDVWTVRSQTGDPDLGHRV--DASQMH  524

Query  1473  LCDCNSANMGNLCEH  1429
              C C ++  G +CEH
Sbjct  525   GCSCLASTRGAVCEH  539



>ref|XP_003390496.1| PREDICTED: hypothetical protein LOC100636472 [Amphimedon queenslandica]
Length=1057

 Score = 86.3 bits (212),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 99/440 (23%), Positives = 177/440 (40%), Gaps = 48/440 (11%)
 Frame = -3

Query  2658  RLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELDAD  2479
             R+++ S L  GVS+  I+    +    QG    R+ L+  + ++  ER +  S  +   +
Sbjct  192   RVKIASQLRAGVSINNILDSIRDVSLDQGY--KREHLIVRQDIKNIERILNLSNIQKHTN  249

Query  2478  DAISISLWVESH----QNHIFFYK------------DFSDSDPFVLGIQTEWQLQQMIRF  2347
             D  S+++WV+       N +  +K            D  +   F+L IQTE+Q   M +F
Sbjct  250   DQTSVAIWVQEALTQPYNPVLVFKLQGRKDSVVGDTDNLEEKNFILAIQTEFQCDAMKKF  309

Query  2346  GNRG-LLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNR  2170
                G ++  DA  GTN   + + +++V +   + +PVAW I+ R  S    ++ + ++ R
Sbjct  310   ACNGRVVCVDATHGTNVYDFFLITVMVLDDYGEGVPVAWCISDREDSSVLSQFFKHMHER  369

Query  2169  VHTKDPTWKLAGFIVDDPLTDIPAIREVFQ--CSVLISFWRVRHAWHKNLMKRCSEMEVR  1996
             V    P +    F+ DD      A   VF      L+  W V  AW K +       E +
Sbjct  370   VGNIGPDY----FMSDDAEQYHTAWCGVFGPVKKKLLCIWHVDRAWKKAIHAHVPGDEQK  425

Query  1995  VTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVE-----FVDYFKATWYPRLGLWSNA  1831
               +   L  +++           F+  +   +   E     F +Y + T+  R   W+  
Sbjct  426   AEVYHMLRVLLNET-----SITDFQVLLSQAMSYFEEKHPRFYEYMRTTYATRSDQWATC  480

Query  1830  LRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTT----VHSYFWLD  1663
              R    AS  T  A+E +H  LK+  L  +      R D L+  L       +++Y   +
Sbjct  481   HRI--NASIGTNMAVEAFHRVLKIEYLQHKQ---NRRLDHLLHVLFKINRDLIYNYIRKE  535

Query  1662  EYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNMVHVIWNPSS  1483
             E   +       +    S +T   + + I       DG S KV  Q   +  +++   +S
Sbjct  536   EIGKRSHKLCEIRKRHCSAVTINERGIDIQSN----DGNSWKVKSQSTPDQWYIVEKIAS  591

Query  1482  EFALCDCNSANMGNLCEHVF  1423
                L      +  N+C H+F
Sbjct  592   ACNLSCKLRCDECNICTHMF  611



>gb|KFM69083.1| hypothetical protein X975_14697, partial [Stegodyphus mimosarum]
Length=783

 Score = 85.5 bits (210),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 99/439 (23%), Positives = 184/439 (42%), Gaps = 77/439 (18%)
 Frame = -3

Query  2991  QTSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPK----KKSAGRPNTKRGCT  2824
             ++S K K  G+ +   Y C      HR G         Y+PK    +    + + K GCT
Sbjct  117   KSSLKNKETGV-KLTYYTC------HRSG--------IYIPKEDRMRHLKAKGSIKSGCT  161

Query  2823  CHFIVK---RLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRL  2653
             C  I+    + + E +   ++Y Q KHV  +      P               +S++ + 
Sbjct  162   CPAIINVSAQTVNEATEIKVVY-QSKHVGHELEVGKLP---------------LSKEEKS  205

Query  2652  RVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIR-RSTYELDADD  2476
              + S L++G+ +  I+ +      ++  P  R  L T + +   ++  +      L  DD
Sbjct  206   NLASSLHLGIPMSKILDK----TRKKYSPTKRYGLTTRKDLHNIQKEFKIEKNIMLHEDD  261

Query  2475  AISISLWVESHQ----NHIFFYK-------DFS--DSDPFVLGIQTEWQLQQMIRFGNRG  2335
             A S+ + V+  Q    N +  YK       DF     + F+LGI  E Q Q+++      
Sbjct  262   ATSVDITVKKLQDGECNSVLVYKQVGKVLEDFPAIQKEEFLLGIMNEPQ-QKLLELYGSD  320

Query  2334  LLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKD  2155
              +  D+  GTN+  + + ++ V + +++ +P+A + + R A++  + +  A+  R+    
Sbjct  321   CIMIDSTHGTNQYGFQLSTVTVHDENHEGLPIAVLFSTRTAADTFIPFFNAIKKRI----  376

Query  2154  PTWKLAGFIVDDPLTDIPAIREVFQCSV--LISFWRVRHAWHKNLMKRCSEMEVRVTIAK  1981
             P  K   F+ DD  +   A + VF+ S   L+  W +   W+  +  +      +  I  
Sbjct  377   PNMKTKVFMSDDTNSYYNAWQAVFEDSSRHLLCTWHINKNWNFQINSKVKNKTNKENIKI  436

Query  1980  RLGEMIHSICKGCEPANTFEAFMEDFVDAVE-----FVDYFKATWYPRLGLWSNALR-AL  1819
              L ++I  +        TFE  M +F+   E     F++YFK  +  R   W+   R  L
Sbjct  437   ELKKIITEV-----DVITFERLMSNFISTFEDKEKNFIEYFKTNYEKRTEKWAYCHRVGL  491

Query  1818  PLASQETCAALEFYHNQLK  1762
              +    T   +E +H QLK
Sbjct  492   GI---NTNMKIERWHRQLK  507



>gb|EYU23542.1| hypothetical protein MIMGU_mgv1a019642mg [Erythranthe guttata]
 gb|EYU41892.1| hypothetical protein MIMGU_mgv1a017160mg [Erythranthe guttata]
Length=90

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = -3

Query  3204  DEILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTK  3025
             + I +L VQ+PP  +FSS+D+ W K  G  +  D VALIPY RVD F+ GE +  ECPT+
Sbjct  5     ESIDNLQVQDPPGEDFSSADLEWVKF-GTAERCDDVALIPYDRVDAFIIGECSCVECPTR  63

Query  3024  FHVEARRRRTAQTSYKPKVDGIL  2956
             FH+E  R+R   +  + K DG+ 
Sbjct  64    FHIERGRKRARGSLKQCKNDGVC  86



>gb|EYU40888.1| hypothetical protein MIMGU_mgv1a018026mg [Erythranthe guttata]
Length=90

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = -3

Query  3198  ILSLPVQNPPTLEFSSSDIVWSKVEGWRDNIDRVALIPYARVDDFVRGESANKECPTKFH  3019
             I +L VQ+PP  +FSS+D+ W K  G  +  D VALIPY RVD F+ GE +  ECPT+FH
Sbjct  7     IDNLQVQDPPGEDFSSADLEWVKF-GTAERCDDVALIPYDRVDAFIIGECSCVECPTRFH  65

Query  3018  VEARRRRTAQTSYKPKVDGIL  2956
             +E  R+R   +  + K DG+ 
Sbjct  66    IERGRKRARGSLKQCKNDGVC  86



>ref|XP_003388723.1| PREDICTED: hypothetical protein LOC100638179, partial [Amphimedon 
queenslandica]
Length=835

 Score = 79.3 bits (194),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 75/313 (24%), Positives = 134/313 (43%), Gaps = 33/313 (11%)
 Frame = -3

Query  2577  QGGPCNRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNH------IFFYK-  2419
             +G    R +L+  + +            +  ++D  S+ LWV++ Q+       +  +K 
Sbjct  137   EGAEIGRSELINRQDIHNIRHQYNIEGIQYHSNDHSSVQLWVDNLQSDSEDESVVLLFKE  196

Query  2418  ----------DFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVV  2269
                       DFS SD F LGIQT +Q   +IRFG   +   D+  GTN   + + +++V
Sbjct  197   QGVEQSNDLNDFSVSD-FALGIQTCFQKDMLIRFGKEAICI-DSTHGTNIYDFYLITVLV  254

Query  2268  FNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIRE  2089
              +   + IPVAW+I+ R   ED    +   ++++  +        F+ DD        + 
Sbjct  255   LDDYKEGIPVAWLISNR---EDAA-VLNQFFSKLKVRCGDISTDVFMSDDADNFFNGWKG  310

Query  2088  VFQCS---VLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGC--EPANTF  1924
             VF  S    LI  W V  +W K L    S    +  +   L  ++    +    +    F
Sbjct  311   VFTVSNTRKLICSWHVDRSWRKGLHTHISVKSKQAEVYHHLRVLLSETSEAVFRQRLQQF  370

Query  1923  EAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNE  1744
              +++ +  D V F+ YF+  +  R+  W+   R+    +  T  ALE +H  LK+  L +
Sbjct  371   LSWLRNDADLVTFLQYFEGNYMQRIKQWAPCYRSSTTVN--TNMALESFHRVLKVCYLQK  428

Query  1743  RDLSVYERADWLV  1705
             +      R D+L+
Sbjct  429   KQ---NRRIDYLL  438



>ref|XP_003390653.1| PREDICTED: hypothetical protein LOC100639460 [Amphimedon queenslandica]
Length=513

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/274 (24%), Positives = 121/274 (44%), Gaps = 40/274 (15%)
 Frame = -3

Query  2481  DDAISISLWVESHQNH------IFFYK-----------DFSDSDPFVLGIQTEWQLQQMI  2353
             +D  S+ +WVE+ ++       +  YK           DFS SD F +GIQT +Q   ++
Sbjct  15    NDHCSVHMWVENAKSKADIPSPVLLYKQQDVKQIDELNDFSKSD-FAIGIQTTFQRDMLM  73

Query  2352  RFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYN  2173
             +FG+  +   D+   TN   + + +++V +   + +PV W+I+ R   ED    +R    
Sbjct  74    KFGSEAI-CMDSTHSTNVYDFCLVTILVLDDFGEGVPVGWMISNR---EDAAA-LRQFLL  128

Query  2172  RVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSV---LISFWRVRHAWHKNLMKRCSEME  2002
             +V       +   F+ DD      A + +F  S    LI  W +   W K + +  +   
Sbjct  129   KVRNVCGDIQTKVFMSDDADNFYNAWKSIFTVSKTKKLICAWHIDKTWRKGVQEHITVKS  188

Query  2001  VRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFV-------DAVEFVDYFKATWYPRLGL  1843
              +  +   L  ++  + KG     TF   ++ F+       D + F+DYF+  + P++  
Sbjct  189   KQAEVYHHLRVLLEEVTKG-----TFHLRLQQFISWLSNDDDLLAFLDYFRKQYVPKIEQ  243

Query  1842  WSNALRALPLASQETCAALEFYHNQLKLRLLNER  1741
             W+   R     +  T  A+E +H  LK+  L ++
Sbjct  244   WAPCYRGATTVN--TNMAIESFHRLLKVCYLEKK  275



>emb|CEG00893.1| Peptidase C48, SUMO/Sentrin/Ubl1 [Ostreococcus tauri]
Length=621

 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/270 (24%), Positives = 123/270 (46%), Gaps = 37/270 (14%)
 Frame = -3

Query  2400  PFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAP  2221
             PF+L + +  Q + + ++GN+  +  D+ F   + K+   +L+  + D   +P A+ I  
Sbjct  237   PFILVLMSPAQERLLWKYGNQRCIQMDSTFNITRSKFSTFTLIARHPDGFYMPCAFFITS  296

Query  2220  RFASEDTVRWMRALYNRVHTKDP--TWKLAGFIVDDPLTDIPAIREVF-QCSVLISFWRV  2050
                 E  V  ++ + +R+  K P  TW  + F+VD    +  AI +VF +  VL   + V
Sbjct  297   DERQETIVYCLQVIRDRIKRKYPGGTWCPSTFMVDCCWAETNAIEQVFPKARVLWCQFHV  356

Query  2049  RHAWHKNLMKRCSEME-VRVTIA------KRLGEMIHSICKGCEPANTFEAFMEDFVDAV  1891
               A+++N+  + +E + V+V+IA       ++ +M+  + K  E     +A+ + +   +
Sbjct  357   FQAFNRNITSKLAEKQGVQVSIAISPKERGQIKKMLWKLVK--ETFKDDDAWDKAYTSVL  414

Query  1890  EFVD-----------------------YFKATWYPRLGLWSNALRA-LPLASQETCAALE  1783
             EF D                       Y +  W     LW+   R+ L   +QET  ++E
Sbjct  415   EFCDHKQKEIDKQFGDASWTTWRSFRKYLETQWGRHRKLWARHFRSGLTYGTQETTGSIE  474

Query  1782  FYHNQLKLRLLNERDLSVY-ERADWLVDKL  1696
              +H + K RL+ +    +   R DWL+  L
Sbjct  475   SFHGRWKARLIADGKGDIRCRRMDWLIHHL  504



>ref|XP_003074723.1| Protease, Ulp1 family (ISS) [Ostreococcus tauri]
Length=656

 Score = 72.0 bits (175),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/270 (24%), Positives = 123/270 (46%), Gaps = 37/270 (14%)
 Frame = -3

Query  2400  PFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAP  2221
             PF+L + +  Q + + ++GN+  +  D+ F   + K+   +L+  + D   +P A+ I  
Sbjct  316   PFILVLMSPAQERLLWKYGNQRCIQMDSTFNITRSKFSTFTLIARHPDGFYMPCAFFITS  375

Query  2220  RFASEDTVRWMRALYNRVHTKDP--TWKLAGFIVDDPLTDIPAIREVF-QCSVLISFWRV  2050
                 E  V  ++ + +R+  K P  TW  + F+VD    +  AI +VF +  VL   + V
Sbjct  376   DERQETIVYCLQVIRDRIKRKYPGGTWCPSTFMVDCCWAETNAIEQVFPKARVLWCQFHV  435

Query  2049  RHAWHKNLMKRCSEME-VRVTIA------KRLGEMIHSICKGCEPANTFEAFMEDFVDAV  1891
               A+++N+  + +E + V+V+IA       ++ +M+  + K  E     +A+ + +   +
Sbjct  436   FQAFNRNITSKLAEKQGVQVSIAISPKERGQIKKMLWKLVK--ETFKDDDAWDKAYTSVL  493

Query  1890  EFVD-----------------------YFKATWYPRLGLWSNALRA-LPLASQETCAALE  1783
             EF D                       Y +  W     LW+   R+ L   +QET  ++E
Sbjct  494   EFCDHKQKEIDKQFGDASWTTWRSFRKYLETQWGRHRKLWARHFRSGLTYGTQETTGSIE  553

Query  1782  FYHNQLKLRLLNERDLSVY-ERADWLVDKL  1696
              +H + K RL+ +    +   R DWL+  L
Sbjct  554   SFHGRWKARLIADGKGDIRCRRMDWLIHHL  583



>ref|XP_793556.3| PREDICTED: uncharacterized protein LOC588798, partial [Strongylocentrotus 
purpuratus]
Length=422

 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 81/326 (25%), Positives = 137/326 (42%), Gaps = 34/326 (10%)
 Frame = -3

Query  2673  ISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTY  2494
             +S   R+ V   L  GVS + I+    ES+        R  L+T + +R  ERS+     
Sbjct  98    LSATERVDVAQKLAQGVSFDRILDDIRESLST---TLERQHLITRQDIRNIERSLGLQGI  154

Query  2493  ELDADDAISISLWV-----ESHQNHIFFYK-----------DFSDSDPFVLGIQTEWQLQ  2362
                 DDA S+ +WV     +   N +  YK           D  ++D FVLGI T  Q +
Sbjct  155   RRHNDDATSVDMWVKEMRDQGDSNPVLLYKGQGSPCPEELDDLGEND-FVLGIMTPIQKE  213

Query  2361  QMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRA  2182
              ++ FG + ++  D+  GTN   + + +++V +   +  PVAW I+ R        +++ 
Sbjct  214   MLLSFG-KHVVCMDSTHGTNAYDFSLVTVLVVDEFGEGFPVAWCISNREDRAVLTGFLQK  272

Query  2181  LYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVF--QCSVLISFWRVRHAWHKNLMKRC-S  2011
             + + V   + +W ++    DD      +   VF  +   L+  W V  AW   L      
Sbjct  273   IRDVVGQLETSWLMS----DDAEQFFNSWISVFTHRPRKLLCTWHVDRAWRGALRSHIPG  328

Query  2010  EMEVRVTIAKRLGEMIHSICKG---CEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLW  1840
               E++  + K LG ++    +       +     FMED      F +YF   +  R   W
Sbjct  329   NAELQSAVYKTLGVLLEETDEAKFELLLSRVTSDFMEDET-TRRFGEYF-VLYADRKRQW  386

Query  1839  SNALRALPLASQETCAALEFYHNQLK  1762
             +   R  P A+  T   +E +H+ LK
Sbjct  387   AVCFRK-PGANINTNVYVEAFHHTLK  411



>ref|XP_003391041.1| PREDICTED: hypothetical protein LOC100636384, partial [Amphimedon 
queenslandica]
Length=567

 Score = 71.2 bits (173),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 142/336 (42%), Gaps = 47/336 (14%)
 Frame = -3

Query  2673  ISEDLRLRVLSLLYVGVSVETIMQRHNESVERQG--GPCNRDDLLTHRYVRRQERSIRRS  2500
             I E ++L + + L  GV ++ I+    + +   G  GP   + LL+ + +   +R +   
Sbjct  113   IPESVKLNIAAKLQQGVPIDRILDDMRDRMSNDGASGP---ELLLSKQDIHNLKRLLNLQ  169

Query  2499  TYELDADDAISISLWVES----HQNHIFFYK-----------DFSDSDPFVLGIQTEWQL  2365
                  ++D  S   WVE     H N +  +K           D +  D F+L IQTE+Q 
Sbjct  170   GIMKHSNDYESTCAWVEELKAKHYNPVIVFKPQGKEQTGSVNDLA-KDDFLLAIQTEFQK  228

Query  2364  QQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR  2185
               + ++GN  ++  DA  GT +  + + S++V +     +PVAW ++ R  S   ++++ 
Sbjct  229   DALQQYGN-NVIMMDATHGTTQYNFLLISILVIDDHGTGLPVAWAVSNREDSMLLMQFLI  287

Query  2184  ALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVF---QCSVLISFWRVRHAWHKNLMKRC  2014
              +  RV +  P +    F+ D       A    F       L+  W V  AW K+L    
Sbjct  288   VVNERVGSLTPKY----FMSDCAEQYFTAWCGTFGHNNTQKLVCIWHVDRAWRKSLQTHV  343

Query  2013  SEMEVRVTIAKRLGEMIHSIC---KGCEPANTFEAFMEDFVDAV-----EFVDYFKATWY  1858
             +  + RV       E+ H +C   +  + +N F   ++  +  +     EF +YF   + 
Sbjct  344   NSQQNRV-------EIYHHLCVLLRETDQSN-FILKLQQLMSYLHENHHEFFEYFNTYYV  395

Query  1857  PRLGLWSNALRALPLASQETCAALEFYHNQLKLRLL  1750
             P    W+   R   + +    A  E +H  LK+  L
Sbjct  396   PHKEEWATCFRIGTIVNTNMFA--ESFHRLLKVVYL  429



>gb|EIE89847.1| hypothetical protein RO3G_14558 [Rhizopus delemar RA 99-880]
Length=290

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 101/229 (44%), Gaps = 42/229 (18%)
 Frame = -3

Query  2484  ADDAISISLWVESHQNHIFF-YKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFG  2308
             ++D  SI LWV++ +   FF    F ++ PF+L   + WQ +            S    G
Sbjct  84    SNDKESIKLWVDTLKQEGFFSLIRFHENGPFLLSWVSFWQKK-----------VSPTVVG  132

Query  2307  TNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFI  2128
             +     PI S        K++PV + I        + +W+ +L +       T KL   I
Sbjct  133   S-----PITS--------KSVPVCFFITDHEVLSTSEQWLTSLKSTF-----TLKLKKII  174

Query  2127  VDDPLTDIPAIREVF--QCSVLISFWRVRHAWHKNLMK-----RCSEM--EVRVTIAKRL  1975
             +D  LT++ AIR VF     VL+  W ++ AW  ++ K     + +E    VR  +   L
Sbjct  175   IDCSLTEVGAIRSVFGDAVQVLLCHWYIKRAWETHIKKDIEVNKATEQSENVRSAVRTSL  234

Query  1974  GEMIHSICKGCEPAN-TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNA  1831
               M+++  K CE  + +   F   + + + FVDYF   W P+   WS A
Sbjct  235   NSMMYA--KSCEEFDLSVSLFNLKYKENISFVDYFNKLWVPKKQRWSQA  281



>ref|XP_008189988.1| PREDICTED: uncharacterized protein LOC103311925 [Acyrthosiphon 
pisum]
Length=608

 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 116/270 (43%), Gaps = 42/270 (16%)
 Frame = -3

Query  2496  YELDADDAISISLWVE----SHQNHIFFYKDFS------DSDPFVLGIQTEWQLQQMIRF  2347
             Y+L   DA+S  L V+    S  N I FYK         D D F+L I TE Q   + +F
Sbjct  181   YKLHDIDALSADLQVKRFANSSSNPIVFYKTQGTEYPPLDLDDFMLIILTETQKAVLHKF  240

Query  2346  GNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRV  2167
              N G L  D+  GTN+  + + ++VV +   +  P A+ I+ +    D V  M+  ++++
Sbjct  241   SN-GKLCIDSTHGTNQYNFNLTTIVVIDEFGEGYPAAFCISTKI---DEVH-MKVFFSKI  295

Query  2166  HTKDPTWKLAGFIVDDPLTDIPAIREVFQCSV-------LISFWRVRHAWHKNLMKRCSE  2008
                   +    F+ DD    +PA    +   +       L+  W + + W KNL K    
Sbjct  296   KEVMGCFTPNVFMSDD----VPAFWNAWINIMWPIPQHRLLCKWHIDNNWRKNLKKISGS  351

Query  2007  MEVRVTIAKRLGEMIHSICKGCEPANT-FEAFMEDFVDAVE-------FVDYFKATWYPR  1852
               V+  + K L  ++       EP  T FE  +  F+  +E       F  YF+ T+  R
Sbjct  352   QNVKAYVYKTLRVLLE------EPNETQFEELLNSFLSKLEEEPALHNFKTYFERTYVHR  405

Query  1851  LGLWSNALRALPLASQETCAALEFYHNQLK  1762
               LW+   R   + +  T   LE +H  LK
Sbjct  406   KKLWAACYRHQVMLN--TNMVLEAFHKTLK  433



>ref|XP_008183964.1| PREDICTED: uncharacterized protein LOC103309676 [Acyrthosiphon 
pisum]
Length=798

 Score = 68.6 bits (166),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 88/384 (23%), Positives = 152/384 (40%), Gaps = 49/384 (13%)
 Frame = -3

Query  2742  KGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPC  2563
             + L   G     A  T  M    +SE+L  +V      GV  +TI+ +  ES+       
Sbjct  169   RKLKSQGSNKINATCTAQMV---VSENLDGKVKE----GVPFDTILDQIRESINDMYVD-  220

Query  2562  NRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVE-----SHQNHIFFYKDFS----  2410
             N    L  R +    R  +        +D IS+ LWVE     + +N + +YK+ S    
Sbjct  221   NALVCLGKRDIWNIRRDFQLHKGRQHTNDFISVKLWVEKVQGLNEKNPVLYYKEQSQEKI  280

Query  2409  --------DSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDN  2254
                     +    +L I  ++QL  + +FGN  ++  D+  GTN   + + +L+V +   
Sbjct  281   NYSANKVQEDGNIMLVIANDFQLSMLEKFGN-DIICIDSTHGTNIYDFHLTTLLVVDEFG  339

Query  2253  KAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCS  2074
               IP A+ I+ +   +DT  W+   + ++  +        F+ D   +   A R V + +
Sbjct  340   NGIPTAFCISNK---KDTATWV-TFFEKLRDRGIFLHPKVFMSDIDDSFYNAWRTVMKSA  395

Query  2073  V--LISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFV  1900
                L+  W V  AW  NL ++    E R  + K L +++          + F   +E F+
Sbjct  396   EKRLLCTWHVDKAWRTNLQEKIKIQEKRALVYKGLRDLLQET-----NVDKFFKLVEGFL  450

Query  1899  -------DAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNER  1741
                    D  EF  YF   +  R+  W+   R     +  T   LE +H   K   L  R
Sbjct  451   VDTYSDDDTKEFASYFNNFYMKRVNEWAYCYRKGSFIN--TNMYLESFHKVFKYYYLEGR  508

Query  1740  DLSVYERADWLVDKLGTTVHSYFW  1669
                  +R D  +D L   +   ++
Sbjct  509   K---NKRLDTCIDALLKLIRDQYF  529



>gb|EIE76341.1| hypothetical protein RO3G_01045 [Rhizopus delemar RA 99-880]
Length=408

 Score = 67.0 bits (162),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 73/265 (28%), Positives = 110/265 (42%), Gaps = 53/265 (20%)
 Frame = -3

Query  2484  ADDAISISLWVESHQNHIFF-YKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFG  2308
             ++D  SI L V++ +   FF    F ++ PF+L   + WQ                    
Sbjct  28    SNDKESIKLCVDALKQEGFFSLLRFHENGPFLLSWVSPWQ--------------------  67

Query  2307  TNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFI  2128
               K + PI         NK +PV + I  R       +W+  L +       T K+   +
Sbjct  68    --KKRSPI--------TNKGVPVCFFITDREVLSTLEQWLTWLKSTF-----TLKVKKIM  112

Query  2127  VDDPLTDIPAIREVF--QCSVLISFWRVRHAWHKNLMK--------RCSEMEVRVTIAKR  1978
             +D   T+I AIR VF     VL+  W ++ AW  ++ K        + SE  VR  +   
Sbjct  113   IDCSPTEIGAIRSVFGDAVQVLLCHWHIKRAWETHIKKDIKVDKATKQSE-NVRSAVRAS  171

Query  1977  LGEMIHSICKGCEPAN-TFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQE  1801
             L  M+++  K CE  + +   F   + +   FVDYF   W P+   WS A      AS  
Sbjct  172   LNSMMYA--KSCEEFDLSVSLFNIKYKEYTSFVDYFNKLWVPKKQNWSQAWSQ--EASFH  227

Query  1800  TCAALEFYHNQLK-LRLLNERDLSV  1729
             T   +E YHNQ+K   L   R+L V
Sbjct  228   TNNLIESYHNQIKSFYLGRSRNLRV  252



>gb|KHJ95183.1| hypothetical protein OESDEN_04875 [Oesophagostomum dentatum]
Length=854

 Score = 67.8 bits (164),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 120/284 (42%), Gaps = 32/284 (11%)
 Frame = -3

Query  2487  DADDAISISLWVESHQ--NHIFFYKDFSDS--DPFVLGIQTEWQLQQMIRFGNRGLLASD  2320
             D +D +S+ + + S    +    Y   S++  D F L I    Q Q M  F  RG+   D
Sbjct  247   DNNDILSLEMRIASKNEGDGFLHYSPASNATGDGFCLVIMNSLQEQWMRDFAWRGIGIDD  306

Query  2319  ARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKL  2140
               F        + +++V N+ +K++P A++++ R +  +    +  L+  +  K PT+  
Sbjct  307   T-FNITLYHLRLATIIVANNCDKSLPAAFLLSFRMSQAE----LELLFLEIKKKIPTFAP  361

Query  2139  AGFIVDDPLTDIPAIREVFQCSV---LISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE  1969
               F+ DD      A  ++F  S    L+  W V+ A  KN  K+   ++V   +   L  
Sbjct  362   RYFMSDDASAFFNAYTKIFPGSATRKLLCSWHVQRAIRKNAAKKL--IKVCTNLKDELMR  419

Query  1968  MIHSICKGCEPANTFEAFMEDFVDAVEF---------VDYFKATWYPRLGLWSNALRALP  1816
              I + C     + + E F + + D + F         VDY  A W PR+  WS   R   
Sbjct  420   RISATCN----SPSLEEFSKRYGDTLTFLMSHGENEMVDYTHAYWTPRIEEWSCHCRK--  473

Query  1815  LASQETCAALEFYHNQLKLRLLNERDLSVYERADWLVDKLGTTV  1684
              A   T    E +H +LK  +   +      R D LVD L + V
Sbjct  474   GAVMHTSMLCERWHRRLKREIFCSK---TKIRVDELVDSLISAV  514



>ref|XP_002585982.1| hypothetical protein BRAFLDRAFT_110252 [Branchiostoma floridae]
 gb|EEN41993.1| hypothetical protein BRAFLDRAFT_110252 [Branchiostoma floridae]
Length=633

 Score = 67.0 bits (162),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 92/433 (21%), Positives = 174/433 (40%), Gaps = 54/433 (12%)
 Frame = -3

Query  2916  HRKGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLI-AEPSVALIIYNQDKHVDKK  2740
             HR G    P+R   + +K+ A +        C F V+ ++ A+ ++ + IY    H +  
Sbjct  166   HRSGA---PTRKRTIKRKRQASKK-----VGCKFRVRAVVPADTTLPVQIYLHGMHTN--  215

Query  2739  GLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCN  2560
                 H P     +     + P + E ++      L  G+S++  +     ++    G   
Sbjct  216   ----HTP----GSAEDQRWLP-VDERVQCIATDCLDAGLSIQKTVNIIQTAL--TSGTVG  264

Query  2559  RDDLLTHRYVRRQERSI-----RRSTYELDADDAISISLWVESHQNH---IFFYK-DFSD  2407
               D   +R +  ++  +     RR    L  +D +S    +E +Q     +FF K D  +
Sbjct  265   EVDRCRYRELPTRKELVCLQYERRRQNRLTDNDWLSTYQKLEEYQAQGKCLFFQKYDDKE  324

Query  2406  SDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWII  2227
             + PFV  +QTEWQ +   RF      + D+ FG N   +P+++  V N + + IP+ +++
Sbjct  325   NRPFVAVLQTEWQQKMAERFSPNSAWSVDSTFGLNTFGFPLYAATVPNQNGEGIPIFFLL  384

Query  2226  APRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAI-------------REV  2086
                         + A +  V  K    +    ++D  LT+   I              + 
Sbjct  385   TSAENGPQEEIGLEAGFKAVFQKLQV-RPNAIVIDKSLTEKKGIWNAVKDDPLSWEGGQQ  443

Query  2085  FQCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGE-MIHSICKGCEPANTFEAFME  1909
              +  +L+ ++  + AW +NL+ R   ++V   +  RL   M+ +  +  E     E  + 
Sbjct  444   VKRRMLLCWFHTKKAWTENLLPRLP-VDVAAQVYDRLCTVMMATTWEKYEEEK--EQLIA  500

Query  1908  DFVDAVEFVDYFKATWYPR--LGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDL  1735
             DF    + +  +   W     L +W  A R  P  +Q+T   +E     +K  +L   D 
Sbjct  501   DFKPQSKVIVQYLKGWDCEEWLSMWVRAGRMFPHGNQDTTNLVEREWMTIKYTIL---DG  557

Query  1734  SVYERADWLVDKL  1696
                 R D L+D L
Sbjct  558   KANHRVDRLLDAL  570



>ref|XP_008475837.1| PREDICTED: uncharacterized protein LOC103512829 [Diaphorina citri]
Length=559

 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 80/342 (23%), Positives = 147/342 (43%), Gaps = 36/342 (11%)
 Frame = -3

Query  2406  SDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWII  2227
             SD F+ G QT+ Q + MI  G   +L  D    TN+  Y + +++V +++    PVA +I
Sbjct  52    SDVFMFGFQTKEQQKLMIE-GCEHILVVDETHCTNQYDYLLLNMLVVDANRNGWPVAHLI  110

Query  2226  APRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSV--LISFWR  2053
             A + + E+T   ++  ++ ++ K P  ++   I DD    I ++   FQ  +  L+  W 
Sbjct  111   ASK-SDENT---LKHFFSALNEKCPNLEINCVITDDDPKLINSMNAGFQTELRHLLCKWH  166

Query  2052  VRHAWHKNLMKRCSEMEVRVTIAKRLGEMI--HSICKGCEPANTFEAFMEDFV-----DA  1894
             +   + K L ++  +  V         EM     I      +NTF    + F+      A
Sbjct  167   LFKTFRKQLGEKAPKHLV--------DEMFVGLKILVNTRNSNTFGELSQAFIAKYNPTA  218

Query  1893  VEFVDYF-KATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLNERDLSVYERA  1717
              +F++YF K     R+  W    R     S +T   +E +H +LK   ++ +     +R 
Sbjct  219   PKFIEYFLKYLEDGRVQKWPMCYRNFAHQSVDTTGHVESFHRRLKNDYMHRKP---NKRV  275

Query  1716  DWLVDKLGTTVHSYFWLDEYSGKDDFARYWKDEWISGLTAWRKSLQIPDGDVTIDGESAK  1537
             D L++ L        W  +   K+ F      + +S      K + IPD DV    ++  
Sbjct  276   DKLIEMLLVIASDDSW--KRKRKETFGLVQSLKSLSH----EKGIAIPDTDVHYLVDNIW  329

Query  1536  VVDQGDKNMVHVIWNP----SSEFALCDCNSANMGNLCEHVF  1423
              +     ++ H +       +S+  +  C SA+  NLC H++
Sbjct  330   EIKSSQPDVPHEVVRLCEVCTSDHCIIKCTSASCINLCSHMY  371



>gb|KFM78090.1| hypothetical protein X975_08556, partial [Stegodyphus mimosarum]
Length=194

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/191 (26%), Positives = 83/191 (43%), Gaps = 8/191 (4%)
 Frame = -3

Query  2334  LLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKD  2155
             +L  D+   TN+  + + +L+V +      PVA  I   F   DT   +  L+N +  + 
Sbjct  9     ILCIDSMHKTNQYDFYLINLIVPDEFGCGYPVAHFIT-NFLDADT---LYCLFNSLKCRV  64

Query  2154  PTWKLAGFIVDDPLTDIPAIREVFQCSV--LISFWRVRHAWHKNLMKRCSEMEVRVTIAK  1981
             P   +   + DD     PA   VF  +V  L+  W VR +W + L  +  + EVR  +  
Sbjct  65    PNLYVNCVMTDDDKGTYPAFSRVFGQNVKHLLCSWHVRQSWFRQLNSKVVDKEVRQKVLG  124

Query  1980  RLGEMIHSICKGCEPANTFEAFMEDFV-DAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
              L +++H         +    F  D+   + +F++YF   +  RL  W+   R  P A  
Sbjct  125   ELTKILHER-NQITFYDQISKFFNDYSGKSRDFIEYFSENYKNRLEEWALCYRNFPHAFT  183

Query  1803  ETCAALEFYHN  1771
             +T    E +HN
Sbjct  184   DTNVYCESFHN  194



>ref|XP_002416515.1| conserved hypothetical protein [Ixodes scapularis]
 gb|EEC20432.1| conserved hypothetical protein [Ixodes scapularis]
Length=505

 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 74/309 (24%), Positives = 124/309 (40%), Gaps = 35/309 (11%)
 Frame = -3

Query  2628  GVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYE-LDADDAISISLWV  2452
             GV ++ IM+    S+    GP     LL    V   +R    +  E    DD  S+ +W 
Sbjct  45    GVPIKVIMKDIRTSI---SGPLRPLHLLERPQVHNIKRQFNITYSERCHQDDHTSVGMWA  101

Query  2451  ESHQNH----IFFYKDFSDSDP--------FVLGIQTEWQLQQMIRFGNRGLLASDARFG  2308
             ++  +     +  +K    +DP        F L + TE Q + + + G   +   D+  G
Sbjct  102   QAMMSQDNSLVKLFKQQGMADPTGQLSERDFALVLMTEPQQELLQKLGTDKI-CIDSTHG  160

Query  2307  TNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFI  2128
             T    + + +L+V +     +P A++++ R    DT+  M+  +  V           F+
Sbjct  161   TTGYDFLLTTLLVVDEFGSGVPCAYLLSNR---ADTI-MMKIFFEAVREAVGVISAKVFM  216

Query  2127  VDDPLTDIPAIREVFQCS--VLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSI  1954
              DD L    A   V   +   L+  W V   W  N+ K     E+  ++ K +  ++   
Sbjct  217   SDDALEFYNAWSAVMSPAERQLLCTWHVDKNWKLNIRKLVEGQELMASVYKAVRVLLE--  274

Query  1953  CKGCEPANTFEAFMEDFVDAVE-----FVDYFKATWYPRLGLWSNALRALPLASQETCAA  1789
                C+    FE  ++ FVD  +     F+DYFKA +  R  LW+   R    A   T   
Sbjct  275   ---CQDQEEFEELLKAFVDCKDPSLKLFLDYFKAHYAKRPHLWAFCYR--KGAGINTNMY  329

Query  1788  LEFYHNQLK  1762
             LE  H  LK
Sbjct  330   LEAMHKTLK  338



>ref|XP_004211156.1| PREDICTED: uncharacterized protein LOC101241630 [Hydra vulgaris]
Length=465

 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 85/381 (22%), Positives = 155/381 (41%), Gaps = 65/381 (17%)
 Frame = -3

Query  2904  GVVRPSRTTYVPKKKSAGR---PNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGL  2734
             G  +P R+   P +K+  R    + K G  C          P+  ++  N +   + + +
Sbjct  110   GHSKPHRSVSEPARKTNKRYYRGSVKSGAFC----------PARMIVKVNINGVTNVQYI  159

Query  2733  PCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRD  2554
               H   +     T  MY P I  +++  + + L +GV V T+ +   ES    G   NR+
Sbjct  160   KTH---NHSIGITNTMYQP-IPGNIKKNISAKLSIGVPVNTVYRDLRESF---GDRQNRN  212

Query  2553  D---------LLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQ----NHIFFYKDF  2413
             D         LLT + +    R++++    L  DD++S  L V+  +    N I  YK  
Sbjct  213   DEDTVLTKSHLLTKKNISDISRAVKKGC-RLHPDDSVSTFLLVQKLKSEDFNSILVYKSQ  271

Query  2412  S---------------DSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHS  2278
                             + D FV+GIQT+ QL  M    +  ++  DA   TN+  +P+ +
Sbjct  272   GQQTVIGPKVYDDIDLNKDSFVVGIQTKHQLS-MFETHSSQIVCIDATHCTNQYAFPLVT  330

Query  2277  LVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPA  2098
             L+  +   +  PVA++I+     +    ++  +  R +    + K+   + DD L+   A
Sbjct  331   LLFRDEFKRGYPVAFLISNHADEQTITPFLEEIKRRCNN---SVKVNAVMTDDDLSGWNA  387

Query  2097  IREVF-QCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFE  1921
                VF     L+  W  + AW   L      +     + + +  ++ ++     P + F 
Sbjct  388   FTNVFGDVRHLLCKWHKKRAWRNKL-----PLVGPTNLQEEVYRILETVIDEKNP-DVFL  441

Query  1920  AFMEDFVDAVE-----FVDYF  1873
             + M  FV A E     F+ YF
Sbjct  442   STMNGFVKAYEHKCPNFISYF  462



>ref|XP_005091692.1| PREDICTED: uncharacterized protein LOC101864592 [Aplysia californica]
Length=1294

 Score = 65.9 bits (159),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 82/332 (25%), Positives = 137/332 (41%), Gaps = 41/332 (12%)
 Frame = -3

Query  2673  ISEDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTY  2494
             +SE+L+  ++  L  G   +TI+   NE   R    C   D  +     +Q  S   S  
Sbjct  655   LSENLKHTIVRKLKKGHDEKTIL---NEI--RNKVTCINQDTQS----IKQHYSYGISHA  705

Query  2493  ELDADDAISISLWVES----HQNHIFFYKDFSDS------DPFVLGIQTEWQLQQMIRFG  2344
               D DDA S  LWVE+      N I ++K   +S      D F+L  QT++Q   M+  G
Sbjct  706   RRDKDDAKSCHLWVEALNEDSDNPIIYFKQKGNSHETLGKDDFLLCFQTDFQRNMMLHHG  765

Query  2343  NRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVH  2164
              R ++  D+  GT + KY + +++V +   +AIPVAW I+    ++    ++  + N   
Sbjct  766   TR-IICVDSTHGTTQYKYFLTTILVLDEFLEAIPVAWAISNTKETKIMTVFLNVVKNACG  824

Query  2163  TKDPTWKLAGFIVDDPLTDIPAIREVFQCSV--------LISFWRVRHAWHKNLMKRCSE  2008
                       F+ D  ++D+        CS         L   W V  AW K L +   +
Sbjct  825   --------QSFVPDVFMSDLTNNFYNAWCSAFEQPPKKRLYCSWHVDKAWRKQLGECFGK  876

Query  2007  MEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDF-VDAVEFVDYFKATWYP--RLGLWS  1837
                R      L +M+ +   G E     +  + D+ +   +F  YF   +    +   W+
Sbjct  877   DSERRLHTYNLLKMLQTEILGSEFRALLQFALSDWQISCPKFYAYFHENYCEDNKPAFWA  936

Query  1836  NALRALPLASQETCAALEFYHNQLKLRLLNER  1741
                R   LA+    A  E +H+ LK + +  R
Sbjct  937   GCYRIGALANANMFA--ESFHHLLKTKYMENR  966



>ref|XP_002587205.1| hypothetical protein BRAFLDRAFT_102090 [Branchiostoma floridae]
 gb|EEN43216.1| hypothetical protein BRAFLDRAFT_102090 [Branchiostoma floridae]
Length=485

 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 75/331 (23%), Positives = 123/331 (37%), Gaps = 86/331 (26%)
 Frame = -3

Query  2547  LTHRYVRRQER--------SIRRSTYELDADDAISISLWVESH--------QNHIFFYKD  2416
             LT  YVR+ E          I +  YE+     +  + W+ ++        Q    F+K+
Sbjct  38    LTLFYVRQNEAPRFNSKDLQILKLQYEMRCSKRVHQNDWIGTYAKAQRLRDQGVCIFFKE  97

Query  2415  FS------DSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDN  2254
             +       D  PFVL + TEWQ Q   RF    +   D+ FG N    P++S VV N   
Sbjct  98    YDSDNEDPDKRPFVLVLLTEWQRQMAERFSPNSVWTVDSTFGLNSYGLPVYSAVVPNQHR  157

Query  2253  KAIPVAWIIAPRFASEDTVR-----WMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIRE  2089
             + +P+ ++I          R     W+R+      +   T +    I+D  LT+  AI  
Sbjct  158   QRLPIFYLITSNDKKNQPRRDRGPTWVRS------SPAMTTRPNAIIIDKSLTEKRAIER  211

Query  2088  VFQ-------------CSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICK  1948
               +             C +L+ ++ V+ AW +NL+ +  E E+   + ++  E +  + K
Sbjct  212   AVENDTLSWEDGTQTKCRLLLCWFHVKKAWTENLLPKL-EGEMAAEVYEKTYEKVQQVTK  270

Query  1947  GCEPANTFEAFMEDFVDAVEFVDYFKATWYPR-------LGLWSNALRALPLASQETCAA  1789
                                          YPR         +W  A R  P    +T   
Sbjct  271   -----------------------------YPRGWDCDEWRDMWVRAGRRFPHGDTDTTNL  301

Query  1788  LEFYHNQLKLRLLNERDLSVYERADWLVDKL  1696
             +E +   +K   LN R      R D L+D L
Sbjct  302   VERHWELIKYTTLNGR---ANHRLDVLMDAL  329



>ref|XP_008178421.1| PREDICTED: uncharacterized protein LOC100568494 [Acyrthosiphon 
pisum]
Length=583

 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 81/327 (25%), Positives = 131/327 (40%), Gaps = 57/327 (17%)
 Frame = -3

Query  2955  EYILYWC--SFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRLIAEPSV  2782
             EYI Y+C  SF P    KG            +K S    + K G  C          PS 
Sbjct  56    EYIYYFCHRSFAPKTSNKG------------RKNSKSSGSVKTGSVC----------PSS  93

Query  2781  ALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISEDLRLRVLSLLYVGVSVETIMQ  2602
               +  N  K ++ +    H   D +    R       +ED R  +   L +GV V  +++
Sbjct  94    IKVHVNSSK-INVQYCSTHMWHDMEIGKQRLF-----TED-RSMIAGKLAMGVPVNRVLE  146

Query  2601  RHNESVERQGGPCNRDDLLTHRYVRRQER--SIRRSTYELDADDAISISLWVESHQ----  2440
                 S  +  G   R  LL  + V   +R  +I  ST + + +DA+S+ LWVE  +    
Sbjct  147   DIRAS--KIQGDLKRIHLLEKKDVHNIKRDYNITYSTKKHE-NDAVSVRLWVEEMKKKGN  203

Query  2439  -NHIFFYKDFSDSDP---------FVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKY  2290
              N + +YK     D          F L I T  Q +  I+FGN  +   D   G N   +
Sbjct  204   LNPVLYYKQQGSIDSAVPHFTVNNFCLIIMTPLQSELFIKFGNDKVCV-DGTHGLNGYSF  262

Query  2289  PIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLT  2110
              ++++VV N      PVA+  + RF ++    + + + N + T +    ++    DD   
Sbjct  263   QLYTIVVVNEYGNGYPVAFCFSNRFDTDTYKHYFQCIKNTIGTINSFISMS----DDEPA  318

Query  2109  DIPAIREVFQCSV--LISFWRVRHAWH  2035
                A   + +C+V  L+  W V   W+
Sbjct  319   FYNAWCSIMRCAVKQLLCTWHVLRNWN  345



>ref|XP_003387167.1| PREDICTED: hypothetical protein LOC100634859 [Amphimedon queenslandica]
Length=821

 Score = 64.3 bits (155),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 100/234 (43%), Gaps = 28/234 (12%)
 Frame = -3

Query  2667  EDLRLRVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYEL  2488
             E  R  + + L  GV ++ I+    + VE  G    R +L+  + +            + 
Sbjct  177   ESTRHMIAAKLQDGVEIQAILDSIRDGVE--GAEIGRSELINRQDIHNIRHQYNIEGIQY  234

Query  2487  DADDAISISLWVESHQNH------IFFYK-----------DFSDSDPFVLGIQTEWQLQQ  2359
              ++D  S+ LWV++ Q+       +  +K           DFS SD F LGIQT +Q   
Sbjct  235   HSNDHSSVQLWVDNLQSDSEDESVVLLFKEQGVEQSNDLNDFSVSD-FALGIQTCFQKDM  293

Query  2358  MIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRAL  2179
             + RFG   +   D+  GTN   + + +++V +   + IPVAW+I  R   ED    +   
Sbjct  294   LFRFGKESICI-DSTHGTNIYDFYLITVLVLDDYKEGIPVAWLILNR---EDAA-VLNQF  348

Query  2178  YNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCS---VLISFWRVRHAWHKNL  2026
             ++++  +        F+ DD        + VF  S    LI  W V  +W K L
Sbjct  349   FSKLKVRCGDISTDVFMSDDADNFFNGWKGVFTVSNTRKLICSWHVDRSWRKGL  402



>ref|XP_005851835.1| hypothetical protein CHLNCDRAFT_133328 [Chlorella variabilis]
 gb|EFN59733.1| hypothetical protein CHLNCDRAFT_133328 [Chlorella variabilis]
Length=352

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 8/126 (6%)
 Frame = -3

Query  2442  QNHIFFYKDF------SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +  + FY+ +      S   P V+ +Q  +Q + + +FG R L+  DA FG NK  YP++
Sbjct  11    EGSVLFYQPYKQAGRRSGEQPLVIVMQVSFQARMLDQFGRR-LVFMDATFGVNKYGYPLY  69

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR-ALYNRVHTKDPTWKLAGFIVDDPLTDI  2104
             +LVV +   + +PV++++     +E    ++R ++       D T+K    ++D   T+I
Sbjct  70    ALVVQDESGRGVPVSFMVCSSDTAEVVEHFLRTSMEGAQAAGDGTFKYKSIMIDKSKTEI  129

Query  2103  PAIREV  2086
              A+ ++
Sbjct  130   AAVDQL  135



>ref|XP_005846663.1| hypothetical protein CHLNCDRAFT_135360 [Chlorella variabilis]
 gb|EFN54561.1| hypothetical protein CHLNCDRAFT_135360 [Chlorella variabilis]
Length=372

 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 8/126 (6%)
 Frame = -3

Query  2442  QNHIFFYKDF------SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +  + FY+ +      S   P V+ +Q  +Q + + +FG R L+  DA FG NK  YP++
Sbjct  93    EGSVLFYQPYKQAGRRSGEQPLVIVMQVSFQARMLDQFGRR-LVFMDATFGINKYGYPLY  151

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR-ALYNRVHTKDPTWKLAGFIVDDPLTDI  2104
             +LVV +   + +PV++++     +E    ++R ++       D T+K    ++D   T+I
Sbjct  152   ALVVQDESGRGVPVSFMVCSSDTAEVVEHFLRTSMEGAQAAGDGTFKYKSIMIDKSKTEI  211

Query  2103  PAIREV  2086
              A+ ++
Sbjct  212   AAVDQL  217



>ref|XP_005843545.1| hypothetical protein CHLNCDRAFT_140162 [Chlorella variabilis]
 gb|EFN51443.1| hypothetical protein CHLNCDRAFT_140162 [Chlorella variabilis]
Length=719

 Score = 62.0 bits (149),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 8/126 (6%)
 Frame = -3

Query  2442  QNHIFFYKDF------SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +  + FY+ +      S   P V+ +Q  +Q + + +FG R L+  DA FG NK  YP++
Sbjct  260   EGSVLFYQPYKQAGRRSGEQPLVIVMQVSFQARMLDQFGRR-LVFMDATFGVNKYGYPLY  318

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR-ALYNRVHTKDPTWKLAGFIVDDPLTDI  2104
             +LVV +   + +PV++++     +E    ++R ++       D T+K    ++D   T+I
Sbjct  319   ALVVQDESGRGVPVSFMVCSSDTAEVVEHFLRTSMEGAQAAGDGTFKYKSIMIDKSKTEI  378

Query  2103  PAIREV  2086
              A+ ++
Sbjct  379   AAVDQL  384



>ref|XP_005846407.1| hypothetical protein CHLNCDRAFT_58222 [Chlorella variabilis]
 gb|EFN54305.1| hypothetical protein CHLNCDRAFT_58222 [Chlorella variabilis]
Length=1711

 Score = 61.6 bits (148),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 73/150 (49%), Gaps = 12/150 (8%)
 Frame = -3

Query  2442  QNHIFFYKDF------SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +  + FY+ +      S   P V+ +Q  +Q + + +FG R L+  DA FG NK  YP++
Sbjct  408   EGSVLFYQPYKQAGRRSGEQPLVIVMQVSFQARMLDQFGRR-LVFMDATFGVNKYGYPLY  466

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR-ALYNRVHTKDPTWKLAGFIVDDPLTDI  2104
             +LVV +   + +PV++++     +E    ++R ++       D T+K    ++D   T+I
Sbjct  467   ALVVQDESGRGVPVSFMVCSSDTAEVVEHFLRTSMEGAQAAGDGTFKYKSIMIDKSKTEI  526

Query  2103  PAIREVFQC----SVLISFWRVRHAWHKNL  2026
              A+ ++         L+ ++     W + L
Sbjct  527   AAVDQLVSTGHAEGYLLCYFHFLQDWERFL  556



>ref|XP_005845169.1| hypothetical protein CHLNCDRAFT_137356 [Chlorella variabilis]
 gb|EFN53067.1| hypothetical protein CHLNCDRAFT_137356 [Chlorella variabilis]
Length=588

 Score = 60.8 bits (146),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 8/126 (6%)
 Frame = -3

Query  2442  QNHIFFYKDF------SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +  + FY+ +      S   P V+ +Q  +Q + + +FG R L+  DA FG NK  YP++
Sbjct  260   EGSVLFYQPYKQAGRRSGEQPLVIVMQVSFQARMLDQFGRR-LVFMDATFGVNKYGYPLY  318

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR-ALYNRVHTKDPTWKLAGFIVDDPLTDI  2104
             +LVV +   + +PV++++     +E    ++R ++       D T+K    ++D   T+I
Sbjct  319   ALVVQDESGRGVPVSFMVCSSDTAEVVEHFLRTSMEGAQAAGDGTFKYKSIMIDKSKTEI  378

Query  2103  PAIREV  2086
              A+ ++
Sbjct  379   AAVDQL  384



>gb|KFM58447.1| hypothetical protein X975_10518, partial [Stegodyphus mimosarum]
Length=624

 Score = 60.8 bits (146),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 125/297 (42%), Gaps = 39/297 (13%)
 Frame = -3

Query  2562  NRDDLLTHRYVRRQE-RSIRR-------STYELDADDAISISLWVESHQ----NHIFFYK  2419
             +RDD+ T + + R++  +I+R       S   +  DD  S+  WV +      N +  YK
Sbjct  238   SRDDIETKQLITRKDLHNIKRDFGLSINSKGLILTDDETSVWSWVNTMSQMEFNPVLMYK  297

Query  2418  -------DFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNS  2260
                    + +++D F+L I TE+Q + +I FGN   +  D+  G +   + + +L+V + 
Sbjct  298   RQGKKYANVNEND-FMLAIMTEFQKKMLIEFGN-DRICIDSTHGISAYGFELVTLLVVDK  355

Query  2259  DNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVF-  2083
               + IPVA++I+   + +  V +   +   +  K        F+ DD      A    F 
Sbjct  356   YEEGIPVAFLISSTVSEKILVNFFNCIKKIIDIKPKV-----FMSDDAPMFYNAWEHTFG  410

Query  2082  QCSVLISFWRVRHAW--HKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFME  1909
              C  L+  W V  AW  H N + +     V  T+   + E+   +          E F E
Sbjct  411   SCQKLLCAWHVDRAWKGHLNSVPKHKRQAVYKTLKTLMYELDEEM-----FNKMLETFSE  465

Query  1908  DFV---DAVEFVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLKLRLLN  1747
                   D  EF  YF   ++ R  +W+   R    A   T   +E +H +LK   L+
Sbjct  466   QLCEDEDTREFHKYFMTYYFERAKMWAYCFR--KGAKINTNMYVETFHRKLKYIYLD  520



>gb|ADE77528.1| unknown [Picea sitchensis]
Length=146

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 4/103 (4%)
 Frame = -3

Query  2400  PFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAP  2221
             P   GIQ E  + +M+++     +    R G  K+ Y +++L++F      +P+AW+I+ 
Sbjct  48    PGTAGIQLEANILEMVQYRATYEMG---RIGKKKM-YQLYTLMIFYKHRNGVPIAWMISS  103

Query  2220  RFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIR  2092
             R  +ED  +WM  L+     +   W +  FI +D  T+I A+R
Sbjct  104   RNITEDICKWMSTLFRVGSNECSDWHVRSFITNDVATEIEALR  146



>ref|XP_005848966.1| hypothetical protein CHLNCDRAFT_144489 [Chlorella variabilis]
 gb|EFN56864.1| hypothetical protein CHLNCDRAFT_144489 [Chlorella variabilis]
Length=1320

 Score = 60.1 bits (144),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 8/126 (6%)
 Frame = -3

Query  2442  QNHIFFYKDF------SDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIH  2281
             +  + FY+ +      S   P V+ +Q  +Q + + +FG R L+  DA FG NK  YP++
Sbjct  260   EGSVLFYQPYKQAGRRSGEQPLVIVMQVSFQARMLDQFGRR-LVFMDATFGVNKYGYPLY  318

Query  2280  SLVVFNSDNKAIPVAWIIAPRFASEDTVRWMR-ALYNRVHTKDPTWKLAGFIVDDPLTDI  2104
             +LVV +   + +PV++++     +E    ++R ++       D T+K    ++D   T+I
Sbjct  319   ALVVQDESGRGVPVSFMVCSSDTAEVVEHFLRTSMEGAQAAGDGTFKYKSIMIDKSKTEI  378

Query  2103  PAIREV  2086
              A+ ++
Sbjct  379   AAVDQL  384



>emb|CEJ00747.1| hypothetical protein RMCBS344292_14795 [Rhizopus microsporus]
Length=472

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 79/319 (25%), Positives = 134/319 (42%), Gaps = 62/319 (19%)
 Frame = -3

Query  2286  IHSLVVFNS-DNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGF-------  2131
             + ++VV N   N+ +PV + I          +W+            TW  A F       
Sbjct  126   LFTIVVHNYITNRGLPVCFFITDMETISTLHQWL------------TWIKANFSLNLKRI  173

Query  2130  IVDDPLTDIPAIREVFQ--CSVLISFWRVRHAWHKNLMKRCSEME--------VRVTIAK  1981
             ++D    +  AIR+VF+    +L+ +W ++ AW  ++ KR +++         VR  +  
Sbjct  174   MIDCSSAETSAIRDVFEGPVQILLFYWHIKRAWETHI-KRDAKISKSSHDTKLVRDRVCA  232

Query  1980  RLGEMIHS-ICKGCEPANTFEAFMEDFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQ  1804
              L  M++S   K  + A  ++ F+ + ++   F+ YF     PR  LWS A +    AS 
Sbjct  233   NLNSMMYSETPKAFDLA--YQLFLAENMEFEVFLAYFNRLRLPRKKLWSKAWKQ--TASF  288

Query  1803  ETCAALEFYHNQLK-LRLLNERDLSVYERADWLVDKLGTTVHSYFWLDEYSGKDDFA--R  1633
              T   +E YHNQLK   L + R L    R D LV  L   V   +W D      DF   R
Sbjct  289   HTNNMIESYHNQLKTFYLGHSRSL----RVDRLVYLLSQVVALDYWQDTIKAAHDFGGFR  344

Query  1632  YWKDEWISGLTAWRKSLQIPDGDVTIDGESAKVVDQGDKNM---------VHVIWNPSSE  1480
                +E   G  A+       D DV     +  +++Q ++N+         +      + E
Sbjct  345   LTANEEKKGRAAY-----CIDYDV-----ACSMIEQLEENVYQCRSFIEDILFYEMDTKE  394

Query  1479  FALCDCNSANMGNLCEHVF  1423
               L +C+  +   +C+H+F
Sbjct  395   GYLKNCSCPDQTKMCKHIF  413



>gb|EIE90463.1| hypothetical protein RO3G_15174 [Rhizopus delemar RA 99-880]
Length=648

 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 119/526 (23%), Positives = 197/526 (37%), Gaps = 81/526 (15%)
 Frame = -3

Query  2883  TTYVPKKKSAGRP----NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQ  2716
               YV K     RP    + K GC    +V    ++P   +         ++K +  H P 
Sbjct  81    NVYVSKASGNHRPIQKESKKIGCPACIMVTCYRSDPEFVIF--------ERKNMHNHVP-  131

Query  2715  DKKAAGTRA-MYAPYISEDLRLRVLSLLYVGVSVETI----MQRHNESVERQGGPCNRDD  2551
                  G+ A +    +S+ LR ++ + L  G S   I    +Q  +E  E       RD 
Sbjct  132   -----GSYADLKFMSLSDALRRKIKAFLQYGFSRREIRSCLLQEIDEDAEE------RDK  180

Query  2550  LLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEW  2371
             L  +  V     S+ +  ++   ++  S  +W E      +    +S  + F  GI + W
Sbjct  181   LFHYDDVYNIWLSVAKDMFKFKENEFESPKVWEEKLAAINYKILSYSMGNTFYYGIISPW  240

Query  2370  QLQQMIRFGNRGLLASDARFG-TNKLKYPIHSLVVFNSDN-KAIPVAWIIAPRFASEDTV  2197
             Q+  M   G     + D+ FG +++    ++SLVV + D  K +PV ++I    +    +
Sbjct  241   QMSIM---GVSKSFSLDSTFGISSRSSEVLYSLVVRHPDTGKGVPVGYMITNDQSVNPVL  297

Query  2196  RWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVF--QCSVLISFWRVRHAWHKNL-  2026
              W+R L N               +D  + +  AIR  F   C + +  + V   W +NL 
Sbjct  298   NWLRFLKNNCAMSPEQ-----ITIDCSIPESDAIRATFGENCRIQLCLFHVAQCWSRNLA  352

Query  2025  --MKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEA---FMEDFV-DAVEFVDYFKAT  1864
               +K   E      +   +   + SI      A   E    F E +     +FV+YF+  
Sbjct  353   TKVKNSPEHSNARVVRGNIMSDLQSIMYETTCAIVVEKVRMFREKWTAQQPQFVEYFEDK  412

Query  1863  WYPRLGL--WSNALRALPLASQETCAALEFYHNQLK---LRLLNERDLSVYERADWLVDK  1699
             W    G   WS A       +  T   +E +HNQLK   L+ +  R      R D L+  
Sbjct  413   WLALDGYKRWSAAYVIEEHQNMRTNNYIESWHNQLKSVYLKRIKNR------RLDRLIFI  466

Query  1698  LGTTVHSYFWLDEYSGKDDFARYW-------KDEWISGLTAWRKSLQIPDGD----VTID  1552
             L   V +   L+E     +  R         K E I+          IPD      +T +
Sbjct  467   LVNEVENDMKLEEARVSSEVGRMGPETRNRRKREMIAA--------AIPDDRMNEMITKE  518

Query  1551  GESAKVVDQGDKN--MVHVIWNPSSEFALCDCNSANMGN-LCEHVF  1423
              E+   V+   +   M  V  N +   A C C      +  C+H+F
Sbjct  519   SETTYNVESFSQEDIMYTVQINEAGNIASCSCCYFKFNSRACKHMF  564



>ref|XP_008185710.1| PREDICTED: uncharacterized protein LOC103310160 [Acyrthosiphon 
pisum]
Length=437

 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 126/299 (42%), Gaps = 33/299 (11%)
 Frame = -3

Query  2652  RVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVR--RQERSIRRSTYELDAD  2479
              + + L  GV++E I+     ++   G    R+DL+T   +   +Q+ +I     +L  +
Sbjct  148   EIAAKLSQGVTMERILDDFRGNI---GSNLKREDLITRADLHNIKQKYNITMQDGQLHKN  204

Query  2478  DAISISLWVE-----SHQNHIFFYK--------DFSDSDPFVLGIQTEWQLQQMIRFGNR  2338
             DA S+ +WVE        N + +YK        +  D   F + +    Q+  + +FGN 
Sbjct  205   DATSVDIWVEQMKQEGENNPVIYYKKQGEVDVNNILDLKDFCIILMDPSQMHMLKQFGNG  264

Query  2337  GLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTK  2158
              ++  D   G N   + + +L+V +      P  ++    F +    +    +++ +  K
Sbjct  265   KIVCIDGTHGLNAYDFELVTLLVVDDFGSGFPCCFM----FTNLKDTKIYTVMFSTIKDK  320

Query  2157  DPTWKLAGFIVDDPLTDIPAIREVFQCSV---LISFWRVRHAWHKNLMKRC--SEMEVRV  1993
                     F++D   T   A       SV   L+  W V  AW +N+ K    +  E + 
Sbjct  321   VGIINPDTFMIDIVETFYSAWENTMG-SVPHRLLCSWHVDRAWRQNICKITGPTRKEKQG  379

Query  1992  TIAKRLGEMIHSICKGCEPANTFEAFMEDFV---DAVEFVDYFKATWYPRLGLWSNALR  1825
             TI K L +++ S+C   E  N  + F ++ +   D  +F  YF   +  RL L  N ++
Sbjct  380   TIYKSL-KVLQSMCDENEFNNALKEFNQELMNDPDTKDFGIYFDRMYGNRL-LCKNLIK  436



>ref|XP_002123387.1| PREDICTED: uncharacterized protein zf(c2h2/swim)-1 [Ciona intestinalis]
Length=791

 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 69/293 (24%), Positives = 128/293 (44%), Gaps = 46/293 (16%)
 Frame = -3

Query  2562  NRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQ-----NHIFFYKD--FSD-  2407
             +RD ++T + +    +    S  E   +D  S+ +W++        N +  YK    +D 
Sbjct  210   DRDAMVTRKDIWNIRKRYHISNVEKHENDTQSVDIWIKELSTGNDFNPVVMYKQQGVTDC  269

Query  2406  ---SDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVA  2236
                 D FVL +QTE+Q + M+R   + ++  D+   T K  + + +++V +   +AIP A
Sbjct  270   DLLKDDFVLCLQTEFQ-KHMLREFAQKMICIDSTHSTTK--FLLTTIMVIDDFGEAIPTA  326

Query  2235  WIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIP-----AIREVFQC--  2077
             WII+ R  +E   R   AL +         K    + D  ++D+      A   VF    
Sbjct  327   WIISNREDAELLTRAFSALKH---------KCGDIMTDIFMSDLANNFYNAWTTVFTIPN  377

Query  2076  SVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEP-ANTFEAFMEDFV  1900
               L   W V   W + + K  S +E + T+   L +++H     CE     F   +++  
Sbjct  378   KRLYCNWHVDKCWRRMIAKTISNLEDQATVYAYL-KILH-----CETEEQKFRKMLQEVN  431

Query  1899  DAV-----EFVDYFKATWY--PRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
             D +     +F++YF  ++    +  LW++  R   +A+      +E +H  LK
Sbjct  432   DVLGETSPQFLEYFNNSYVLDDKYKLWASCFRIGSIANNN--MYVEAFHRVLK  482



>tpd|FAA00144.1| TPA: zinc finger protein [Ciona intestinalis]
Length=792

 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 69/293 (24%), Positives = 128/293 (44%), Gaps = 46/293 (16%)
 Frame = -3

Query  2562  NRDDLLTHRYVRRQERSIRRSTYELDADDAISISLWVESHQ-----NHIFFYKD--FSD-  2407
             +RD ++T + +    +    S  E   +D  S+ +W++        N +  YK    +D 
Sbjct  211   DRDAMVTRKDIWNIRKRYHISNVEKHENDTQSVDIWIKELSTGNDFNPVVMYKQQGVTDC  270

Query  2406  ---SDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVA  2236
                 D FVL +QTE+Q + M+R   + ++  D+   T K  + + +++V +   +AIP A
Sbjct  271   DLLKDDFVLCLQTEFQ-KHMLREFAQKMICIDSTHSTTK--FLLTTIMVIDDFGEAIPTA  327

Query  2235  WIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIP-----AIREVFQC--  2077
             WII+ R  +E   R   AL +         K    + D  ++D+      A   VF    
Sbjct  328   WIISNREDAELLTRAFSALKH---------KCGDIMTDIFMSDLANNFYNAWTTVFTIPN  378

Query  2076  SVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEP-ANTFEAFMEDFV  1900
               L   W V   W + + K  S +E + T+   L +++H     CE     F   +++  
Sbjct  379   KRLYCNWHVDKCWRRMIAKTISNLEDQATVYAYL-KILH-----CETEEQKFRKMLQEVN  432

Query  1899  DAV-----EFVDYFKATWY--PRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
             D +     +F++YF  ++    +  LW++  R   +A+      +E +H  LK
Sbjct  433   DVLGETSPQFLEYFNNSYVLDDKYKLWASCFRIGSIANNN--MYVEAFHRVLK  483



>ref|XP_008179308.1| PREDICTED: uncharacterized protein LOC103308155 [Acyrthosiphon 
pisum]
Length=376

 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 65/297 (22%), Positives = 123/297 (41%), Gaps = 46/297 (15%)
 Frame = -3

Query  2652  RVLSLLYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVR--RQERSIRRSTYELDAD  2479
              + + L  GV++E I+     ++   G    R+DL+T   +   +Q+ +I     +L  +
Sbjct  78    EIAAKLSQGVTMERILDDFRGNI---GSNLKREDLITRADLHNIKQKYNITMQDGQLHKN  134

Query  2478  DAISISLWVE-----SHQNHIFFYKDFSDSD--------PFVLGIQTEWQLQQMIRFGNR  2338
             DA S+ +WVE        N + +YK   + D         F + +    Q+  + +FGN 
Sbjct  135   DATSVDIWVEQMKQEGENNPVIYYKKQGEVDVNNILDLKDFCIILMDPSQMHMLKQFGNG  194

Query  2337  GLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTK  2158
              ++  D   G N   + + +L+V +      P  ++    F +    +    +++ +  K
Sbjct  195   KIVCIDGTHGLNAYDFELVTLLVVDDFGSGFPCCFM----FTNLKDTKIYTVMFSTIKDK  250

Query  2157  DPTWKLAGFIVDDPLTDIPAIREVFQCS----------VLISFWRVRHAWHKNLMKRC--  2014
                    G I  +P T +  I E F  +           L+  W V  AW +N+ K    
Sbjct  251   ------VGII--NPDTFMTDIVETFYSAWENTMGSVPHRLLCSWHVDRAWRQNICKITGP  302

Query  2013  SEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFV---DAVEFVDYFKATWYPR  1852
             +  E + TI K L +++ S+C   E  N  + F ++ +   D  +F  YF   +  R
Sbjct  303   TRKEKQGTIYKSL-KVLQSMCDENEFNNALKEFNQELMNDPDTKDFGIYFDRMYGNR  358



>ref|XP_008184675.1| PREDICTED: uncharacterized protein LOC100575142 [Acyrthosiphon 
pisum]
Length=566

 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 110/275 (40%), Gaps = 49/275 (18%)
 Frame = -3

Query  2496  YELDADDAISISLWVESHQ-------NHIFFYKDFS------DSDPFVLGIQTEWQLQQM  2356
             Y+L   DA+S+ L V+          N I  YK         + D F+L I TE Q   +
Sbjct  175   YKLHDVDAVSVDLQVKRFAQNPNKSLNPIILYKTQGTEYFPLEKDDFMLIILTETQKAVL  234

Query  2355  IRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALY  2176
              +F +  L   D+  GTN+  + + +++V +   +  P A+ I+ +    D V  M   +
Sbjct  235   EKFSSEKLCI-DSTHGTNQYSFNLTTIIVIDEFGEGYPAAFCISSKI---DEVH-MTVFF  289

Query  2175  NRVHTKDPTWKLAGFIVDDP----------LTDIPAIREVFQCSVLISFWRVRHAWHKNL  2026
             +++     +     F+ DD           ++ IP          L+  W + + W KNL
Sbjct  290   SKIKEATGSLTPNVFMSDDAPAFWNAWIKIMSPIPKFH-------LLCKWHIDNNWRKNL  342

Query  2025  MKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFEAFMEDFVDAVE-------FVDYFKA  1867
              K    +  +  + K L  ++            FE  +  F+  +E       F  YF +
Sbjct  343   KKIDGSLTTKAYVYKTLRVLLDE-----SNITEFENLLSSFLCKLEEEPAMHNFRAYFMS  397

Query  1866  TWYPRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
             T+ PR  LW+   R   + +  T   LE +H  LK
Sbjct  398   TYVPRKKLWAACYRCQAMLN--TNMVLEAFHKTLK  430



>ref|XP_005451942.1| PREDICTED: uncharacterized protein LOC102078155 [Oreochromis 
niloticus]
Length=213

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 90/199 (45%), Gaps = 16/199 (8%)
 Frame = -3

Query  2445  HQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVF  2266
             HQ H+ FY+ ++     ++ +QT      M  +  + L+  D     N+  +P+ +LVV 
Sbjct  23    HQEHVLFYQPYTSDQELMIVLQTPVMKSNMENYA-KQLVFVDTTHRVNQYSFPLFTLVVR  81

Query  2265  NSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREV  2086
             +   + +PVA+ I     S ++ + +  +   V    PT   A F+VD    +I A+++V
Sbjct  82    DDHGRGVPVAYAI----VSNESQKTLETVLGIVCEHLPTSPRA-FMVDKDFAEINALQKV  136

Query  2085  F-QCSVLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSI--CKGCEPANTFEAF  1915
             F + ++L+ ++ V  A ++ L K  S +       KR  E+I      K C     F+A 
Sbjct  137   FPESAILLCWYHVLQAVNRWLSKSESGVHGLSNTQKR-NEIISFFGKLKACTSEEDFKA-  194

Query  1914  MEDFVDAVEFVDYFKATWY  1858
                   + EF   FK   Y
Sbjct  195   -----TSAEFCQTFKQNPY  208



>gb|KFM68785.1| putative zinc finger transcription factor protein 17, partial 
[Stegodyphus mimosarum]
Length=720

 Score = 57.4 bits (137),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 113/282 (40%), Gaps = 47/282 (17%)
 Frame = -3

Query  2517  RSIRR-----STYELDADDAISISLWVESHQ----NHIFFYKDFSDS---------DPFV  2392
             R+IRR         LD +D +S+ + V   Q    N +  YK  ++            F+
Sbjct  200   RNIRRDFGIDKDVMLDKNDFVSVDITVRKLQAEPGNPVLIYKQINEELLQYPGICKSDFL  259

Query  2391  LGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFA  2212
             LGI    QL+ +    N   +  D+  GTN+    + S++V +++ +  PVA + + +  
Sbjct  260   LGIMNSAQLKMLEHHSN--CIMIDSTHGTNQYGLNLTSVLVNDNNFEGFPVAILYSSKLT  317

Query  2211  SEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSV------LISFWRV  2050
             +E    +   +  R+    P  K   F+ DD     PA    + C        L+  W V
Sbjct  318   TETFAAFFSCIKERL----PNLKTTVFMSDDA----PAYYNAWCCVFGEADHHLLCSWHV  369

Query  2049  RHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFE----AFMEDFV--DAVE  1888
             + AW KNL  +  + E R  I   L +++  +        TFE    A + D++  D   
Sbjct  370   QRAWFKNLNSKVRDPERRGKIKSELLKILKEV-----DILTFERLSDACISDYLLHDETR  424

Query  1887  FVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
                 +  T+  R   W+   R        T   +E +H QLK
Sbjct  425   AFGEYLTTYMQRKKQWAYCYRT--YLGINTNMKVERWHRQLK  464



>gb|ADE76062.1| unknown [Picea sitchensis]
Length=87

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 40/81 (49%), Gaps = 11/81 (14%)
 Frame = -3

Query  2979  KPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRPNTKRGCTCHFIVKRL  2800
             K +    L Y  Y CS+G ++ R G   +  RT++V K          RGC CHFIVK +
Sbjct  18    KSRASAALRYEFYACSYGREEKR-GKHTKKQRTSFVKK----------RGCQCHFIVKVM  66

Query  2799  IAEPSVALIIYNQDKHVDKKG  2737
             +    VA++ YN   H D  G
Sbjct  67    VQNLDVAILTYNVYDHEDGDG  87



>gb|EYC40549.1| hypothetical protein Y032_0607g586, partial [Ancylostoma ceylanicum]
Length=856

 Score = 57.4 bits (137),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 108/258 (42%), Gaps = 23/258 (9%)
 Frame = -3

Query  2481  DDAISISLWVESHQNHI---FFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARF  2311
             DD  S+ + VE+H++         D    D F+L   T    + + R G+RGL+  D  F
Sbjct  275   DDRASLRILVENHEDIAAVKLVETDDVSGDGFILAFVTANGKKYLQRHGHRGLVFDDT-F  333

Query  2310  GTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGF  2131
               ++  + + +LVV +      P A +++ R ++ +    +R L+  V    P +     
Sbjct  334   NVSRYSFRLATLVVSDDGGNGFPCAHLLSFRMSAAE----VRVLFELVEECVPDFDPKYV  389

Query  2130  IVDDPLTDIPAIREVFQCSVLISFWRVRHA------WHKNLMKRCSEMEVRVTIAKRLGE  1969
             + DD        + VF  S  +    + H        HK  +K+C      V+ A RL  
Sbjct  390   MTDDTYVFYNGFKAVFPLSKAMKLLCLFHIDQSLERKHKEHLKKC-----HVSTANRLFH  444

Query  1968  MIHSICKGCEPANTFEAFME--DFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETC  1795
              +       +  ++F A+M     + A E +D+ ++T+  R   W+   R    A   T 
Sbjct  445   SLVLETDAKKFESSFSAYMSWLMSISATEMLDHVESTYSGRRREWALCYR--QNAPFNTS  502

Query  1794  AALEFYHNQLKLRLLNER  1741
                E +HN+LK  LL  +
Sbjct  503   NHAESWHNKLKHILLRSK  520



>gb|EYC40547.1| hypothetical protein Y032_0607g586, partial [Ancylostoma ceylanicum]
Length=849

 Score = 57.4 bits (137),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 108/258 (42%), Gaps = 23/258 (9%)
 Frame = -3

Query  2481  DDAISISLWVESHQNHI---FFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARF  2311
             DD  S+ + VE+H++         D    D F+L   T    + + R G+RGL+  D  F
Sbjct  275   DDRASLRILVENHEDIAAVKLVETDDVSGDGFILAFVTANGKKYLQRHGHRGLVFDDT-F  333

Query  2310  GTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGF  2131
               ++  + + +LVV +      P A +++ R ++ +    +R L+  V    P +     
Sbjct  334   NVSRYSFRLATLVVSDDGGNGFPCAHLLSFRMSAAE----VRVLFELVEECVPDFDPKYV  389

Query  2130  IVDDPLTDIPAIREVFQCSVLISFWRVRHA------WHKNLMKRCSEMEVRVTIAKRLGE  1969
             + DD        + VF  S  +    + H        HK  +K+C      V+ A RL  
Sbjct  390   MTDDTYVFYNGFKAVFPLSKAMKLLCLFHIDQSLERKHKEHLKKC-----HVSTANRLFH  444

Query  1968  MIHSICKGCEPANTFEAFME--DFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETC  1795
              +       +  ++F A+M     + A E +D+ ++T+  R   W+   R    A   T 
Sbjct  445   SLVLETDAKKFESSFSAYMSWLMSISATEMLDHVESTYSGRRREWALCYR--QNAPFNTS  502

Query  1794  AALEFYHNQLKLRLLNER  1741
                E +HN+LK  LL  +
Sbjct  503   NHAESWHNKLKHILLRSK  520



>gb|EYC40548.1| hypothetical protein Y032_0607g586 [Ancylostoma ceylanicum]
Length=863

 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 108/258 (42%), Gaps = 23/258 (9%)
 Frame = -3

Query  2481  DDAISISLWVESHQNHI---FFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARF  2311
             DD  S+ + VE+H++         D    D F+L   T    + + R G+RGL+  D  F
Sbjct  277   DDRASLRILVENHEDIAAVKLVETDDVSGDGFILAFVTANGKKYLQRHGHRGLVFDDT-F  335

Query  2310  GTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGF  2131
               ++  + + +LVV +      P A +++ R ++ +    +R L+  V    P +     
Sbjct  336   NVSRYSFRLATLVVSDDGGNGFPCAHLLSFRMSAAE----VRVLFELVEECVPDFDPKYV  391

Query  2130  IVDDPLTDIPAIREVFQCSVLISFWRVRHA------WHKNLMKRCSEMEVRVTIAKRLGE  1969
             + DD        + VF  S  +    + H        HK  +K+C      V+ A RL  
Sbjct  392   MTDDTYVFYNGFKAVFPLSKAMKLLCLFHIDQSLERKHKEHLKKC-----HVSTANRLFH  446

Query  1968  MIHSICKGCEPANTFEAFME--DFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETC  1795
              +       +  ++F A+M     + A E +D+ ++T+  R   W+   R    A   T 
Sbjct  447   SLVLETDAKKFESSFSAYMSWLMSISATEMLDHVESTYSGRRREWALCYR--QNAPFNTS  504

Query  1794  AALEFYHNQLKLRLLNER  1741
                E +HN+LK  LL  +
Sbjct  505   NHAESWHNKLKHILLRSK  522



>gb|EYC40546.1| hypothetical protein Y032_0607g586 [Ancylostoma ceylanicum]
Length=861

 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 108/258 (42%), Gaps = 23/258 (9%)
 Frame = -3

Query  2481  DDAISISLWVESHQNHI---FFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARF  2311
             DD  S+ + VE+H++         D    D F+L   T    + + R G+RGL+  D  F
Sbjct  275   DDRASLRILVENHEDIAAVKLVETDDVSGDGFILAFVTANGKKYLQRHGHRGLVFDDT-F  333

Query  2310  GTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGF  2131
               ++  + + +LVV +      P A +++ R ++ +    +R L+  V    P +     
Sbjct  334   NVSRYSFRLATLVVSDDGGNGFPCAHLLSFRMSAAE----VRVLFELVEECVPDFDPKYV  389

Query  2130  IVDDPLTDIPAIREVFQCSVLISFWRVRHA------WHKNLMKRCSEMEVRVTIAKRLGE  1969
             + DD        + VF  S  +    + H        HK  +K+C      V+ A RL  
Sbjct  390   MTDDTYVFYNGFKAVFPLSKAMKLLCLFHIDQSLERKHKEHLKKC-----HVSTANRLFH  444

Query  1968  MIHSICKGCEPANTFEAFME--DFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETC  1795
              +       +  ++F A+M     + A E +D+ ++T+  R   W+   R    A   T 
Sbjct  445   SLVLETDAKKFESSFSAYMSWLMSISATEMLDHVESTYSGRRREWALCYR--QNAPFNTS  502

Query  1794  AALEFYHNQLKLRLLNER  1741
                E +HN+LK  LL  +
Sbjct  503   NHAESWHNKLKHILLRSK  520



>gb|EYC40550.1| hypothetical protein Y032_0607g586, partial [Ancylostoma ceylanicum]
Length=851

 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/258 (24%), Positives = 108/258 (42%), Gaps = 23/258 (9%)
 Frame = -3

Query  2481  DDAISISLWVESHQNHI---FFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARF  2311
             DD  S+ + VE+H++         D    D F+L   T    + + R G+RGL+  D  F
Sbjct  277   DDRASLRILVENHEDIAAVKLVETDDVSGDGFILAFVTANGKKYLQRHGHRGLVFDDT-F  335

Query  2310  GTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGF  2131
               ++  + + +LVV +      P A +++ R ++ +    +R L+  V    P +     
Sbjct  336   NVSRYSFRLATLVVSDDGGNGFPCAHLLSFRMSAAE----VRVLFELVEECVPDFDPKYV  391

Query  2130  IVDDPLTDIPAIREVFQCSVLISFWRVRHA------WHKNLMKRCSEMEVRVTIAKRLGE  1969
             + DD        + VF  S  +    + H        HK  +K+C      V+ A RL  
Sbjct  392   MTDDTYVFYNGFKAVFPLSKAMKLLCLFHIDQSLERKHKEHLKKC-----HVSTANRLFH  446

Query  1968  MIHSICKGCEPANTFEAFME--DFVDAVEFVDYFKATWYPRLGLWSNALRALPLASQETC  1795
              +       +  ++F A+M     + A E +D+ ++T+  R   W+   R    A   T 
Sbjct  447   SLVLETDAKKFESSFSAYMSWLMSISATEMLDHVESTYSGRRREWALCYR--QNAPFNTS  504

Query  1794  AALEFYHNQLKLRLLNER  1741
                E +HN+LK  LL  +
Sbjct  505   NHAESWHNKLKHILLRSK  522



>gb|KFM73864.1| putative zinc finger transcription factor protein 17, partial 
[Stegodyphus mimosarum]
Length=828

 Score = 57.0 bits (136),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 67/282 (24%), Positives = 114/282 (40%), Gaps = 47/282 (17%)
 Frame = -3

Query  2517  RSIRR-----STYELDADDAISISLWVESHQ----NHIFFYKDFSDS---------DPFV  2392
             R+IRR         LD +D +S+ + V   Q    N +  YK  ++            F+
Sbjct  228   RNIRRDFGIDKDVMLDKNDFVSVDITVRKLQAEPGNPVLIYKQINEELLQYPGICKSDFL  287

Query  2391  LGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFA  2212
             LGI    QL+ +    N  ++  D+  GTN+    + S++V +++ +  PVA + + +  
Sbjct  288   LGIMNSAQLKMLEHHSNCIMI--DSTHGTNQYGLNLTSVLVNDNNFEGFPVAILYSSKLT  345

Query  2211  SEDTVRWMRALYNRVHTKDPTWKLAGFIVDDPLTDIPAIREVFQCSV------LISFWRV  2050
             +E    +   +  R+    P  K   F+ DD     PA    + C        L+  W V
Sbjct  346   TETFAAFFSCIKERL----PNLKTTVFMSDDA----PAYYNAWCCVFGEADHHLLCSWHV  397

Query  2049  RHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSICKGCEPANTFE----AFMEDFV--DAVE  1888
             + AW KNL  +  + E R  I   L +++  +        TFE    A + D++  D   
Sbjct  398   QRAWFKNLNSKVRDPERRGKIKSELLKILKEV-----DILTFERLSDACISDYLLHDETR  452

Query  1887  FVDYFKATWYPRLGLWSNALRALPLASQETCAALEFYHNQLK  1762
                 +  T+  R   W+   R        T   +E +H QLK
Sbjct  453   AFGEYLTTYMQRKKQWAYCYRT--YLGINTNMKVERWHRQLK  492



>gb|KFM66875.1| hypothetical protein X975_01819, partial [Stegodyphus mimosarum]
Length=739

 Score = 56.2 bits (134),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/279 (24%), Positives = 119/279 (43%), Gaps = 40/279 (14%)
 Frame = -3

Query  2481  DDAISISLWV----ESHQNHIFFYKDFSDS---------DPFVLGIQTEWQLQQMIRFGN  2341
             +DA+S+ + V    +  +N I  YK   +S         + F+L I    QL+ +  +G 
Sbjct  257   NDAMSVDIRVRQMLKEDENSILVYKPVDESLAEYPLIKKEDFLLAIMNHAQLKLLQLYGG  316

Query  2340  RGLLASDARFGTNKLKYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHT  2161
               ++  D+  GTN+  Y + +L+V +++++  PVA + + +  +E    +   +  R   
Sbjct  317   -NIIMIDSTHGTNQYGYQLTTLMVNDANHEGFPVAIMYSSKTTAETFYVFFMQIKKRC--  373

Query  2160  KDPTWKLAGFIVDDPLTDIPAIREVFQ--CSVLISFWRVRHAWHKNLMKRCSEMEVRVTI  1987
                 +K   F+ DD      A   VF    + L+  W V  AW+ NL  +    E R  +
Sbjct  374   ---NFKPLVFMSDDDPAFYNAFANVFGEVETRLLCSWHVIRAWNMNLNAKIQNKEERNVV  430

Query  1986  AKRLGEMIHSICKGCEPANTF----EAFMED---FVDAVEFVDYFKATWYPRLGLWSNAL  1828
                L  ++           TF    + F+E+   F     F +YF+  +  R+  W+   
Sbjct  431   KNNLMTILQET-----DLETFTQHCKVFIENLIAFEKTQAFGEYFQNYYMNRVEQWAYCY  485

Query  1827  RALPLASQ-ETCAALEFYHNQLKLRLLNERDLSVYERAD  1714
             R   + SQ  T   +E +H ++K     E D  V +R D
Sbjct  486   R---VGSQINTNMKVERWHREIKYE---EADGKVIKRLD  518



>ref|XP_002607282.1| hypothetical protein BRAFLDRAFT_88230 [Branchiostoma floridae]
 gb|EEN63292.1| hypothetical protein BRAFLDRAFT_88230 [Branchiostoma floridae]
Length=261

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 5/75 (7%)
 Frame = -3

Query  2433  IFFYK---DFSDSD--PFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKLKYPIHSLVV  2269
             IFF +   D  D D  PFVL +QTEWQ Q   RF    +   D+ FG N    P++S VV
Sbjct  156   IFFQEYDADNEDPDKRPFVLVLQTEWQRQMAERFSPNSVWTVDSTFGLNSYGLPVYSAVV  215

Query  2268  FNSDNKAIPVAWIIA  2224
              N + + +P+ ++I 
Sbjct  216   PNQNRQGLPIFYLIT  230



>ref|XP_003392145.1| PREDICTED: hypothetical protein LOC100638283, partial [Amphimedon 
queenslandica]
Length=230

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/237 (24%), Positives = 98/237 (41%), Gaps = 30/237 (13%)
 Frame = -3

Query  2637  LYVGVSVETIMQRHNESVERQGGPCNRDDLLTHRYVRRQERSIRRSTYELD------ADD  2476
             L+ GVS+  I+    + V         DD+       RQ+    R  Y ++      AD 
Sbjct  6     LHDGVSINAILDSIRDGV--------HDDVGRAELTCRQDIHNIRHQYNIEENAKSKADI  57

Query  2475  AISISLWVESHQNHIFFYKDFSDSDPFVLGIQTEWQLQQMIRFGNRGLLASDARFGTNKL  2296
                  L+ +     I    DFS SD F +GIQT +Q   +++FG+  +   D+   TN  
Sbjct  58    PSPFLLYKQQDVKQIDELNDFSKSD-FAIGIQTTFQRDMLMKFGSEAI-CMDSTHSTNVY  115

Query  2295  KYPIHSLVVFNSDNKAIPVAWIIAPRFASEDTVRWMRALYNRVHTKDPTWKLAGFIVDDP  2116
              + + +++V +   + +PV W+I+ R   ED    +R    +V       +   F+ DD 
Sbjct  116   DFCLVTILVLDDFGEGVPVGWMISNR---EDAAA-LRQFLLKVRNVCGDIQTKVFMSDDA  171

Query  2115  LTDIPAIREVFQCS---VLISFWRVRHAWHKNLMKRCSEMEVRVTIAKRLGEMIHSI  1954
                  A + +F  S    LI  W +   W K + +        +T+  +  E+ H +
Sbjct  172   DNFYNAWKSIFSVSKTKKLICTWHIDKTWRKGVQE-------HITVKSKQAEVYHHL  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11914461251809